4GT9A

T. maritima fdts with fad, dump and folate.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 75
structure length 214
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gt9A00
4KATA 4GT9A 1O28A 1O24A 1O2BA 3N0CA 4P5AA 5JFEA 4GTDA 5CHPA 2CFAA 4KASA 1O2AA 5IOQA 3N0BA 4GTEA 5IORA 1O25A 2CFAB 3AH5A 4GTCA 3N3YA 4KARA 1O27A 1O26A 1KQ4A 4GTAA 4GTLA 4P5BA 4GTFA 4GTBA 5IOSA 3G4CA 1O29A 3G4AA 4FZBA 5IOTA
chains in the Genus database with same CATH superfamily
1O28A 3N0CA 3BP8C 4YFXA 1WOSA 2ZFZA 5IYBC 3HOUC 4A3CK 3HOYC 2Y0SL 3QX3A 1V5VA 3RZOK 3GTMK 3SZYA 3I4NK 4PAAA 1PJ6A 4GTAA 2R7ZK 4YFKA 3GSIA 3S1RC 1HQMA 3GTJC 1TWHK 1IBAA 3T00A 2O5IA 4A3BC 4KM8A 4C3IK 1SFOA 4NOIA 3GTGK 3GTLC 3TTGA 4A3LK 3S14K 4G0UA 1HI9A 3A8JA 3ADAC 1XZPB 4XLNA 4YG2A 4GTFA 4A3GC 2GSUA 2NVTC 4C45A 3M3YK 4KMAA 3GTQA 4BY1C 1WQGA 1I3QA 4A3DK 1J98A 3S2HC 5C4JC 4C3HC 3GTPC 3AQOA 1WCMA 4XLPA 3S15C 3PO3K 2E2JC 4C3IC 3AD9C 5IP9K 4LK0A 2A68A 3TFIA 2XCQA 2EBBA 3GTLA 2JA6K 4BY1K 3RZDC 1TWAA 1JOEA 4A3IK 3GTPK 2PA8L 3S2DC 3M4OK 3FOEA 5M5WK 2W7VA 2JA5K 2P8TA 1B4BA 1TWCA 2XCRB 1IS1A 1O2FB 1Y1WC 1VLOA 1VH2A 3S1QC 1SMYA 3S1MC 3GTQC 2XCOA 3H0GA 4OIRA 2JA7A 1DCPA 1INNA 2RGRA 3A8KA 4BBRC 1XXCA 5TMFA 5FLMC 4GTBA 5M5YK 4C3JC 1PJ5A 3K7AK 1I50K 3BUEA 4GT9A 1O24A 2WAQD 4J3NA 2GSNA 2VUMA 3OPFA 1WORA 4LOWA 3M3YC 4A3FC 4A3MK 2NVTK 3S17K 3MMLB 1I6HK 4OINA 3RZOC 2R92A 2B63C 5M3MK 4KARA 4BY7C 2R7ZA 4OIOA 1ISEA 1Y1WA 1EK8A 3GTJA 4C3JK 2NVXK 2FQTA 4C2MK 4FZBA 4LQYA 3L4KA 3H3VD 3LPXA 2B63A 3HOZK 4KAWX 2PPBA 1SFOK 1K83K 4BLAA 1BS2A 3OREA 5JVOA 1WSRA 2RH6A 4Q5SA 4BY7K 1O25A 3CAGA 2E2IA 3AH5A 4QJVB 5IP7K 3S17C 3M4OC 2NVXC 2JA5C 4KC6A 4MEYA 4RMFA 4AYBD 1USMA 2YU9K 3S1NK 3Q3QA 2NVYC 2CW0A 2E2HA 2E2IC 1YNJA 2P5MA 4BXXK 3GTKC 5TMCA 1TWGC 2D6FC 1YNNA 1IE0A 1I50C 4GTEA 3FKIC 4KMHA 5FLMK 4GTCA 4AH6A 4Y7NK 2YU9C 1JQWA 3GTOC 2E2JK 1O26A 1BJTA 3HOXC 4LR2A 3GTKK 5IYCK 4A3FK 4QJVA 3FKIA 2PHCB 5C4XC 3GTPA 5TJ3A 3FOFA 2V6UA 4A3JK 4YFNA 1Y1VA 5EGHA 2JA6C 4PABA 1I6HC 2PMZL 4KN4A 1VJEA 4A3LC 1WQFA 4OIPA 3GEHA 2BE5A 3GTGC 3AQPA 4A3IC 5FJ8K 4X6AC 1F9NA 3GTOK 4KMDA 2A69A 1EH1A 1TWAC 3L4JA 4MQ9A 4ZH4A 1F93A 3S2HK 3GDZA 1UV7A 4P9SA 4Y52C 4WJ4A 1R9TA 1XZQB 4BBRK 5IOSA 1C0AA 4G7OA 1TWHA 3PO2C 4JK1A 5M3FK 2JA7C 2NVYK 3S1NC 4GTDA 3S0XA 3JSTA 2GAGC 4A3EC 1GE9A 1DCOA 2O5JA 2E2HC 3H3VL 3IPJA 1TWFA 3RZDK 1O27A 5C44C 1ZYRA 2JH3A 5M5XK 3H0GK 3S14C 5D4DA 3HOWC 3GTQK 2PMZD 4BLBA 2R93C 1YCLA 2R92C 1VGXA 3S1QK 5HL8A 3BP3A 5IYDK 3HXAA 3OEPA 5L46A 1USOA 1WSVA 5CJ9A 2R93A 4QIWL 4WJ3M 1WOPA 2CFAB 1I6VA 4A93C 5IP7C 4A3KK 1KQ4A 2JA8C 1J6XA 3HKZD 2R92K 1WQHA 1EI6A 1TWCC 3HOWK 3GTJK 5IOTA 2NVXA 5IP9C 2NVQK 4KM9A 3CQZK 5CHPA 1X31C 1ZVUA 1TWGK 4AYBL 2B63K 3N0BA 3SZZA 2JA7K 1AB4A 4G7ZA 3GTKA 1JVIA 2FQOA 1I3QC 4ILDA 1DCHA 3GTGA 1I50A 1SFOC 4WILA 1XXBA 4GTLA 4P5BA 3HOXK 1BDFA 3I4MC 2JA5A 4G0WA 1L0WA 3VA7A 2WB1L 3HOYK 3GTOA 1EQRA 4O2DA 3K7AC 5EGEA 3S16K 2CFAA 1TWAK 1XPPA 1ZBSA 5IORA 3CQZC 1WIHA 4M1XA 3GTMA 3AD8C 1G51A 1TWHC 4MEXA 4XSZA 4OIQA 1IQ0A 1YX2A 3T01A 4GZYA 1ZQ1C 3S1RK 3I4MK 3HKZL 3GEEA 2WAQL 1WOOA 4LK1A 3S2DK 3G4AA 2Y3PA 1F7UA 3FKIK 2GAHC 5C4XK 4Y7NC 3HOVC 3S16C 2ZUFA 2VUMK 5C44K 1TWCK 5E68A 4A3DC 2V6TA 3TFJA 2E2HK 1F7VA 4X6AK 1ZXOA 5C4JK 1DD5A 2PA8D 1XXAA 2WB1D 1XZPA 2KWAA 1B4AA 1TWFC 4KB2A 3LAJA 1R9TK 2R7ZC 1J6WA 4P5AA 4BBSK 2E2IK 4KN7A 5IYDC 3V4GA 4KASA 1O2AA 5IOQA 5C3EK 2NVYA 1K83A 4A3BK 2VUMC 3N3YA 3PO2K 2A6EA 1IW7A 3GTLK 1RU0A 5IYBK 2JA6A 1PJ7A 3HOZC 1Y1VK 1K83C 3GEIA 3CQZA 1O29A 4G7HA 4BBSC 4A3EK 4KATA 1WCMC 4A3GK 4FM9A 3GTMC 1VRQC 4C2MC 4XSXA 4XCHA 5C3EC 1EFWA 2GSOA 3GIRA 4DDQA 2ZUEA 1I3QK 3DXJA 1Y1VC 4QIWD 3NUHA 4LJZA 4KDDA 2R93K 3AD7C 3ERED 4LLGA 4A3MC 4BKWA 1WCMK 3FHZA 4G0VA 3T02A 3HOVK 4Y52K 4KB4A 2YU9A 4A3KC 1O2BA 2A6HA 4BXXC 4A93K 3WODA 5JFEA 4KMUA 4GFQA 3EQLA 3S1MK 1TWFK 1XZQA 1R9TC 4Q4ZA 3TFHA 2V6SA 2JA8K 1Y1WK 3A8IA 2Y0SD 1TWGA 1J6VA 5IYCC 4A3CC 3HOUK 3I4NC 3LAPA 4A3JC 1BGWA 1IL2A 2NVQC 3PO3C 3S15K 3H0GC 3G4CA 4C3HK
chains in the Genus database with same CATH topology
3BUEA 4GT9A 1O28A 1O24A 3N0CA 4J3NA 2GSNA 2VUMA 4GTDA 3S0XA 2ZFZA 3OPFA 4C3JC 3MMLB 1GE9A 2R92A 1TWFA 4KARA 1O27A 2R7ZA 3QX3A 2JH3A 1ISEA 1Y1WA 1EK8A 3GTJA 1ZXOA 1DD5A 4GTAA 1XXAA 4BLBA 2KWAA 1B4AA 4FZBA 4LQYA 3L4KA 4KB2A 3LPXA 3LAJA 2B63A 4KAWX 4P5AA 4BLAA 3OREA 3OEPA 1O2AA 4KASA 3V4GA 5JVOA 5CJ9A 2RH6A 5IOQA 2R93A 2NVYA 4KM8A 1O25A 3CAGA 1SFOA 2CFAB 1K83A 2E2IA 3AH5A 3N3YA 4G0UA 4KC6A 2JA6A 1KQ4A 3Q3QA 1WQHA 4GTFA 2E2HA 3CQZA 2P5MA 2GSUA 1O29A 5IOTA 2NVXA 4KATA 4FM9A 4KMAA 4C2MC 3GTQA 1WQGA 4KM9A 5CHPA 1I3QA 1ZVUA 2GSOA 3N0BA 4GTEA 4DDQA 1AB4A 4C3HC 3AQOA 4KMHA 1WCMA 4GTCA 3GTKA 4C3IC 3NUHA 4KDDA 1O26A 1BJTA 3ERED 4LR2A 4BKWA 4ILDA 3FHZA 4G0VA 3GTGA 1I50A 3FKIA 2PHCB 1XXBA 2XCQA 4GTLA 4P5BA 3GTPA 5TJ3A 3GTLA 3FOFA 2JA5A 1TWAA 4G0WA 1Y1VA 4KB4A 5EGHA 2YU9A 3VA7A 1O2BA 3GTOA 5JFEA 3FOEA 1WQFA 5EGEA 3AQPA 1B4BA 2CFAA 1TWCA 4GFQA 1ZBSA 1F9NA 1IS1A 5IORA 1WIHA 4KMDA 2XCRB 4M1XA 1EH1A 3GTMA 2XCOA 3H0GA 1TWGA 3L4JA 2JA7A 2RGRA 1XXCA 3LAPA 1R9TA 1BGWA 4GTBA 5IOSA 1TWHA 3G4CA 3G4AA 2Y3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAT A;  4GT9 A;  1O28 A;  1O24 A;  1O2B A;  3N0C A;  4P5A A;  5JFE A;  4GTD A;  5CHP A;  2CFA A;  4KAS A;  1O2A A;  5IOQ A;  3N0B A;  4GTE A;  5IOR A;  1O25 A;  2CFA B;  3AH5 A;  4GTC A;  3N3Y A;  4KAR A;  1O27 A;  1O26 A;  1KQ4 A;  4GTA A;  4GTL A;  4P5B A;  4GTF A;  4GTB A;  5IOS A;  3G4C A;  1O29 A;  3G4A A;  4FZB A;  5IOT A; 
#chains in the Genus database with same CATH topology
 1O28 A;  3N0C A;  3BP8 C;  4YFX A;  1WOS A;  2ZFZ A;  5IYB C;  3HOU C;  4A3C K;  3HOY C;  2Y0S L;  3QX3 A;  1V5V A;  3RZO K;  3GTM K;  3SZY A;  3I4N K;  4PAA A;  1PJ6 A;  4GTA A;  2R7Z K;  4YFK A;  3GSI A;  3S1R C;  1HQM A;  3GTJ C;  1TWH K;  1IBA A;  3T00 A;  2O5I A;  4A3B C;  4KM8 A;  4C3I K;  1SFO A;  4NOI A;  3GTG K;  3GTL C;  3TTG A;  4A3L K;  3S14 K;  4G0U A;  1HI9 A;  3A8J A;  3ADA C;  1XZP B;  4XLN A;  4YG2 A;  4GTF A;  4A3G C;  2GSU A;  2NVT C;  4C45 A;  3M3Y K;  4KMA A;  3GTQ A;  4BY1 C;  1WQG A;  1I3Q A;  4A3D K;  1J98 A;  3S2H C;  5C4J C;  4C3H C;  3GTP C;  3AQO A;  1WCM A;  4XLP A;  3S15 C;  3PO3 K;  2E2J C;  4C3I C;  3AD9 C;  5IP9 K;  4LK0 A;  2A68 A;  3TFI A;  2XCQ A;  2EBB A;  3GTL A;  2JA6 K;  4BY1 K;  3RZD C;  1TWA A;  1JOE A;  4A3I K;  3GTP K;  2PA8 L;  3S2D C;  3M4O K;  3FOE A;  5M5W K;  2W7V A;  2JA5 K;  2P8T A;  1B4B A;  1TWC A;  2XCR B;  1IS1 A;  1O2F B;  1Y1W C;  1VLO A;  1VH2 A;  3S1Q C;  1SMY A;  3S1M C;  3GTQ C;  2XCO A;  3H0G A;  4OIR A;  2JA7 A;  1DCP A;  1INN A;  2RGR A;  3A8K A;  4BBR C;  1XXC A;  5TMF A;  5FLM C;  4GTB A;  5M5Y K;  4C3J C;  1PJ5 A;  3K7A K;  1I50 K;  3BUE A;  4GT9 A;  1O24 A;  2WAQ D;  4J3N A;  2GSN A;  2VUM A;  3OPF A;  1WOR A;  4LOW A;  3M3Y C;  4A3F C;  4A3M K;  2NVT K;  3S17 K;  3MML B;  1I6H K;  4OIN A;  3RZO C;  2R92 A;  2B63 C;  5M3M K;  4KAR A;  4BY7 C;  2R7Z A;  4OIO A;  1ISE A;  1Y1W A;  1EK8 A;  3GTJ A;  4C3J K;  2NVX K;  2FQT A;  4C2M K;  4FZB A;  4LQY A;  3L4K A;  3H3V D;  3LPX A;  2B63 A;  3HOZ K;  4KAW X;  2PPB A;  1SFO K;  1K83 K;  4BLA A;  1BS2 A;  3ORE A;  5JVO A;  1WSR A;  2RH6 A;  4Q5S A;  4BY7 K;  1O25 A;  3CAG A;  2E2I A;  3AH5 A;  4QJV B;  5IP7 K;  3S17 C;  3M4O C;  2NVX C;  2JA5 C;  4KC6 A;  4MEY A;  4RMF A;  4AYB D;  1USM A;  2YU9 K;  3S1N K;  3Q3Q A;  2NVY C;  2CW0 A;  2E2H A;  2E2I C;  1YNJ A;  2P5M A;  4BXX K;  3GTK C;  5TMC A;  1TWG C;  2D6F C;  1YNN A;  1IE0 A;  1I50 C;  4GTE A;  3FKI C;  4KMH A;  5FLM K;  4GTC A;  4AH6 A;  4Y7N K;  2YU9 C;  1JQW A;  3GTO C;  2E2J K;  1O26 A;  1BJT A;  3HOX C;  4LR2 A;  3GTK K;  5IYC K;  4A3F K;  4QJV A;  3FKI A;  2PHC B;  5C4X C;  3GTP A;  5TJ3 A;  3FOF A;  2V6U A;  4A3J K;  4YFN A;  1Y1V A;  5EGH A;  2JA6 C;  4PAB A;  1I6H C;  2PMZ L;  4KN4 A;  1VJE A;  4A3L C;  1WQF A;  4OIP A;  3GEH A;  2BE5 A;  3GTG C;  3AQP A;  4A3I C;  5FJ8 K;  4X6A C;  1F9N A;  3GTO K;  4KMD A;  2A69 A;  1EH1 A;  1TWA C;  3L4J A;  4MQ9 A;  4ZH4 A;  1F93 A;  3S2H K;  3GDZ A;  1UV7 A;  4P9S A;  4Y52 C;  4WJ4 A;  1R9T A;  1XZQ B;  4BBR K;  5IOS A;  1C0A A;  4G7O A;  1TWH A;  3PO2 C;  4JK1 A;  5M3F K;  2JA7 C;  2NVY K;  3S1N C;  4GTD A;  3S0X A;  3JST A;  2GAG C;  4A3E C;  1GE9 A;  1DCO A;  2O5J A;  2E2H C;  3H3V L;  3IPJ A;  1TWF A;  3RZD K;  1O27 A;  5C44 C;  1ZYR A;  2JH3 A;  5M5X K;  3H0G K;  3S14 C;  5D4D A;  3HOW C;  3GTQ K;  2PMZ D;  4BLB A;  2R93 C;  1YCL A;  2R92 C;  1VGX A;  3S1Q K;  5HL8 A;  3BP3 A;  5IYD K;  3HXA A;  3OEP A;  5L46 A;  1USO A;  1WSV A;  5CJ9 A;  2R93 A;  4QIW L;  4WJ3 M;  1WOP A;  2CFA B;  1I6V A;  4A93 C;  5IP7 C;  4A3K K;  1KQ4 A;  2JA8 C;  1J6X A;  3HKZ D;  2R92 K;  1WQH A;  1EI6 A;  1TWC C;  3HOW K;  3GTJ K;  5IOT A;  2NVX A;  5IP9 C;  2NVQ K;  4KM9 A;  3CQZ K;  5CHP A;  1X31 C;  1ZVU A;  1TWG K;  4AYB L;  2B63 K;  3N0B A;  3SZZ A;  2JA7 K;  1AB4 A;  4G7Z A;  3GTK A;  1JVI A;  2FQO A;  1I3Q C;  4ILD A;  1DCH A;  3GTG A;  1I50 A;  1SFO C;  4WIL A;  1XXB A;  4GTL A;  4P5B A;  3HOX K;  1BDF A;  3I4M C;  2JA5 A;  4G0W A;  1L0W A;  3VA7 A;  2WB1 L;  3HOY K;  3GTO A;  1EQR A;  4O2D A;  3K7A C;  5EGE A;  3S16 K;  2CFA A;  1TWA K;  1XPP A;  1ZBS A;  5IOR A;  3CQZ C;  1WIH A;  4M1X A;  3GTM A;  3AD8 C;  1G51 A;  1TWH C;  4MEX A;  4XSZ A;  4OIQ A;  1IQ0 A;  1YX2 A;  3T01 A;  4GZY A;  1ZQ1 C;  3S1R K;  3I4M K;  3HKZ L;  3GEE A;  2WAQ L;  1WOO A;  4LK1 A;  3S2D K;  3G4A A;  2Y3P A;  1F7U A;  3FKI K;  2GAH C;  5C4X K;  4Y7N C;  3HOV C;  3S16 C;  2ZUF A;  2VUM K;  5C44 K;  1TWC K;  5E68 A;  4A3D C;  2V6T A;  3TFJ A;  2E2H K;  1F7V A;  4X6A K;  1ZXO A;  5C4J K;  1DD5 A;  2PA8 D;  1XXA A;  2WB1 D;  1XZP A;  2KWA A;  1B4A A;  1TWF C;  4KB2 A;  3LAJ A;  1R9T K;  2R7Z C;  1J6W A;  4P5A A;  4BBS K;  2E2I K;  4KN7 A;  5IYD C;  3V4G A;  4KAS A;  1O2A A;  5IOQ A;  5C3E K;  2NVY A;  1K83 A;  4A3B K;  2VUM C;  3N3Y A;  3PO2 K;  2A6E A;  1IW7 A;  3GTL K;  1RU0 A;  5IYB K;  2JA6 A;  1PJ7 A;  3HOZ C;  1Y1V K;  1K83 C;  3GEI A;  3CQZ A;  1O29 A;  4G7H A;  4BBS C;  4A3E K;  4KAT A;  1WCM C;  4A3G K;  4FM9 A;  3GTM C;  1VRQ C;  4C2M C;  4XSX A;  4XCH A;  5C3E C;  1EFW A;  2GSO A;  3GIR A;  4DDQ A;  2ZUE A;  1I3Q K;  3DXJ A;  1Y1V C;  4QIW D;  3NUH A;  4LJZ A;  4KDD A;  2R93 K;  3AD7 C;  3ERE D;  4LLG A;  4A3M C;  4BKW A;  1WCM K;  3FHZ A;  4G0V A;  3T02 A;  3HOV K;  4Y52 K;  4KB4 A;  2YU9 A;  4A3K C;  1O2B A;  2A6H A;  4BXX C;  4A93 K;  3WOD A;  5JFE A;  4KMU A;  4GFQ A;  3EQL A;  3S1M K;  1TWF K;  1XZQ A;  1R9T C;  4Q4Z A;  3TFH A;  2V6S A;  2JA8 K;  1Y1W K;  3A8I A;  2Y0S D;  1TWG A;  1J6V A;  5IYC C;  4A3C C;  3HOU K;  3I4N C;  3LAP A;  4A3J C;  1BGW A;  1IL2 A;  2NVQ C;  3PO3 C;  3S15 K;  3H0G C;  3G4C A;  4C3H K; 
#chains in the Genus database with same CATH homology
 3BUE A;  4GT9 A;  1O28 A;  1O24 A;  3N0C A;  4J3N A;  2GSN A;  2VUM A;  4GTD A;  3S0X A;  2ZFZ A;  3OPF A;  4C3J C;  3MML B;  1GE9 A;  2R92 A;  1TWF A;  4KAR A;  1O27 A;  2R7Z A;  3QX3 A;  2JH3 A;  1ISE A;  1Y1W A;  1EK8 A;  3GTJ A;  1ZXO A;  1DD5 A;  4GTA A;  1XXA A;  4BLB A;  2KWA A;  1B4A A;  4FZB A;  4LQY A;  3L4K A;  4KB2 A;  3LPX A;  3LAJ A;  2B63 A;  4KAW X;  4P5A A;  4BLA A;  3ORE A;  3OEP A;  1O2A A;  4KAS A;  3V4G A;  5JVO A;  5CJ9 A;  2RH6 A;  5IOQ A;  2R93 A;  2NVY A;  4KM8 A;  1O25 A;  3CAG A;  1SFO A;  2CFA B;  1K83 A;  2E2I A;  3AH5 A;  3N3Y A;  4G0U A;  4KC6 A;  2JA6 A;  1KQ4 A;  3Q3Q A;  1WQH A;  4GTF A;  2E2H A;  3CQZ A;  2P5M A;  2GSU A;  1O29 A;  5IOT A;  2NVX A;  4KAT A;  4FM9 A;  4KMA A;  4C2M C;  3GTQ A;  1WQG A;  4KM9 A;  5CHP A;  1I3Q A;  1ZVU A;  2GSO A;  3N0B A;  4GTE A;  4DDQ A;  1AB4 A;  4C3H C;  3AQO A;  4KMH A;  1WCM A;  4GTC A;  3GTK A;  4C3I C;  3NUH A;  4KDD A;  1O26 A;  1BJT A;  3ERE D;  4LR2 A;  4BKW A;  4ILD A;  3FHZ A;  4G0V A;  3GTG A;  1I50 A;  3FKI A;  2PHC B;  1XXB A;  2XCQ A;  4GTL A;  4P5B A;  3GTP A;  5TJ3 A;  3GTL A;  3FOF A;  2JA5 A;  1TWA A;  4G0W A;  1Y1V A;  4KB4 A;  5EGH A;  2YU9 A;  3VA7 A;  1O2B A;  3GTO A;  5JFE A;  3FOE A;  1WQF A;  5EGE A;  3AQP A;  1B4B A;  2CFA A;  1TWC A;  4GFQ A;  1ZBS A;  1F9N A;  1IS1 A;  5IOR A;  1WIH A;  4KMD A;  2XCR B;  4M1X A;  1EH1 A;  3GTM A;  2XCO A;  3H0G A;  1TWG A;  3L4J A;  2JA7 A;  2RGR A;  1XXC A;  3LAP A;  1R9T A;  1BGW A;  4GTB A;  5IOS A;  1TWH A;  3G4C A;  3G4A A;  2Y3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...