4GT9A

T. maritima fdts with fad, dump and folate.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 75
structure length 214
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gt9A00
1O2AA 4P5AA 3N0CA 4KATA 4GTBA 1O25A 1O24A 5IOSA 3N3YA 4GTFA 4GTEA 4GTAA 4FZBA 1O26A 1O28A 4GTCA 3N0BA 3G4CA 2CFAA 1O29A 5CHPA 1KQ4A 4GT9A 4GTDA 3AH5A 5IOTA 2CFAB 4P5BA 1O27A 5IORA 3G4AA 5IOQA 5JFEA 4KASA 4GTLA 4KARA 1O2BA
chains in the Genus database with same CATH superfamily
5IYBC 4BY1K 4AYBD 1EQRA 5TMFA 5TMCA 2BE5A 2JA5K 2NVYC 2Y0SL 3GTGK 3HOVK 5C4XK 4A3BK 3SZZA 3A8KA 1BGWA 3GTMK 1TWCC 1XZPA 3BP3A 2R7ZK 1JOEA 3G4AA 1WQGA 4BBSK 5C4JK 4X6AC 4C3JK 3HOXC 2JA8C 5FLMK 3SZYA 4A3CC 1O24A 4OINA 2ZUEA 2Y0SD 5M3MK 4OIRA 1DD5A 3ADAC 4FZBA 2JA6A 2NVYA 1Y1WA 1SMYA 4KMDA 3LAPA 3S1QC 3M3YC 1IE0A 4LR2A 3FOEA 1K83K 3H3VL 2PMZL 5M5YK 3HOUK 5M3FK 2B63A 4XLPA 1ISEA 4LJZA 4MEYA 2PPBA 2VUMA 3WODA 3OPFA 4GTLA 4MQ9A 1TWGK 1USMA 3S17C 4WILA 4WJ3M 2GSNA 1IQ0A 3TFIA 4WJ4A 4YFKA 3TFJA 3AD9C 4LOWA 4A3JC 2E2IC 3RZOK 2PMZD 3S1RC 3GTKC 3CQZA 1ZYRA 3GTLA 1VGXA 4A3GK 4XSXA 5IP7C 1Y1VA 2P5MA 1O2BA 2FQTA 4G0VA 4BBRC 4GTBA 5IYCC 3S15K 4C45A 3GTOK 3NUHA 1BJTA 2NVXC 3N3YA 4GTAA 3T02A 3OEPA 1VH2A 4KMUA 5CHPA 3GTKA 3GDZA 4X6AK 2JA7A 2JA8K 1UV7A 4GFQA 4MEXA 2WAQD 3GTPK 1WOSA 5IYDC 4G7OA 3S1QK 3GEEA 1USOA 3A8JA 1EI6A 2E2HA 3GTQK 4GTCA 1G51A 2NVTC 4QJVA 4KN4A 2PHCB 1TWHK 1BS2A 1XXCA 2R92A 4G0UA 3Q3QA 2R93A 3S14C 1I3QK 1O27A 3A8IA 5JFEA 4KDDA 4KASA 1ZXOA 5C44C 1DCPA 4A3JK 1EK8A 2E2IK 2JH3A 4BY7C 4KMHA 3H0GA 4Q5SA 1EH1A 4GTFA 1VLOA 1O28A 3FKIK 2JA6C 1Y1WC 3CAGA 3ERED 5IP7K 4Y52C 3QX3A 1KQ4A 3FHZA 2A6EA 5C3EC 1K83A 5IYCK 2B63C 4C3HC 2XCRB 4P5BA 2VUMC 1XPPA 1O2FB 2NVXK 4FM9A 1BDFA 1SFOK 4AH6A 1WCMK 3HKZD 1HI9A 4P5AA 5EGHA 4A3FC 1O25A 2E2JC 3S1MK 1ZQ1C 4Y7NK 3AD7C 4A3LC 1IBAA 4OIQA 1TWFA 3TTGA 3PO2C 3S1NC 3GTJK 2CFAA 2V6SA 1B4AA 4LK0A 1I6HC 1GE9A 3RZDC 1WIHA 3CQZC 4GT9A 4GTDA 3HOYC 3HXAA 3GTLC 1R9TA 4XSZA 5IP9K 2O5IA 5E68A 5M5XK 5IOQA 1XZPB 4G7HA 4A3MC 2W7VA 4A3DK 2EBBA 1Y1VC 4A3EK 1J98A 2NVTK 3HOWK 3T00A 3I4MC 4G0WA 1F93A 1WOOA 1YNJA 2FQOA 3IPJA 3K7AC 2GAHC 3PO3C 2YU9A 2JA7C 3GIRA 2NVQC 4BY7K 4BLBA 3S2HC 4C2MC 5M5WK 1XZQA 5IYBK 5TJ3A 5D4DA 1O2AA 5CJ9A 2NVYK 2PA8L 1Y1WK 1TWAA 2WAQL 3JSTA 4LLGA 4Y52K 3T01A 1TWCK 1EFWA 4A93C 1WQFA 4C3HK 2O5JA 4BLAA 2E2HC 2VUMK 3EQLA 4M1XA 1F7UA 4LQYA 4KN7A 4YFNA 3HOXK 2R92C 3HOVC 1XXBA 3AD8C 2R93C 2E2JK 4A3CK 1VJEA 3DXJA 3S16C 1YX2A 2PA8D 4A3LK 3GEIA 1I3QA 3S1NK 1I50A 5C4JC 5IOSA 3M3YK 1PJ7A 4C3JC 1I6HK 3H0GC 3RZDK 3CQZK 4JK1A 1JQWA 3N0BA 1B4BA 4OIOA 3M4OC 1X31C 1AB4A 2JA5A 1WSRA 3GSIA 3FKIA 1IS1A 3GTGA 1IW7A 3S17K 3GTMA 1K83C 3BUEA 4A3KC 1ZVUA 2R7ZA 3K7AK 2Y3PA 3S1RK 1F9NA 3HKZL 1WCMA 3PO3K 3GTKK 4GTEA 4KMAA 2JA7K 2NVQK 2P8TA 1TWFC 1IL2A 3S2HK 4C2MK 4O2DA 1J6WA 2WB1D 4QJVB 2RGRA 4BBRK 1R9TC 3FOFA 1HQMA 1XXAA 1I6VA 3OREA 4A3GC 3BP8C 1RU0A 4YG2A 4PABA 4A93K 2D6FC 2E2HK 3HOZC 1INNA 1TWGA 4LK1A 1O26A 1WOPA 2R92K 3S15C 2R93K 1PJ6A 1V5VA 3S2DC 4BXXC 4KB4A 5HL8A 4OIPA 3GTOC 4GZYA 4KM9A 3L4KA 3S16K 4KB2A 1WORA 4QIWD 3AH5A 2KWAA 1L0WA 2YU9C 4DDQA 5IYDK 5IORA 4C3IC 4BKWA 3H0GK 4KARA 1JVIA 3N0CA 3TFHA 1TWAC 3M4OK 1VRQC 1YCLA 3AQOA 3GTPC 3S14K 3GTOA 4A3IC 2CW0A 4A3KK 1TWCA 5C44K 4PAAA 1PJ5A 4XCHA 3GTQC 2CFAB 2A6HA 2V6TA 3AQPA 1J6XA 1TWHC 2XCOA 2GSOA 4ZH4A 3I4NC 5JVOA 2V6UA 4P9SA 4KATA 1I3QC 1TWFK 4KM8A 4G7ZA 2JA6K 1I50C 4ILDA 3MMLB 4KAWX 1WQHA 1DCOA 3H3VD 3GTPA 1YNNA 5C3EK 2B63K 1R9TK 3G4CA 4BY1C 5EGEA 4J3NA 2XCQA 2JA5C 3GTQA 3FKIC 3GTGC 4A3BC 5C4XC 3HOZK 1C0AA 4A3FK 1TWHA 5FJ8K 3GTMC 2A68A 2ZFZA 2R7ZC 1XZQB 3PO2K 3S2DK 4BXXK 4BBSC 4Q4ZA 1SFOC 2E2IA 1WCMC 5FLMC 4YFXA 2YU9K 3HOYK 3GTLK 3S1MC 4RMFA 4C3IK 1O29A 1WSVA 4Y7NC 3V4GA 4A3MK 5L46A 2ZUFA 5IOTA 2A69A 1Y1VK 3GTJC 3GEHA 3I4MK 1TWAK 2WB1L 1F7VA 1ZBSA 4KC6A 3LPXA 2RH6A 3HOUC 1J6VA 4NOIA 1DCHA 5IP9C 2GSUA 4A3IK 2NVXA 2GAGC 4A3DC 1SFOA 3LAJA 4XLNA 3L4JA 4A3EC 1TWGC 4AYBL 3VA7A 3HOWC 3S0XA 3I4NK 3RZOC 3GTJA 1I50K 4QIWL
chains in the Genus database with same CATH topology
1O2AA 3N0CA 5CJ9A 1TWAA 3AQOA 2E2HA 1WQFA 4GTCA 3GTOA 4BLAA 1BGWA 2PHCB 4M1XA 1TWCA 1XXCA 4LQYA 4G0UA 2R92A 3Q3QA 2R93A 2CFAB 3AQPA 1XXBA 1O27A 3G4AA 1WQGA 2XCOA 5JFEA 2GSOA 4KDDA 4KASA 1ZXOA 5JVOA 1EK8A 2JH3A 1I3QA 4KMHA 4KATA 1I50A 4KM8A 1O24A 4ILDA 5IOSA 3H0GA 3MMLB 4C3JC 1DD5A 1EH1A 4GTFA 1WQHA 4KAWX 4FZBA 3GTPA 2NVYA 1Y1WA 1O28A 4KMDA 2JA6A 3LAPA 3CAGA 3N0BA 3G4CA 4LR2A 3FOEA 1B4BA 3ERED 2JA5A 1AB4A 5EGEA 4J3NA 3FKIA 3QX3A 1KQ4A 1IS1A 2XCQA 3GTGA 3GTQA 3FHZA 2B63A 1ISEA 1K83A 4C3HC 2XCRB 4P5BA 3GTMA 2VUMA 1TWHA 3BUEA 3OPFA 4GTLA 1ZVUA 4FM9A 2R7ZA 2ZFZA 4P5AA 5EGHA 2Y3PA 1O25A 2GSNA 1F9NA 1WCMA 2E2IA 4GTEA 4KMAA 1TWFA 2CFAA 1O29A 1B4AA 3V4GA 3CQZA 1GE9A 1WIHA 3GTLA 4GT9A 4GTDA 5IOTA 2RGRA 1R9TA 3FOFA 5IOQA 1ZBSA 1XXAA 3OREA 2RH6A 3LPXA 1Y1VA 2P5MA 1O2BA 4KC6A 4G0VA 2GSUA 4GTBA 4G0WA 2NVXA 3NUHA 1BJTA 3N3YA 1SFOA 1TWGA 3LAJA 4GTAA 3L4JA 1O26A 3VA7A 3OEPA 3S0XA 4KB4A 5CHPA 3GTKA 4KM9A 3L4KA 2JA7A 4KB2A 2YU9A 3AH5A 2KWAA 3GTJA 4BLBA 4DDQA 4C2MC 4GFQA 5IORA 4C3IC 4BKWA 5TJ3A 4KARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2A A;  4P5A A;  3N0C A;  4KAT A;  4GTB A;  1O25 A;  1O24 A;  5IOS A;  3N3Y A;  4GTF A;  4GTE A;  4GTA A;  4FZB A;  1O26 A;  1O28 A;  4GTC A;  3N0B A;  3G4C A;  2CFA A;  1O29 A;  5CHP A;  1KQ4 A;  4GT9 A;  4GTD A;  3AH5 A;  5IOT A;  2CFA B;  4P5B A;  1O27 A;  5IOR A;  3G4A A;  5IOQ A;  5JFE A;  4KAS A;  4GTL A;  4KAR A;  1O2B A; 
#chains in the Genus database with same CATH topology
 5IYB C;  4BY1 K;  4AYB D;  1EQR A;  5TMF A;  5TMC A;  2BE5 A;  2JA5 K;  2NVY C;  2Y0S L;  3GTG K;  3HOV K;  5C4X K;  4A3B K;  3SZZ A;  3A8K A;  1BGW A;  3GTM K;  1TWC C;  1XZP A;  3BP3 A;  2R7Z K;  1JOE A;  3G4A A;  1WQG A;  4BBS K;  5C4J K;  4X6A C;  4C3J K;  3HOX C;  2JA8 C;  5FLM K;  3SZY A;  4A3C C;  1O24 A;  4OIN A;  2ZUE A;  2Y0S D;  5M3M K;  4OIR A;  1DD5 A;  3ADA C;  4FZB A;  2JA6 A;  2NVY A;  1Y1W A;  1SMY A;  4KMD A;  3LAP A;  3S1Q C;  3M3Y C;  1IE0 A;  4LR2 A;  3FOE A;  1K83 K;  3H3V L;  2PMZ L;  5M5Y K;  3HOU K;  5M3F K;  2B63 A;  4XLP A;  1ISE A;  4LJZ A;  4MEY A;  2PPB A;  2VUM A;  3WOD A;  3OPF A;  4GTL A;  4MQ9 A;  1TWG K;  1USM A;  3S17 C;  4WIL A;  4WJ3 M;  2GSN A;  1IQ0 A;  3TFI A;  4WJ4 A;  4YFK A;  3TFJ A;  3AD9 C;  4LOW A;  4A3J C;  2E2I C;  3RZO K;  2PMZ D;  3S1R C;  3GTK C;  3CQZ A;  1ZYR A;  3GTL A;  1VGX A;  4A3G K;  4XSX A;  5IP7 C;  1Y1V A;  2P5M A;  1O2B A;  2FQT A;  4G0V A;  4BBR C;  4GTB A;  5IYC C;  3S15 K;  4C45 A;  3GTO K;  3NUH A;  1BJT A;  2NVX C;  3N3Y A;  4GTA A;  3T02 A;  3OEP A;  1VH2 A;  4KMU A;  5CHP A;  3GTK A;  3GDZ A;  4X6A K;  2JA7 A;  2JA8 K;  1UV7 A;  4GFQ A;  4MEX A;  2WAQ D;  3GTP K;  1WOS A;  5IYD C;  4G7O A;  3S1Q K;  3GEE A;  1USO A;  3A8J A;  1EI6 A;  2E2H A;  3GTQ K;  4GTC A;  1G51 A;  2NVT C;  4QJV A;  4KN4 A;  2PHC B;  1TWH K;  1BS2 A;  1XXC A;  2R92 A;  4G0U A;  3Q3Q A;  2R93 A;  3S14 C;  1I3Q K;  1O27 A;  3A8I A;  5JFE A;  4KDD A;  4KAS A;  1ZXO A;  5C44 C;  1DCP A;  4A3J K;  1EK8 A;  2E2I K;  2JH3 A;  4BY7 C;  4KMH A;  3H0G A;  4Q5S A;  1EH1 A;  4GTF A;  1VLO A;  1O28 A;  3FKI K;  2JA6 C;  1Y1W C;  3CAG A;  3ERE D;  5IP7 K;  4Y52 C;  3QX3 A;  1KQ4 A;  3FHZ A;  2A6E A;  5C3E C;  1K83 A;  5IYC K;  2B63 C;  4C3H C;  2XCR B;  4P5B A;  2VUM C;  1XPP A;  1O2F B;  2NVX K;  4FM9 A;  1BDF A;  1SFO K;  4AH6 A;  1WCM K;  3HKZ D;  1HI9 A;  4P5A A;  5EGH A;  4A3F C;  1O25 A;  2E2J C;  3S1M K;  1ZQ1 C;  4Y7N K;  3AD7 C;  4A3L C;  1IBA A;  4OIQ A;  1TWF A;  3TTG A;  3PO2 C;  3S1N C;  3GTJ K;  2CFA A;  2V6S A;  1B4A A;  4LK0 A;  1I6H C;  1GE9 A;  3RZD C;  1WIH A;  3CQZ C;  4GT9 A;  4GTD A;  3HOY C;  3HXA A;  3GTL C;  1R9T A;  4XSZ A;  5IP9 K;  2O5I A;  5E68 A;  5M5X K;  5IOQ A;  1XZP B;  4G7H A;  4A3M C;  2W7V A;  4A3D K;  2EBB A;  1Y1V C;  4A3E K;  1J98 A;  2NVT K;  3HOW K;  3T00 A;  3I4M C;  4G0W A;  1F93 A;  1WOO A;  1YNJ A;  2FQO A;  3IPJ A;  3K7A C;  2GAH C;  3PO3 C;  2YU9 A;  2JA7 C;  3GIR A;  2NVQ C;  4BY7 K;  4BLB A;  3S2H C;  4C2M C;  5M5W K;  1XZQ A;  5IYB K;  5TJ3 A;  5D4D A;  1O2A A;  5CJ9 A;  2NVY K;  2PA8 L;  1Y1W K;  1TWA A;  2WAQ L;  3JST A;  4LLG A;  4Y52 K;  3T01 A;  1TWC K;  1EFW A;  4A93 C;  1WQF A;  4C3H K;  2O5J A;  4BLA A;  2E2H C;  2VUM K;  3EQL A;  4M1X A;  1F7U A;  4LQY A;  4KN7 A;  4YFN A;  3HOX K;  2R92 C;  3HOV C;  1XXB A;  3AD8 C;  2R93 C;  2E2J K;  4A3C K;  1VJE A;  3DXJ A;  3S16 C;  1YX2 A;  2PA8 D;  4A3L K;  3GEI A;  1I3Q A;  3S1N K;  1I50 A;  5C4J C;  5IOS A;  3M3Y K;  1PJ7 A;  4C3J C;  1I6H K;  3H0G C;  3RZD K;  3CQZ K;  4JK1 A;  1JQW A;  3N0B A;  1B4B A;  4OIO A;  3M4O C;  1X31 C;  1AB4 A;  2JA5 A;  1WSR A;  3GSI A;  3FKI A;  1IS1 A;  3GTG A;  1IW7 A;  3S17 K;  3GTM A;  1K83 C;  3BUE A;  4A3K C;  1ZVU A;  2R7Z A;  3K7A K;  2Y3P A;  3S1R K;  1F9N A;  3HKZ L;  1WCM A;  3PO3 K;  3GTK K;  4GTE A;  4KMA A;  2JA7 K;  2NVQ K;  2P8T A;  1TWF C;  1IL2 A;  3S2H K;  4C2M K;  4O2D A;  1J6W A;  2WB1 D;  4QJV B;  2RGR A;  4BBR K;  1R9T C;  3FOF A;  1HQM A;  1XXA A;  1I6V A;  3ORE A;  4A3G C;  3BP8 C;  1RU0 A;  4YG2 A;  4PAB A;  4A93 K;  2D6F C;  2E2H K;  3HOZ C;  1INN A;  1TWG A;  4LK1 A;  1O26 A;  1WOP A;  2R92 K;  3S15 C;  2R93 K;  1PJ6 A;  1V5V A;  3S2D C;  4BXX C;  4KB4 A;  5HL8 A;  4OIP A;  3GTO C;  4GZY A;  4KM9 A;  3L4K A;  3S16 K;  4KB2 A;  1WOR A;  4QIW D;  3AH5 A;  2KWA A;  1L0W A;  2YU9 C;  4DDQ A;  5IYD K;  5IOR A;  4C3I C;  4BKW A;  3H0G K;  4KAR A;  1JVI A;  3N0C A;  3TFH A;  1TWA C;  3M4O K;  1VRQ C;  1YCL A;  3AQO A;  3GTP C;  3S14 K;  3GTO A;  4A3I C;  2CW0 A;  4A3K K;  1TWC A;  5C44 K;  4PAA A;  1PJ5 A;  4XCH A;  3GTQ C;  2CFA B;  2A6H A;  2V6T A;  3AQP A;  1J6X A;  1TWH C;  2XCO A;  2GSO A;  4ZH4 A;  3I4N C;  5JVO A;  2V6U A;  4P9S A;  4KAT A;  1I3Q C;  1TWF K;  4KM8 A;  4G7Z A;  2JA6 K;  1I50 C;  4ILD A;  3MML B;  4KAW X;  1WQH A;  1DCO A;  3H3V D;  3GTP A;  1YNN A;  5C3E K;  2B63 K;  1R9T K;  3G4C A;  4BY1 C;  5EGE A;  4J3N A;  2XCQ A;  2JA5 C;  3GTQ A;  3FKI C;  3GTG C;  4A3B C;  5C4X C;  3HOZ K;  1C0A A;  4A3F K;  1TWH A;  5FJ8 K;  3GTM C;  2A68 A;  2ZFZ A;  2R7Z C;  1XZQ B;  3PO2 K;  3S2D K;  4BXX K;  4BBS C;  4Q4Z A;  1SFO C;  2E2I A;  1WCM C;  5FLM C;  4YFX A;  2YU9 K;  3HOY K;  3GTL K;  3S1M C;  4RMF A;  4C3I K;  1O29 A;  1WSV A;  4Y7N C;  3V4G A;  4A3M K;  5L46 A;  2ZUF A;  5IOT A;  2A69 A;  1Y1V K;  3GTJ C;  3GEH A;  3I4M K;  1TWA K;  2WB1 L;  1F7V A;  1ZBS A;  4KC6 A;  3LPX A;  2RH6 A;  3HOU C;  1J6V A;  4NOI A;  1DCH A;  5IP9 C;  2GSU A;  4A3I K;  2NVX A;  2GAG C;  4A3D C;  1SFO A;  3LAJ A;  4XLN A;  3L4J A;  4A3E C;  1TWG C;  4AYB L;  3VA7 A;  3HOW C;  3S0X A;  3I4N K;  3RZO C;  3GTJ A;  1I50 K;  4QIW L; 
#chains in the Genus database with same CATH homology
 1O2A A;  3N0C A;  5CJ9 A;  1TWA A;  3AQO A;  2E2H A;  1WQF A;  4GTC A;  3GTO A;  4BLA A;  1BGW A;  2PHC B;  4M1X A;  1TWC A;  1XXC A;  4LQY A;  4G0U A;  2R92 A;  3Q3Q A;  2R93 A;  2CFA B;  3AQP A;  1XXB A;  1O27 A;  3G4A A;  1WQG A;  2XCO A;  5JFE A;  2GSO A;  4KDD A;  4KAS A;  1ZXO A;  5JVO A;  1EK8 A;  2JH3 A;  1I3Q A;  4KMH A;  4KAT A;  1I50 A;  4KM8 A;  1O24 A;  4ILD A;  5IOS A;  3H0G A;  3MML B;  4C3J C;  1DD5 A;  1EH1 A;  4GTF A;  1WQH A;  4KAW X;  4FZB A;  3GTP A;  2NVY A;  1Y1W A;  1O28 A;  4KMD A;  2JA6 A;  3LAP A;  3CAG A;  3N0B A;  3G4C A;  4LR2 A;  3FOE A;  1B4B A;  3ERE D;  2JA5 A;  1AB4 A;  5EGE A;  4J3N A;  3FKI A;  3QX3 A;  1KQ4 A;  1IS1 A;  2XCQ A;  3GTG A;  3GTQ A;  3FHZ A;  2B63 A;  1ISE A;  1K83 A;  4C3H C;  2XCR B;  4P5B A;  3GTM A;  2VUM A;  1TWH A;  3BUE A;  3OPF A;  4GTL A;  1ZVU A;  4FM9 A;  2R7Z A;  2ZFZ A;  4P5A A;  5EGH A;  2Y3P A;  1O25 A;  2GSN A;  1F9N A;  1WCM A;  2E2I A;  4GTE A;  4KMA A;  1TWF A;  2CFA A;  1O29 A;  1B4A A;  3V4G A;  3CQZ A;  1GE9 A;  1WIH A;  3GTL A;  4GT9 A;  4GTD A;  5IOT A;  2RGR A;  1R9T A;  3FOF A;  5IOQ A;  1ZBS A;  1XXA A;  3ORE A;  2RH6 A;  3LPX A;  1Y1V A;  2P5M A;  1O2B A;  4KC6 A;  4G0V A;  2GSU A;  4GTB A;  4G0W A;  2NVX A;  3NUH A;  1BJT A;  3N3Y A;  1SFO A;  1TWG A;  3LAJ A;  4GTA A;  3L4J A;  1O26 A;  3VA7 A;  3OEP A;  3S0X A;  4KB4 A;  5CHP A;  3GTK A;  4KM9 A;  3L4K A;  2JA7 A;  4KB2 A;  2YU9 A;  3AH5 A;  2KWA A;  3GTJ A;  4BLB A;  4DDQ A;  4C2M C;  4GFQ A;  5IOR A;  4C3I C;  4BKW A;  5TJ3 A;  4KAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...