4GT9A

T. maritima fdts with fad, dump and folate.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 75
structure length 214
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gt9A00
4P5BA 4GTFA 4GTDA 4GTEA 4KATA 1O25A 2CFAB 5CHPA 5IORA 4GTCA 1O29A 1O26A 1O27A 4KASA 3N0CA 5IOQA 1KQ4A 4FZBA 4GTAA 3G4CA 5IOTA 4GT9A 4P5AA 3G4AA 4KARA 5JFEA 4GTBA 1O2BA 1O28A 1O24A 2CFAA 3N0BA 4GTLA 3N3YA 5IOSA 3AH5A 1O2AA
chains in the Genus database with same CATH superfamily
1O2FB 3CAGA 5EGEA 1YNJA 3PO2C 3HOYK 4KATA 1ZQ1C 1USOA 4GZYA 4KB4A 2A6EA 3GDZA 3S1RC 3S2HC 1TWCC 4Q5SA 3WODA 1TWGC 4BBRK 1WORA 4BY1C 3GTMC 5C4JC 1VH2A 1J6XA 1TWHA 3S1MC 1XZPB 4MQ9A 1PJ7A 4KMHA 3CQZA 2PMZD 3S16C 4A3BK 1WSVA 2GAGC 3TTGA 2E2HK 3FKIC 1I6HK 2PPBA 1BDFA 2JA6K 1TWCK 1WQHA 4A3DC 1VLOA 3SZYA 5IYBC 4BY7K 3GTPA 3G4AA 1PJ6A 4YFXA 1YCLA 4C3JK 3M3YC 2JA6C 3N3YA 1DCHA 1EI6A 4A3EK 4M1XA 3S15C 3NUHA 4X6AK 5C4XC 1K83C 4BBRC 3RZDC 2R92K 5IORA 4G7OA 4KMDA 3A8IA 3RZOC 1RU0A 3GEEA 4G7ZA 3T01A 3S1MK 4X6AC 4Q4ZA 3HKZD 2JA7K 5C44C 4BXXC 2R93C 5C3EK 4NOIA 3LAJA 3RZDK 3HXAA 5IOTA 5D4DA 1IS1A 4A3JK 3HOVK 2NVYA 4ILDA 4WILA 1J6VA 4LLGA 4C3IK 1XXBA 4BY7C 4A3KC 3QX3A 3H0GA 1EQRA 5FLMK 2JA5A 1WCMK 1I6HC 3HOUK 1I3QK 2VUMK 2GSUA 2NVYC 4A3CK 2JH3A 1HQMA 3HOUC 4C2MK 3GTMA 1JQWA 2NVXC 2JA5C 1Y1WA 3TFHA 4A3IK 3S1QC 4P5BA 4KMAA 1Y1WC 4ZH4A 2PMZL 2B63K 5HL8A 4G0WA 3GTGA 4C2MC 4Y7NC 2R93A 1TWFA 4OIQA 1IQ0A 2XCRB 3DXJA 2V6TA 4OINA 3N0CA 3S17K 3PO3K 4XSXA 4A93K 5IYDK 4O2DA 4MEXA 3G4CA 2YU9A 1GE9A 2E2JK 3GIRA 1IE0A 3GTJK 3GTQK 5EGHA 3GTPC 1YX2A 2E2IK 4PABA 1XZQA 2R92C 2PA8D 1L0WA 3I4NC 3GTQC 1O25A 4BLAA 1EK8A 3S2DK 1XXAA 5L46A 3AQOA 3FKIK 4KDDA 1IW7A 1KQ4A 3HKZL 1WIHA 3IPJA 5M5XK 4Y7NK 1B4BA 1SFOK 1TWGK 3PO2K 1TWHC 2RGRA 5TMCA 4A3EC 1X31C 5IYDC 3H3VD 1IBAA 4A3LC 4C3JC 3A8JA 1O27A 2WB1L 3BP3A 2KWAA 1K83K 3HOYC 2R7ZA 1XPPA 1TWHK 2A69A 2XCOA 4KC6A 4A3GC 3H3VL 1XZQB 1ZVUA 1R9TC 3A8KA 4C3HC 4GTDA 3GTLK 2FQOA 3FOEA 4XLPA 4A3DK 2E2HA 4DDQA 1SFOC 5E68A 1TWAA 1TWCA 4OIPA 4KN7A 4G0VA 1DD5A 2FQTA 4KN4A 4XCHA 4FZBA 4GTAA 5JVOA 4A3MK 4C3IC 3GTPK 2O5JA 5TJ3A 4AYBD 2CFAA 4QIWL 4WJ3M 3FHZA 1USMA 1WCMC 3GTKK 3GTOK 4KM8A 4JK1A 4AH6A 4PAAA 2ZUFA 1J6WA 4KM9A 2R92A 5M5WK 4BXXK 2E2IC 3GTGC 1VJEA 1DCPA 2O5IA 1O26A 2EBBA 3GEIA 3T02A 1WOPA 4A3IC 3OPFA 3HOVC 2WAQD 2Y3PA 2B63C 5C4XK 4C45A 4GT9A 3LAPA 1O28A 1O24A 2P8TA 3GTKC 2RH6A 3HOZC 4XLNA 4A3LK 5TMFA 5M5YK 3S1NK 4A3MC 3GEHA 2ZUEA 3H0GK 4QJVB 2P5MA 3S1QK 1HI9A 2NVXA 2YU9C 1WQFA 3S16K 4A3BC 3LPXA 3S1NC 4BBSK 3GSIA 2JA7C 4RMFA 4A3KK 4KMUA 1Y1VA 1WSRA 1XZPA 1O2BA 5C4JK 1ISEA 1R9TK 4A3JC 4BBSC 3I4MK 2BE5A 2PHCB 4OIRA 4A93C 1Y1WK 5FJ8K 1I6VA 1I50A 5IP7K 3SZZA 2GAHC 3GTJC 3S1RK 2GSNA 3I4MC 2R93K 1TWFC 3K7AK 1UV7A 4BLBA 4LQYA 5IP9C 5M3MK 2NVQC 3V4GA 4YFKA 4LK1A 1INNA 3VA7A 2E2JC 2NVTK 2PA8L 3S2HK 4A3CC 3M3YK 3S0XA 1WOOA 2XCQA 2CW0A 3GTQA 5IOSA 1JVIA 4QIWD 1V5VA 2ZFZA 4AYBL 3M4OC 3CQZK 5IYBK 3HOZK 3L4JA 1VGXA 3Q3QA 4Y52C 4A3FK 1I3QC 3H0GC 4YG2A 1ZBSA 1YNNA 2V6UA 2JA6A 3TFIA 2JA8K 3MMLB 1SMYA 1F7VA 1Y1VC 1F7UA 2WAQL 3GTLC 3BP8C 4GTBA 3EQLA 3M4OK 1TWGA 3S14K 5C3EC 1G51A 3ADAC 3AD9C 5C44K 4KB2A 5CHPA 4C3HK 4GFQA 4QJVA 2JA7A 4G7HA 1I50C 5IOQA 2W7VA 3T00A 1K83A 3FOFA 4P5AA 2Y0SL 4KARA 5JFEA 4G0UA 3S15K 2NVYK 5IP7C 2R7ZK 1WOSA 4KAWX 4LOWA 3AD8C 2JA8C 3CQZC 1AB4A 3GTLA 4WJ4A 1WQGA 3HOWK 1DCOA 3L4KA 4A3FC 4Y52K 1EFWA 1PJ5A 1F93A 1WCMA 4LK0A 2JA5K 4LJZA 1TWAK 5FLMC 4YFNA 1I3QA 3HOWC 3HOXC 2VUMA 5IP9K 3JSTA 2R7ZC 4LR2A 3N0BA 1TWAC 4BY1K 3GTMK 2A68A 1J98A 3GTKA 2NVTC 4MEYA 3S17C 3GTOA 3ERED 1B4AA 1BS2A 4XSZA 2B63A 3PO3C 3GTGK 1C0AA 1BGWA 3RZOK 1VRQC 1TWFK 3K7AC 4GTCA 2NVQK 4J3NA 2D6FC 4KASA 3GTOC 2WB1D 1EH1A 1F9NA 2YU9K 3S2DC 3GTJA 4OIOA 5IYCC 4GTLA 1JOEA 3AD7C 1ZXOA 2E2IA 4BKWA 5CJ9A 1XXCA 5M3FK 4GTFA 1ZYRA 4GTEA 4P9SA 3AQPA 5IYCK 2CFAB 2E2HC 2GSOA 3S14C 3I4NK 2V6SA 2NVXK 1O29A 3FKIA 4FM9A 3BUEA 2A6HA 2VUMC 3OREA 3HOXK 1Y1VK 1IL2A 1R9TA 1BJTA 2Y0SD 1SFOA 3OEPA 4A3GK 3TFJA 3AH5A 1I50K 1O2AA
chains in the Genus database with same CATH topology
4P5BA 4KM8A 4KMAA 3CAGA 5EGEA 4KATA 4KB2A 4G0WA 3GTGA 4C2MC 4KM9A 2R92A 5CHPA 1TWFA 2R93A 4GFQA 2XCRB 4KB4A 1O26A 2JA7A 3N0CA 3OPFA 5IOQA 2Y3PA 2YU9A 3G4CA 1K83A 3FOFA 4GT9A 4P5AA 3LAPA 1GE9A 4KARA 5JFEA 4G0UA 1O28A 1O24A 1TWHA 5EGHA 2RH6A 4KAWX 4KMHA 3CQZA 1AB4A 3GTLA 1WQGA 1O25A 4BLAA 1EK8A 2P5MA 3L4KA 1XXAA 1WCMA 2NVXA 3AQOA 1WQFA 3LPXA 4KDDA 1WQHA 1I3QA 1KQ4A 3GTPA 1Y1VA 2VUMA 3G4AA 1WIHA 1O2BA 1ISEA 1B4BA 4LR2A 3N0BA 3N3YA 2PHCB 2RGRA 3GTKA 1I50A 4M1XA 3GTOA 3NUHA 3ERED 1B4AA 2B63A 2GSNA 1BGWA 5IORA 4C3JC 4KMDA 4BLBA 4GTCA 4LQYA 4J3NA 3V4GA 1O27A 4KASA 3VA7A 3LAJA 1EH1A 1F9NA 2KWAA 5IOTA 1IS1A 3GTJA 2NVYA 3S0XA 4ILDA 2XCQA 2R7ZA 4GTLA 2XCOA 5IOSA 3GTQA 4KC6A 1ZVUA 2ZFZA 1ZXOA 2E2IA 4BKWA 5CJ9A 4C3HC 1XXCA 4GTFA 3L4JA 4GTDA 4GTEA 3Q3QA 1XXBA 3FOEA 3AQPA 3QX3A 2CFAB 3H0GA 2GSOA 2E2HA 1ZBSA 2JA5A 4DDQA 1O29A 3FKIA 1TWAA 2JA6A 1TWCA 4G0VA 3MMLB 4FM9A 1DD5A 3BUEA 4FZBA 4GTAA 5JVOA 3OREA 4C3IC 2GSUA 5TJ3A 4GTBA 2JH3A 2CFAA 1R9TA 1BJTA 3GTMA 1SFOA 3OEPA 3FHZA 1TWGA 1Y1WA 3AH5A 1O2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5B A;  4GTF A;  4GTD A;  4GTE A;  4KAT A;  1O25 A;  2CFA B;  5CHP A;  5IOR A;  4GTC A;  1O29 A;  1O26 A;  1O27 A;  4KAS A;  3N0C A;  5IOQ A;  1KQ4 A;  4FZB A;  4GTA A;  3G4C A;  5IOT A;  4GT9 A;  4P5A A;  3G4A A;  4KAR A;  5JFE A;  4GTB A;  1O2B A;  1O28 A;  1O24 A;  2CFA A;  3N0B A;  4GTL A;  3N3Y A;  5IOS A;  3AH5 A;  1O2A A; 
#chains in the Genus database with same CATH topology
 1O2F B;  3CAG A;  5EGE A;  1YNJ A;  3PO2 C;  3HOY K;  4KAT A;  1ZQ1 C;  1USO A;  4GZY A;  4KB4 A;  2A6E A;  3GDZ A;  3S1R C;  3S2H C;  1TWC C;  4Q5S A;  3WOD A;  1TWG C;  4BBR K;  1WOR A;  4BY1 C;  3GTM C;  5C4J C;  1VH2 A;  1J6X A;  1TWH A;  3S1M C;  1XZP B;  4MQ9 A;  1PJ7 A;  4KMH A;  3CQZ A;  2PMZ D;  3S16 C;  4A3B K;  1WSV A;  2GAG C;  3TTG A;  2E2H K;  3FKI C;  1I6H K;  2PPB A;  1BDF A;  2JA6 K;  1TWC K;  1WQH A;  4A3D C;  1VLO A;  3SZY A;  5IYB C;  4BY7 K;  3GTP A;  3G4A A;  1PJ6 A;  4YFX A;  1YCL A;  4C3J K;  3M3Y C;  2JA6 C;  3N3Y A;  1DCH A;  1EI6 A;  4A3E K;  4M1X A;  3S15 C;  3NUH A;  4X6A K;  5C4X C;  1K83 C;  4BBR C;  3RZD C;  2R92 K;  5IOR A;  4G7O A;  4KMD A;  3A8I A;  3RZO C;  1RU0 A;  3GEE A;  4G7Z A;  3T01 A;  3S1M K;  4X6A C;  4Q4Z A;  3HKZ D;  2JA7 K;  5C44 C;  4BXX C;  2R93 C;  5C3E K;  4NOI A;  3LAJ A;  3RZD K;  3HXA A;  5IOT A;  5D4D A;  1IS1 A;  4A3J K;  3HOV K;  2NVY A;  4ILD A;  4WIL A;  1J6V A;  4LLG A;  4C3I K;  1XXB A;  4BY7 C;  4A3K C;  3QX3 A;  3H0G A;  1EQR A;  5FLM K;  2JA5 A;  1WCM K;  1I6H C;  3HOU K;  1I3Q K;  2VUM K;  2GSU A;  2NVY C;  4A3C K;  2JH3 A;  1HQM A;  3HOU C;  4C2M K;  3GTM A;  1JQW A;  2NVX C;  2JA5 C;  1Y1W A;  3TFH A;  4A3I K;  3S1Q C;  4P5B A;  4KMA A;  1Y1W C;  4ZH4 A;  2PMZ L;  2B63 K;  5HL8 A;  4G0W A;  3GTG A;  4C2M C;  4Y7N C;  2R93 A;  1TWF A;  4OIQ A;  1IQ0 A;  2XCR B;  3DXJ A;  2V6T A;  4OIN A;  3N0C A;  3S17 K;  3PO3 K;  4XSX A;  4A93 K;  5IYD K;  4O2D A;  4MEX A;  3G4C A;  2YU9 A;  1GE9 A;  2E2J K;  3GIR A;  1IE0 A;  3GTJ K;  3GTQ K;  5EGH A;  3GTP C;  1YX2 A;  2E2I K;  4PAB A;  1XZQ A;  2R92 C;  2PA8 D;  1L0W A;  3I4N C;  3GTQ C;  1O25 A;  4BLA A;  1EK8 A;  3S2D K;  1XXA A;  5L46 A;  3AQO A;  3FKI K;  4KDD A;  1IW7 A;  1KQ4 A;  3HKZ L;  1WIH A;  3IPJ A;  5M5X K;  4Y7N K;  1B4B A;  1SFO K;  1TWG K;  3PO2 K;  1TWH C;  2RGR A;  5TMC A;  4A3E C;  1X31 C;  5IYD C;  3H3V D;  1IBA A;  4A3L C;  4C3J C;  3A8J A;  1O27 A;  2WB1 L;  3BP3 A;  2KWA A;  1K83 K;  3HOY C;  2R7Z A;  1XPP A;  1TWH K;  2A69 A;  2XCO A;  4KC6 A;  4A3G C;  3H3V L;  1XZQ B;  1ZVU A;  1R9T C;  3A8K A;  4C3H C;  4GTD A;  3GTL K;  2FQO A;  3FOE A;  4XLP A;  4A3D K;  2E2H A;  4DDQ A;  1SFO C;  5E68 A;  1TWA A;  1TWC A;  4OIP A;  4KN7 A;  4G0V A;  1DD5 A;  2FQT A;  4KN4 A;  4XCH A;  4FZB A;  4GTA A;  5JVO A;  4A3M K;  4C3I C;  3GTP K;  2O5J A;  5TJ3 A;  4AYB D;  2CFA A;  4QIW L;  4WJ3 M;  3FHZ A;  1USM A;  1WCM C;  3GTK K;  3GTO K;  4KM8 A;  4JK1 A;  4AH6 A;  4PAA A;  2ZUF A;  1J6W A;  4KM9 A;  2R92 A;  5M5W K;  4BXX K;  2E2I C;  3GTG C;  1VJE A;  1DCP A;  2O5I A;  1O26 A;  2EBB A;  3GEI A;  3T02 A;  1WOP A;  4A3I C;  3OPF A;  3HOV C;  2WAQ D;  2Y3P A;  2B63 C;  5C4X K;  4C45 A;  4GT9 A;  3LAP A;  1O28 A;  1O24 A;  2P8T A;  3GTK C;  2RH6 A;  3HOZ C;  4XLN A;  4A3L K;  5TMF A;  5M5Y K;  3S1N K;  4A3M C;  3GEH A;  2ZUE A;  3H0G K;  4QJV B;  2P5M A;  3S1Q K;  1HI9 A;  2NVX A;  2YU9 C;  1WQF A;  3S16 K;  4A3B C;  3LPX A;  3S1N C;  4BBS K;  3GSI A;  2JA7 C;  4RMF A;  4A3K K;  4KMU A;  1Y1V A;  1WSR A;  1XZP A;  1O2B A;  5C4J K;  1ISE A;  1R9T K;  4A3J C;  4BBS C;  3I4M K;  2BE5 A;  2PHC B;  4OIR A;  4A93 C;  1Y1W K;  5FJ8 K;  1I6V A;  1I50 A;  5IP7 K;  3SZZ A;  2GAH C;  3GTJ C;  3S1R K;  2GSN A;  3I4M C;  2R93 K;  1TWF C;  3K7A K;  1UV7 A;  4BLB A;  4LQY A;  5IP9 C;  5M3M K;  2NVQ C;  3V4G A;  4YFK A;  4LK1 A;  1INN A;  3VA7 A;  2E2J C;  2NVT K;  2PA8 L;  3S2H K;  4A3C C;  3M3Y K;  3S0X A;  1WOO A;  2XCQ A;  2CW0 A;  3GTQ A;  5IOS A;  1JVI A;  4QIW D;  1V5V A;  2ZFZ A;  4AYB L;  3M4O C;  3CQZ K;  5IYB K;  3HOZ K;  3L4J A;  1VGX A;  3Q3Q A;  4Y52 C;  4A3F K;  1I3Q C;  3H0G C;  4YG2 A;  1ZBS A;  1YNN A;  2V6U A;  2JA6 A;  3TFI A;  2JA8 K;  3MML B;  1SMY A;  1F7V A;  1Y1V C;  1F7U A;  2WAQ L;  3GTL C;  3BP8 C;  4GTB A;  3EQL A;  3M4O K;  1TWG A;  3S14 K;  5C3E C;  1G51 A;  3ADA C;  3AD9 C;  5C44 K;  4KB2 A;  5CHP A;  4C3H K;  4GFQ A;  4QJV A;  2JA7 A;  4G7H A;  1I50 C;  5IOQ A;  2W7V A;  3T00 A;  1K83 A;  3FOF A;  4P5A A;  2Y0S L;  4KAR A;  5JFE A;  4G0U A;  3S15 K;  2NVY K;  5IP7 C;  2R7Z K;  1WOS A;  4KAW X;  4LOW A;  3AD8 C;  2JA8 C;  3CQZ C;  1AB4 A;  3GTL A;  4WJ4 A;  1WQG A;  3HOW K;  1DCO A;  3L4K A;  4A3F C;  4Y52 K;  1EFW A;  1PJ5 A;  1F93 A;  1WCM A;  4LK0 A;  2JA5 K;  4LJZ A;  1TWA K;  5FLM C;  4YFN A;  1I3Q A;  3HOW C;  3HOX C;  2VUM A;  5IP9 K;  3JST A;  2R7Z C;  4LR2 A;  3N0B A;  1TWA C;  4BY1 K;  3GTM K;  2A68 A;  1J98 A;  3GTK A;  2NVT C;  4MEY A;  3S17 C;  3GTO A;  3ERE D;  1B4A A;  1BS2 A;  4XSZ A;  2B63 A;  3PO3 C;  3GTG K;  1C0A A;  1BGW A;  3RZO K;  1VRQ C;  1TWF K;  3K7A C;  4GTC A;  2NVQ K;  4J3N A;  2D6F C;  4KAS A;  3GTO C;  2WB1 D;  1EH1 A;  1F9N A;  2YU9 K;  3S2D C;  3GTJ A;  4OIO A;  5IYC C;  4GTL A;  1JOE A;  3AD7 C;  1ZXO A;  2E2I A;  4BKW A;  5CJ9 A;  1XXC A;  5M3F K;  4GTF A;  1ZYR A;  4GTE A;  4P9S A;  3AQP A;  5IYC K;  2CFA B;  2E2H C;  2GSO A;  3S14 C;  3I4N K;  2V6S A;  2NVX K;  1O29 A;  3FKI A;  4FM9 A;  3BUE A;  2A6H A;  2VUM C;  3ORE A;  3HOX K;  1Y1V K;  1IL2 A;  1R9T A;  1BJT A;  2Y0S D;  1SFO A;  3OEP A;  4A3G K;  3TFJ A;  3AH5 A;  1I50 K;  1O2A A; 
#chains in the Genus database with same CATH homology
 4P5B A;  4KM8 A;  4KMA A;  3CAG A;  5EGE A;  4KAT A;  4KB2 A;  4G0W A;  3GTG A;  4C2M C;  4KM9 A;  2R92 A;  5CHP A;  1TWF A;  2R93 A;  4GFQ A;  2XCR B;  4KB4 A;  1O26 A;  2JA7 A;  3N0C A;  3OPF A;  5IOQ A;  2Y3P A;  2YU9 A;  3G4C A;  1K83 A;  3FOF A;  4GT9 A;  4P5A A;  3LAP A;  1GE9 A;  4KAR A;  5JFE A;  4G0U A;  1O28 A;  1O24 A;  1TWH A;  5EGH A;  2RH6 A;  4KAW X;  4KMH A;  3CQZ A;  1AB4 A;  3GTL A;  1WQG A;  1O25 A;  4BLA A;  1EK8 A;  2P5M A;  3L4K A;  1XXA A;  1WCM A;  2NVX A;  3AQO A;  1WQF A;  3LPX A;  4KDD A;  1WQH A;  1I3Q A;  1KQ4 A;  3GTP A;  1Y1V A;  2VUM A;  3G4A A;  1WIH A;  1O2B A;  1ISE A;  1B4B A;  4LR2 A;  3N0B A;  3N3Y A;  2PHC B;  2RGR A;  3GTK A;  1I50 A;  4M1X A;  3GTO A;  3NUH A;  3ERE D;  1B4A A;  2B63 A;  2GSN A;  1BGW A;  5IOR A;  4C3J C;  4KMD A;  4BLB A;  4GTC A;  4LQY A;  4J3N A;  3V4G A;  1O27 A;  4KAS A;  3VA7 A;  3LAJ A;  1EH1 A;  1F9N A;  2KWA A;  5IOT A;  1IS1 A;  3GTJ A;  2NVY A;  3S0X A;  4ILD A;  2XCQ A;  2R7Z A;  4GTL A;  2XCO A;  5IOS A;  3GTQ A;  4KC6 A;  1ZVU A;  2ZFZ A;  1ZXO A;  2E2I A;  4BKW A;  5CJ9 A;  4C3H C;  1XXC A;  4GTF A;  3L4J A;  4GTD A;  4GTE A;  3Q3Q A;  1XXB A;  3FOE A;  3AQP A;  3QX3 A;  2CFA B;  3H0G A;  2GSO A;  2E2H A;  1ZBS A;  2JA5 A;  4DDQ A;  1O29 A;  3FKI A;  1TWA A;  2JA6 A;  1TWC A;  4G0V A;  3MML B;  4FM9 A;  1DD5 A;  3BUE A;  4FZB A;  4GTA A;  5JVO A;  3ORE A;  4C3I C;  2GSU A;  5TJ3 A;  4GTB A;  2JH3 A;  2CFA A;  1R9T A;  1BJT A;  3GTM A;  1SFO A;  3OEP A;  3FHZ A;  1TWG A;  1Y1W A;  3AH5 A;  1O2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...