5IYDK

Human core-pic in the initial transcribing state (no iis)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iydK00
4LK0A 1R9TK 3GTJK 4OIPA 3RZDK 3S16C 2R92C 3HKZD 5M5XK 4Y7NK 4XSZA 4A3GC 3GTKC 1TWGK 3K7AC 1TWCK 3DXJA 5IP7C 5IYBC 5C3EC 3S2DC 4BY7K 4AYBD 5IYCK 5C44C 4A3JC 3HOYK 4Q4ZA 3GTPK 4XSXA 4BY1K 4YFKA 4MEXA 3HOWK 1SFOK 5C4JK 4A3EC 4A3MK 2VUMC 3CQZC 5C4XK 3H3VL 4Y52C 3GTQK 5IP9C 2B63C 2NVQC 2A69A 1YNJA 4A3BC 2Y0SL 4BBSC 2E2JC 4X6AK 2PA8L 2NVTK 1I50C 3PO3K 3H3VD 3GTOC 3PO2C 1TWFK 2JA5K 3S1RC 4LK1A 3HOVK 1K83C 1Y1WC 1I6VA 3S2HC 2NVYC 4A3KC 3H0GC 2A6EA 2R7ZC 4OIRA 4A93C 1HQMA 4LJZA 2NVXC 4OIQA 4A3FK 2E2HC 4A3IK 3I4MK 1TWAK 1R9TC 3GTJC 3RZDC 3HOUC 1Y1VC 1I6HK 2A68A 4GZYA 2JA6K 4Y7NC 4A3CK 2JA7K 3S17K 2BE5A 1TWGC 3I4NK 1TWCC 4ZH4A 4A3DK 4BXXK 1ZYRA 2WB1L 5IYCC 3HOXK 5FLMK 2E2IC 3HOUK 3HOYC 3GTPC 4BY1C 3HOWC 4QJVB 5FJ8K 5C4JC 4A3MC 2R92K 3RZOC 5C4XC 2R93K 3EQLA 2YU9C 3GTQC 3S2DK 5IYDC 5IP7K 5IYBK 3HOZK 3S1NC 3GTMC 2CW0A 4A3JK 4G7OA 4X6AC 3M3YC 2NVTC 5TMCA 2Y0SD 4XLPA 3S14C 1IW7A 3M4OK 2PA8D 2VUMK 3CQZK 2JA5C 3S1MK 1TWHK 4Y52K 4YG2A 2JA8C 2NVQK 2O5JA 4LLGA 1BDFA 5TMFA 5M3MK 4YFNA 3GTGK 3M3YK 3S1NK 4A3BK 5D4DA 3GTLK 4C3IK 5M5WK 1WCMK 2WAQL 3FKIK 4MQ9A 4C2MK 3S1QK 4A3FC 4OINA 3GTOK 4NOIA 1K83K 1I3QK 4BBRK 3S2HK 4QIWL 4BY7C 4A3LK 2JA6C 3S15K 4A3CC 3HKZL 4Q5SA 1SFOC 2JA7C 3WODA 2WAQD 4C3HK 3S17C 3S16K 4BXXC 3HOXC 5FLMC 4A3GK 4KN4A 2PPBA 3GTKK 3K7AK 4OIOA 2WB1D 5C3EK 1Y1VK 5C44K 4G7ZA 2R93C 4JK1A 3PO3C 4A3EK 3HOZC 1TWFC 4MEYA 3HOVC 1YNNA 2O5IA 2E2IK 2A6HA 5IP9K 2B63K 3M4OC 4BBSK 2E2JK 4C3JK 2PMZL 3RZOK 3S1MC 5M5YK 1TWHC 2YU9K 1I50K 4KMUA 5IYDK 3PO2K 4A3IC 3GTGC 4XLNA 5M3FK 4G7HA 3S1RK 1Y1WK 1TWAC 4YFXA 3GTMK 3I4MC 2NVYK 3GTLC 1XPPA 4A3KK 1I6HC 3S14K 1SMYA 1WCMC 3FKIC 3H0GK 4QJVA 2PMZD 3S1QC 4A3DC 2R7ZK 3I4NC 4A93K 1I3QC 4BBRC 2NVXK 4KN7A 2JA8K 4A3LC 2E2HK 4AYBL 3S15C 4QIWD
chains in the Genus database with same CATH superfamily
1J98A 1R9TK 2KWAA 4OIPA 1VJEA 1KQ4A 3AD9C 3GTKC 3K7AC 4G0VA 5C3EC 1HI9A 4AYBD 5IYCK 4A3JC 4Q4ZA 1USOA 1YCLA 3T01A 4KB2A 5C4XK 3H3VL 1XZQA 1WCMA 3JSTA 3NUHA 2NVQC 4A3BC 4BBSC 2PA8L 2XCQA 4C2MC 2RH6A 3AH5A 2EBBA 3S1RC 3HOVK 3ADAC 3TFIA 1Y1WC 2NVYC 4GTDA 4A93C 1HQMA 4LJZA 4OIQA 1WQGA 2V6SA 1R9TC 3S0XA 2A68A 2VUMA 4GTEA 2JA6K 4A3CK 1JOEA 2BE5A 1XZPB 4KM9A 2B63A 1GE9A 3A8KA 4BXXK 1ZYRA 3BP3A 5IYCC 3HOXK 4FM9A 2R92K 5C4XC 2CFAB 2V6UA 2YU9C 1DCPA 3GTMC 5JFEA 4YG2A 1ZQ1C 3GEHA 2O5JA 3M3YK 3SZZA 3GSIA 1WCMK 1JVIA 4RMFA 3G4CA 1SFOA 4BBRK 1RU0A 2JA6C 4P9SA 4A3CC 2WAQD 3S16K 1O2FB 4BXXC 3HOXC 2PPBA 1BGWA 1J6XA 2JA5A 5IOTA 5IOQA 4A3EK 1YNNA 1VRQC 2B63K 2E2JK 4LR2A 2PMZL 3N0BA 3L4JA 4KMUA 1XZPA 4KATA 3PO2K 4A3IC 3M3YC 4XLNA 4G7HA 1TWAC 3CAGA 1XPPA 3S14K 1WCMC 2CFAA 4BBRC 2GSNA 3BUEA 3BP8C 2JA8K 3HOUC 4QIWD 1ZBSA 1G51A 3A8IA 3S16C 3HKZD 3MMLB 1F7UA 1IBAA 1XXCA 5IYBC 1L0WA 4BY7K 1X31C 4XSXA 4MEXA 1SFOK 5C4JK 4A3EC 2VUMC 1PJ5A 4LQYA 2B63C 2A69A 2Y0SL 2E2JC 1AB4A 5TJ3A 4C3IC 1I3QA 3VA7A 3PO3K 3H3VD 3GTOC 3AQOA 3PO2C 2JA5K 4KM8A 1WQHA 3ERED 2A6EA 4P5AA 4OIRA 3HXAA 3I4MK 3OREA 4M1XA 1I6HK 4GTFA 2XCRB 2XCOA 4A3DK 3I4NK 2WB1L 2E2IC 2RGRA 1I50A 5C4JC 3RZOC 3EQLA 5E68A 4KARA 3S2DK 5IYDC 5IP7K 3GEEA 3H0GA 3S1NC 3TTGA 2R7ZA 3M4OK 5TMCA 4XLPA 2NVXA 2P8TA 1IW7A 3T00A 3CQZK 2JA5C 3N3YA 4Y52K 4GT9A 4KDDA 5TMFA 1BDFA 1XXAA 5M3MK 4YFNA 1O28A 5D4DA 3SZYA 2ZUFA 4MQ9A 1ZVUA 1K83K 1I3QK 3S2HK 1XXBA 4C3HK 2GSUA 4A3GK 1Y1VK 5C44K 1TWFA 4G7ZA 1WIHA 4MEYA 1BS2A 2V6TA 2Y3PA 3HOVC 3M4OC 4C3JK 1I50K 5M3FK 4WJ3M 1YX2A 1O24A 1ISEA 3H0GK 2PMZD 2R7ZK 2P5MA 1I3QC 3Q3QA 2NVXK 1F7VA 2D6FC 4KMHA 4LK0A 2PHCB 4C3HC 2R92C 5M5XK 4Y7NK 4XSZA 4A3GC 3N0CA 1J6WA 5C44C 4BY1K 3HOWK 1EK8A 4BLAA 1BJTA 4A3MK 3GTGA 1PJ6A 3L4KA 3FKIA 1WOPA 1YNJA 4XCHA 1WORA 1IL2A 4X6AK 4GFQA 1I50C 3IPJA 1TWFK 3G4AA 4LK1A 1I6VA 3H0GC 3LPXA 1ZXOA 4PAAA 4O2DA 2R7ZC 2GAGC 2NVXC 4DDQA 4A3FK 3CQZA 4GZYA 4Y7NC 2ZUEA 3V4GA 4BY1C 3HOWC 4GTAA 5FJ8K 4A3MC 3GTMA 1K83A 2GSOA 3FOFA 4KMAA 4FZBA 3HOZK 4A3JK 4G7OA 4X6AC 3GEIA 3S14C 1F9NA 2PA8D 1B4BA 2E2HA 3S1MK 3QX3A 2FQTA 1O29A 3GTJA 1Y1VA 2JA8C 2NVQK 4KAWX 4LLGA 3GTGK 4A3BK 1JQWA 1TWGA 1TWCA 3AD7C 3FKIK 4C2MK 3S1QK 4A3FC 4OINA 3GTPA 1DD5A 1O26A 4GTLA 1VLOA 4QIWL 4BY7C 4A3LK 3LAPA 4Q5SA 3HKZL 3GTQA 1SFOC 3WODA 5IOSA 3FHZA 1DCOA 4KN4A 1INNA 2GAHC 4JK1A 3PO3C 3HOZC 4BLBA 2O5IA 4WJ4A 2A6HA 5IP9K 3S1MC 1TWAA 2YU9K 1VGXA 3GTGC 3GTMK 3I4MC 4C45A 4YFXA 2JA7A 3A8JA 3AD8C 4A3KK 1I6HC 1SMYA 3FKIC 4KASA 3S1QC 4A3DC 1WSVA 3I4NC 4J3NA 4A3LC 2E2HK 2R93A 4AYBL 4LOWA 2W7VA 5IORA 3GTJK 3RZDK 3LAJA 1TWGK 3S2DC 1TWCK 1WSRA 3DXJA 5IP7C 3HOYK 3OPFA 3GTPK 1TWHA 4YFKA 3CQZC 5JVOA 4Y52C 3GTQK 1WQFA 3GTLA 5IP9C 4GTBA 1O25A 3GTOA 1IS1A 2NVTK 3GIRA 5CJ9A 1WOSA 4P5BA 5EGEA 1K83C 1O27A 3S2HC 1J6VA 4A3KC 3TFJA 3GTKA 4PABA 4G0UA 2E2HC 4A3IK 1TWAK 3GTJC 3RZDC 1Y1VC 1B4AA 2E2IA 2JA7K 3S17K 1IE0A 1TWGC 1TWCC 4ZH4A 3HOYC 5FLMK 5HL8A 3HOUK 3GTPC 1EFWA 4QJVB 4KMDA 5EGHA 4C3JC 2R93K 1Y1WA 3GTQC 1O2BA 2NVYA 5IYBK 2CW0A 2NVTC 2Y0SD 2ZFZA 2VUMK 1EQRA 1EI6A 1TWHK 3AQPA 5L46A 1R9TA 1PJ7A 4BKWA 3GTLK 4C3IK 1WOOA 2WAQL 5M5WK 3GTOK 4NOIA 1C0AA 1XZQB 1O2AA 3FOEA 2YU9A 3S15K 2JA7C 3S17C 4WILA 4ILDA 5FLMC 3GTKK 3K7AK 4OIOA 4G0WA 2WB1D 5C3EK 2FQOA 1VH2A 2R93C 4AH6A 1TWFC 1UV7A 1USMA 2E2IK 2JH3A 5CHPA 1V5VA 1F93A 4KC6A 4BBSK 4KB4A 3RZOK 1EH1A 5M5YK 1TWHC 3GDZA 5IYDK 2JA6A 3S1NK 3S1RK 3OEPA 1Y1WK 3TFHA 2NVYK 3GTLC 4QJVA 1DCHA 3T02A 1IQ0A 4A93K 4KN7A 4GTCA 2R92A 3S15C
chains in the Genus database with same CATH topology
4LK0A 1R9TK 3GTJK 4OIPA 3RZDK 3S16C 2R92C 3HKZD 5M5XK 4Y7NK 4XSZA 4A3GC 3GTKC 1TWGK 3K7AC 1TWCK 3DXJA 5IP7C 5IYBC 5C3EC 3S2DC 4BY7K 4AYBD 5IYCK 5C44C 4A3JC 3HOYK 4Q4ZA 3GTPK 4XSXA 4BY1K 4YFKA 4MEXA 3HOWK 1SFOK 5C4JK 4A3EC 4A3MK 2VUMC 3CQZC 5C4XK 3H3VL 4Y52C 3GTQK 5IP9C 2B63C 2NVQC 2A69A 1YNJA 4A3BC 2Y0SL 4BBSC 2E2JC 4X6AK 2PA8L 2NVTK 1I50C 3PO3K 3H3VD 3GTOC 3PO2C 1TWFK 2JA5K 3S1RC 4LK1A 3HOVK 1K83C 1Y1WC 1I6VA 3S2HC 2NVYC 4A3KC 3H0GC 2A6EA 2R7ZC 4OIRA 4A93C 1HQMA 4LJZA 2NVXC 4OIQA 4A3FK 2E2HC 4A3IK 3I4MK 1TWAK 1R9TC 3GTJC 3RZDC 3HOUC 1Y1VC 1I6HK 2A68A 4GZYA 2JA6K 4Y7NC 4A3CK 2JA7K 3S17K 2BE5A 1TWGC 3I4NK 1TWCC 4ZH4A 4A3DK 4BXXK 1ZYRA 2WB1L 5IYCC 3HOXK 5FLMK 2E2IC 3HOUK 3HOYC 3GTPC 4BY1C 3HOWC 4QJVB 5FJ8K 5C4JC 4A3MC 2R92K 3RZOC 5C4XC 2R93K 3EQLA 2YU9C 3GTQC 3S2DK 5IYDC 5IP7K 5IYBK 3HOZK 3S1NC 3GTMC 2CW0A 4A3JK 4G7OA 4X6AC 3M3YC 2NVTC 5TMCA 2Y0SD 4XLPA 3S14C 1IW7A 3M4OK 2PA8D 2VUMK 3CQZK 2JA5C 3S1MK 1TWHK 4Y52K 4YG2A 2JA8C 2NVQK 2O5JA 4LLGA 1BDFA 5TMFA 5M3MK 4YFNA 3GTGK 3M3YK 3S1NK 4A3BK 5D4DA 3GTLK 4C3IK 5M5WK 1WCMK 2WAQL 3FKIK 4MQ9A 4C2MK 3S1QK 4A3FC 4OINA 3GTOK 4NOIA 1K83K 1I3QK 4BBRK 3S2HK 4QIWL 4BY7C 4A3LK 2JA6C 3S15K 4A3CC 3HKZL 4Q5SA 1SFOC 2JA7C 3WODA 2WAQD 4C3HK 3S17C 3S16K 4BXXC 3HOXC 5FLMC 4A3GK 4KN4A 2PPBA 3GTKK 3K7AK 4OIOA 2WB1D 5C3EK 1Y1VK 5C44K 4G7ZA 2R93C 4JK1A 3PO3C 4A3EK 3HOZC 1TWFC 4MEYA 3HOVC 1YNNA 2O5IA 2E2IK 2A6HA 5IP9K 2B63K 3M4OC 4BBSK 2E2JK 4C3JK 2PMZL 3RZOK 3S1MC 5M5YK 1TWHC 2YU9K 1I50K 4KMUA 5IYDK 3PO2K 4A3IC 3GTGC 4XLNA 5M3FK 4G7HA 3S1RK 1Y1WK 1TWAC 4YFXA 3GTMK 3I4MC 2NVYK 3GTLC 1XPPA 4A3KK 1I6HC 3S14K 1SMYA 1WCMC 3FKIC 3H0GK 4QJVA 2PMZD 3S1QC 4A3DC 2R7ZK 3I4NC 4A93K 1I3QC 4BBRC 2NVXK 4KN7A 2JA8K 4A3LC 2E2HK 4AYBL 3S15C 4QIWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 A;  1R9T K;  3GTJ K;  4OIP A;  3RZD K;  3S16 C;  2R92 C;  3HKZ D;  5M5X K;  4Y7N K;  4XSZ A;  4A3G C;  3GTK C;  1TWG K;  3K7A C;  1TWC K;  3DXJ A;  5IP7 C;  5IYB C;  5C3E C;  3S2D C;  4BY7 K;  4AYB D;  5IYC K;  5C44 C;  4A3J C;  3HOY K;  4Q4Z A;  3GTP K;  4XSX A;  4BY1 K;  4YFK A;  4MEX A;  3HOW K;  1SFO K;  5C4J K;  4A3E C;  4A3M K;  2VUM C;  3CQZ C;  5C4X K;  3H3V L;  4Y52 C;  3GTQ K;  5IP9 C;  2B63 C;  2NVQ C;  2A69 A;  1YNJ A;  4A3B C;  2Y0S L;  4BBS C;  2E2J C;  4X6A K;  2PA8 L;  2NVT K;  1I50 C;  3PO3 K;  3H3V D;  3GTO C;  3PO2 C;  1TWF K;  2JA5 K;  3S1R C;  4LK1 A;  3HOV K;  1K83 C;  1Y1W C;  1I6V A;  3S2H C;  2NVY C;  4A3K C;  3H0G C;  2A6E A;  2R7Z C;  4OIR A;  4A93 C;  1HQM A;  4LJZ A;  2NVX C;  4OIQ A;  4A3F K;  2E2H C;  4A3I K;  3I4M K;  1TWA K;  1R9T C;  3GTJ C;  3RZD C;  3HOU C;  1Y1V C;  1I6H K;  2A68 A;  4GZY A;  2JA6 K;  4Y7N C;  4A3C K;  2JA7 K;  3S17 K;  2BE5 A;  1TWG C;  3I4N K;  1TWC C;  4ZH4 A;  4A3D K;  4BXX K;  1ZYR A;  2WB1 L;  5IYC C;  3HOX K;  5FLM K;  2E2I C;  3HOU K;  3HOY C;  3GTP C;  4BY1 C;  3HOW C;  4QJV B;  5FJ8 K;  5C4J C;  4A3M C;  2R92 K;  3RZO C;  5C4X C;  2R93 K;  3EQL A;  2YU9 C;  3GTQ C;  3S2D K;  5IYD C;  5IP7 K;  5IYB K;  3HOZ K;  3S1N C;  3GTM C;  2CW0 A;  4A3J K;  4G7O A;  4X6A C;  3M3Y C;  2NVT C;  5TMC A;  2Y0S D;  4XLP A;  3S14 C;  1IW7 A;  3M4O K;  2PA8 D;  2VUM K;  3CQZ K;  2JA5 C;  3S1M K;  1TWH K;  4Y52 K;  4YG2 A;  2JA8 C;  2NVQ K;  2O5J A;  4LLG A;  1BDF A;  5TMF A;  5M3M K;  4YFN A;  3GTG K;  3M3Y K;  3S1N K;  4A3B K;  5D4D A;  3GTL K;  4C3I K;  5M5W K;  1WCM K;  2WAQ L;  3FKI K;  4MQ9 A;  4C2M K;  3S1Q K;  4A3F C;  4OIN A;  3GTO K;  4NOI A;  1K83 K;  1I3Q K;  4BBR K;  3S2H K;  4QIW L;  4BY7 C;  4A3L K;  2JA6 C;  3S15 K;  4A3C C;  3HKZ L;  4Q5S A;  1SFO C;  2JA7 C;  3WOD A;  2WAQ D;  4C3H K;  3S17 C;  3S16 K;  4BXX C;  3HOX C;  5FLM C;  4A3G K;  4KN4 A;  2PPB A;  3GTK K;  3K7A K;  4OIO A;  2WB1 D;  5C3E K;  1Y1V K;  5C44 K;  4G7Z A;  2R93 C;  4JK1 A;  3PO3 C;  4A3E K;  3HOZ C;  1TWF C;  4MEY A;  3HOV C;  1YNN A;  2O5I A;  2E2I K;  2A6H A;  5IP9 K;  2B63 K;  3M4O C;  4BBS K;  2E2J K;  4C3J K;  2PMZ L;  3RZO K;  3S1M C;  5M5Y K;  1TWH C;  2YU9 K;  1I50 K;  4KMU A;  5IYD K;  3PO2 K;  4A3I C;  3GTG C;  4XLN A;  5M3F K;  4G7H A;  3S1R K;  1Y1W K;  1TWA C;  4YFX A;  3GTM K;  3I4M C;  2NVY K;  3GTL C;  1XPP A;  4A3K K;  1I6H C;  3S14 K;  1SMY A;  1WCM C;  3FKI C;  3H0G K;  4QJV A;  2PMZ D;  3S1Q C;  4A3D C;  2R7Z K;  3I4N C;  4A93 K;  1I3Q C;  4BBR C;  2NVX K;  4KN7 A;  2JA8 K;  4A3L C;  2E2H K;  4AYB L;  3S15 C;  4QIW D; 
#chains in the Genus database with same CATH topology
 1J98 A;  1R9T K;  2KWA A;  4OIP A;  1VJE A;  1KQ4 A;  3AD9 C;  3GTK C;  3K7A C;  4G0V A;  5C3E C;  1HI9 A;  4AYB D;  5IYC K;  4A3J C;  4Q4Z A;  1USO A;  1YCL A;  3T01 A;  4KB2 A;  5C4X K;  3H3V L;  1XZQ A;  1WCM A;  3JST A;  3NUH A;  2NVQ C;  4A3B C;  4BBS C;  2PA8 L;  2XCQ A;  4C2M C;  2RH6 A;  3AH5 A;  2EBB A;  3S1R C;  3HOV K;  3ADA C;  3TFI A;  1Y1W C;  2NVY C;  4GTD A;  4A93 C;  1HQM A;  4LJZ A;  4OIQ A;  1WQG A;  2V6S A;  1R9T C;  3S0X A;  2A68 A;  2VUM A;  4GTE A;  2JA6 K;  4A3C K;  1JOE A;  2BE5 A;  1XZP B;  4KM9 A;  2B63 A;  1GE9 A;  3A8K A;  4BXX K;  1ZYR A;  3BP3 A;  5IYC C;  3HOX K;  4FM9 A;  2R92 K;  5C4X C;  2CFA B;  2V6U A;  2YU9 C;  1DCP A;  3GTM C;  5JFE A;  4YG2 A;  1ZQ1 C;  3GEH A;  2O5J A;  3M3Y K;  3SZZ A;  3GSI A;  1WCM K;  1JVI A;  4RMF A;  3G4C A;  1SFO A;  4BBR K;  1RU0 A;  2JA6 C;  4P9S A;  4A3C C;  2WAQ D;  3S16 K;  1O2F B;  4BXX C;  3HOX C;  2PPB A;  1BGW A;  1J6X A;  2JA5 A;  5IOT A;  5IOQ A;  4A3E K;  1YNN A;  1VRQ C;  2B63 K;  2E2J K;  4LR2 A;  2PMZ L;  3N0B A;  3L4J A;  4KMU A;  1XZP A;  4KAT A;  3PO2 K;  4A3I C;  3M3Y C;  4XLN A;  4G7H A;  1TWA C;  3CAG A;  1XPP A;  3S14 K;  1WCM C;  2CFA A;  4BBR C;  2GSN A;  3BUE A;  3BP8 C;  2JA8 K;  3HOU C;  4QIW D;  1ZBS A;  1G51 A;  3A8I A;  3S16 C;  3HKZ D;  3MML B;  1F7U A;  1IBA A;  1XXC A;  5IYB C;  1L0W A;  4BY7 K;  1X31 C;  4XSX A;  4MEX A;  1SFO K;  5C4J K;  4A3E C;  2VUM C;  1PJ5 A;  4LQY A;  2B63 C;  2A69 A;  2Y0S L;  2E2J C;  1AB4 A;  5TJ3 A;  4C3I C;  1I3Q A;  3VA7 A;  3PO3 K;  3H3V D;  3GTO C;  3AQO A;  3PO2 C;  2JA5 K;  4KM8 A;  1WQH A;  3ERE D;  2A6E A;  4P5A A;  4OIR A;  3HXA A;  3I4M K;  3ORE A;  4M1X A;  1I6H K;  4GTF A;  2XCR B;  2XCO A;  4A3D K;  3I4N K;  2WB1 L;  2E2I C;  2RGR A;  1I50 A;  5C4J C;  3RZO C;  3EQL A;  5E68 A;  4KAR A;  3S2D K;  5IYD C;  5IP7 K;  3GEE A;  3H0G A;  3S1N C;  3TTG A;  2R7Z A;  3M4O K;  5TMC A;  4XLP A;  2NVX A;  2P8T A;  1IW7 A;  3T00 A;  3CQZ K;  2JA5 C;  3N3Y A;  4Y52 K;  4GT9 A;  4KDD A;  5TMF A;  1BDF A;  1XXA A;  5M3M K;  4YFN A;  1O28 A;  5D4D A;  3SZY A;  2ZUF A;  4MQ9 A;  1ZVU A;  1K83 K;  1I3Q K;  3S2H K;  1XXB A;  4C3H K;  2GSU A;  4A3G K;  1Y1V K;  5C44 K;  1TWF A;  4G7Z A;  1WIH A;  4MEY A;  1BS2 A;  2V6T A;  2Y3P A;  3HOV C;  3M4O C;  4C3J K;  1I50 K;  5M3F K;  4WJ3 M;  1YX2 A;  1O24 A;  1ISE A;  3H0G K;  2PMZ D;  2R7Z K;  2P5M A;  1I3Q C;  3Q3Q A;  2NVX K;  1F7V A;  2D6F C;  4KMH A;  4LK0 A;  2PHC B;  4C3H C;  2R92 C;  5M5X K;  4Y7N K;  4XSZ A;  4A3G C;  3N0C A;  1J6W A;  5C44 C;  4BY1 K;  3HOW K;  1EK8 A;  4BLA A;  1BJT A;  4A3M K;  3GTG A;  1PJ6 A;  3L4K A;  3FKI A;  1WOP A;  1YNJ A;  4XCH A;  1WOR A;  1IL2 A;  4X6A K;  4GFQ A;  1I50 C;  3IPJ A;  1TWF K;  3G4A A;  4LK1 A;  1I6V A;  3H0G C;  3LPX A;  1ZXO A;  4PAA A;  4O2D A;  2R7Z C;  2GAG C;  2NVX C;  4DDQ A;  4A3F K;  3CQZ A;  4GZY A;  4Y7N C;  2ZUE A;  3V4G A;  4BY1 C;  3HOW C;  4GTA A;  5FJ8 K;  4A3M C;  3GTM A;  1K83 A;  2GSO A;  3FOF A;  4KMA A;  4FZB A;  3HOZ K;  4A3J K;  4G7O A;  4X6A C;  3GEI A;  3S14 C;  1F9N A;  2PA8 D;  1B4B A;  2E2H A;  3S1M K;  3QX3 A;  2FQT A;  1O29 A;  3GTJ A;  1Y1V A;  2JA8 C;  2NVQ K;  4KAW X;  4LLG A;  3GTG K;  4A3B K;  1JQW A;  1TWG A;  1TWC A;  3AD7 C;  3FKI K;  4C2M K;  3S1Q K;  4A3F C;  4OIN A;  3GTP A;  1DD5 A;  1O26 A;  4GTL A;  1VLO A;  4QIW L;  4BY7 C;  4A3L K;  3LAP A;  4Q5S A;  3HKZ L;  3GTQ A;  1SFO C;  3WOD A;  5IOS A;  3FHZ A;  1DCO A;  4KN4 A;  1INN A;  2GAH C;  4JK1 A;  3PO3 C;  3HOZ C;  4BLB A;  2O5I A;  4WJ4 A;  2A6H A;  5IP9 K;  3S1M C;  1TWA A;  2YU9 K;  1VGX A;  3GTG C;  3GTM K;  3I4M C;  4C45 A;  4YFX A;  2JA7 A;  3A8J A;  3AD8 C;  4A3K K;  1I6H C;  1SMY A;  3FKI C;  4KAS A;  3S1Q C;  4A3D C;  1WSV A;  3I4N C;  4J3N A;  4A3L C;  2E2H K;  2R93 A;  4AYB L;  4LOW A;  2W7V A;  5IOR A;  3GTJ K;  3RZD K;  3LAJ A;  1TWG K;  3S2D C;  1TWC K;  1WSR A;  3DXJ A;  5IP7 C;  3HOY K;  3OPF A;  3GTP K;  1TWH A;  4YFK A;  3CQZ C;  5JVO A;  4Y52 C;  3GTQ K;  1WQF A;  3GTL A;  5IP9 C;  4GTB A;  1O25 A;  3GTO A;  1IS1 A;  2NVT K;  3GIR A;  5CJ9 A;  1WOS A;  4P5B A;  5EGE A;  1K83 C;  1O27 A;  3S2H C;  1J6V A;  4A3K C;  3TFJ A;  3GTK A;  4PAB A;  4G0U A;  2E2H C;  4A3I K;  1TWA K;  3GTJ C;  3RZD C;  1Y1V C;  1B4A A;  2E2I A;  2JA7 K;  3S17 K;  1IE0 A;  1TWG C;  1TWC C;  4ZH4 A;  3HOY C;  5FLM K;  5HL8 A;  3HOU K;  3GTP C;  1EFW A;  4QJV B;  4KMD A;  5EGH A;  4C3J C;  2R93 K;  1Y1W A;  3GTQ C;  1O2B A;  2NVY A;  5IYB K;  2CW0 A;  2NVT C;  2Y0S D;  2ZFZ A;  2VUM K;  1EQR A;  1EI6 A;  1TWH K;  3AQP A;  5L46 A;  1R9T A;  1PJ7 A;  4BKW A;  3GTL K;  4C3I K;  1WOO A;  2WAQ L;  5M5W K;  3GTO K;  4NOI A;  1C0A A;  1XZQ B;  1O2A A;  3FOE A;  2YU9 A;  3S15 K;  2JA7 C;  3S17 C;  4WIL A;  4ILD A;  5FLM C;  3GTK K;  3K7A K;  4OIO A;  4G0W A;  2WB1 D;  5C3E K;  2FQO A;  1VH2 A;  2R93 C;  4AH6 A;  1TWF C;  1UV7 A;  1USM A;  2E2I K;  2JH3 A;  5CHP A;  1V5V A;  1F93 A;  4KC6 A;  4BBS K;  4KB4 A;  3RZO K;  1EH1 A;  5M5Y K;  1TWH C;  3GDZ A;  5IYD K;  2JA6 A;  3S1N K;  3S1R K;  3OEP A;  1Y1W K;  3TFH A;  2NVY K;  3GTL C;  4QJV A;  1DCH A;  3T02 A;  1IQ0 A;  4A93 K;  4KN7 A;  4GTC A;  2R92 A;  3S15 C; 
#chains in the Genus database with same CATH homology
 4LK0 A;  1R9T K;  3GTJ K;  4OIP A;  3RZD K;  3S16 C;  2R92 C;  3HKZ D;  5M5X K;  4Y7N K;  4XSZ A;  4A3G C;  3GTK C;  1TWG K;  3K7A C;  1TWC K;  3DXJ A;  5IP7 C;  5IYB C;  5C3E C;  3S2D C;  4BY7 K;  4AYB D;  5IYC K;  5C44 C;  4A3J C;  3HOY K;  4Q4Z A;  3GTP K;  4XSX A;  4BY1 K;  4YFK A;  4MEX A;  3HOW K;  1SFO K;  5C4J K;  4A3E C;  4A3M K;  2VUM C;  3CQZ C;  5C4X K;  3H3V L;  4Y52 C;  3GTQ K;  5IP9 C;  2B63 C;  2NVQ C;  2A69 A;  1YNJ A;  4A3B C;  2Y0S L;  4BBS C;  2E2J C;  4X6A K;  2PA8 L;  2NVT K;  1I50 C;  3PO3 K;  3H3V D;  3GTO C;  3PO2 C;  1TWF K;  2JA5 K;  3S1R C;  4LK1 A;  3HOV K;  1K83 C;  1Y1W C;  1I6V A;  3S2H C;  2NVY C;  4A3K C;  3H0G C;  2A6E A;  2R7Z C;  4OIR A;  4A93 C;  1HQM A;  4LJZ A;  2NVX C;  4OIQ A;  4A3F K;  2E2H C;  4A3I K;  3I4M K;  1TWA K;  1R9T C;  3GTJ C;  3RZD C;  3HOU C;  1Y1V C;  1I6H K;  2A68 A;  4GZY A;  2JA6 K;  4Y7N C;  4A3C K;  2JA7 K;  3S17 K;  2BE5 A;  1TWG C;  3I4N K;  1TWC C;  4ZH4 A;  4A3D K;  4BXX K;  1ZYR A;  2WB1 L;  5IYC C;  3HOX K;  5FLM K;  2E2I C;  3HOU K;  3HOY C;  3GTP C;  4BY1 C;  3HOW C;  4QJV B;  5FJ8 K;  5C4J C;  4A3M C;  2R92 K;  3RZO C;  5C4X C;  2R93 K;  3EQL A;  2YU9 C;  3GTQ C;  3S2D K;  5IYD C;  5IP7 K;  5IYB K;  3HOZ K;  3S1N C;  3GTM C;  2CW0 A;  4A3J K;  4G7O A;  4X6A C;  3M3Y C;  2NVT C;  5TMC A;  2Y0S D;  4XLP A;  3S14 C;  1IW7 A;  3M4O K;  2PA8 D;  2VUM K;  3CQZ K;  2JA5 C;  3S1M K;  1TWH K;  4Y52 K;  4YG2 A;  2JA8 C;  2NVQ K;  2O5J A;  4LLG A;  1BDF A;  5TMF A;  5M3M K;  4YFN A;  3GTG K;  3M3Y K;  3S1N K;  4A3B K;  5D4D A;  3GTL K;  4C3I K;  5M5W K;  1WCM K;  2WAQ L;  3FKI K;  4MQ9 A;  4C2M K;  3S1Q K;  4A3F C;  4OIN A;  3GTO K;  4NOI A;  1K83 K;  1I3Q K;  4BBR K;  3S2H K;  4QIW L;  4BY7 C;  4A3L K;  2JA6 C;  3S15 K;  4A3C C;  3HKZ L;  4Q5S A;  1SFO C;  2JA7 C;  3WOD A;  2WAQ D;  4C3H K;  3S17 C;  3S16 K;  4BXX C;  3HOX C;  5FLM C;  4A3G K;  4KN4 A;  2PPB A;  3GTK K;  3K7A K;  4OIO A;  2WB1 D;  5C3E K;  1Y1V K;  5C44 K;  4G7Z A;  2R93 C;  4JK1 A;  3PO3 C;  4A3E K;  3HOZ C;  1TWF C;  4MEY A;  3HOV C;  1YNN A;  2O5I A;  2E2I K;  2A6H A;  5IP9 K;  2B63 K;  3M4O C;  4BBS K;  2E2J K;  4C3J K;  2PMZ L;  3RZO K;  3S1M C;  5M5Y K;  1TWH C;  2YU9 K;  1I50 K;  4KMU A;  5IYD K;  3PO2 K;  4A3I C;  3GTG C;  4XLN A;  5M3F K;  4G7H A;  3S1R K;  1Y1W K;  1TWA C;  4YFX A;  3GTM K;  3I4M C;  2NVY K;  3GTL C;  1XPP A;  4A3K K;  1I6H C;  3S14 K;  1SMY A;  1WCM C;  3FKI C;  3H0G K;  4QJV A;  2PMZ D;  3S1Q C;  4A3D C;  2R7Z K;  3I4N C;  4A93 K;  1I3Q C;  4BBR C;  2NVX K;  4KN7 A;  2JA8 K;  4A3L C;  2E2H K;  4AYB L;  3S15 C;  4QIW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...