5IYDK

Human core-pic in the initial transcribing state (no iis)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iydK00
3S15K 3PO2K 4G7OA 5FJ8K 3GTLC 2VUMK 5M5WK 4XSZA 2R92C 2PA8L 2WB1D 3HOYC 5IYDK 1TWCK 5C4JC 3HKZL 1SFOC 5FLMK 3S16C 2PA8D 2NVYK 4A3JK 5M3FK 3S1NK 3HKZD 2JA5K 4A93K 2YU9C 3I4NK 2PMZD 2E2HK 1WCMC 5IP9K 4A3EC 2R93C 4OIPA 1I3QC 3RZDK 2A69A 4A3FC 3FKIK 3HOUC 5IYCC 4A3DC 4BXXC 5C4XK 2Y0SL 1I6VA 4LK0A 4Y52C 3GTMK 3M4OK 2WAQL 3I4MC 4Q4ZA 3GTKC 5C3EC 2Y0SD 5M5XK 2JA6K 3CQZK 2PPBA 2B63K 4A3LK 1TWAK 2JA7K 3S2DK 4JK1A 5M3MK 4A3BK 2CW0A 1Y1WC 3GTPC 4G7ZA 5IYBK 3S17K 3PO2C 4OIRA 3GTQC 3S15C 3PO3K 2WB1L 2VUMC 4YFKA 5IP7K 1YNJA 5IYDC 4LLGA 4BBSK 4KN7A 2R7ZK 1TWCC 3S1QK 2NVXK 4XLNA 3WODA 1I6HC 5TMFA 2NVYC 1YNNA 2PMZL 4A3JC 3S1NC 1TWHC 2JA5C 4A93C 3I4NC 2E2HC 2E2IC 3HOZC 1I50C 3S14K 4C2MK 3H3VL 3S1MK 3RZDC 4BY7K 3K7AK 3FKIC 4BBRK 4MEXA 3H3VD 2JA8C 2BE5A 3GTMC 4Y7NK 3M4OC 3GTOK 4QIWL 3HOWC 3GTGK 3S2HK 4G7HA 3RZOK 2A68A 4KMUA 4QJVB 2JA6C 3CQZC 4QIWD 4A3LC 2B63C 1TWAC 1TWGC 3H0GC 4A3MK 2JA7C 4A3BC 5C44K 3S2DC 2E2JC 4QJVA 5IYBC 4YG2A 4XLPA 3PO3C 4A3GK 5IP7C 3HOVK 4BBSC 1SFOK 2R7ZC 3S16K 4YFXA 3S1QC 4C3HK 2NVXC 4BY1K 1R9TK 5FLMC 2O5IA 4A3KK 4OIQA 1IW7A 4A3CK 4C3IK 1TWFK 4LK1A 3GTJK 4X6AK 3S14C 2A6EA 5IP9C 3S1MC 3HOXK 3HOUK 4LJZA 4A3DK 4MQ9A 3K7AC 4BBRC 4Y52K 4C3JK 1XPPA 3I4MK 4Y7NC 5C4XC 5C3EK 3GTOC 1K83K 4A3IK 1BDFA 5D4DA 3GTGC 4NOIA 3RZOC 4MEYA 3DXJA 3S1RK 3S2HC 5M5YK 1Y1VK 4KN4A 3M3YK 4A3MC 5C44C 2NVQK 2NVTK 4Q5SA 3GTQK 4XSXA 2A6HA 4A3GC 4AYBL 3GTLK 3S17C 1SMYA 3HOVC 2R92K 3HOYK 1I6HK 2O5JA 1ZYRA 4AYBD 5C4JK 4BY1C 5TMCA 4OIOA 1R9TC 1HQMA 1TWHK 4A3KC 4A3CC 2YU9K 2E2IK 3HOZK 1TWFC 1I50K 3GTJC 4X6AC 1WCMK 4A3EK 4YFNA 2R93K 4ZH4A 1I3QK 3EQLA 3HOXC 4A3FK 2JA8K 5IYCK 4BY7C 4BXXK 3HOWK 1K83C 4A3IC 3GTKK 4GZYA 3S1RC 2WAQD 1TWGK 1Y1VC 3H0GK 4OINA 3M3YC 2E2JK 2NVQC 2NVTC 1Y1WK 3GTPK
chains in the Genus database with same CATH superfamily
4KC6A 4G7OA 1V5VA 4BLAA 2VUMK 2D6FC 2R92C 4ILDA 5EGHA 3HOYC 4KAWX 5FLMK 2ZFZA 3S1NK 4A93K 1IE0A 1INNA 4KM9A 2E2HK 5IP9K 4A3EC 3GTOA 4OIPA 3AD7C 3GTGA 3RZDK 2A69A 5TJ3A 3GDZA 1PJ7A 5L46A 4BXXC 1USOA 1I6VA 2Y0SL 4KMAA 3QX3A 5C3EC 4O2DA 1J98A 2RH6A 5M5XK 2R92A 2CFAB 3CQZK 4KB2A 4A3LK 4KATA 3S17K 3PO3K 2WB1L 4FZBA 4YFKA 3HXAA 1USMA 1TWFA 3GTJA 2NVXK 1IQ0A 1YNNA 2PMZL 1TWHC 4G0VA 1K83A 3VA7A 4WJ3M 3K7AK 1B4AA 1RU0A 3GTMC 2RGRA 3GTOK 3GTGK 3RZOK 3JSTA 3GTLA 3BP8C 4QIWD 1TWAC 1TWGC 2JA7C 2E2JC 1XXCA 1YCLA 4QJVA 4XLPA 1TWHA 3HOVK 1DCOA 2R7ZC 3S1QC 3NUHA 2R93A 1EK8A 3AQOA 3GEIA 4A3KK 5IORA 1WORA 1TWFK 3GTJK 1PJ6A 3S14C 1O2AA 4C2MC 4G0UA 1HI9A 1F9NA 1TWGA 2JA7A 4P5BA 2KWAA 1O28A 5JFEA 5C4XC 5C3EK 1K83K 3GTPA 3DXJA 4GT9A 1DD5A 1B4BA 3GTLK 3FOEA 1SMYA 5CHPA 3SZZA 4BY1C 5TMCA 4OIOA 1HQMA 1TWHK 4A3CC 3FKIA 1XXBA 2R93K 3HOXC 4BKWA 5HL8A 2JA6A 5IYCK 3AQPA 1BS2A 3IPJA 3GTKK 4GFQA 4KDDA 4GZYA 3S1RC 2WAQD 1TWGK 4OINA 1O25A 2E2JK 4G0WA 1XXAA 3GTPK 3S15K 3PO2K 5FJ8K 2FQTA 4LQYA 5IYDK 1SFOC 2PA8D 4A3JK 3T01A 2YU9C 3AH5A 4PAAA 2JH3A 5CJ9A 3G4CA 1I3QC 5JVOA 3FKIK 3N0BA 5C4XK 4LK0A 3M4OK 1WQHA 1J6WA 5IOQA 2P5MA 2JA6K 3S2DK 5M3MK 1SFOA 5IYBK 3ADAC 2YU9A 4KMDA 5IP7K 1J6XA 4LLGA 4KN7A 1TWCC 1I6HC 1I3QA 3G4AA 2NVYC 2JA5C 3I4NC 3AD8C 1EFWA 2E2IC 3HOZC 4M1XA 1JVIA 3S1MK 3OPFA 1F93A 1Y1VA 3H3VD 4QIWL 3S2HK 5E68A 1ZBSA 4QJVB 3A8KA 4GTCA 2B63C 1TWCA 4A3MK 1O2BA 4A3BC 5C44K 2V6TA 3N3YA 4YG2A 2JA5A 2E2IA 4BBSC 1SFOK 3A8IA 1XZPA 3Q3QA 4GTBA 4AH6A 1IL2A 4C3IK 1KQ4A 1EQRA 1O27A 4BBRC 3GIRA 4Y7NC 4A3IK 1ZXOA 1YX2A 5M5YK 1Y1VK 4KN4A 3M3YK 2NVQK 4Q5SA 2A6HA 4A3GC 2R92K 4DDQA 3HOYK 1I6HK 4AYBD 1F7UA 3S0XA 3TFJA 1R9TC 3OREA 2ZUEA 2E2IK 3HOZK 1GE9A 1IS1A 3GTMA 4X6AC 4A3EK 3LAJA 4ZH4A 3T02A 4BY7C 4BXXK 1TWAA 4C3JC 1BJTA 1VJEA 2R7ZA 2NVTC 5EGEA 5M5WK 1XZQA 2PA8L 2WB1D 5C4JC 1O29A 3HKZD 2PMZD 1WCMC 3BP3A 1O26A 2W7VA 4A3FC 3GTMK 3I4MC 4Q4ZA 3V4GA 2PPBA 1TWAK 2JA7K 4JK1A 2CW0A 4P9SA 3AD9C 1Y1WC 3TTGA 4G7ZA 4OIRA 3GTQC 2V6UA 2VUMC 1VH2A 2R7ZK 4KMHA 3S1QK 3WODA 3LPXA 5TMFA 3S1NC 4A93C 2P8TA 2E2HC 1WSRA 4KARA 1I50C 3S14K 4C2MK 3H3VL 3RZDC 4BY7K 4MEXA 1ZQ1C 1ZVUA 2JA8C 3HOWC 3GTQA 4G7HA 2A68A 3CQZC 4GTFA 3N0CA 4A3LC 1EI6A 3H0GC 4C45A 1JOEA 1XZPB 3PO3C 4PABA 1I50A 2NVXC 4BY1K 2O5IA 4A3CK 4P5AA 4LK1A 4GTAA 2A6EA 3HOXK 2Y3PA 3K7AC 3H0GA 1AB4A 3T00A 3I4MK 3GTOC 1BDFA 3GTGC 4NOIA 3RZOC 4MEYA 3FOFA 3S1RK 2NVXA 1WQGA 4KB4A 3GTQK 1F7VA 4AYBL 2NVYA 3HOVC 4KASA 2V6SA 2O5JA 1ZYRA 2GSOA 4A3KC 1X31C 2YU9K 1TWFC 1I50K 3GTJC 1WIHA 4WILA 1I3QK 2JA8K 2XCRB 2B63A 2GSUA 3TFIA 4RMFA 3HOWK 1K83C 3H0GK 1VRQC 1XZQB 1WOSA 3GTLC 4XSZA 1TWCK 3HKZL 1DCHA 3S16C 4C3HC 2EBBA 2NVYK 5M3FK 2JA5K 3I4NK 1PJ5A 1EH1A 1J6VA 1WQFA 2R93C 4J3NA 3HOUC 4XCHA 5IYCC 4A3DC 1IBAA 3A8JA 4Y52C 3GSIA 1G51A 2WAQL 3GTKC 2PHCB 3SZYA 2Y0SD 3L4KA 4GTDA 4FM9A 3FHZA 2B63K 3GEEA 4A3BK 3GTPC 1WOPA 3S15C 3PO2C 2CFAA 1R9TA 1C0AA 1YNJA 5IYDC 4BBSK 4XLNA 4A3JC 4BLBA 3GTKA 2FQOA 1VGXA 3BUEA 4BBRK 3FKIC 2ZUFA 2BE5A 4Y7NK 3M4OC 3MMLB 4KMUA 2JA6C 3S2DC 2GSNA 5IYBC 4A3GK 5IP7C 1UV7A 3S16K 4YFXA 1WCMA 4C3HK 2GAGC 4WJ4A 1L0WA 1R9TK 5FLMC 3ERED 4OIQA 1IW7A 4X6AK 1JQWA 1DCPA 5IP9C 1ISEA 3S1MC 3HOUK 4LJZA 4KM8A 4A3DK 4LR2A 4MQ9A 4Y52K 2GAHC 4C3JK 1XPPA 1Y1WA 5D4DA 3S2HC 4LOWA 2VUMA 1WOOA 4A3MC 5C44C 2NVTK 1WSVA 1BGWA 5IOSA 2XCOA 4XSXA 3S17C 2XCQA 1VLOA 2E2HA 5C4JK 4GTEA 3TFHA 4GTLA 4C3IC 3GEHA 3LAPA 1WCMK 1O24A 4YFNA 3EQLA 4A3FK 3CQZA 1O2FB 3OEPA 5IOTA 3L4JA 4A3IC 3CAGA 1Y1VC 3M3YC 2NVQC 1Y1WK
chains in the Genus database with same CATH topology
3S15K 3PO2K 4G7OA 5FJ8K 3GTLC 2VUMK 5M5WK 4XSZA 2R92C 2PA8L 2WB1D 3HOYC 5IYDK 1TWCK 5C4JC 3HKZL 1SFOC 5FLMK 3S16C 2PA8D 2NVYK 4A3JK 5M3FK 3S1NK 3HKZD 2JA5K 4A93K 2YU9C 3I4NK 2PMZD 2E2HK 1WCMC 5IP9K 4A3EC 2R93C 4OIPA 1I3QC 3RZDK 2A69A 4A3FC 3FKIK 3HOUC 5IYCC 4A3DC 4BXXC 5C4XK 2Y0SL 1I6VA 4LK0A 4Y52C 3GTMK 3M4OK 2WAQL 3I4MC 4Q4ZA 3GTKC 5C3EC 2Y0SD 5M5XK 2JA6K 3CQZK 2PPBA 2B63K 4A3LK 1TWAK 2JA7K 3S2DK 4JK1A 5M3MK 4A3BK 2CW0A 1Y1WC 3GTPC 4G7ZA 5IYBK 3S17K 3PO2C 4OIRA 3GTQC 3S15C 3PO3K 2WB1L 2VUMC 4YFKA 5IP7K 1YNJA 5IYDC 4LLGA 4BBSK 4KN7A 2R7ZK 1TWCC 3S1QK 2NVXK 4XLNA 3WODA 1I6HC 5TMFA 2NVYC 1YNNA 2PMZL 4A3JC 3S1NC 1TWHC 2JA5C 4A93C 3I4NC 2E2HC 2E2IC 3HOZC 1I50C 3S14K 4C2MK 3H3VL 3S1MK 3RZDC 4BY7K 3K7AK 3FKIC 4BBRK 4MEXA 3H3VD 2JA8C 2BE5A 3GTMC 4Y7NK 3M4OC 3GTOK 4QIWL 3HOWC 3GTGK 3S2HK 4G7HA 3RZOK 2A68A 4KMUA 4QJVB 2JA6C 3CQZC 4QIWD 4A3LC 2B63C 1TWAC 1TWGC 3H0GC 4A3MK 2JA7C 4A3BC 5C44K 3S2DC 2E2JC 4QJVA 5IYBC 4YG2A 4XLPA 3PO3C 4A3GK 5IP7C 3HOVK 4BBSC 1SFOK 2R7ZC 3S16K 4YFXA 3S1QC 4C3HK 2NVXC 4BY1K 1R9TK 5FLMC 2O5IA 4A3KK 4OIQA 1IW7A 4A3CK 4C3IK 1TWFK 4LK1A 3GTJK 4X6AK 3S14C 2A6EA 5IP9C 3S1MC 3HOXK 3HOUK 4LJZA 4A3DK 4MQ9A 3K7AC 4BBRC 4Y52K 4C3JK 1XPPA 3I4MK 4Y7NC 5C4XC 5C3EK 3GTOC 1K83K 4A3IK 1BDFA 5D4DA 3GTGC 4NOIA 3RZOC 4MEYA 3DXJA 3S1RK 3S2HC 5M5YK 1Y1VK 4KN4A 3M3YK 4A3MC 5C44C 2NVQK 2NVTK 4Q5SA 3GTQK 4XSXA 2A6HA 4A3GC 4AYBL 3GTLK 3S17C 1SMYA 3HOVC 2R92K 3HOYK 1I6HK 2O5JA 1ZYRA 4AYBD 5C4JK 4BY1C 5TMCA 4OIOA 1R9TC 1HQMA 1TWHK 4A3KC 4A3CC 2YU9K 2E2IK 3HOZK 1TWFC 1I50K 3GTJC 4X6AC 1WCMK 4A3EK 4YFNA 2R93K 4ZH4A 1I3QK 3EQLA 3HOXC 4A3FK 2JA8K 5IYCK 4BY7C 4BXXK 3HOWK 1K83C 4A3IC 3GTKK 4GZYA 3S1RC 2WAQD 1TWGK 1Y1VC 3H0GK 4OINA 3M3YC 2E2JK 2NVQC 2NVTC 1Y1WK 3GTPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 K;  3PO2 K;  4G7O A;  5FJ8 K;  3GTL C;  2VUM K;  5M5W K;  4XSZ A;  2R92 C;  2PA8 L;  2WB1 D;  3HOY C;  5IYD K;  1TWC K;  5C4J C;  3HKZ L;  1SFO C;  5FLM K;  3S16 C;  2PA8 D;  2NVY K;  4A3J K;  5M3F K;  3S1N K;  3HKZ D;  2JA5 K;  4A93 K;  2YU9 C;  3I4N K;  2PMZ D;  2E2H K;  1WCM C;  5IP9 K;  4A3E C;  2R93 C;  4OIP A;  1I3Q C;  3RZD K;  2A69 A;  4A3F C;  3FKI K;  3HOU C;  5IYC C;  4A3D C;  4BXX C;  5C4X K;  2Y0S L;  1I6V A;  4LK0 A;  4Y52 C;  3GTM K;  3M4O K;  2WAQ L;  3I4M C;  4Q4Z A;  3GTK C;  5C3E C;  2Y0S D;  5M5X K;  2JA6 K;  3CQZ K;  2PPB A;  2B63 K;  4A3L K;  1TWA K;  2JA7 K;  3S2D K;  4JK1 A;  5M3M K;  4A3B K;  2CW0 A;  1Y1W C;  3GTP C;  4G7Z A;  5IYB K;  3S17 K;  3PO2 C;  4OIR A;  3GTQ C;  3S15 C;  3PO3 K;  2WB1 L;  2VUM C;  4YFK A;  5IP7 K;  1YNJ A;  5IYD C;  4LLG A;  4BBS K;  4KN7 A;  2R7Z K;  1TWC C;  3S1Q K;  2NVX K;  4XLN A;  3WOD A;  1I6H C;  5TMF A;  2NVY C;  1YNN A;  2PMZ L;  4A3J C;  3S1N C;  1TWH C;  2JA5 C;  4A93 C;  3I4N C;  2E2H C;  2E2I C;  3HOZ C;  1I50 C;  3S14 K;  4C2M K;  3H3V L;  3S1M K;  3RZD C;  4BY7 K;  3K7A K;  3FKI C;  4BBR K;  4MEX A;  3H3V D;  2JA8 C;  2BE5 A;  3GTM C;  4Y7N K;  3M4O C;  3GTO K;  4QIW L;  3HOW C;  3GTG K;  3S2H K;  4G7H A;  3RZO K;  2A68 A;  4KMU A;  4QJV B;  2JA6 C;  3CQZ C;  4QIW D;  4A3L C;  2B63 C;  1TWA C;  1TWG C;  3H0G C;  4A3M K;  2JA7 C;  4A3B C;  5C44 K;  3S2D C;  2E2J C;  4QJV A;  5IYB C;  4YG2 A;  4XLP A;  3PO3 C;  4A3G K;  5IP7 C;  3HOV K;  4BBS C;  1SFO K;  2R7Z C;  3S16 K;  4YFX A;  3S1Q C;  4C3H K;  2NVX C;  4BY1 K;  1R9T K;  5FLM C;  2O5I A;  4A3K K;  4OIQ A;  1IW7 A;  4A3C K;  4C3I K;  1TWF K;  4LK1 A;  3GTJ K;  4X6A K;  3S14 C;  2A6E A;  5IP9 C;  3S1M C;  3HOX K;  3HOU K;  4LJZ A;  4A3D K;  4MQ9 A;  3K7A C;  4BBR C;  4Y52 K;  4C3J K;  1XPP A;  3I4M K;  4Y7N C;  5C4X C;  5C3E K;  3GTO C;  1K83 K;  4A3I K;  1BDF A;  5D4D A;  3GTG C;  4NOI A;  3RZO C;  4MEY A;  3DXJ A;  3S1R K;  3S2H C;  5M5Y K;  1Y1V K;  4KN4 A;  3M3Y K;  4A3M C;  5C44 C;  2NVQ K;  2NVT K;  4Q5S A;  3GTQ K;  4XSX A;  2A6H A;  4A3G C;  4AYB L;  3GTL K;  3S17 C;  1SMY A;  3HOV C;  2R92 K;  3HOY K;  1I6H K;  2O5J A;  1ZYR A;  4AYB D;  5C4J K;  4BY1 C;  5TMC A;  4OIO A;  1R9T C;  1HQM A;  1TWH K;  4A3K C;  4A3C C;  2YU9 K;  2E2I K;  3HOZ K;  1TWF C;  1I50 K;  3GTJ C;  4X6A C;  1WCM K;  4A3E K;  4YFN A;  2R93 K;  4ZH4 A;  1I3Q K;  3EQL A;  3HOX C;  4A3F K;  2JA8 K;  5IYC K;  4BY7 C;  4BXX K;  3HOW K;  1K83 C;  4A3I C;  3GTK K;  4GZY A;  3S1R C;  2WAQ D;  1TWG K;  1Y1V C;  3H0G K;  4OIN A;  3M3Y C;  2E2J K;  2NVQ C;  2NVT C;  1Y1W K;  3GTP K; 
#chains in the Genus database with same CATH topology
 4KC6 A;  4G7O A;  1V5V A;  4BLA A;  2VUM K;  2D6F C;  2R92 C;  4ILD A;  5EGH A;  3HOY C;  4KAW X;  5FLM K;  2ZFZ A;  3S1N K;  4A93 K;  1IE0 A;  1INN A;  4KM9 A;  2E2H K;  5IP9 K;  4A3E C;  3GTO A;  4OIP A;  3AD7 C;  3GTG A;  3RZD K;  2A69 A;  5TJ3 A;  3GDZ A;  1PJ7 A;  5L46 A;  4BXX C;  1USO A;  1I6V A;  2Y0S L;  4KMA A;  3QX3 A;  5C3E C;  4O2D A;  1J98 A;  2RH6 A;  5M5X K;  2R92 A;  2CFA B;  3CQZ K;  4KB2 A;  4A3L K;  4KAT A;  3S17 K;  3PO3 K;  2WB1 L;  4FZB A;  4YFK A;  3HXA A;  1USM A;  1TWF A;  3GTJ A;  2NVX K;  1IQ0 A;  1YNN A;  2PMZ L;  1TWH C;  4G0V A;  1K83 A;  3VA7 A;  4WJ3 M;  3K7A K;  1B4A A;  1RU0 A;  3GTM C;  2RGR A;  3GTO K;  3GTG K;  3RZO K;  3JST A;  3GTL A;  3BP8 C;  4QIW D;  1TWA C;  1TWG C;  2JA7 C;  2E2J C;  1XXC A;  1YCL A;  4QJV A;  4XLP A;  1TWH A;  3HOV K;  1DCO A;  2R7Z C;  3S1Q C;  3NUH A;  2R93 A;  1EK8 A;  3AQO A;  3GEI A;  4A3K K;  5IOR A;  1WOR A;  1TWF K;  3GTJ K;  1PJ6 A;  3S14 C;  1O2A A;  4C2M C;  4G0U A;  1HI9 A;  1F9N A;  1TWG A;  2JA7 A;  4P5B A;  2KWA A;  1O28 A;  5JFE A;  5C4X C;  5C3E K;  1K83 K;  3GTP A;  3DXJ A;  4GT9 A;  1DD5 A;  1B4B A;  3GTL K;  3FOE A;  1SMY A;  5CHP A;  3SZZ A;  4BY1 C;  5TMC A;  4OIO A;  1HQM A;  1TWH K;  4A3C C;  3FKI A;  1XXB A;  2R93 K;  3HOX C;  4BKW A;  5HL8 A;  2JA6 A;  5IYC K;  3AQP A;  1BS2 A;  3IPJ A;  3GTK K;  4GFQ A;  4KDD A;  4GZY A;  3S1R C;  2WAQ D;  1TWG K;  4OIN A;  1O25 A;  2E2J K;  4G0W A;  1XXA A;  3GTP K;  3S15 K;  3PO2 K;  5FJ8 K;  2FQT A;  4LQY A;  5IYD K;  1SFO C;  2PA8 D;  4A3J K;  3T01 A;  2YU9 C;  3AH5 A;  4PAA A;  2JH3 A;  5CJ9 A;  3G4C A;  1I3Q C;  5JVO A;  3FKI K;  3N0B A;  5C4X K;  4LK0 A;  3M4O K;  1WQH A;  1J6W A;  5IOQ A;  2P5M A;  2JA6 K;  3S2D K;  5M3M K;  1SFO A;  5IYB K;  3ADA C;  2YU9 A;  4KMD A;  5IP7 K;  1J6X A;  4LLG A;  4KN7 A;  1TWC C;  1I6H C;  1I3Q A;  3G4A A;  2NVY C;  2JA5 C;  3I4N C;  3AD8 C;  1EFW A;  2E2I C;  3HOZ C;  4M1X A;  1JVI A;  3S1M K;  3OPF A;  1F93 A;  1Y1V A;  3H3V D;  4QIW L;  3S2H K;  5E68 A;  1ZBS A;  4QJV B;  3A8K A;  4GTC A;  2B63 C;  1TWC A;  4A3M K;  1O2B A;  4A3B C;  5C44 K;  2V6T A;  3N3Y A;  4YG2 A;  2JA5 A;  2E2I A;  4BBS C;  1SFO K;  3A8I A;  1XZP A;  3Q3Q A;  4GTB A;  4AH6 A;  1IL2 A;  4C3I K;  1KQ4 A;  1EQR A;  1O27 A;  4BBR C;  3GIR A;  4Y7N C;  4A3I K;  1ZXO A;  1YX2 A;  5M5Y K;  1Y1V K;  4KN4 A;  3M3Y K;  2NVQ K;  4Q5S A;  2A6H A;  4A3G C;  2R92 K;  4DDQ A;  3HOY K;  1I6H K;  4AYB D;  1F7U A;  3S0X A;  3TFJ A;  1R9T C;  3ORE A;  2ZUE A;  2E2I K;  3HOZ K;  1GE9 A;  1IS1 A;  3GTM A;  4X6A C;  4A3E K;  3LAJ A;  4ZH4 A;  3T02 A;  4BY7 C;  4BXX K;  1TWA A;  4C3J C;  1BJT A;  1VJE A;  2R7Z A;  2NVT C;  5EGE A;  5M5W K;  1XZQ A;  2PA8 L;  2WB1 D;  5C4J C;  1O29 A;  3HKZ D;  2PMZ D;  1WCM C;  3BP3 A;  1O26 A;  2W7V A;  4A3F C;  3GTM K;  3I4M C;  4Q4Z A;  3V4G A;  2PPB A;  1TWA K;  2JA7 K;  4JK1 A;  2CW0 A;  4P9S A;  3AD9 C;  1Y1W C;  3TTG A;  4G7Z A;  4OIR A;  3GTQ C;  2V6U A;  2VUM C;  1VH2 A;  2R7Z K;  4KMH A;  3S1Q K;  3WOD A;  3LPX A;  5TMF A;  3S1N C;  4A93 C;  2P8T A;  2E2H C;  1WSR A;  4KAR A;  1I50 C;  3S14 K;  4C2M K;  3H3V L;  3RZD C;  4BY7 K;  4MEX A;  1ZQ1 C;  1ZVU A;  2JA8 C;  3HOW C;  3GTQ A;  4G7H A;  2A68 A;  3CQZ C;  4GTF A;  3N0C A;  4A3L C;  1EI6 A;  3H0G C;  4C45 A;  1JOE A;  1XZP B;  3PO3 C;  4PAB A;  1I50 A;  2NVX C;  4BY1 K;  2O5I A;  4A3C K;  4P5A A;  4LK1 A;  4GTA A;  2A6E A;  3HOX K;  2Y3P A;  3K7A C;  3H0G A;  1AB4 A;  3T00 A;  3I4M K;  3GTO C;  1BDF A;  3GTG C;  4NOI A;  3RZO C;  4MEY A;  3FOF A;  3S1R K;  2NVX A;  1WQG A;  4KB4 A;  3GTQ K;  1F7V A;  4AYB L;  2NVY A;  3HOV C;  4KAS A;  2V6S A;  2O5J A;  1ZYR A;  2GSO A;  4A3K C;  1X31 C;  2YU9 K;  1TWF C;  1I50 K;  3GTJ C;  1WIH A;  4WIL A;  1I3Q K;  2JA8 K;  2XCR B;  2B63 A;  2GSU A;  3TFI A;  4RMF A;  3HOW K;  1K83 C;  3H0G K;  1VRQ C;  1XZQ B;  1WOS A;  3GTL C;  4XSZ A;  1TWC K;  3HKZ L;  1DCH A;  3S16 C;  4C3H C;  2EBB A;  2NVY K;  5M3F K;  2JA5 K;  3I4N K;  1PJ5 A;  1EH1 A;  1J6V A;  1WQF A;  2R93 C;  4J3N A;  3HOU C;  4XCH A;  5IYC C;  4A3D C;  1IBA A;  3A8J A;  4Y52 C;  3GSI A;  1G51 A;  2WAQ L;  3GTK C;  2PHC B;  3SZY A;  2Y0S D;  3L4K A;  4GTD A;  4FM9 A;  3FHZ A;  2B63 K;  3GEE A;  4A3B K;  3GTP C;  1WOP A;  3S15 C;  3PO2 C;  2CFA A;  1R9T A;  1C0A A;  1YNJ A;  5IYD C;  4BBS K;  4XLN A;  4A3J C;  4BLB A;  3GTK A;  2FQO A;  1VGX A;  3BUE A;  4BBR K;  3FKI C;  2ZUF A;  2BE5 A;  4Y7N K;  3M4O C;  3MML B;  4KMU A;  2JA6 C;  3S2D C;  2GSN A;  5IYB C;  4A3G K;  5IP7 C;  1UV7 A;  3S16 K;  4YFX A;  1WCM A;  4C3H K;  2GAG C;  4WJ4 A;  1L0W A;  1R9T K;  5FLM C;  3ERE D;  4OIQ A;  1IW7 A;  4X6A K;  1JQW A;  1DCP A;  5IP9 C;  1ISE A;  3S1M C;  3HOU K;  4LJZ A;  4KM8 A;  4A3D K;  4LR2 A;  4MQ9 A;  4Y52 K;  2GAH C;  4C3J K;  1XPP A;  1Y1W A;  5D4D A;  3S2H C;  4LOW A;  2VUM A;  1WOO A;  4A3M C;  5C44 C;  2NVT K;  1WSV A;  1BGW A;  5IOS A;  2XCO A;  4XSX A;  3S17 C;  2XCQ A;  1VLO A;  2E2H A;  5C4J K;  4GTE A;  3TFH A;  4GTL A;  4C3I C;  3GEH A;  3LAP A;  1WCM K;  1O24 A;  4YFN A;  3EQL A;  4A3F K;  3CQZ A;  1O2F B;  3OEP A;  5IOT A;  3L4J A;  4A3I C;  3CAG A;  1Y1V C;  3M3Y C;  2NVQ C;  1Y1W K; 
#chains in the Genus database with same CATH homology
 3S15 K;  3PO2 K;  4G7O A;  5FJ8 K;  3GTL C;  2VUM K;  5M5W K;  4XSZ A;  2R92 C;  2PA8 L;  2WB1 D;  3HOY C;  5IYD K;  1TWC K;  5C4J C;  3HKZ L;  1SFO C;  5FLM K;  3S16 C;  2PA8 D;  2NVY K;  4A3J K;  5M3F K;  3S1N K;  3HKZ D;  2JA5 K;  4A93 K;  2YU9 C;  3I4N K;  2PMZ D;  2E2H K;  1WCM C;  5IP9 K;  4A3E C;  2R93 C;  4OIP A;  1I3Q C;  3RZD K;  2A69 A;  4A3F C;  3FKI K;  3HOU C;  5IYC C;  4A3D C;  4BXX C;  5C4X K;  2Y0S L;  1I6V A;  4LK0 A;  4Y52 C;  3GTM K;  3M4O K;  2WAQ L;  3I4M C;  4Q4Z A;  3GTK C;  5C3E C;  2Y0S D;  5M5X K;  2JA6 K;  3CQZ K;  2PPB A;  2B63 K;  4A3L K;  1TWA K;  2JA7 K;  3S2D K;  4JK1 A;  5M3M K;  4A3B K;  2CW0 A;  1Y1W C;  3GTP C;  4G7Z A;  5IYB K;  3S17 K;  3PO2 C;  4OIR A;  3GTQ C;  3S15 C;  3PO3 K;  2WB1 L;  2VUM C;  4YFK A;  5IP7 K;  1YNJ A;  5IYD C;  4LLG A;  4BBS K;  4KN7 A;  2R7Z K;  1TWC C;  3S1Q K;  2NVX K;  4XLN A;  3WOD A;  1I6H C;  5TMF A;  2NVY C;  1YNN A;  2PMZ L;  4A3J C;  3S1N C;  1TWH C;  2JA5 C;  4A93 C;  3I4N C;  2E2H C;  2E2I C;  3HOZ C;  1I50 C;  3S14 K;  4C2M K;  3H3V L;  3S1M K;  3RZD C;  4BY7 K;  3K7A K;  3FKI C;  4BBR K;  4MEX A;  3H3V D;  2JA8 C;  2BE5 A;  3GTM C;  4Y7N K;  3M4O C;  3GTO K;  4QIW L;  3HOW C;  3GTG K;  3S2H K;  4G7H A;  3RZO K;  2A68 A;  4KMU A;  4QJV B;  2JA6 C;  3CQZ C;  4QIW D;  4A3L C;  2B63 C;  1TWA C;  1TWG C;  3H0G C;  4A3M K;  2JA7 C;  4A3B C;  5C44 K;  3S2D C;  2E2J C;  4QJV A;  5IYB C;  4YG2 A;  4XLP A;  3PO3 C;  4A3G K;  5IP7 C;  3HOV K;  4BBS C;  1SFO K;  2R7Z C;  3S16 K;  4YFX A;  3S1Q C;  4C3H K;  2NVX C;  4BY1 K;  1R9T K;  5FLM C;  2O5I A;  4A3K K;  4OIQ A;  1IW7 A;  4A3C K;  4C3I K;  1TWF K;  4LK1 A;  3GTJ K;  4X6A K;  3S14 C;  2A6E A;  5IP9 C;  3S1M C;  3HOX K;  3HOU K;  4LJZ A;  4A3D K;  4MQ9 A;  3K7A C;  4BBR C;  4Y52 K;  4C3J K;  1XPP A;  3I4M K;  4Y7N C;  5C4X C;  5C3E K;  3GTO C;  1K83 K;  4A3I K;  1BDF A;  5D4D A;  3GTG C;  4NOI A;  3RZO C;  4MEY A;  3DXJ A;  3S1R K;  3S2H C;  5M5Y K;  1Y1V K;  4KN4 A;  3M3Y K;  4A3M C;  5C44 C;  2NVQ K;  2NVT K;  4Q5S A;  3GTQ K;  4XSX A;  2A6H A;  4A3G C;  4AYB L;  3GTL K;  3S17 C;  1SMY A;  3HOV C;  2R92 K;  3HOY K;  1I6H K;  2O5J A;  1ZYR A;  4AYB D;  5C4J K;  4BY1 C;  5TMC A;  4OIO A;  1R9T C;  1HQM A;  1TWH K;  4A3K C;  4A3C C;  2YU9 K;  2E2I K;  3HOZ K;  1TWF C;  1I50 K;  3GTJ C;  4X6A C;  1WCM K;  4A3E K;  4YFN A;  2R93 K;  4ZH4 A;  1I3Q K;  3EQL A;  3HOX C;  4A3F K;  2JA8 K;  5IYC K;  4BY7 C;  4BXX K;  3HOW K;  1K83 C;  4A3I C;  3GTK K;  4GZY A;  3S1R C;  2WAQ D;  1TWG K;  1Y1V C;  3H0G K;  4OIN A;  3M3Y C;  2E2J K;  2NVQ C;  2NVT C;  1Y1W K;  3GTP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...