5IYDK

Human core-pic in the initial transcribing state (no iis)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iydK00
5M5XK 5C3EC 5IYBC 4Y7NC 2E2JC 2JA5C 5D4DA 1K83K 1TWGC 3CQZK 3PO3K 3GTQK 3GTLC 3M4OC 2JA8K 4BBSK 1TWFK 3PO2K 3S14K 2E2HC 3I4NC 4A3GK 2R7ZC 3GTOK 4MEXA 4BY1K 3PO3C 2NVXK 5IYBK 2WAQL 2E2JK 3GTQC 1TWGK 1WCMK 3CQZC 3DXJA 4A3FK 3HKZL 4MQ9A 1TWHC 2VUMC 2WB1D 3M3YC 4A3CK 5M3MK 1TWFC 5IP7C 3PO2C 3S14C 4A3GC 3S2DC 1ZYRA 2NVTK 4Y52K 3H3VL 3WODA 3I4MK 2Y0SL 2JA7C 1WCMC 4A3FC 3RZOK 3M3YK 1TWHK 2VUMK 2O5IA 4A3EK 3HOVC 4A3CC 1TWAC 4G7ZA 2PA8D 4BBRK 5IP7K 3S16C 5C44C 3S1MK 3S1QK 3RZDC 3S2DK 4KN7A 3K7AC 3GTGK 2NVTC 4Y52C 3H0GC 5IYCC 4A3MK 4OIRA 3GTMC 3I4MC 4YFKA 4MEYA 2R93K 3GTLK 4YG2A 2PPBA 4A3JC 2B63K 2PA8L 3S2HK 3S15C 2O5JA 4LK1A 2JA8C 4BBRC 4ZH4A 4A3IC 1TWAK 3GTKK 1SMYA 3S1QC 4BBSC 5C4XC 3S1MC 3I4NK 3K7AK 3HOXC 5TMCA 2BE5A 4GZYA 3GTOC 2R7ZK 4NOIA 4BY7K 2A6HA 3H0GK 5FLMC 4A3MC 2R93C 1Y1VK 1I3QC 2B63C 2JA6C 3HOUK 2NVYC 2R92C 4X6AC 3HOZK 4LK0A 2WB1L 1I6VA 5IP9C 4OIQA 3HKZD 2A68A 3GTPK 2JA5K 4BY7C 4G7OA 5M5YK 1Y1VC 5FLMK 2JA6K 4LJZA 1Y1WK 3HOUC 4LLGA 5C4JC 2NVQC 4OIPA 1SFOK 4X6AK 1BDFA 2Y0SD 5FJ8K 3FKIK 4XLNA 3HOWC 4XLPA 3M4OK 3GTGC 4BY1C 5M5WK 4OINA 3H3VD 4A3DK 2NVXC 3GTMK 2CW0A 4Q4ZA 2E2IK 4A3JK 2NVQK 3S15K 3S2HC 5C4JK 4BXXC 4XSXA 1SFOC 3S1NC 1I6HK 3S1RK 4A3LC 4AYBD 4QIWD 4A3KC 1R9TC 3HOYC 3FKIC 2WAQD 5IYDC 4QJVB 4JK1A 1I50K 4KN4A 4A3DC 2JA7K 3RZOC 2YU9K 1XPPA 2NVYK 2A6EA 2R92K 3HOVK 1IW7A 4Y7NK 3S1NK 1YNNA 3S16K 4BXXK 3S1RC 4A3LK 3HOYK 3RZDK 4A3KK 1R9TK 5IYDK 4YFXA 4A3EC 4QJVA 4A93C 4KMUA 4XSZA 2E2HK 3S17C 1TWCC 1HQMA 3EQLA 2YU9C 2A69A 5C4XK 5IYCK 4A3IK 4G7HA 4C3JK 3HOWK 5M3FK 4C3HK 3GTKC 4A93K 3GTJK 4C3IK 2PMZL 4A3BC 1TWCK 2PMZD 3HOXK 3S17K 2E2IC 4YFNA 5C3EK 3HOZC 1K83C 5IP9K 1I3QK 4QIWL 4AYBL 4Q5SA 1I6HC 4OIOA 1I50C 3GTJC 5C44K 1Y1WC 3GTPC 4A3BK 1YNJA 4C2MK 5TMFA
chains in the Genus database with same CATH superfamily
5C3EC 2E2JC 1K83K 3CQZK 1F93A 1USMA 3GTLC 3M4OC 3A8IA 4BBSK 4AH6A 1VH2A 2V6UA 2NVXK 3GTQC 3AQPA 4A3FK 1DCOA 3M3YC 1WOSA 3S2DC 1RU0A 2NVTK 4ILDA 3H3VL 3WODA 3I4MK 5IORA 4KATA 2GAGC 3M3YK 4LQYA 3LAJA 3AD8C 4G7ZA 2PA8D 1F7UA 3S16C 3S1QK 1JVIA 3K7AC 4Y52C 5IYCC 3N0BA 4OIRA 4YFKA 3GTLK 1O26A 3S15C 2FQTA 2O5JA 1I6HC 4BBSC 4ZH4A 4C3IC 3HXAA 3K7AK 2P5MA 1UV7A 1B4AA 2D6FC 2B63C 1I6VA 2CFAB 1J6WA 1X31C 4BLAA 5M5YK 1Y1VC 2JA6K 1Y1WK 1TWGA 1EFWA 3V4GA 2NVQC 4OIPA 2Y0SD 4C3JC 5FJ8K 3HOWC 5JFEA 3GTJA 4BY1C 1XZQA 4Q4ZA 4A3JK 2NVQK 3ERED 3S2HC 1I6HK 3GTLA 4J3NA 4A3KC 3FKIC 3T00A 2WAQD 5IYDC 4QJVB 1O28A 1I50K 4A3DC 3BP8C 2JA7K 3RZOC 4C2MC 4WJ4A 1J6XA 3GIRA 2ZUFA 4BKWA 1IW7A 4Y7NK 3S1NK 4WILA 2R92A 3S1RC 4A3LK 3A8KA 3RZDK 5IYDK 4YFXA 2GAHC 4GTLA 3S17C 1ZXOA 5IYCK 4G0WA 4C3HK 4A93K 1PJ7A 3FOFA 1O25A 1EH1A 4OIOA 1ISEA 3OPFA 2XCOA 5C44K 4A3BK 3T01A 3JSTA 1JOEA 1I3QA 4Y7NC 2YU9A 5D4DA 1WQGA 5IOTA 3GTQK 1IE0A 2RH6A 5HL8A 4GTAA 1TWFK 3N3YA 5IOSA 3I4NC 2R7ZC 4MEXA 2EBBA 1TWGK 1WCMK 3DXJA 1TWHC 2VUMC 4A3CK 1XZPB 1TWHA 2VUMA 1WOOA 4PABA 4Y52K 2JA7C 3RZOK 1O27A 3GSIA 2O5IA 5C44C 1O24A 3H0GC 4A3MK 1EI6A 4MEYA 4YG2A 2B63K 2PA8L 1IS1A 4LK1A 4BBRC 4A3IC 5C4XC 3GTMA 3S1MC 5TMCA 2BE5A 4WJ3M 4NOIA 2A6HA 1Y1VK 2JA6C 4GTBA 5L46A 2NVYC 4X6AC 3ADAC 4OIQA 3GTPK 3TFHA 3MMLB 1O29A 4LJZA 3SZZA 3HOUC 5C4JC 4XLNA 3FKIK 3M4OK 4XLPA 3FHZA 1BS2A 5M5WK 3QX3A 4A3DK 1WSRA 3S15K 1USOA 1K83A 4XSXA 3S1NC 3S1RK 4A3LC 4QIWD 4KAWX 2W7VA 4KASA 5JVOA 3GTPA 1WSVA 2KWAA 2NVYK 4X6AK 3HOVK 2NVYA 3HOYK 5CHPA 1R9TK 1XXBA 5EGHA 1BGWA 1XZPA 3CAGA 4QJVA 4A93C 4KB4A 3EQLA 2YU9C 3OREA 4C3JK 3HOWK 5EGEA 1HI9A 3L4KA 1B4BA 4C3IK 1TWCK 4YFNA 5C3EK 3HOZC 1K83C 3AH5A 1I50C 3GTJC 3GTPC 4C2MK 1TWGC 3S14K 1VJEA 3GTOK 4BY1K 1IBAA 3PO3C 5IYBK 2GSNA 1IL2A 3LAPA 1F9NA 3NUHA 3S14C 3FKIA 3L4JA 4A3FC 3H0GA 4BBRK 5IP7K 3S1MK 4FZBA 3RZDC 4KN7A 3GTGK 1ZVUA 3GTMC 1YCLA 3I4MC 2R93K 3Q3QA 3GTOA 2PPBA 1XXCA 3GTKK 1TWAK 3I4NK 3BP3A 3HOXC 2R7ZK 4C45A 1J98A 3A8JA 4KB2A 2R93C 1I3QC 3GTQA 3HOUK 2R92C 3HOZK 2WB1L 3HKZD 2A68A 1I50A 3GDZA 2JA5K 4BY7C 1V5VA 4G7OA 1DCHA 4GTCA 1O2FB 5FLMK 4FM9A 3G4AA 4O2DA 1SFOK 2ZUEA 3GTGC 1BJTA 1O2BA 4OINA 1KQ4A 2NVXC 1YX2A 2CW0A 2E2IK 3AD9C 2JH3A 1SFOC 1F7VA 2V6SA 4P9SA 4AYBD 1R9TC 3HOYC 3VA7A 1TWFA 4JK1A 4KN4A 1DCPA 1PJ6A 4BLBA 2Y3PA 2RGRA 3BUEA 2YU9K 4KMHA 1WQHA 2A6EA 2R92K 4GFQA 4BXXK 1YNNA 4RMFA 3GEIA 3S16K 4P5BA 3N0CA 2E2HK 1C0AA 1TWCC 1DD5A 5TJ3A 1J6VA 2XCQA 4G7HA 4KM8A 3AD7C 3GTJK 4A3BC 1WOPA 5IP9K 4AYBL 1G51A 1Y1WA 1Y1WC 5M5XK 2JA5C 5IYBC 3PO3K 4GTEA 3FOEA 2JA8K 3PO2K 4A3GK 2E2HC 4KDDA 4KMDA 2E2JK 2WAQL 2E2HA 3CQZC 3HKZL 4MQ9A 2WB1D 3LPXA 4P5AA 5M3MK 1JQWA 2JA5A 1TWFC 5IP7C 3PO2C 4A3GC 1ZYRA 1VLOA 1PJ5A 5IOQA 2CFAA 2Y0SL 1WCMC 4M1XA 1TWHK 4LR2A 2VUMK 4A3EK 3HOVC 4A3CC 1TWAC 4DDQA 3S2DK 2NVTC 1INNA 1VGXA 1TWAA 2E2IA 1L0WA 4A3JC 3S2HK 4C3HC 2JA8C 2NVXA 1SMYA 3S1QC 3GTGA 4GZYA 3IPJA 4GT9A 2P8TA 3GTOC 1VRQC 4BY7K 4XCHA 3H0GK 5FLMC 4A3MC 2PHCB 2GSUA 3GEEA 3CQZA 4LK0A 3OEPA 4KMAA 5IP9C 1WIHA 4GTFA 2V6TA 2GSOA 1EQRA 4LLGA 4G0UA 3T02A 1Y1VA 5CJ9A 1BDFA 3GTKA 3H3VD 4KM9A 3GTMK 2ZFZA 2FQOA 5C4JK 4BXXC 2B63A 1WORA 3G4CA 3SZYA 1SFOA 1ZBSA 4G0VA 1XPPA 2JA7A 1EK8A 1TWCA 4A3KK 1ZQ1C 1IQ0A 4A3EC 4PAAA 4KMUA 3TTGA 3TFIA 4XSZA 1WQFA 1HQMA 1XXAA 3TFJA 4KARA 2A69A 5C4XK 3S0XA 1WCMA 2XCRB 4A3IK 4GTDA 2R7ZA 5M3FK 3GTKC 1XZQB 2PMZL 2PMZD 1R9TA 3HOXK 3S17K 2E2IC 1O2AA 2JA6A 2R93A 4KC6A 1I3QK 4QIWL 4Q5SA 3AQOA 5E68A 4LOWA 1AB4A 1YNJA 3GEHA 5TMFA 1GE9A
chains in the Genus database with same CATH topology
5M5XK 5C3EC 5IYBC 4Y7NC 2E2JC 2JA5C 5D4DA 1K83K 1TWGC 3CQZK 3PO3K 3GTQK 3GTLC 3M4OC 2JA8K 4BBSK 1TWFK 3PO2K 3S14K 2E2HC 3I4NC 4A3GK 2R7ZC 3GTOK 4MEXA 4BY1K 3PO3C 2NVXK 5IYBK 2WAQL 2E2JK 3GTQC 1TWGK 1WCMK 3CQZC 3DXJA 4A3FK 3HKZL 4MQ9A 1TWHC 2VUMC 2WB1D 3M3YC 4A3CK 5M3MK 1TWFC 5IP7C 3PO2C 3S14C 4A3GC 3S2DC 1ZYRA 2NVTK 4Y52K 3H3VL 3WODA 3I4MK 2Y0SL 2JA7C 1WCMC 4A3FC 3RZOK 3M3YK 1TWHK 2VUMK 2O5IA 4A3EK 3HOVC 4A3CC 1TWAC 4G7ZA 2PA8D 4BBRK 5IP7K 3S16C 5C44C 3S1MK 3S1QK 3RZDC 3S2DK 4KN7A 3K7AC 3GTGK 2NVTC 4Y52C 3H0GC 5IYCC 4A3MK 4OIRA 3GTMC 3I4MC 4YFKA 4MEYA 2R93K 3GTLK 4YG2A 2PPBA 4A3JC 2B63K 2PA8L 3S2HK 3S15C 2O5JA 4LK1A 2JA8C 4BBRC 4ZH4A 4A3IC 1TWAK 3GTKK 1SMYA 3S1QC 4BBSC 5C4XC 3S1MC 3I4NK 3K7AK 3HOXC 5TMCA 2BE5A 4GZYA 3GTOC 2R7ZK 4NOIA 4BY7K 2A6HA 3H0GK 5FLMC 4A3MC 2R93C 1Y1VK 1I3QC 2B63C 2JA6C 3HOUK 2NVYC 2R92C 4X6AC 3HOZK 4LK0A 2WB1L 1I6VA 5IP9C 4OIQA 3HKZD 2A68A 3GTPK 2JA5K 4BY7C 4G7OA 5M5YK 1Y1VC 5FLMK 2JA6K 4LJZA 1Y1WK 3HOUC 4LLGA 5C4JC 2NVQC 4OIPA 1SFOK 4X6AK 1BDFA 2Y0SD 5FJ8K 3FKIK 4XLNA 3HOWC 4XLPA 3M4OK 3GTGC 4BY1C 5M5WK 4OINA 3H3VD 4A3DK 2NVXC 3GTMK 2CW0A 4Q4ZA 2E2IK 4A3JK 2NVQK 3S15K 3S2HC 5C4JK 4BXXC 4XSXA 1SFOC 3S1NC 1I6HK 3S1RK 4A3LC 4AYBD 4QIWD 4A3KC 1R9TC 3HOYC 3FKIC 2WAQD 5IYDC 4QJVB 4JK1A 1I50K 4KN4A 4A3DC 2JA7K 3RZOC 2YU9K 1XPPA 2NVYK 2A6EA 2R92K 3HOVK 1IW7A 4Y7NK 3S1NK 1YNNA 3S16K 4BXXK 3S1RC 4A3LK 3HOYK 3RZDK 4A3KK 1R9TK 5IYDK 4YFXA 4A3EC 4QJVA 4A93C 4KMUA 4XSZA 2E2HK 3S17C 1TWCC 1HQMA 3EQLA 2YU9C 2A69A 5C4XK 5IYCK 4A3IK 4G7HA 4C3JK 3HOWK 5M3FK 4C3HK 3GTKC 4A93K 3GTJK 4C3IK 2PMZL 4A3BC 1TWCK 2PMZD 3HOXK 3S17K 2E2IC 4YFNA 5C3EK 3HOZC 1K83C 5IP9K 1I3QK 4QIWL 4AYBL 4Q5SA 1I6HC 4OIOA 1I50C 3GTJC 5C44K 1Y1WC 3GTPC 4A3BK 1YNJA 4C2MK 5TMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X K;  5C3E C;  5IYB C;  4Y7N C;  2E2J C;  2JA5 C;  5D4D A;  1K83 K;  1TWG C;  3CQZ K;  3PO3 K;  3GTQ K;  3GTL C;  3M4O C;  2JA8 K;  4BBS K;  1TWF K;  3PO2 K;  3S14 K;  2E2H C;  3I4N C;  4A3G K;  2R7Z C;  3GTO K;  4MEX A;  4BY1 K;  3PO3 C;  2NVX K;  5IYB K;  2WAQ L;  2E2J K;  3GTQ C;  1TWG K;  1WCM K;  3CQZ C;  3DXJ A;  4A3F K;  3HKZ L;  4MQ9 A;  1TWH C;  2VUM C;  2WB1 D;  3M3Y C;  4A3C K;  5M3M K;  1TWF C;  5IP7 C;  3PO2 C;  3S14 C;  4A3G C;  3S2D C;  1ZYR A;  2NVT K;  4Y52 K;  3H3V L;  3WOD A;  3I4M K;  2Y0S L;  2JA7 C;  1WCM C;  4A3F C;  3RZO K;  3M3Y K;  1TWH K;  2VUM K;  2O5I A;  4A3E K;  3HOV C;  4A3C C;  1TWA C;  4G7Z A;  2PA8 D;  4BBR K;  5IP7 K;  3S16 C;  5C44 C;  3S1M K;  3S1Q K;  3RZD C;  3S2D K;  4KN7 A;  3K7A C;  3GTG K;  2NVT C;  4Y52 C;  3H0G C;  5IYC C;  4A3M K;  4OIR A;  3GTM C;  3I4M C;  4YFK A;  4MEY A;  2R93 K;  3GTL K;  4YG2 A;  2PPB A;  4A3J C;  2B63 K;  2PA8 L;  3S2H K;  3S15 C;  2O5J A;  4LK1 A;  2JA8 C;  4BBR C;  4ZH4 A;  4A3I C;  1TWA K;  3GTK K;  1SMY A;  3S1Q C;  4BBS C;  5C4X C;  3S1M C;  3I4N K;  3K7A K;  3HOX C;  5TMC A;  2BE5 A;  4GZY A;  3GTO C;  2R7Z K;  4NOI A;  4BY7 K;  2A6H A;  3H0G K;  5FLM C;  4A3M C;  2R93 C;  1Y1V K;  1I3Q C;  2B63 C;  2JA6 C;  3HOU K;  2NVY C;  2R92 C;  4X6A C;  3HOZ K;  4LK0 A;  2WB1 L;  1I6V A;  5IP9 C;  4OIQ A;  3HKZ D;  2A68 A;  3GTP K;  2JA5 K;  4BY7 C;  4G7O A;  5M5Y K;  1Y1V C;  5FLM K;  2JA6 K;  4LJZ A;  1Y1W K;  3HOU C;  4LLG A;  5C4J C;  2NVQ C;  4OIP A;  1SFO K;  4X6A K;  1BDF A;  2Y0S D;  5FJ8 K;  3FKI K;  4XLN A;  3HOW C;  4XLP A;  3M4O K;  3GTG C;  4BY1 C;  5M5W K;  4OIN A;  3H3V D;  4A3D K;  2NVX C;  3GTM K;  2CW0 A;  4Q4Z A;  2E2I K;  4A3J K;  2NVQ K;  3S15 K;  3S2H C;  5C4J K;  4BXX C;  4XSX A;  1SFO C;  3S1N C;  1I6H K;  3S1R K;  4A3L C;  4AYB D;  4QIW D;  4A3K C;  1R9T C;  3HOY C;  3FKI C;  2WAQ D;  5IYD C;  4QJV B;  4JK1 A;  1I50 K;  4KN4 A;  4A3D C;  2JA7 K;  3RZO C;  2YU9 K;  1XPP A;  2NVY K;  2A6E A;  2R92 K;  3HOV K;  1IW7 A;  4Y7N K;  3S1N K;  1YNN A;  3S16 K;  4BXX K;  3S1R C;  4A3L K;  3HOY K;  3RZD K;  4A3K K;  1R9T K;  5IYD K;  4YFX A;  4A3E C;  4QJV A;  4A93 C;  4KMU A;  4XSZ A;  2E2H K;  3S17 C;  1TWC C;  1HQM A;  3EQL A;  2YU9 C;  2A69 A;  5C4X K;  5IYC K;  4A3I K;  4G7H A;  4C3J K;  3HOW K;  5M3F K;  4C3H K;  3GTK C;  4A93 K;  3GTJ K;  4C3I K;  2PMZ L;  4A3B C;  1TWC K;  2PMZ D;  3HOX K;  3S17 K;  2E2I C;  4YFN A;  5C3E K;  3HOZ C;  1K83 C;  5IP9 K;  1I3Q K;  4QIW L;  4AYB L;  4Q5S A;  1I6H C;  4OIO A;  1I50 C;  3GTJ C;  5C44 K;  1Y1W C;  3GTP C;  4A3B K;  1YNJ A;  4C2M K;  5TMF A; 
#chains in the Genus database with same CATH topology
 5C3E C;  2E2J C;  1K83 K;  3CQZ K;  1F93 A;  1USM A;  3GTL C;  3M4O C;  3A8I A;  4BBS K;  4AH6 A;  1VH2 A;  2V6U A;  2NVX K;  3GTQ C;  3AQP A;  4A3F K;  1DCO A;  3M3Y C;  1WOS A;  3S2D C;  1RU0 A;  2NVT K;  4ILD A;  3H3V L;  3WOD A;  3I4M K;  5IOR A;  4KAT A;  2GAG C;  3M3Y K;  4LQY A;  3LAJ A;  3AD8 C;  4G7Z A;  2PA8 D;  1F7U A;  3S16 C;  3S1Q K;  1JVI A;  3K7A C;  4Y52 C;  5IYC C;  3N0B A;  4OIR A;  4YFK A;  3GTL K;  1O26 A;  3S15 C;  2FQT A;  2O5J A;  1I6H C;  4BBS C;  4ZH4 A;  4C3I C;  3HXA A;  3K7A K;  2P5M A;  1UV7 A;  1B4A A;  2D6F C;  2B63 C;  1I6V A;  2CFA B;  1J6W A;  1X31 C;  4BLA A;  5M5Y K;  1Y1V C;  2JA6 K;  1Y1W K;  1TWG A;  1EFW A;  3V4G A;  2NVQ C;  4OIP A;  2Y0S D;  4C3J C;  5FJ8 K;  3HOW C;  5JFE A;  3GTJ A;  4BY1 C;  1XZQ A;  4Q4Z A;  4A3J K;  2NVQ K;  3ERE D;  3S2H C;  1I6H K;  3GTL A;  4J3N A;  4A3K C;  3FKI C;  3T00 A;  2WAQ D;  5IYD C;  4QJV B;  1O28 A;  1I50 K;  4A3D C;  3BP8 C;  2JA7 K;  3RZO C;  4C2M C;  4WJ4 A;  1J6X A;  3GIR A;  2ZUF A;  4BKW A;  1IW7 A;  4Y7N K;  3S1N K;  4WIL A;  2R92 A;  3S1R C;  4A3L K;  3A8K A;  3RZD K;  5IYD K;  4YFX A;  2GAH C;  4GTL A;  3S17 C;  1ZXO A;  5IYC K;  4G0W A;  4C3H K;  4A93 K;  1PJ7 A;  3FOF A;  1O25 A;  1EH1 A;  4OIO A;  1ISE A;  3OPF A;  2XCO A;  5C44 K;  4A3B K;  3T01 A;  3JST A;  1JOE A;  1I3Q A;  4Y7N C;  2YU9 A;  5D4D A;  1WQG A;  5IOT A;  3GTQ K;  1IE0 A;  2RH6 A;  5HL8 A;  4GTA A;  1TWF K;  3N3Y A;  5IOS A;  3I4N C;  2R7Z C;  4MEX A;  2EBB A;  1TWG K;  1WCM K;  3DXJ A;  1TWH C;  2VUM C;  4A3C K;  1XZP B;  1TWH A;  2VUM A;  1WOO A;  4PAB A;  4Y52 K;  2JA7 C;  3RZO K;  1O27 A;  3GSI A;  2O5I A;  5C44 C;  1O24 A;  3H0G C;  4A3M K;  1EI6 A;  4MEY A;  4YG2 A;  2B63 K;  2PA8 L;  1IS1 A;  4LK1 A;  4BBR C;  4A3I C;  5C4X C;  3GTM A;  3S1M C;  5TMC A;  2BE5 A;  4WJ3 M;  4NOI A;  2A6H A;  1Y1V K;  2JA6 C;  4GTB A;  5L46 A;  2NVY C;  4X6A C;  3ADA C;  4OIQ A;  3GTP K;  3TFH A;  3MML B;  1O29 A;  4LJZ A;  3SZZ A;  3HOU C;  5C4J C;  4XLN A;  3FKI K;  3M4O K;  4XLP A;  3FHZ A;  1BS2 A;  5M5W K;  3QX3 A;  4A3D K;  1WSR A;  3S15 K;  1USO A;  1K83 A;  4XSX A;  3S1N C;  3S1R K;  4A3L C;  4QIW D;  4KAW X;  2W7V A;  4KAS A;  5JVO A;  3GTP A;  1WSV A;  2KWA A;  2NVY K;  4X6A K;  3HOV K;  2NVY A;  3HOY K;  5CHP A;  1R9T K;  1XXB A;  5EGH A;  1BGW A;  1XZP A;  3CAG A;  4QJV A;  4A93 C;  4KB4 A;  3EQL A;  2YU9 C;  3ORE A;  4C3J K;  3HOW K;  5EGE A;  1HI9 A;  3L4K A;  1B4B A;  4C3I K;  1TWC K;  4YFN A;  5C3E K;  3HOZ C;  1K83 C;  3AH5 A;  1I50 C;  3GTJ C;  3GTP C;  4C2M K;  1TWG C;  3S14 K;  1VJE A;  3GTO K;  4BY1 K;  1IBA A;  3PO3 C;  5IYB K;  2GSN A;  1IL2 A;  3LAP A;  1F9N A;  3NUH A;  3S14 C;  3FKI A;  3L4J A;  4A3F C;  3H0G A;  4BBR K;  5IP7 K;  3S1M K;  4FZB A;  3RZD C;  4KN7 A;  3GTG K;  1ZVU A;  3GTM C;  1YCL A;  3I4M C;  2R93 K;  3Q3Q A;  3GTO A;  2PPB A;  1XXC A;  3GTK K;  1TWA K;  3I4N K;  3BP3 A;  3HOX C;  2R7Z K;  4C45 A;  1J98 A;  3A8J A;  4KB2 A;  2R93 C;  1I3Q C;  3GTQ A;  3HOU K;  2R92 C;  3HOZ K;  2WB1 L;  3HKZ D;  2A68 A;  1I50 A;  3GDZ A;  2JA5 K;  4BY7 C;  1V5V A;  4G7O A;  1DCH A;  4GTC A;  1O2F B;  5FLM K;  4FM9 A;  3G4A A;  4O2D A;  1SFO K;  2ZUE A;  3GTG C;  1BJT A;  1O2B A;  4OIN A;  1KQ4 A;  2NVX C;  1YX2 A;  2CW0 A;  2E2I K;  3AD9 C;  2JH3 A;  1SFO C;  1F7V A;  2V6S A;  4P9S A;  4AYB D;  1R9T C;  3HOY C;  3VA7 A;  1TWF A;  4JK1 A;  4KN4 A;  1DCP A;  1PJ6 A;  4BLB A;  2Y3P A;  2RGR A;  3BUE A;  2YU9 K;  4KMH A;  1WQH A;  2A6E A;  2R92 K;  4GFQ A;  4BXX K;  1YNN A;  4RMF A;  3GEI A;  3S16 K;  4P5B A;  3N0C A;  2E2H K;  1C0A A;  1TWC C;  1DD5 A;  5TJ3 A;  1J6V A;  2XCQ A;  4G7H A;  4KM8 A;  3AD7 C;  3GTJ K;  4A3B C;  1WOP A;  5IP9 K;  4AYB L;  1G51 A;  1Y1W A;  1Y1W C;  5M5X K;  2JA5 C;  5IYB C;  3PO3 K;  4GTE A;  3FOE A;  2JA8 K;  3PO2 K;  4A3G K;  2E2H C;  4KDD A;  4KMD A;  2E2J K;  2WAQ L;  2E2H A;  3CQZ C;  3HKZ L;  4MQ9 A;  2WB1 D;  3LPX A;  4P5A A;  5M3M K;  1JQW A;  2JA5 A;  1TWF C;  5IP7 C;  3PO2 C;  4A3G C;  1ZYR A;  1VLO A;  1PJ5 A;  5IOQ A;  2CFA A;  2Y0S L;  1WCM C;  4M1X A;  1TWH K;  4LR2 A;  2VUM K;  4A3E K;  3HOV C;  4A3C C;  1TWA C;  4DDQ A;  3S2D K;  2NVT C;  1INN A;  1VGX A;  1TWA A;  2E2I A;  1L0W A;  4A3J C;  3S2H K;  4C3H C;  2JA8 C;  2NVX A;  1SMY A;  3S1Q C;  3GTG A;  4GZY A;  3IPJ A;  4GT9 A;  2P8T A;  3GTO C;  1VRQ C;  4BY7 K;  4XCH A;  3H0G K;  5FLM C;  4A3M C;  2PHC B;  2GSU A;  3GEE A;  3CQZ A;  4LK0 A;  3OEP A;  4KMA A;  5IP9 C;  1WIH A;  4GTF A;  2V6T A;  2GSO A;  1EQR A;  4LLG A;  4G0U A;  3T02 A;  1Y1V A;  5CJ9 A;  1BDF A;  3GTK A;  3H3V D;  4KM9 A;  3GTM K;  2ZFZ A;  2FQO A;  5C4J K;  4BXX C;  2B63 A;  1WOR A;  3G4C A;  3SZY A;  1SFO A;  1ZBS A;  4G0V A;  1XPP A;  2JA7 A;  1EK8 A;  1TWC A;  4A3K K;  1ZQ1 C;  1IQ0 A;  4A3E C;  4PAA A;  4KMU A;  3TTG A;  3TFI A;  4XSZ A;  1WQF A;  1HQM A;  1XXA A;  3TFJ A;  4KAR A;  2A69 A;  5C4X K;  3S0X A;  1WCM A;  2XCR B;  4A3I K;  4GTD A;  2R7Z A;  5M3F K;  3GTK C;  1XZQ B;  2PMZ L;  2PMZ D;  1R9T A;  3HOX K;  3S17 K;  2E2I C;  1O2A A;  2JA6 A;  2R93 A;  4KC6 A;  1I3Q K;  4QIW L;  4Q5S A;  3AQO A;  5E68 A;  4LOW A;  1AB4 A;  1YNJ A;  3GEH A;  5TMF A;  1GE9 A; 
#chains in the Genus database with same CATH homology
 5M5X K;  5C3E C;  5IYB C;  4Y7N C;  2E2J C;  2JA5 C;  5D4D A;  1K83 K;  1TWG C;  3CQZ K;  3PO3 K;  3GTQ K;  3GTL C;  3M4O C;  2JA8 K;  4BBS K;  1TWF K;  3PO2 K;  3S14 K;  2E2H C;  3I4N C;  4A3G K;  2R7Z C;  3GTO K;  4MEX A;  4BY1 K;  3PO3 C;  2NVX K;  5IYB K;  2WAQ L;  2E2J K;  3GTQ C;  1TWG K;  1WCM K;  3CQZ C;  3DXJ A;  4A3F K;  3HKZ L;  4MQ9 A;  1TWH C;  2VUM C;  2WB1 D;  3M3Y C;  4A3C K;  5M3M K;  1TWF C;  5IP7 C;  3PO2 C;  3S14 C;  4A3G C;  3S2D C;  1ZYR A;  2NVT K;  4Y52 K;  3H3V L;  3WOD A;  3I4M K;  2Y0S L;  2JA7 C;  1WCM C;  4A3F C;  3RZO K;  3M3Y K;  1TWH K;  2VUM K;  2O5I A;  4A3E K;  3HOV C;  4A3C C;  1TWA C;  4G7Z A;  2PA8 D;  4BBR K;  5IP7 K;  3S16 C;  5C44 C;  3S1M K;  3S1Q K;  3RZD C;  3S2D K;  4KN7 A;  3K7A C;  3GTG K;  2NVT C;  4Y52 C;  3H0G C;  5IYC C;  4A3M K;  4OIR A;  3GTM C;  3I4M C;  4YFK A;  4MEY A;  2R93 K;  3GTL K;  4YG2 A;  2PPB A;  4A3J C;  2B63 K;  2PA8 L;  3S2H K;  3S15 C;  2O5J A;  4LK1 A;  2JA8 C;  4BBR C;  4ZH4 A;  4A3I C;  1TWA K;  3GTK K;  1SMY A;  3S1Q C;  4BBS C;  5C4X C;  3S1M C;  3I4N K;  3K7A K;  3HOX C;  5TMC A;  2BE5 A;  4GZY A;  3GTO C;  2R7Z K;  4NOI A;  4BY7 K;  2A6H A;  3H0G K;  5FLM C;  4A3M C;  2R93 C;  1Y1V K;  1I3Q C;  2B63 C;  2JA6 C;  3HOU K;  2NVY C;  2R92 C;  4X6A C;  3HOZ K;  4LK0 A;  2WB1 L;  1I6V A;  5IP9 C;  4OIQ A;  3HKZ D;  2A68 A;  3GTP K;  2JA5 K;  4BY7 C;  4G7O A;  5M5Y K;  1Y1V C;  5FLM K;  2JA6 K;  4LJZ A;  1Y1W K;  3HOU C;  4LLG A;  5C4J C;  2NVQ C;  4OIP A;  1SFO K;  4X6A K;  1BDF A;  2Y0S D;  5FJ8 K;  3FKI K;  4XLN A;  3HOW C;  4XLP A;  3M4O K;  3GTG C;  4BY1 C;  5M5W K;  4OIN A;  3H3V D;  4A3D K;  2NVX C;  3GTM K;  2CW0 A;  4Q4Z A;  2E2I K;  4A3J K;  2NVQ K;  3S15 K;  3S2H C;  5C4J K;  4BXX C;  4XSX A;  1SFO C;  3S1N C;  1I6H K;  3S1R K;  4A3L C;  4AYB D;  4QIW D;  4A3K C;  1R9T C;  3HOY C;  3FKI C;  2WAQ D;  5IYD C;  4QJV B;  4JK1 A;  1I50 K;  4KN4 A;  4A3D C;  2JA7 K;  3RZO C;  2YU9 K;  1XPP A;  2NVY K;  2A6E A;  2R92 K;  3HOV K;  1IW7 A;  4Y7N K;  3S1N K;  1YNN A;  3S16 K;  4BXX K;  3S1R C;  4A3L K;  3HOY K;  3RZD K;  4A3K K;  1R9T K;  5IYD K;  4YFX A;  4A3E C;  4QJV A;  4A93 C;  4KMU A;  4XSZ A;  2E2H K;  3S17 C;  1TWC C;  1HQM A;  3EQL A;  2YU9 C;  2A69 A;  5C4X K;  5IYC K;  4A3I K;  4G7H A;  4C3J K;  3HOW K;  5M3F K;  4C3H K;  3GTK C;  4A93 K;  3GTJ K;  4C3I K;  2PMZ L;  4A3B C;  1TWC K;  2PMZ D;  3HOX K;  3S17 K;  2E2I C;  4YFN A;  5C3E K;  3HOZ C;  1K83 C;  5IP9 K;  1I3Q K;  4QIW L;  4AYB L;  4Q5S A;  1I6H C;  4OIO A;  1I50 C;  3GTJ C;  5C44 K;  1Y1W C;  3GTP C;  4A3B K;  1YNJ A;  4C2M K;  5TMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...