5IYDK

Human core-pic in the initial transcribing state (no iis)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iydK00
3GTGC 4BBRC 4BBRK 4YFXA 2E2JK 3PO3K 3S1QC 4A3IC 3GTPK 4A3LK 2BE5A 4NOIA 1I3QK 5M3MK 2JA5K 2B63K 4YFNA 2O5JA 4LK1A 1TWGC 4KN7A 1SMYA 1K83C 3M3YK 1YNJA 4C2MK 3S17K 4MEXA 3GTLK 4OIOA 3I4NK 4QIWL 2A6HA 2NVTK 3I4NC 2WAQD 3K7AK 5IYDC 5FLMC 4A3EK 3S2DC 1TWGK 3GTGK 3HOXK 1R9TC 3HOWK 4BY7C 1Y1WK 4Y7NC 1TWHK 4A3CC 4A3CK 4GZYA 4YG2A 3GTPC 4A3LC 3GTJC 4A3EC 2R93C 2JA7C 3PO2K 2E2HC 3H0GC 4OINA 3M4OK 3M3YC 2NVXK 4A3KC 5C4XK 4A3FC 4A3FK 1SFOK 2YU9K 4OIPA 3S15C 4BBSC 2NVXC 2B63C 2JA5C 2R7ZK 4Y52K 2Y0SD 4XLNA 3FKIK 5IP7K 1TWAK 4JK1A 2PPBA 4MQ9A 1WCMK 1WCMC 2A6EA 3HKZL 1I50K 4KMUA 4XSXA 4Y52C 1Y1VK 1TWCC 4KN4A 3S1MC 4OIQA 4A3GK 4BY7K 5M5XK 5C4JC 3CQZC 4A3KK 2NVQC 1TWAC 3H3VD 4BXXK 1YNNA 4YFKA 5C44C 4A93K 4A93C 3GTLC 4XSZA 4C3JK 3EQLA 4G7OA 1K83K 4C3HK 4G7ZA 2R93K 4A3GC 2PMZD 4A3MK 3S1MK 3DXJA 3M4OC 4ZH4A 3HOZK 3S1NC 3GTKK 2PA8D 5M5WK 5IP9C 3HOXC 3RZOK 3RZOC 1BDFA 5FLMK 3K7AC 3S2DK 5IYDK 2JA6C 5IYCC 3HOZC 1TWHC 4Y7NK 3S1NK 2E2IC 4A3MC 2VUMC 1ZYRA 4QJVA 4BY1K 3S16K 1SFOC 1XPPA 2Y0SL 4QIWD 1IW7A 3S16C 5C4XC 2PA8L 5IYCK 3H0GK 2NVYK 3HKZD 4A3BC 4AYBD 2NVQK 4QJVB 4BXXC 3PO3C 1I6VA 5C3EC 4G7HA 5IP9K 2VUMK 1Y1VC 1I3QC 3GTQK 3GTQC 4X6AK 4C3IK 2A69A 2JA6K 1R9TK 3HOWC 3GTOK 2E2JC 3S1QK 4OIRA 2WB1D 4A3BK 3GTKC 4AYBL 2NVTC 4LK0A 2JA8C 3GTMC 3HOYK 3S17C 4XLPA 4A3JC 3S1RK 5TMFA 2PMZL 3S2HC 5C4JK 3S14K 4A3DC 5M5YK 3S2HK 5IYBC 2O5IA 2E2IK 4A3DK 1TWFC 5FJ8K 5D4DA 2JA8K 3HOVC 3HOYC 3I4MC 1I6HC 4Q4ZA 1I50C 1HQMA 3RZDC 3HOUK 2A68A 4LJZA 5M3FK 3GTOC 4LLGA 3RZDK 2WAQL 3HOUC 4Q5SA 1TWCK 5IP7C 4X6AC 5TMCA 2R92C 3WODA 1TWFK 2R92K 3HOVK 3I4MK 1I6HK 3H3VL 3S15K 2YU9C 4BBSK 5C3EK 3S14C 2NVYC 3FKIC 2CW0A 2R7ZC 2E2HK 5C44K 5IYBK 3CQZK 4MEYA 4BY1C 3GTJK 4A3JK 3S1RC 3GTMK 3PO2C 2JA7K 1Y1WC 4A3IK 2WB1L
chains in the Genus database with same CATH superfamily
2GAHC 4BBRK 4YFXA 2E2JK 1USMA 4AH6A 1O2FB 4KC6A 4LK1A 1K83C 1YNJA 1B4BA 1HI9A 2A6HA 1V5VA 2NVTK 4BKWA 1O25A 5IYDC 3QX3A 2D6FC 2XCOA 3HOWK 4KMHA 1SFOA 1IE0A 3GTOA 2E2HC 1TWCA 4BLAA 2ZUEA 3M3YC 5C4XK 3L4KA 3HXAA 2Y3PA 3V4GA 4JK1A 1WSRA 4WILA 2PPBA 1WCMC 3HKZL 1AB4A 3G4CA 4KMUA 1RU0A 4Y52C 3CQZA 4A3GK 4A3KK 2NVQC 4KMDA 3GTPA 1PJ5A 2PMZD 3S1MK 3M4OC 1O29A 5CJ9A 4ZH4A 3RZOC 5FLMK 3S2DK 1TWGA 2JA6C 4ILDA 4KB4A 2V6SA 1XZQB 2CFAB 4Y7NK 2VUMC 4BY1K 1BS2A 4QJVA 3S16K 3GTJA 4C3HC 3S16C 4G0UA 5C4XC 5IYCK 1R9TA 3A8JA 3AQOA 4AYBD 1YCLA 5C3EC 3T01A 2NVYA 2JA6K 3GTOK 1DCOA 3ADAC 1IS1A 4PAAA 3L4JA 4OIRA 3GTKC 3GTLA 2NVTC 4LK0A 2JA8C 2JH3A 4XLPA 4A3JC 5TMFA 3S14K 1JVIA 4P5BA 4GTDA 2E2IK 1HQMA 3VA7A 4LJZA 3GTOC 2WAQL 2R92K 3I4MK 1I6HK 3S14C 1ZBSA 2CW0A 1Y1VA 5IYBK 4XCHA 3S1RC 3GTMK 1WCMA 3GEHA 1DCHA 1Y1WC 2E2HA 4P9SA 3A8KA 3S1QC 1ZXOA 2VUMA 1I3QK 3SZZA 2JA5K 4YFNA 5E68A 4KAWX 1SMYA 3N3YA 4C2MK 3S17K 3I4NK 4LR2A 4QIWL 1IL2A 5FLMC 3S2DC 3TTGA 3NUHA 3OEPA 4GZYA 1O27A 3OREA 3GTPC 4A3LC 1O2AA 1F93A 4A3EC 3GSIA 3H0GC 1WQHA 2NVXK 1SFOK 4A3FK 5IOSA 3AH5A 4FZBA 2B63C 2R7ZK 3TFHA 2Y0SD 4Y52K 5IP7K 4MQ9A 3IPJA 3T00A 1I50K 3AD7C 1PJ6A 1Y1VK 1TWAC 1YNNA 3S0XA 2NVXA 4M1XA 4A93C 4GTFA 1O24A 2RH6A 1K83K 3BP8C 2JA5A 1XZQA 2CFAA 5IYDK 1TWHC 4C2MC 2E2IC 1XPPA 2PA8L 1K83A 2GSNA 3HKZD 2NVQK 4QJVB 3MMLB 3GTQA 2V6TA 1O28A 1Y1VC 1I3QC 1ZQ1C 4C3IK 1R9TK 1DCPA 2GSOA 3ERED 3HOYK 3GTMC 1XZPA 3S1RK 1XXBA 2P8TA 2PMZL 5C4JK 2R7ZA 3GEIA 1Y1WA 2O5IA 3I4MC 1I6HC 3CAGA 1VH2A 5EGEA 5M3FK 2JA7A 4O2DA 3RZDK 3HOUC 5TMCA 3GDZA 3H3VL 2ZFZA 1J6WA 4DDQA 2FQTA 2NVYC 3FKIC 3N0CA 1XXAA 4MEYA 1VJEA 3GTJK 4A3JK 2JA7K 2W7VA 3GTGC 4BBRC 1VGXA 4A3IC 4LOWA 2GAGC 4KM9A 2B63K 2PHCB 1TWGC 4RMFA 1C0AA 4KATA 3M3YK 1EK8A 4GTCA 4MEXA 4OIOA 3GTLK 4KB2A 2WAQD 3K7AK 4A3EK 2GSUA 4BY7C 3GTGK 2FQOA 5IOQA 1R9TC 1TWHK 1XXCA 4YG2A 1IQ0A 2R92A 1WOOA 2R93C 4GTEA 3PO2K 4KMAA 2P5MA 3TFIA 3LAPA 3SZYA 3BP3A 4A3KC 3AD9C 2YU9K 3S15C 4BBSC 4WJ4A 2KWAA 2JA5C 1UV7A 5L46A 3GTGA 1TWAK 1L0WA 3GTMA 1WCMK 1F7VA 4XSXA 1J6VA 4BLBA 1TWCC 4KN4A 3LAJA 3T02A 3OPFA 4OIQA 4WJ3M 1WOPA 1I3QA 5C4JC 3CQZC 3H3VD 4BXXK 3GTLC 3GTKA 4XSZA 4GTBA 1TWFA 5HL8A 2YU9A 3EQLA 4C3HK 1INNA 3BUEA 3DXJA 3HOZK 3HOXC 5IP9C 3RZOK 4KASA 1USOA 3S1NK 4A3MC 1EH1A 3G4AA 2Y0SL 4C45A 1IW7A 3H0GK 4J3NA 4A3BC 1WORA 1I6VA 4G7HA 5IP9K 4X6AK 3S1QK 2WB1D 1WOSA 1B4AA 1WQGA 1TWAA 3S2HC 4A3DC 2E2IA 1O2BA 1WSVA 1JQWA 3S2HK 5IYBC 4A3DK 5FJ8K 3HOVC 4GFQA 3HOYC 3FOEA 1BJTA 2A68A 5TJ3A 4LLGA 4X6AC 4Q5SA 1TWCK 5IP7C 2R92C 1J98A 1TWFK 3WODA 1VLOA 3S15K 2YU9C 4BBSK 5C44K 1WQFA 3PO2C 1JOEA 1EQRA 4FM9A 2R93A 3PO3K 1DD5A 3GTPK 4A3LK 2BE5A 5IOTA 4NOIA 1EFWA 3JSTA 4KM8A 5M3MK 2O5JA 4KN7A 3H0GA 3I4NC 3GEEA 3FKIA 3TFJA 1TWGK 4P5AA 3HOXK 1Y1WK 4Y7NC 1O26A 4A3CC 4A3CK 2RGRA 3GTJC 2JA7C 2ZUFA 4OINA 4KARA 3M4OK 2XCQA 1ISEA 4A3FC 4OIPA 4KDDA 2NVXC 1IBAA 1XZPB 4XLNA 3FKIK 3FOFA 2A6EA 1WIHA 3LPXA 3S1MC 5JVOA 3AD8C 4BY7K 5M5XK 4GTLA 2B63A 3A8IA 4YFKA 2V6UA 5C44C 4A93K 4C3JK 4G7OA 5EGHA 2R93K 4G7ZA 4A3GC 4A3MK 5JFEA 3S1NC 3GTKK 1TWHA 2PA8D 5M5WK 1BDFA 4G0WA 3K7AC 4C3IC 1KQ4A 5IORA 5IYCC 3HOZC 4G0VA 1GE9A 1G51A 1ZVUA 1ZYRA 1SFOC 4QIWD 4LQYA 2NVYK 2JA6A 1EI6A 4BXXC 3PO3C 3N0BA 3AQPA 2VUMK 2EBBA 3GTQK 3FHZA 3GTQC 2A69A 3HOWC 3GIRA 2E2JC 4A3BK 3Q3QA 4AYBL 3S17C 4GT9A 1F7UA 1VRQC 5M5YK 1TWFC 1BGWA 5D4DA 2JA8K 4GTAA 4Q4ZA 1I50C 2XCRB 3RZDC 3HOUK 1J6XA 4PABA 1YX2A 3HOVK 5C3EK 4C3JC 1X31C 2R7ZC 2E2HK 3CQZK 1F9NA 5CHPA 1I50A 4BY1C 1PJ7A 4A3IK 2WB1L
chains in the Genus database with same CATH topology
3GTGC 4BBRC 4BBRK 4YFXA 2E2JK 3PO3K 3S1QC 4A3IC 3GTPK 4A3LK 2BE5A 4NOIA 1I3QK 5M3MK 2JA5K 2B63K 4YFNA 2O5JA 4LK1A 1TWGC 4KN7A 1SMYA 1K83C 3M3YK 1YNJA 4C2MK 3S17K 4MEXA 3GTLK 4OIOA 3I4NK 4QIWL 2A6HA 2NVTK 3I4NC 2WAQD 3K7AK 5IYDC 5FLMC 4A3EK 3S2DC 1TWGK 3GTGK 3HOXK 1R9TC 3HOWK 4BY7C 1Y1WK 4Y7NC 1TWHK 4A3CC 4A3CK 4GZYA 4YG2A 3GTPC 4A3LC 3GTJC 4A3EC 2R93C 2JA7C 3PO2K 2E2HC 3H0GC 4OINA 3M4OK 3M3YC 2NVXK 4A3KC 5C4XK 4A3FC 4A3FK 1SFOK 2YU9K 4OIPA 3S15C 4BBSC 2NVXC 2B63C 2JA5C 2R7ZK 4Y52K 2Y0SD 4XLNA 3FKIK 5IP7K 1TWAK 4JK1A 2PPBA 4MQ9A 1WCMK 1WCMC 2A6EA 3HKZL 1I50K 4KMUA 4XSXA 4Y52C 1Y1VK 1TWCC 4KN4A 3S1MC 4OIQA 4A3GK 4BY7K 5M5XK 5C4JC 3CQZC 4A3KK 2NVQC 1TWAC 3H3VD 4BXXK 1YNNA 4YFKA 5C44C 4A93K 4A93C 3GTLC 4XSZA 4C3JK 3EQLA 4G7OA 1K83K 4C3HK 4G7ZA 2R93K 4A3GC 2PMZD 4A3MK 3S1MK 3DXJA 3M4OC 4ZH4A 3HOZK 3S1NC 3GTKK 2PA8D 5M5WK 5IP9C 3HOXC 3RZOK 3RZOC 1BDFA 5FLMK 3K7AC 3S2DK 5IYDK 2JA6C 5IYCC 3HOZC 1TWHC 4Y7NK 3S1NK 2E2IC 4A3MC 2VUMC 1ZYRA 4QJVA 4BY1K 3S16K 1SFOC 1XPPA 2Y0SL 4QIWD 1IW7A 3S16C 5C4XC 2PA8L 5IYCK 3H0GK 2NVYK 3HKZD 4A3BC 4AYBD 2NVQK 4QJVB 4BXXC 3PO3C 1I6VA 5C3EC 4G7HA 5IP9K 2VUMK 1Y1VC 1I3QC 3GTQK 3GTQC 4X6AK 4C3IK 2A69A 2JA6K 1R9TK 3HOWC 3GTOK 2E2JC 3S1QK 4OIRA 2WB1D 4A3BK 3GTKC 4AYBL 2NVTC 4LK0A 2JA8C 3GTMC 3HOYK 3S17C 4XLPA 4A3JC 3S1RK 5TMFA 2PMZL 3S2HC 5C4JK 3S14K 4A3DC 5M5YK 3S2HK 5IYBC 2O5IA 2E2IK 4A3DK 1TWFC 5FJ8K 5D4DA 2JA8K 3HOVC 3HOYC 3I4MC 1I6HC 4Q4ZA 1I50C 1HQMA 3RZDC 3HOUK 2A68A 4LJZA 5M3FK 3GTOC 4LLGA 3RZDK 2WAQL 3HOUC 4Q5SA 1TWCK 5IP7C 4X6AC 5TMCA 2R92C 3WODA 1TWFK 2R92K 3HOVK 3I4MK 1I6HK 3H3VL 3S15K 2YU9C 4BBSK 5C3EK 3S14C 2NVYC 3FKIC 2CW0A 2R7ZC 2E2HK 5C44K 5IYBK 3CQZK 4MEYA 4BY1C 3GTJK 4A3JK 3S1RC 3GTMK 3PO2C 2JA7K 1Y1WC 4A3IK 2WB1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG C;  4BBR C;  4BBR K;  4YFX A;  2E2J K;  3PO3 K;  3S1Q C;  4A3I C;  3GTP K;  4A3L K;  2BE5 A;  4NOI A;  1I3Q K;  5M3M K;  2JA5 K;  2B63 K;  4YFN A;  2O5J A;  4LK1 A;  1TWG C;  4KN7 A;  1SMY A;  1K83 C;  3M3Y K;  1YNJ A;  4C2M K;  3S17 K;  4MEX A;  3GTL K;  4OIO A;  3I4N K;  4QIW L;  2A6H A;  2NVT K;  3I4N C;  2WAQ D;  3K7A K;  5IYD C;  5FLM C;  4A3E K;  3S2D C;  1TWG K;  3GTG K;  3HOX K;  1R9T C;  3HOW K;  4BY7 C;  1Y1W K;  4Y7N C;  1TWH K;  4A3C C;  4A3C K;  4GZY A;  4YG2 A;  3GTP C;  4A3L C;  3GTJ C;  4A3E C;  2R93 C;  2JA7 C;  3PO2 K;  2E2H C;  3H0G C;  4OIN A;  3M4O K;  3M3Y C;  2NVX K;  4A3K C;  5C4X K;  4A3F C;  4A3F K;  1SFO K;  2YU9 K;  4OIP A;  3S15 C;  4BBS C;  2NVX C;  2B63 C;  2JA5 C;  2R7Z K;  4Y52 K;  2Y0S D;  4XLN A;  3FKI K;  5IP7 K;  1TWA K;  4JK1 A;  2PPB A;  4MQ9 A;  1WCM K;  1WCM C;  2A6E A;  3HKZ L;  1I50 K;  4KMU A;  4XSX A;  4Y52 C;  1Y1V K;  1TWC C;  4KN4 A;  3S1M C;  4OIQ A;  4A3G K;  4BY7 K;  5M5X K;  5C4J C;  3CQZ C;  4A3K K;  2NVQ C;  1TWA C;  3H3V D;  4BXX K;  1YNN A;  4YFK A;  5C44 C;  4A93 K;  4A93 C;  3GTL C;  4XSZ A;  4C3J K;  3EQL A;  4G7O A;  1K83 K;  4C3H K;  4G7Z A;  2R93 K;  4A3G C;  2PMZ D;  4A3M K;  3S1M K;  3DXJ A;  3M4O C;  4ZH4 A;  3HOZ K;  3S1N C;  3GTK K;  2PA8 D;  5M5W K;  5IP9 C;  3HOX C;  3RZO K;  3RZO C;  1BDF A;  5FLM K;  3K7A C;  3S2D K;  5IYD K;  2JA6 C;  5IYC C;  3HOZ C;  1TWH C;  4Y7N K;  3S1N K;  2E2I C;  4A3M C;  2VUM C;  1ZYR A;  4QJV A;  4BY1 K;  3S16 K;  1SFO C;  1XPP A;  2Y0S L;  4QIW D;  1IW7 A;  3S16 C;  5C4X C;  2PA8 L;  5IYC K;  3H0G K;  2NVY K;  3HKZ D;  4A3B C;  4AYB D;  2NVQ K;  4QJV B;  4BXX C;  3PO3 C;  1I6V A;  5C3E C;  4G7H A;  5IP9 K;  2VUM K;  1Y1V C;  1I3Q C;  3GTQ K;  3GTQ C;  4X6A K;  4C3I K;  2A69 A;  2JA6 K;  1R9T K;  3HOW C;  3GTO K;  2E2J C;  3S1Q K;  4OIR A;  2WB1 D;  4A3B K;  3GTK C;  4AYB L;  2NVT C;  4LK0 A;  2JA8 C;  3GTM C;  3HOY K;  3S17 C;  4XLP A;  4A3J C;  3S1R K;  5TMF A;  2PMZ L;  3S2H C;  5C4J K;  3S14 K;  4A3D C;  5M5Y K;  3S2H K;  5IYB C;  2O5I A;  2E2I K;  4A3D K;  1TWF C;  5FJ8 K;  5D4D A;  2JA8 K;  3HOV C;  3HOY C;  3I4M C;  1I6H C;  4Q4Z A;  1I50 C;  1HQM A;  3RZD C;  3HOU K;  2A68 A;  4LJZ A;  5M3F K;  3GTO C;  4LLG A;  3RZD K;  2WAQ L;  3HOU C;  4Q5S A;  1TWC K;  5IP7 C;  4X6A C;  5TMC A;  2R92 C;  3WOD A;  1TWF K;  2R92 K;  3HOV K;  3I4M K;  1I6H K;  3H3V L;  3S15 K;  2YU9 C;  4BBS K;  5C3E K;  3S14 C;  2NVY C;  3FKI C;  2CW0 A;  2R7Z C;  2E2H K;  5C44 K;  5IYB K;  3CQZ K;  4MEY A;  4BY1 C;  3GTJ K;  4A3J K;  3S1R C;  3GTM K;  3PO2 C;  2JA7 K;  1Y1W C;  4A3I K;  2WB1 L; 
#chains in the Genus database with same CATH topology
 2GAH C;  4BBR K;  4YFX A;  2E2J K;  1USM A;  4AH6 A;  1O2F B;  4KC6 A;  4LK1 A;  1K83 C;  1YNJ A;  1B4B A;  1HI9 A;  2A6H A;  1V5V A;  2NVT K;  4BKW A;  1O25 A;  5IYD C;  3QX3 A;  2D6F C;  2XCO A;  3HOW K;  4KMH A;  1SFO A;  1IE0 A;  3GTO A;  2E2H C;  1TWC A;  4BLA A;  2ZUE A;  3M3Y C;  5C4X K;  3L4K A;  3HXA A;  2Y3P A;  3V4G A;  4JK1 A;  1WSR A;  4WIL A;  2PPB A;  1WCM C;  3HKZ L;  1AB4 A;  3G4C A;  4KMU A;  1RU0 A;  4Y52 C;  3CQZ A;  4A3G K;  4A3K K;  2NVQ C;  4KMD A;  3GTP A;  1PJ5 A;  2PMZ D;  3S1M K;  3M4O C;  1O29 A;  5CJ9 A;  4ZH4 A;  3RZO C;  5FLM K;  3S2D K;  1TWG A;  2JA6 C;  4ILD A;  4KB4 A;  2V6S A;  1XZQ B;  2CFA B;  4Y7N K;  2VUM C;  4BY1 K;  1BS2 A;  4QJV A;  3S16 K;  3GTJ A;  4C3H C;  3S16 C;  4G0U A;  5C4X C;  5IYC K;  1R9T A;  3A8J A;  3AQO A;  4AYB D;  1YCL A;  5C3E C;  3T01 A;  2NVY A;  2JA6 K;  3GTO K;  1DCO A;  3ADA C;  1IS1 A;  4PAA A;  3L4J A;  4OIR A;  3GTK C;  3GTL A;  2NVT C;  4LK0 A;  2JA8 C;  2JH3 A;  4XLP A;  4A3J C;  5TMF A;  3S14 K;  1JVI A;  4P5B A;  4GTD A;  2E2I K;  1HQM A;  3VA7 A;  4LJZ A;  3GTO C;  2WAQ L;  2R92 K;  3I4M K;  1I6H K;  3S14 C;  1ZBS A;  2CW0 A;  1Y1V A;  5IYB K;  4XCH A;  3S1R C;  3GTM K;  1WCM A;  3GEH A;  1DCH A;  1Y1W C;  2E2H A;  4P9S A;  3A8K A;  3S1Q C;  1ZXO A;  2VUM A;  1I3Q K;  3SZZ A;  2JA5 K;  4YFN A;  5E68 A;  4KAW X;  1SMY A;  3N3Y A;  4C2M K;  3S17 K;  3I4N K;  4LR2 A;  4QIW L;  1IL2 A;  5FLM C;  3S2D C;  3TTG A;  3NUH A;  3OEP A;  4GZY A;  1O27 A;  3ORE A;  3GTP C;  4A3L C;  1O2A A;  1F93 A;  4A3E C;  3GSI A;  3H0G C;  1WQH A;  2NVX K;  1SFO K;  4A3F K;  5IOS A;  3AH5 A;  4FZB A;  2B63 C;  2R7Z K;  3TFH A;  2Y0S D;  4Y52 K;  5IP7 K;  4MQ9 A;  3IPJ A;  3T00 A;  1I50 K;  3AD7 C;  1PJ6 A;  1Y1V K;  1TWA C;  1YNN A;  3S0X A;  2NVX A;  4M1X A;  4A93 C;  4GTF A;  1O24 A;  2RH6 A;  1K83 K;  3BP8 C;  2JA5 A;  1XZQ A;  2CFA A;  5IYD K;  1TWH C;  4C2M C;  2E2I C;  1XPP A;  2PA8 L;  1K83 A;  2GSN A;  3HKZ D;  2NVQ K;  4QJV B;  3MML B;  3GTQ A;  2V6T A;  1O28 A;  1Y1V C;  1I3Q C;  1ZQ1 C;  4C3I K;  1R9T K;  1DCP A;  2GSO A;  3ERE D;  3HOY K;  3GTM C;  1XZP A;  3S1R K;  1XXB A;  2P8T A;  2PMZ L;  5C4J K;  2R7Z A;  3GEI A;  1Y1W A;  2O5I A;  3I4M C;  1I6H C;  3CAG A;  1VH2 A;  5EGE A;  5M3F K;  2JA7 A;  4O2D A;  3RZD K;  3HOU C;  5TMC A;  3GDZ A;  3H3V L;  2ZFZ A;  1J6W A;  4DDQ A;  2FQT A;  2NVY C;  3FKI C;  3N0C A;  1XXA A;  4MEY A;  1VJE A;  3GTJ K;  4A3J K;  2JA7 K;  2W7V A;  3GTG C;  4BBR C;  1VGX A;  4A3I C;  4LOW A;  2GAG C;  4KM9 A;  2B63 K;  2PHC B;  1TWG C;  4RMF A;  1C0A A;  4KAT A;  3M3Y K;  1EK8 A;  4GTC A;  4MEX A;  4OIO A;  3GTL K;  4KB2 A;  2WAQ D;  3K7A K;  4A3E K;  2GSU A;  4BY7 C;  3GTG K;  2FQO A;  5IOQ A;  1R9T C;  1TWH K;  1XXC A;  4YG2 A;  1IQ0 A;  2R92 A;  1WOO A;  2R93 C;  4GTE A;  3PO2 K;  4KMA A;  2P5M A;  3TFI A;  3LAP A;  3SZY A;  3BP3 A;  4A3K C;  3AD9 C;  2YU9 K;  3S15 C;  4BBS C;  4WJ4 A;  2KWA A;  2JA5 C;  1UV7 A;  5L46 A;  3GTG A;  1TWA K;  1L0W A;  3GTM A;  1WCM K;  1F7V A;  4XSX A;  1J6V A;  4BLB A;  1TWC C;  4KN4 A;  3LAJ A;  3T02 A;  3OPF A;  4OIQ A;  4WJ3 M;  1WOP A;  1I3Q A;  5C4J C;  3CQZ C;  3H3V D;  4BXX K;  3GTL C;  3GTK A;  4XSZ A;  4GTB A;  1TWF A;  5HL8 A;  2YU9 A;  3EQL A;  4C3H K;  1INN A;  3BUE A;  3DXJ A;  3HOZ K;  3HOX C;  5IP9 C;  3RZO K;  4KAS A;  1USO A;  3S1N K;  4A3M C;  1EH1 A;  3G4A A;  2Y0S L;  4C45 A;  1IW7 A;  3H0G K;  4J3N A;  4A3B C;  1WOR A;  1I6V A;  4G7H A;  5IP9 K;  4X6A K;  3S1Q K;  2WB1 D;  1WOS A;  1B4A A;  1WQG A;  1TWA A;  3S2H C;  4A3D C;  2E2I A;  1O2B A;  1WSV A;  1JQW A;  3S2H K;  5IYB C;  4A3D K;  5FJ8 K;  3HOV C;  4GFQ A;  3HOY C;  3FOE A;  1BJT A;  2A68 A;  5TJ3 A;  4LLG A;  4X6A C;  4Q5S A;  1TWC K;  5IP7 C;  2R92 C;  1J98 A;  1TWF K;  3WOD A;  1VLO A;  3S15 K;  2YU9 C;  4BBS K;  5C44 K;  1WQF A;  3PO2 C;  1JOE A;  1EQR A;  4FM9 A;  2R93 A;  3PO3 K;  1DD5 A;  3GTP K;  4A3L K;  2BE5 A;  5IOT A;  4NOI A;  1EFW A;  3JST A;  4KM8 A;  5M3M K;  2O5J A;  4KN7 A;  3H0G A;  3I4N C;  3GEE A;  3FKI A;  3TFJ A;  1TWG K;  4P5A A;  3HOX K;  1Y1W K;  4Y7N C;  1O26 A;  4A3C C;  4A3C K;  2RGR A;  3GTJ C;  2JA7 C;  2ZUF A;  4OIN A;  4KAR A;  3M4O K;  2XCQ A;  1ISE A;  4A3F C;  4OIP A;  4KDD A;  2NVX C;  1IBA A;  1XZP B;  4XLN A;  3FKI K;  3FOF A;  2A6E A;  1WIH A;  3LPX A;  3S1M C;  5JVO A;  3AD8 C;  4BY7 K;  5M5X K;  4GTL A;  2B63 A;  3A8I A;  4YFK A;  2V6U A;  5C44 C;  4A93 K;  4C3J K;  4G7O A;  5EGH A;  2R93 K;  4G7Z A;  4A3G C;  4A3M K;  5JFE A;  3S1N C;  3GTK K;  1TWH A;  2PA8 D;  5M5W K;  1BDF A;  4G0W A;  3K7A C;  4C3I C;  1KQ4 A;  5IOR A;  5IYC C;  3HOZ C;  4G0V A;  1GE9 A;  1G51 A;  1ZVU A;  1ZYR A;  1SFO C;  4QIW D;  4LQY A;  2NVY K;  2JA6 A;  1EI6 A;  4BXX C;  3PO3 C;  3N0B A;  3AQP A;  2VUM K;  2EBB A;  3GTQ K;  3FHZ A;  3GTQ C;  2A69 A;  3HOW C;  3GIR A;  2E2J C;  4A3B K;  3Q3Q A;  4AYB L;  3S17 C;  4GT9 A;  1F7U A;  1VRQ C;  5M5Y K;  1TWF C;  1BGW A;  5D4D A;  2JA8 K;  4GTA A;  4Q4Z A;  1I50 C;  2XCR B;  3RZD C;  3HOU K;  1J6X A;  4PAB A;  1YX2 A;  3HOV K;  5C3E K;  4C3J C;  1X31 C;  2R7Z C;  2E2H K;  3CQZ K;  1F9N A;  5CHP A;  1I50 A;  4BY1 C;  1PJ7 A;  4A3I K;  2WB1 L; 
#chains in the Genus database with same CATH homology
 3GTG C;  4BBR C;  4BBR K;  4YFX A;  2E2J K;  3PO3 K;  3S1Q C;  4A3I C;  3GTP K;  4A3L K;  2BE5 A;  4NOI A;  1I3Q K;  5M3M K;  2JA5 K;  2B63 K;  4YFN A;  2O5J A;  4LK1 A;  1TWG C;  4KN7 A;  1SMY A;  1K83 C;  3M3Y K;  1YNJ A;  4C2M K;  3S17 K;  4MEX A;  3GTL K;  4OIO A;  3I4N K;  4QIW L;  2A6H A;  2NVT K;  3I4N C;  2WAQ D;  3K7A K;  5IYD C;  5FLM C;  4A3E K;  3S2D C;  1TWG K;  3GTG K;  3HOX K;  1R9T C;  3HOW K;  4BY7 C;  1Y1W K;  4Y7N C;  1TWH K;  4A3C C;  4A3C K;  4GZY A;  4YG2 A;  3GTP C;  4A3L C;  3GTJ C;  4A3E C;  2R93 C;  2JA7 C;  3PO2 K;  2E2H C;  3H0G C;  4OIN A;  3M4O K;  3M3Y C;  2NVX K;  4A3K C;  5C4X K;  4A3F C;  4A3F K;  1SFO K;  2YU9 K;  4OIP A;  3S15 C;  4BBS C;  2NVX C;  2B63 C;  2JA5 C;  2R7Z K;  4Y52 K;  2Y0S D;  4XLN A;  3FKI K;  5IP7 K;  1TWA K;  4JK1 A;  2PPB A;  4MQ9 A;  1WCM K;  1WCM C;  2A6E A;  3HKZ L;  1I50 K;  4KMU A;  4XSX A;  4Y52 C;  1Y1V K;  1TWC C;  4KN4 A;  3S1M C;  4OIQ A;  4A3G K;  4BY7 K;  5M5X K;  5C4J C;  3CQZ C;  4A3K K;  2NVQ C;  1TWA C;  3H3V D;  4BXX K;  1YNN A;  4YFK A;  5C44 C;  4A93 K;  4A93 C;  3GTL C;  4XSZ A;  4C3J K;  3EQL A;  4G7O A;  1K83 K;  4C3H K;  4G7Z A;  2R93 K;  4A3G C;  2PMZ D;  4A3M K;  3S1M K;  3DXJ A;  3M4O C;  4ZH4 A;  3HOZ K;  3S1N C;  3GTK K;  2PA8 D;  5M5W K;  5IP9 C;  3HOX C;  3RZO K;  3RZO C;  1BDF A;  5FLM K;  3K7A C;  3S2D K;  5IYD K;  2JA6 C;  5IYC C;  3HOZ C;  1TWH C;  4Y7N K;  3S1N K;  2E2I C;  4A3M C;  2VUM C;  1ZYR A;  4QJV A;  4BY1 K;  3S16 K;  1SFO C;  1XPP A;  2Y0S L;  4QIW D;  1IW7 A;  3S16 C;  5C4X C;  2PA8 L;  5IYC K;  3H0G K;  2NVY K;  3HKZ D;  4A3B C;  4AYB D;  2NVQ K;  4QJV B;  4BXX C;  3PO3 C;  1I6V A;  5C3E C;  4G7H A;  5IP9 K;  2VUM K;  1Y1V C;  1I3Q C;  3GTQ K;  3GTQ C;  4X6A K;  4C3I K;  2A69 A;  2JA6 K;  1R9T K;  3HOW C;  3GTO K;  2E2J C;  3S1Q K;  4OIR A;  2WB1 D;  4A3B K;  3GTK C;  4AYB L;  2NVT C;  4LK0 A;  2JA8 C;  3GTM C;  3HOY K;  3S17 C;  4XLP A;  4A3J C;  3S1R K;  5TMF A;  2PMZ L;  3S2H C;  5C4J K;  3S14 K;  4A3D C;  5M5Y K;  3S2H K;  5IYB C;  2O5I A;  2E2I K;  4A3D K;  1TWF C;  5FJ8 K;  5D4D A;  2JA8 K;  3HOV C;  3HOY C;  3I4M C;  1I6H C;  4Q4Z A;  1I50 C;  1HQM A;  3RZD C;  3HOU K;  2A68 A;  4LJZ A;  5M3F K;  3GTO C;  4LLG A;  3RZD K;  2WAQ L;  3HOU C;  4Q5S A;  1TWC K;  5IP7 C;  4X6A C;  5TMC A;  2R92 C;  3WOD A;  1TWF K;  2R92 K;  3HOV K;  3I4M K;  1I6H K;  3H3V L;  3S15 K;  2YU9 C;  4BBS K;  5C3E K;  3S14 C;  2NVY C;  3FKI C;  2CW0 A;  2R7Z C;  2E2H K;  5C44 K;  5IYB K;  3CQZ K;  4MEY A;  4BY1 C;  3GTJ K;  4A3J K;  3S1R C;  3GTM K;  3PO2 C;  2JA7 K;  1Y1W C;  4A3I K;  2WB1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...