1Y1VK

Refined rna polymerase ii-tfiis complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1vK00
3S15C 3S2HC 1TWFK 3H0GK 1HQMA 4Y52C 3S14C 2O5IA 4Q5SA 3S14K 1Y1VC 4A3DK 4JK1A 5IYBK 2WB1L 2WAQD 3H3VL 3M4OC 3S2HK 1BDFA 4G7ZA 5C4XC 3GTKK 1I6HC 4A93C 2E2HC 3GTLK 2BE5A 3HOUC 3HOXC 3HKZL 5C44K 1WCMC 4A3BK 2NVXK 1WCMK 4A3EC 1SFOC 5C44C 1TWGK 4X6AK 4YFXA 5IP7K 4BBRK 3DXJA 4OIOA 4BY7C 5M5YK 2B63K 2R93C 4BBSC 5IP9C 4C3HK 4Y52K 1TWFC 3H0GC 4A3JK 4XLNA 2B63C 2R93K 5IYDC 4A3FC 1ZYRA 4A3CC 4A3IK 3FKIK 3GTOK 5C4JK 3S17C 1I50C 2YU9C 4G7OA 1I6VA 5M3MK 3I4MK 1SFOK 4Y7NK 3GTPK 3RZDC 2Y0SD 3K7AK 3I4NK 4A3LC 3GTPC 3S1NK 3HOZK 3I4NC 4A3LK 4A3MC 2R7ZK 5C4JC 3S17K 3M3YC 3GTLC 1TWHK 3HOUK 3S1NC 2NVQK 3RZOK 3PO3K 3RZDK 2JA7K 5C3EK 3I4MC 2PMZD 1SMYA 5FLMK 3GTGK 3S1RK 5M5WK 3GTJK 3S16K 4C3JK 5IP9K 1IW7A 4LLGA 2JA6K 4A3FK 5IYDK 4A3KC 4A3JC 1K83K 1Y1WK 2E2IC 2JA6C 4OIQA 3GTQC 4BY7K 2E2JK 3GTJC 3HOVK 1R9TK 4BBRC 5FLMC 1TWAC 3HKZD 3S1QC 4QJVA 2JA5K 3GTMC 2NVYK 5TMFA 3HOYK 4XLPA 2NVTC 1I3QC 4MEYA 4QIWL 1TWCK 4MEXA 2PA8D 3PO2C 4A93K 3K7AC 4ZH4A 4YFNA 4A3BC 2A6HA 2PMZL 3HOYC 4G7HA 4QJVB 4LK0A 1XPPA 3FKIC 3CQZC 1Y1VK 4XSXA 4A3DC 2O5JA 4AYBL 4YFKA 4MQ9A 4A3KK 1K83C 4OIPA 4C3IK 5D4DA 5IYBC 1Y1WC 2E2IK 2Y0SL 3HOWC 3CQZK 5M3FK 3GTGC 3S16C 4BBSK 1YNNA 4BXXK 2WAQL 3S15K 3S2DC 3PO3C 5FJ8K 4XSZA 3PO2K 5M5XK 1TWCC 4C2MK 2VUMC 1I3QK 5IYCK 4OIRA 3HOZC 4AYBD 4Y7NC 2NVYC 3S2DK 3S1QK 2A68A 3HOXK 2JA5C 3GTOC 3GTMK 1R9TC 1I50K 2E2HK 2PPBA 2YU9K 3GTQK 4A3IC 3GTKC 2E2JC 1I6HK 2PA8L 4Q4ZA 3S1MK 3HOWK 4QIWD 3M4OK 4A3GK 4KN7A 4LK1A 4LJZA 3S1MC 4BY1K 4KN4A 3S1RC 4BY1C 4A3GC 5TMCA 5C3EC 2JA7C 3EQLA 4GZYA 1TWHC 2NVQC 4KMUA 3RZOC 4OINA 2R92C 3H3VD 4NOIA 2CW0A 5IP7C 4A3MK 2R7ZC 2VUMK 3M3YK 1TWGC 1YNJA 2WB1D 4YG2A 2NVXC 2JA8K 4A3EK 2JA8C 2NVTK 4X6AC 5IYCC 4BXXC 2A69A 1TWAK 2R92K 3HOVC 3WODA 2A6EA 4A3CK 5C4XK
chains in the Genus database with same CATH superfamily
4G0VA 3S2HC 3H0GK 1Y1VC 3H3VL 2WAQD 1BDFA 4G7ZA 5C4XC 1O2BA 3GTLK 2R7ZA 4KARA 1WCMC 2NVXK 2XCQA 5C44C 3GTPA 4YFXA 1TWCA 3MMLB 5IP7K 4BBRK 3BUEA 4OIOA 4BY7C 1SFOA 5M5YK 2B63K 3FOEA 4P5AA 4C3HK 3LPXA 3AD7C 2B63C 1B4AA 4WJ4A 1WQHA 3FKIK 3GTOK 5C4JK 1I50C 1TWAA 1J98A 1WCMA 1WQGA 4A3LC 4A3LK 3A8JA 2R7ZK 1WSVA 5C4JC 3GTLC 1TWHK 3PO3K 3IPJA 2P8TA 1SMYA 3GIRA 3GTGK 1WOOA 1BJTA 5M5WK 3N0CA 4C3JK 3GTJK 2JA6K 4A3KC 1K83K 1O26A 3JSTA 4C3HC 1USOA 3AH5A 3OREA 3GTJC 1R9TK 4BBRC 2V6TA 3HKZD 3S1QC 1BGWA 4QJVA 5TMFA 3GEEA 1I3QC 1WSRA 1TWCK 4C2MC 2PA8D 3PO2C 3K7AC 4QJVB 1XPPA 3FKIC 4XSXA 1YCLA 2GAHC 3GTGA 3T02A 3GDZA 4OIPA 2JA6A 2FQTA 3G4CA 3GTGC 2D6FC 3S16C 3H0GA 1K83A 1DCHA 2WAQL 4BXXK 3PO3C 2GSUA 2JA7A 3PO2K 1UV7A 1I3QK 3GTKA 4Y7NC 3OEPA 2A68A 2JA5C 3GTOC 3GTMK 1R9TC 3GTKC 3S1MK 3HOWK 2ZUEA 2JA5A 4GFQA 1VGXA 2JH3A 5TMCA 2JA7C 1TWHC 2NVQC 4KMUA 2R7ZC 3GTLA 2NVXC 2JA8C 3SZZA 1RU0A 1TWAK 3S0XA 4PABA 5C4XK 3AD9C 2R93A 4Y52C 2O5IA 2XCRB 3LAJA 4A3DK 3S2HK 2B63A 1TWHA 1J6VA 2E2HC 3HKZL 3NUHA 4AH6A 3SZYA 5C44K 4A3BK 1WCMK 4A3EC 4XCHA 1SFOC 2GSNA 1O25A 1O27A 4KAWX 2R93C 4BBSC 1XXAA 4Y52K 1V5VA 3H0GC 4A3JK 2R93K 5IYDC 4O2DA 5E68A 3S17C 2YU9C 4G7OA 5IOTA 3I4MK 1DCPA 1SFOK 2Y0SD 3S1NK 2PHCB 1JQWA 1F93A 3S17K 1IS1A 3RZOK 2JA7K 1ZBSA 5FLMK 3S1RK 3S16K 5IP9K 4LLGA 1G51A 5IYDK 3GEIA 4OIQA 3ERED 2E2JK 1O29A 2NVYK 4BLAA 4P5BA 4A93K 2V6SA 3HOYC 1XZPA 5D4DA 1Y1WC 2Y0SL 3GSIA 5M3FK 1F7UA 4G0UA 1BS2A 5FJ8K 2NVYA 4KMAA 5IYCK 1PJ7A 4OIRA 4AYBD 2NVYC 3HOXK 3CQZA 1I50K 3Q3QA 2E2HK 4C45A 1I6HK 2PA8L 1XXCA 4GTCA 3BP3A 3M4OK 2XCOA 4LJZA 4LK1A 3EQLA 2NVXA 4LOWA 4OINA 2R92C 2RH6A 3H3VD 2VUMK 1TWGC 4YG2A 2NVTK 3L4KA 4BXXC 3G4AA 4LR2A 4P9SA 1ZXOA 3HOVC 2A6EA 3S15C 1TWFK 3S14C 4GTAA 1VJEA 2E2HA 4JK1A 2WB1L 3GTMA 3GTKK 1GE9A 2R92A 4KASA 2BE5A 2YU9A 4FZBA 3HXAA 1TWGK 1O28A 3DXJA 3TFIA 2Y3PA 5CJ9A 3OPFA 1VH2A 3TTGA 4KATA 1L0WA 3T01A 4A3FC 2KWAA 3BP8C 4GTEA 5IORA 4A3CC 2VUMA 1I6VA 5M3MK 4LQYA 4Y7NK 3RZDC 1EH1A 3K7AK 1J6XA 3A8KA 2P5MA 4M1XA 4A3MC 4GT9A 3M3YC 4J3NA 1B4BA 5EGHA 3RZDK 2PMZD 1IQ0A 1ISEA 3FOFA 4A3FK 1O24A 3QX3A 1Y1WK 2JA6C 2EBBA 4BY7K 4KC6A 3HOVK 1WIHA 1WORA 1IL2A 3TFJA 3HOYK 4XLPA 4FM9A 2NVTC 4MEYA 1AB4A 1EFWA 3FKIA 3VA7A 4ZH4A 4YFNA 1INNA 3CQZC 1Y1VK 2O5JA 1XZQB 4YFKA 4MQ9A 4A3KK 4C3IK 2E2IK 4KMDA 4C3JC 3CQZK 3GTJA 1YNNA 1TWFA 1F7VA 1Y1WA 5JVOA 3S15K 4RMFA 4GTBA 3S2DC 1EK8A 4XSZA 1TWCC 4C2MK 2VUMC 1R9TA 5IOQA 3HOZC 3S1QK 2YU9K 4KM9A 1DCOA 4KB4A 4A3IC 2E2JC 2GSOA 3AD8C 1Y1VA 4BY1K 4A3GC 4KDDA 2ZFZA 3AQPA 3T00A 3RZOC 4NOIA 2CW0A 5IP7C 4A3MK 4X6AC 1YNJA 2RGRA 1EI6A 4A3EK 1I3QA 5IYCC 3GTOA 1O2FB 2A69A 2R92K 1TWGA 3WODA 5EGEA 2PPBA 4Q5SA 2E2IA 2CFAB 1HQMA 3AQOA 3S14K 3FHZA 5IYBK 3M4OC 1I6HC 4A93C 3HOUC 3HOXC 1I50A 4X6AK 1VRQC 5CHPA 1PJ5A 5IP9C 4G0WA 1WOSA 1J6WA 1TWFC 1IE0A 4XLNA 3L4JA 1ZYRA 4WJ3M 4A3IK 2CFAA 1JVIA 5JFEA 3GTPK 1JOEA 3I4NK 4ILDA 3GTPC 3I4NC 3HOZK 1O2AA 3HOUK 3S1NC 2NVQK 4GTLA 3N3YA 4PAAA 5C3EK 3LAPA 3I4MC 1KQ4A 1WOPA 1F9NA 3GTQA 1IW7A 4A3JC 4C3IC 2FQOA 2E2IC 1IBAA 3GTQC 3V4GA 5FLMC 1TWAC 5L46A 3ADAC 2JA5K 1VLOA 3GTMC 2V6UA 1USMA 1YX2A 4MEXA 4QIWL 4KM8A 4A3BC 4BLBA 2A6HA 2PMZL 4G7HA 4LK0A 2ZUFA 4A3DC 4GTDA 4AYBL 4WILA 1K83C 5IYBC 3HOWC 1ZQ1C 4BBSK 1X31C 5IOSA 5M5XK 5TJ3A 1DD5A 1WQFA 3S2DK 2GAGC 1HI9A 3GTQK 4Q4ZA 4DDQA 4QIWD 1EQRA 1C0AA 3N0BA 4A3GK 4KN7A 3GEHA 4BKWA 3S1MC 4KN4A 3S1RC 1ZVUA 4BY1C 3TFHA 4GTFA 5C3EC 2W7VA 1PJ6A 3CAGA 1XXBA 4GZYA 1XZPB 3M3YK 2WB1D 2JA8K 4KB2A 1XZQA 3A8IA 5HL8A 4A3CK 4KMHA
chains in the Genus database with same CATH topology
3S15C 3S2HC 1TWFK 3H0GK 1HQMA 4Y52C 3S14C 2O5IA 4Q5SA 3S14K 1Y1VC 4A3DK 4JK1A 5IYBK 2WB1L 2WAQD 3H3VL 3M4OC 3S2HK 1BDFA 4G7ZA 5C4XC 3GTKK 1I6HC 4A93C 2E2HC 3GTLK 2BE5A 3HOUC 3HOXC 3HKZL 5C44K 1WCMC 4A3BK 2NVXK 1WCMK 4A3EC 1SFOC 5C44C 1TWGK 4X6AK 4YFXA 5IP7K 4BBRK 3DXJA 4OIOA 4BY7C 5M5YK 2B63K 2R93C 4BBSC 5IP9C 4C3HK 4Y52K 1TWFC 3H0GC 4A3JK 4XLNA 2B63C 2R93K 5IYDC 4A3FC 1ZYRA 4A3CC 4A3IK 3FKIK 3GTOK 5C4JK 3S17C 1I50C 2YU9C 4G7OA 1I6VA 5M3MK 3I4MK 1SFOK 4Y7NK 3GTPK 3RZDC 2Y0SD 3K7AK 3I4NK 4A3LC 3GTPC 3S1NK 3HOZK 3I4NC 4A3LK 4A3MC 2R7ZK 5C4JC 3S17K 3M3YC 3GTLC 1TWHK 3HOUK 3S1NC 2NVQK 3RZOK 3PO3K 3RZDK 2JA7K 5C3EK 3I4MC 2PMZD 1SMYA 5FLMK 3GTGK 3S1RK 5M5WK 3GTJK 3S16K 4C3JK 5IP9K 1IW7A 4LLGA 2JA6K 4A3FK 5IYDK 4A3KC 4A3JC 1K83K 1Y1WK 2E2IC 2JA6C 4OIQA 3GTQC 4BY7K 2E2JK 3GTJC 3HOVK 1R9TK 4BBRC 5FLMC 1TWAC 3HKZD 3S1QC 4QJVA 2JA5K 3GTMC 2NVYK 5TMFA 3HOYK 4XLPA 2NVTC 1I3QC 4MEYA 4QIWL 1TWCK 4MEXA 2PA8D 3PO2C 4A93K 3K7AC 4ZH4A 4YFNA 4A3BC 2A6HA 2PMZL 3HOYC 4G7HA 4QJVB 4LK0A 1XPPA 3FKIC 3CQZC 1Y1VK 4XSXA 4A3DC 2O5JA 4AYBL 4YFKA 4MQ9A 4A3KK 1K83C 4OIPA 4C3IK 5D4DA 5IYBC 1Y1WC 2E2IK 2Y0SL 3HOWC 3CQZK 5M3FK 3GTGC 3S16C 4BBSK 1YNNA 4BXXK 2WAQL 3S15K 3S2DC 3PO3C 5FJ8K 4XSZA 3PO2K 5M5XK 1TWCC 4C2MK 2VUMC 1I3QK 5IYCK 4OIRA 3HOZC 4AYBD 4Y7NC 2NVYC 3S2DK 3S1QK 2A68A 3HOXK 2JA5C 3GTOC 3GTMK 1R9TC 1I50K 2E2HK 2PPBA 2YU9K 3GTQK 4A3IC 3GTKC 2E2JC 1I6HK 2PA8L 4Q4ZA 3S1MK 3HOWK 4QIWD 3M4OK 4A3GK 4KN7A 4LK1A 4LJZA 3S1MC 4BY1K 4KN4A 3S1RC 4BY1C 4A3GC 5TMCA 5C3EC 2JA7C 3EQLA 4GZYA 1TWHC 2NVQC 4KMUA 3RZOC 4OINA 2R92C 3H3VD 4NOIA 2CW0A 5IP7C 4A3MK 2R7ZC 2VUMK 3M3YK 1TWGC 1YNJA 2WB1D 4YG2A 2NVXC 2JA8K 4A3EK 2JA8C 2NVTK 4X6AC 5IYCC 4BXXC 2A69A 1TWAK 2R92K 3HOVC 3WODA 2A6EA 4A3CK 5C4XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 C;  3S2H C;  1TWF K;  3H0G K;  1HQM A;  4Y52 C;  3S14 C;  2O5I A;  4Q5S A;  3S14 K;  1Y1V C;  4A3D K;  4JK1 A;  5IYB K;  2WB1 L;  2WAQ D;  3H3V L;  3M4O C;  3S2H K;  1BDF A;  4G7Z A;  5C4X C;  3GTK K;  1I6H C;  4A93 C;  2E2H C;  3GTL K;  2BE5 A;  3HOU C;  3HOX C;  3HKZ L;  5C44 K;  1WCM C;  4A3B K;  2NVX K;  1WCM K;  4A3E C;  1SFO C;  5C44 C;  1TWG K;  4X6A K;  4YFX A;  5IP7 K;  4BBR K;  3DXJ A;  4OIO A;  4BY7 C;  5M5Y K;  2B63 K;  2R93 C;  4BBS C;  5IP9 C;  4C3H K;  4Y52 K;  1TWF C;  3H0G C;  4A3J K;  4XLN A;  2B63 C;  2R93 K;  5IYD C;  4A3F C;  1ZYR A;  4A3C C;  4A3I K;  3FKI K;  3GTO K;  5C4J K;  3S17 C;  1I50 C;  2YU9 C;  4G7O A;  1I6V A;  5M3M K;  3I4M K;  1SFO K;  4Y7N K;  3GTP K;  3RZD C;  2Y0S D;  3K7A K;  3I4N K;  4A3L C;  3GTP C;  3S1N K;  3HOZ K;  3I4N C;  4A3L K;  4A3M C;  2R7Z K;  5C4J C;  3S17 K;  3M3Y C;  3GTL C;  1TWH K;  3HOU K;  3S1N C;  2NVQ K;  3RZO K;  3PO3 K;  3RZD K;  2JA7 K;  5C3E K;  3I4M C;  2PMZ D;  1SMY A;  5FLM K;  3GTG K;  3S1R K;  5M5W K;  3GTJ K;  3S16 K;  4C3J K;  5IP9 K;  1IW7 A;  4LLG A;  2JA6 K;  4A3F K;  5IYD K;  4A3K C;  4A3J C;  1K83 K;  1Y1W K;  2E2I C;  2JA6 C;  4OIQ A;  3GTQ C;  4BY7 K;  2E2J K;  3GTJ C;  3HOV K;  1R9T K;  4BBR C;  5FLM C;  1TWA C;  3HKZ D;  3S1Q C;  4QJV A;  2JA5 K;  3GTM C;  2NVY K;  5TMF A;  3HOY K;  4XLP A;  2NVT C;  1I3Q C;  4MEY A;  4QIW L;  1TWC K;  4MEX A;  2PA8 D;  3PO2 C;  4A93 K;  3K7A C;  4ZH4 A;  4YFN A;  4A3B C;  2A6H A;  2PMZ L;  3HOY C;  4G7H A;  4QJV B;  4LK0 A;  1XPP A;  3FKI C;  3CQZ C;  1Y1V K;  4XSX A;  4A3D C;  2O5J A;  4AYB L;  4YFK A;  4MQ9 A;  4A3K K;  1K83 C;  4OIP A;  4C3I K;  5D4D A;  5IYB C;  1Y1W C;  2E2I K;  2Y0S L;  3HOW C;  3CQZ K;  5M3F K;  3GTG C;  3S16 C;  4BBS K;  1YNN A;  4BXX K;  2WAQ L;  3S15 K;  3S2D C;  3PO3 C;  5FJ8 K;  4XSZ A;  3PO2 K;  5M5X K;  1TWC C;  4C2M K;  2VUM C;  1I3Q K;  5IYC K;  4OIR A;  3HOZ C;  4AYB D;  4Y7N C;  2NVY C;  3S2D K;  3S1Q K;  2A68 A;  3HOX K;  2JA5 C;  3GTO C;  3GTM K;  1R9T C;  1I50 K;  2E2H K;  2PPB A;  2YU9 K;  3GTQ K;  4A3I C;  3GTK C;  2E2J C;  1I6H K;  2PA8 L;  4Q4Z A;  3S1M K;  3HOW K;  4QIW D;  3M4O K;  4A3G K;  4KN7 A;  4LK1 A;  4LJZ A;  3S1M C;  4BY1 K;  4KN4 A;  3S1R C;  4BY1 C;  4A3G C;  5TMC A;  5C3E C;  2JA7 C;  3EQL A;  4GZY A;  1TWH C;  2NVQ C;  4KMU A;  3RZO C;  4OIN A;  2R92 C;  3H3V D;  4NOI A;  2CW0 A;  5IP7 C;  4A3M K;  2R7Z C;  2VUM K;  3M3Y K;  1TWG C;  1YNJ A;  2WB1 D;  4YG2 A;  2NVX C;  2JA8 K;  4A3E K;  2JA8 C;  2NVT K;  4X6A C;  5IYC C;  4BXX C;  2A69 A;  1TWA K;  2R92 K;  3HOV C;  3WOD A;  2A6E A;  4A3C K;  5C4X K; 
#chains in the Genus database with same CATH topology
 4G0V A;  3S2H C;  3H0G K;  1Y1V C;  3H3V L;  2WAQ D;  1BDF A;  4G7Z A;  5C4X C;  1O2B A;  3GTL K;  2R7Z A;  4KAR A;  1WCM C;  2NVX K;  2XCQ A;  5C44 C;  3GTP A;  4YFX A;  1TWC A;  3MML B;  5IP7 K;  4BBR K;  3BUE A;  4OIO A;  4BY7 C;  1SFO A;  5M5Y K;  2B63 K;  3FOE A;  4P5A A;  4C3H K;  3LPX A;  3AD7 C;  2B63 C;  1B4A A;  4WJ4 A;  1WQH A;  3FKI K;  3GTO K;  5C4J K;  1I50 C;  1TWA A;  1J98 A;  1WCM A;  1WQG A;  4A3L C;  4A3L K;  3A8J A;  2R7Z K;  1WSV A;  5C4J C;  3GTL C;  1TWH K;  3PO3 K;  3IPJ A;  2P8T A;  1SMY A;  3GIR A;  3GTG K;  1WOO A;  1BJT A;  5M5W K;  3N0C A;  4C3J K;  3GTJ K;  2JA6 K;  4A3K C;  1K83 K;  1O26 A;  3JST A;  4C3H C;  1USO A;  3AH5 A;  3ORE A;  3GTJ C;  1R9T K;  4BBR C;  2V6T A;  3HKZ D;  3S1Q C;  1BGW A;  4QJV A;  5TMF A;  3GEE A;  1I3Q C;  1WSR A;  1TWC K;  4C2M C;  2PA8 D;  3PO2 C;  3K7A C;  4QJV B;  1XPP A;  3FKI C;  4XSX A;  1YCL A;  2GAH C;  3GTG A;  3T02 A;  3GDZ A;  4OIP A;  2JA6 A;  2FQT A;  3G4C A;  3GTG C;  2D6F C;  3S16 C;  3H0G A;  1K83 A;  1DCH A;  2WAQ L;  4BXX K;  3PO3 C;  2GSU A;  2JA7 A;  3PO2 K;  1UV7 A;  1I3Q K;  3GTK A;  4Y7N C;  3OEP A;  2A68 A;  2JA5 C;  3GTO C;  3GTM K;  1R9T C;  3GTK C;  3S1M K;  3HOW K;  2ZUE A;  2JA5 A;  4GFQ A;  1VGX A;  2JH3 A;  5TMC A;  2JA7 C;  1TWH C;  2NVQ C;  4KMU A;  2R7Z C;  3GTL A;  2NVX C;  2JA8 C;  3SZZ A;  1RU0 A;  1TWA K;  3S0X A;  4PAB A;  5C4X K;  3AD9 C;  2R93 A;  4Y52 C;  2O5I A;  2XCR B;  3LAJ A;  4A3D K;  3S2H K;  2B63 A;  1TWH A;  1J6V A;  2E2H C;  3HKZ L;  3NUH A;  4AH6 A;  3SZY A;  5C44 K;  4A3B K;  1WCM K;  4A3E C;  4XCH A;  1SFO C;  2GSN A;  1O25 A;  1O27 A;  4KAW X;  2R93 C;  4BBS C;  1XXA A;  4Y52 K;  1V5V A;  3H0G C;  4A3J K;  2R93 K;  5IYD C;  4O2D A;  5E68 A;  3S17 C;  2YU9 C;  4G7O A;  5IOT A;  3I4M K;  1DCP A;  1SFO K;  2Y0S D;  3S1N K;  2PHC B;  1JQW A;  1F93 A;  3S17 K;  1IS1 A;  3RZO K;  2JA7 K;  1ZBS A;  5FLM K;  3S1R K;  3S16 K;  5IP9 K;  4LLG A;  1G51 A;  5IYD K;  3GEI A;  4OIQ A;  3ERE D;  2E2J K;  1O29 A;  2NVY K;  4BLA A;  4P5B A;  4A93 K;  2V6S A;  3HOY C;  1XZP A;  5D4D A;  1Y1W C;  2Y0S L;  3GSI A;  5M3F K;  1F7U A;  4G0U A;  1BS2 A;  5FJ8 K;  2NVY A;  4KMA A;  5IYC K;  1PJ7 A;  4OIR A;  4AYB D;  2NVY C;  3HOX K;  3CQZ A;  1I50 K;  3Q3Q A;  2E2H K;  4C45 A;  1I6H K;  2PA8 L;  1XXC A;  4GTC A;  3BP3 A;  3M4O K;  2XCO A;  4LJZ A;  4LK1 A;  3EQL A;  2NVX A;  4LOW A;  4OIN A;  2R92 C;  2RH6 A;  3H3V D;  2VUM K;  1TWG C;  4YG2 A;  2NVT K;  3L4K A;  4BXX C;  3G4A A;  4LR2 A;  4P9S A;  1ZXO A;  3HOV C;  2A6E A;  3S15 C;  1TWF K;  3S14 C;  4GTA A;  1VJE A;  2E2H A;  4JK1 A;  2WB1 L;  3GTM A;  3GTK K;  1GE9 A;  2R92 A;  4KAS A;  2BE5 A;  2YU9 A;  4FZB A;  3HXA A;  1TWG K;  1O28 A;  3DXJ A;  3TFI A;  2Y3P A;  5CJ9 A;  3OPF A;  1VH2 A;  3TTG A;  4KAT A;  1L0W A;  3T01 A;  4A3F C;  2KWA A;  3BP8 C;  4GTE A;  5IOR A;  4A3C C;  2VUM A;  1I6V A;  5M3M K;  4LQY A;  4Y7N K;  3RZD C;  1EH1 A;  3K7A K;  1J6X A;  3A8K A;  2P5M A;  4M1X A;  4A3M C;  4GT9 A;  3M3Y C;  4J3N A;  1B4B A;  5EGH A;  3RZD K;  2PMZ D;  1IQ0 A;  1ISE A;  3FOF A;  4A3F K;  1O24 A;  3QX3 A;  1Y1W K;  2JA6 C;  2EBB A;  4BY7 K;  4KC6 A;  3HOV K;  1WIH A;  1WOR A;  1IL2 A;  3TFJ A;  3HOY K;  4XLP A;  4FM9 A;  2NVT C;  4MEY A;  1AB4 A;  1EFW A;  3FKI A;  3VA7 A;  4ZH4 A;  4YFN A;  1INN A;  3CQZ C;  1Y1V K;  2O5J A;  1XZQ B;  4YFK A;  4MQ9 A;  4A3K K;  4C3I K;  2E2I K;  4KMD A;  4C3J C;  3CQZ K;  3GTJ A;  1YNN A;  1TWF A;  1F7V A;  1Y1W A;  5JVO A;  3S15 K;  4RMF A;  4GTB A;  3S2D C;  1EK8 A;  4XSZ A;  1TWC C;  4C2M K;  2VUM C;  1R9T A;  5IOQ A;  3HOZ C;  3S1Q K;  2YU9 K;  4KM9 A;  1DCO A;  4KB4 A;  4A3I C;  2E2J C;  2GSO A;  3AD8 C;  1Y1V A;  4BY1 K;  4A3G C;  4KDD A;  2ZFZ A;  3AQP A;  3T00 A;  3RZO C;  4NOI A;  2CW0 A;  5IP7 C;  4A3M K;  4X6A C;  1YNJ A;  2RGR A;  1EI6 A;  4A3E K;  1I3Q A;  5IYC C;  3GTO A;  1O2F B;  2A69 A;  2R92 K;  1TWG A;  3WOD A;  5EGE A;  2PPB A;  4Q5S A;  2E2I A;  2CFA B;  1HQM A;  3AQO A;  3S14 K;  3FHZ A;  5IYB K;  3M4O C;  1I6H C;  4A93 C;  3HOU C;  3HOX C;  1I50 A;  4X6A K;  1VRQ C;  5CHP A;  1PJ5 A;  5IP9 C;  4G0W A;  1WOS A;  1J6W A;  1TWF C;  1IE0 A;  4XLN A;  3L4J A;  1ZYR A;  4WJ3 M;  4A3I K;  2CFA A;  1JVI A;  5JFE A;  3GTP K;  1JOE A;  3I4N K;  4ILD A;  3GTP C;  3I4N C;  3HOZ K;  1O2A A;  3HOU K;  3S1N C;  2NVQ K;  4GTL A;  3N3Y A;  4PAA A;  5C3E K;  3LAP A;  3I4M C;  1KQ4 A;  1WOP A;  1F9N A;  3GTQ A;  1IW7 A;  4A3J C;  4C3I C;  2FQO A;  2E2I C;  1IBA A;  3GTQ C;  3V4G A;  5FLM C;  1TWA C;  5L46 A;  3ADA C;  2JA5 K;  1VLO A;  3GTM C;  2V6U A;  1USM A;  1YX2 A;  4MEX A;  4QIW L;  4KM8 A;  4A3B C;  4BLB A;  2A6H A;  2PMZ L;  4G7H A;  4LK0 A;  2ZUF A;  4A3D C;  4GTD A;  4AYB L;  4WIL A;  1K83 C;  5IYB C;  3HOW C;  1ZQ1 C;  4BBS K;  1X31 C;  5IOS A;  5M5X K;  5TJ3 A;  1DD5 A;  1WQF A;  3S2D K;  2GAG C;  1HI9 A;  3GTQ K;  4Q4Z A;  4DDQ A;  4QIW D;  1EQR A;  1C0A A;  3N0B A;  4A3G K;  4KN7 A;  3GEH A;  4BKW A;  3S1M C;  4KN4 A;  3S1R C;  1ZVU A;  4BY1 C;  3TFH A;  4GTF A;  5C3E C;  2W7V A;  1PJ6 A;  3CAG A;  1XXB A;  4GZY A;  1XZP B;  3M3Y K;  2WB1 D;  2JA8 K;  4KB2 A;  1XZQ A;  3A8I A;  5HL8 A;  4A3C K;  4KMH A; 
#chains in the Genus database with same CATH homology
 3S15 C;  3S2H C;  1TWF K;  3H0G K;  1HQM A;  4Y52 C;  3S14 C;  2O5I A;  4Q5S A;  3S14 K;  1Y1V C;  4A3D K;  4JK1 A;  5IYB K;  2WB1 L;  2WAQ D;  3H3V L;  3M4O C;  3S2H K;  1BDF A;  4G7Z A;  5C4X C;  3GTK K;  1I6H C;  4A93 C;  2E2H C;  3GTL K;  2BE5 A;  3HOU C;  3HOX C;  3HKZ L;  5C44 K;  1WCM C;  4A3B K;  2NVX K;  1WCM K;  4A3E C;  1SFO C;  5C44 C;  1TWG K;  4X6A K;  4YFX A;  5IP7 K;  4BBR K;  3DXJ A;  4OIO A;  4BY7 C;  5M5Y K;  2B63 K;  2R93 C;  4BBS C;  5IP9 C;  4C3H K;  4Y52 K;  1TWF C;  3H0G C;  4A3J K;  4XLN A;  2B63 C;  2R93 K;  5IYD C;  4A3F C;  1ZYR A;  4A3C C;  4A3I K;  3FKI K;  3GTO K;  5C4J K;  3S17 C;  1I50 C;  2YU9 C;  4G7O A;  1I6V A;  5M3M K;  3I4M K;  1SFO K;  4Y7N K;  3GTP K;  3RZD C;  2Y0S D;  3K7A K;  3I4N K;  4A3L C;  3GTP C;  3S1N K;  3HOZ K;  3I4N C;  4A3L K;  4A3M C;  2R7Z K;  5C4J C;  3S17 K;  3M3Y C;  3GTL C;  1TWH K;  3HOU K;  3S1N C;  2NVQ K;  3RZO K;  3PO3 K;  3RZD K;  2JA7 K;  5C3E K;  3I4M C;  2PMZ D;  1SMY A;  5FLM K;  3GTG K;  3S1R K;  5M5W K;  3GTJ K;  3S16 K;  4C3J K;  5IP9 K;  1IW7 A;  4LLG A;  2JA6 K;  4A3F K;  5IYD K;  4A3K C;  4A3J C;  1K83 K;  1Y1W K;  2E2I C;  2JA6 C;  4OIQ A;  3GTQ C;  4BY7 K;  2E2J K;  3GTJ C;  3HOV K;  1R9T K;  4BBR C;  5FLM C;  1TWA C;  3HKZ D;  3S1Q C;  4QJV A;  2JA5 K;  3GTM C;  2NVY K;  5TMF A;  3HOY K;  4XLP A;  2NVT C;  1I3Q C;  4MEY A;  4QIW L;  1TWC K;  4MEX A;  2PA8 D;  3PO2 C;  4A93 K;  3K7A C;  4ZH4 A;  4YFN A;  4A3B C;  2A6H A;  2PMZ L;  3HOY C;  4G7H A;  4QJV B;  4LK0 A;  1XPP A;  3FKI C;  3CQZ C;  1Y1V K;  4XSX A;  4A3D C;  2O5J A;  4AYB L;  4YFK A;  4MQ9 A;  4A3K K;  1K83 C;  4OIP A;  4C3I K;  5D4D A;  5IYB C;  1Y1W C;  2E2I K;  2Y0S L;  3HOW C;  3CQZ K;  5M3F K;  3GTG C;  3S16 C;  4BBS K;  1YNN A;  4BXX K;  2WAQ L;  3S15 K;  3S2D C;  3PO3 C;  5FJ8 K;  4XSZ A;  3PO2 K;  5M5X K;  1TWC C;  4C2M K;  2VUM C;  1I3Q K;  5IYC K;  4OIR A;  3HOZ C;  4AYB D;  4Y7N C;  2NVY C;  3S2D K;  3S1Q K;  2A68 A;  3HOX K;  2JA5 C;  3GTO C;  3GTM K;  1R9T C;  1I50 K;  2E2H K;  2PPB A;  2YU9 K;  3GTQ K;  4A3I C;  3GTK C;  2E2J C;  1I6H K;  2PA8 L;  4Q4Z A;  3S1M K;  3HOW K;  4QIW D;  3M4O K;  4A3G K;  4KN7 A;  4LK1 A;  4LJZ A;  3S1M C;  4BY1 K;  4KN4 A;  3S1R C;  4BY1 C;  4A3G C;  5TMC A;  5C3E C;  2JA7 C;  3EQL A;  4GZY A;  1TWH C;  2NVQ C;  4KMU A;  3RZO C;  4OIN A;  2R92 C;  3H3V D;  4NOI A;  2CW0 A;  5IP7 C;  4A3M K;  2R7Z C;  2VUM K;  3M3Y K;  1TWG C;  1YNJ A;  2WB1 D;  4YG2 A;  2NVX C;  2JA8 K;  4A3E K;  2JA8 C;  2NVT K;  4X6A C;  5IYC C;  4BXX C;  2A69 A;  1TWA K;  2R92 K;  3HOV C;  3WOD A;  2A6E A;  4A3C K;  5C4X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...