1Y1VK

Refined rna polymerase ii-tfiis complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1vK00
4A3JK 2BE5A 5C4XC 3FKIC 4A3BC 5D4DA 3HOWC 5IP7C 1TWAK 4G7HA 2JA6K 1K83C 4AYBD 2E2IC 4LLGA 4C3JK 2A6EA 3HOXK 2YU9K 3H3VL 5TMCA 3M3YK 2JA8K 3GTMC 4Y52C 5C4JC 2PA8L 4BY1C 2B63C 3I4MK 4A3IC 4A3KC 3HOYK 3K7AC 4MQ9A 3H0GK 3S2HK 5IYBK 3S16C 3S1NC 4BXXC 1R9TC 5IYDK 3EQLA 2JA5K 2NVTK 1TWGK 2R7ZK 1TWCC 2NVXC 3S1MC 1Y1VC 2PMZD 3I4NC 4XLNA 3HOUK 4OIPA 1I50K 4XSXA 2E2HC 4A93K 5IYCC 1ZYRA 4A3MC 1YNNA 2NVQK 4LK1A 2A6HA 4C3HK 2PMZL 3S1RC 4QIWL 3PO3C 5C44C 4NOIA 4Y7NK 1I6VA 5TMFA 5FLMK 3GTKK 3S15K 5C4XK 3GTQK 4A3DK 4XSZA 4ZH4A 5IP7K 1TWFC 2Y0SD 1I3QC 4A3GC 2CW0A 1TWHK 2R92C 4YFNA 3GTGK 3GTOK 3H3VD 3M4OK 3S2DC 1I6HC 5M3MK 5C4JK 5C3EK 2WAQD 5IP9K 5M5XK 3S14C 4A3KK 3HOYC 2PA8D 2R93K 4AYBL 3H0GC 4BXXK 3PO2C 3S1NK 3GTPK 5FJ8K 3GTJK 4OIRA 1SFOK 3WODA 3S17K 4GZYA 3S1QC 3I4NK 4A3EK 3HOUC 3HOZK 4BY7K 4A93C 3HOVC 2VUMK 3CQZC 1WCMC 4A3MK 4KMUA 4A3FC 4A3LC 4A3CC 3PO3K 1TWAC 5FLMC 3FKIK 3GTKC 3RZOC 4G7OA 2E2IK 3HOWK 2NVYK 2WAQL 4OIQA 4YFKA 1K83K 4BBSK 4BBRK 2E2JK 3HOXC 2YU9C 2JA8C 3GTMK 1I3QK 2Y0SL 3GTLK 3M3YC 3K7AK 4Y52K 3GTOC 3M4OC 2A68A 1XPPA 2B63K 1SMYA 5IYBC 3RZDK 3I4MC 4Q5SA 3S2HC 4OINA 4MEYA 2NVTC 5IYDC 4C3IK 2JA5C 1TWCK 2NVXK 3S1MK 4OIOA 2R7ZC 1Y1VK 5M3FK 1SFOC 1I50C 1Y1WK 2E2HK 3HKZL 3S17C 3S1QK 4A3EC 5M5YK 1YNJA 2JA7K 4A3CK 1HQMA 3HOVK 5IYCK 3HKZD 3S1RK 1WCMK 4A3JC 5C44K 2O5JA 4X6AC 5M5WK 4A3BK 4A3LK 3GTQC 4Y7NC 2A69A 4JK1A 2JA6C 3S15C 4KN4A 1BDFA 4A3DC 3RZOK 1IW7A 2NVYC 4Q4ZA 4BBSC 1TWFK 2R92K 3GTGC 3DXJA 4QJVA 4BBRC 2E2JC 4BY1K 3S2DK 4A3IK 4XLPA 1TWHC 5IP9C 4A3GK 4LK0A 3GTLC 1I6HK 4X6AK 2R93C 3S16K 5C3EC 1R9TK 3S14K 4C2MK 3RZDC 3GTPC 2PPBA 4QJVB 1TWGC 4G7ZA 3PO2K 2O5IA 2WB1D 3GTJC 4YG2A 4KN7A 4LJZA 3HOZC 4BY7C 4YFXA 2WB1L 1Y1WC 3CQZK 4MEXA 2NVQC 4QIWD 2JA7C 2VUMC 4A3FK
chains in the Genus database with same CATH superfamily
2BE5A 3FKIC 4A3BC 5IP7C 5IOTA 1I3QA 4G0WA 3M3YK 4KMDA 1ZBSA 3TFJA 3CAGA 4BXXC 1IQ0A 3S1NC 3N0CA 3BUEA 1TWCC 1Y1VC 3H0GA 2PMZD 4OIPA 1I50K 3ADAC 4A93K 4LOWA 4GTFA 4A3MC 4WJ4A 1WOPA 4Y7NK 5C4XK 3ERED 3GTLA 4RMFA 2V6UA 2CW0A 4YFNA 1I6HC 1BS2A 3AD7C 5IP9K 5M5XK 4AYBL 4G0VA 1Y1VA 3H0GC 1ZXOA 1O29A 2JA5A 1F7VA 1SFOK 5JFEA 4PAAA 3S0XA 2GAHC 4WILA 1F7UA 3HOUC 2VUMK 4WJ3M 3G4CA 4KMUA 4C3HC 1XZPB 2JA6A 4KASA 2NVYK 4OIQA 3N0BA 3NUHA 1WSRA 2JA8C 1I3QK 1EH1A 2JH3A 2Y0SL 5HL8A 3FHZA 1HI9A 5IOSA 1XPPA 1SMYA 5TJ3A 1B4BA 3T01A 4KDDA 4KAWX 4C3IK 3A8KA 3S1MK 5M3FK 2E2HK 5IYCK 5M5WK 3JSTA 4J3NA 4JK1A 3RZOK 1IW7A 1TWFK 2E2JC 4BY1K 1TWHC 1WIHA 1I6HK 3GTLC 4X6AK 3AQPA 2R93C 3S16K 1R9TK 3GTPA 1F93A 1PJ7A 1WORA 2WB1D 4YG2A 2R93A 4BY7C 1TWFA 5CJ9A 2NVQC 2JA7C 3L4KA 1TWCA 1DD5A 4A3JK 3HOWC 2JA6K 4KB2A 1O25A 4AYBD 4C3JK 3FOFA 5TMCA 3LAPA 1JOEA 3GTMC 1C0AA 4A3IC 4A3KC 3K7AC 3T00A 3S2HK 5IYBK 1B4AA 3GTKA 1XZQB 3QX3A 2FQOA 5IYDK 3AD8C 2JA5K 1TWGK 3S1MC 1USMA 4XSXA 1VH2A 3GEIA 1ZYRA 1VGXA 5JVOA 1BJTA 4QIWL 3PO3C 4GTBA 5FLMK 4G0UA 3GTQK 4XSZA 4ZH4A 1EQRA 5IOQA 5IORA 2R92C 3GTGK 3GTOK 3M4OK 3S2DC 5C4JK 5C3EK 2WAQD 3S14C 3HOYC 2R93K 1BGWA 1YX2A 2ZUEA 3PO2C 3GTPK 3S1NK 5FJ8K 3GTJK 1WQFA 3GTQA 1WCMA 4GZYA 4BLAA 1EK8A 3I4NK 4BY7K 3GTGA 3CQZA 1WCMC 1SFOA 4A3MK 3GDZA 4A3LC 3BP8C 1YCLA 1TWAC 3FKIK 5E68A 2E2IK 3LAJA 2WAQL 4C3JC 1Y1WA 3M3YC 4C2MC 1O2AA 3RZDK 1O26A 4OINA 4MEYA 1XXCA 4KMHA 3FKIA 1RU0A 1SFOC 3S17C 1VLOA 2GSUA 4A3CK 3HOVK 3S1RK 3G4AA 5C44K 4Y7NC 1PJ5A 1O28A 4BBSC 3DXJA 2CFAB 4QJVA 4O2DA 1K83A 1WOSA 4LK0A 4GTLA 1AB4A 5C3EC 1EI6A 1ISEA 3FOEA 3A8JA 4G7ZA 4KATA 3GTJC 1R9TA 3GSIA 3L4JA 3HOZC 2WB1L 3CQZK 2YU9A 2XCQA 1UV7A 4QIWD 2VUMC 4A3FK 5L46A 5C4XC 2Y3PA 4LR2A 5D4DA 1K83C 4LLGA 1J6VA 2A6EA 3GTOA 5EGEA 4GTAA 2JA8K 4Y52C 4BY1C 3I4MK 4MQ9A 3H0GK 1R9TC 1O24A 2ZFZA 4C3IC 2VUMA 1VRQC 2E2HC 1WOOA 1DCHA 2NVQK 2PMZL 3Q3QA 4AH6A 3S1RC 5C44C 4NOIA 2NVYA 3GTKK 3S15K 3TTGA 1TWGA 4A3DK 2B63A 5IP7K 1I3QC 5EGHA 2V6SA 2GAGC 3H3VD 2XCOA 1VJEA 3SZYA 2PA8D 4DDQA 4BXXK 1J6WA 2PHCB 4KC6A 3WODA 3S1QC 4A3EK 1F9NA 3HOZK 4A93C 3GEHA 3CQZC 1I50A 4A3FC 3PO3K 1WQHA 5FLMC 4G7OA 3HOWK 4YFKA 4P5AA 4BBRK 1IE0A 1O2BA 1O27A 4C45A 2JA7A 1TWHA 4Y52K 3GTOC 3M4OC 3I4MC 3S2HC 2NVTC 5IYDC 2P8TA 2JA5C 2NVXK 4GT9A 4OIOA 1Y1VK 1I50C 1Y1WK 3HKZL 1USOA 1JVIA 2RH6A 1XXBA 3IPJA 1XZPA 4BKWA 4LQYA 1WCMK 2O5JA 4BLBA 2E2HA 1G51A 4A3BK 1GE9A 4A3LK 3LPXA 2A69A 2JA6C 3VA7A 3S15C 1BDFA 4A3DC 2GSNA 2NVYC 4FM9A 4A3IK 4XLPA 2V6TA 2P5MA 1O2FB 3S14K 3PO2K 2ZUFA 3TFIA 3OPFA 4KN7A 4LJZA 4YFXA 5CHPA 4P9SA 4A3CC 1WQGA 2E2IA 1JQWA 4GTDA 4P5BA 1TWAK 4G7HA 2E2IC 3HOXK 2XCRB 2YU9K 3H3VL 4GTCA 1XZQA 3OREA 2PA8L 5C4JC 2B63C 3HOYK 1J98A 3S16C 4KARA 3OEPA 4KM9A 3EQLA 4PABA 2NVTK 2R7ZK 2D6FC 2NVXC 3GEEA 4KM8A 3GIRA 4XLNA 1ZQ1C 2W7VA 3HOUK 3I4NC 1INNA 5IYCC 1YNNA 2A6HA 4LK1A 4C3HK 1I6VA 5TMFA 3AD9C 1TWFC 2Y0SD 4FZBA 4A3GC 1TWHK 4M1XA 4GFQA 3T02A 4X6AC 5M3MK 2RGRA 4A3KK 1PJ6A 4KB4A 2KWAA 4OIRA 3S17K 3A8IA 3GTMA 3HOVC 3V4GA 1DCPA 1KQ4A 3GTKC 3RZOC 3HXAA 1K83K 4BBSK 2E2JK 3TFHA 1J6XA 3HOXC 2YU9C 3GTMK 3GTLK 3K7AK 1DCOA 2A68A 2B63K 5IYBC 4Q5SA 3N3YA 1V5VA 3GTJA 3AQOA 1TWCK 2R7ZC 3S1QK 1IBAA 4XCHA 4A3EC 5M5YK 1YNJA 2JA7K 1HQMA 2R92A 3HKZD 4A3JC 4GTEA 1L0WA 3GTQC 1TWAA 2FQTA 4KN4A 3SZZA 1WSVA 1ZVUA 4Q4ZA 2R92K 3GTGC 4BBRC 3S2DK 4A3GK 4KMAA 4ILDA 5IP9C 2GSOA 1IL2A 2R7ZA 4C2MK 3RZDC 3GTPC 2PPBA 1XXAA 2CFAA 1TWGC 4QJVB 3AH5A 2O5IA 3BP3A 2EBBA 1Y1WC 1EFWA 1IS1A 4MEXA 1X31C 3MMLB 2NVXA
chains in the Genus database with same CATH topology
4A3JK 2BE5A 5C4XC 3FKIC 4A3BC 5D4DA 3HOWC 5IP7C 1TWAK 4G7HA 2JA6K 1K83C 4AYBD 2E2IC 4LLGA 4C3JK 2A6EA 3HOXK 2YU9K 3H3VL 5TMCA 3M3YK 2JA8K 3GTMC 4Y52C 5C4JC 2PA8L 4BY1C 2B63C 3I4MK 4A3IC 4A3KC 3HOYK 3K7AC 4MQ9A 3H0GK 3S2HK 5IYBK 3S16C 3S1NC 4BXXC 1R9TC 5IYDK 3EQLA 2JA5K 2NVTK 1TWGK 2R7ZK 1TWCC 2NVXC 3S1MC 1Y1VC 2PMZD 3I4NC 4XLNA 3HOUK 4OIPA 1I50K 4XSXA 2E2HC 4A93K 5IYCC 1ZYRA 4A3MC 1YNNA 2NVQK 4LK1A 2A6HA 4C3HK 2PMZL 3S1RC 4QIWL 3PO3C 5C44C 4NOIA 4Y7NK 1I6VA 5TMFA 5FLMK 3GTKK 3S15K 5C4XK 3GTQK 4A3DK 4XSZA 4ZH4A 5IP7K 1TWFC 2Y0SD 1I3QC 4A3GC 2CW0A 1TWHK 2R92C 4YFNA 3GTGK 3GTOK 3H3VD 3M4OK 3S2DC 1I6HC 5M3MK 5C4JK 5C3EK 2WAQD 5IP9K 5M5XK 3S14C 4A3KK 3HOYC 2PA8D 2R93K 4AYBL 3H0GC 4BXXK 3PO2C 3S1NK 3GTPK 5FJ8K 3GTJK 4OIRA 1SFOK 3WODA 3S17K 4GZYA 3S1QC 3I4NK 4A3EK 3HOUC 3HOZK 4BY7K 4A93C 3HOVC 2VUMK 3CQZC 1WCMC 4A3MK 4KMUA 4A3FC 4A3LC 4A3CC 3PO3K 1TWAC 5FLMC 3FKIK 3GTKC 3RZOC 4G7OA 2E2IK 3HOWK 2NVYK 2WAQL 4OIQA 4YFKA 1K83K 4BBSK 4BBRK 2E2JK 3HOXC 2YU9C 2JA8C 3GTMK 1I3QK 2Y0SL 3GTLK 3M3YC 3K7AK 4Y52K 3GTOC 3M4OC 2A68A 1XPPA 2B63K 1SMYA 5IYBC 3RZDK 3I4MC 4Q5SA 3S2HC 4OINA 4MEYA 2NVTC 5IYDC 4C3IK 2JA5C 1TWCK 2NVXK 3S1MK 4OIOA 2R7ZC 1Y1VK 5M3FK 1SFOC 1I50C 1Y1WK 2E2HK 3HKZL 3S17C 3S1QK 4A3EC 5M5YK 1YNJA 2JA7K 4A3CK 1HQMA 3HOVK 5IYCK 3HKZD 3S1RK 1WCMK 4A3JC 5C44K 2O5JA 4X6AC 5M5WK 4A3BK 4A3LK 3GTQC 4Y7NC 2A69A 4JK1A 2JA6C 3S15C 4KN4A 1BDFA 4A3DC 3RZOK 1IW7A 2NVYC 4Q4ZA 4BBSC 1TWFK 2R92K 3GTGC 3DXJA 4QJVA 4BBRC 2E2JC 4BY1K 3S2DK 4A3IK 4XLPA 1TWHC 5IP9C 4A3GK 4LK0A 3GTLC 1I6HK 4X6AK 2R93C 3S16K 5C3EC 1R9TK 3S14K 4C2MK 3RZDC 3GTPC 2PPBA 4QJVB 1TWGC 4G7ZA 3PO2K 2O5IA 2WB1D 3GTJC 4YG2A 4KN7A 4LJZA 3HOZC 4BY7C 4YFXA 2WB1L 1Y1WC 3CQZK 4MEXA 2NVQC 4QIWD 2JA7C 2VUMC 4A3FK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J K;  2BE5 A;  5C4X C;  3FKI C;  4A3B C;  5D4D A;  3HOW C;  5IP7 C;  1TWA K;  4G7H A;  2JA6 K;  1K83 C;  4AYB D;  2E2I C;  4LLG A;  4C3J K;  2A6E A;  3HOX K;  2YU9 K;  3H3V L;  5TMC A;  3M3Y K;  2JA8 K;  3GTM C;  4Y52 C;  5C4J C;  2PA8 L;  4BY1 C;  2B63 C;  3I4M K;  4A3I C;  4A3K C;  3HOY K;  3K7A C;  4MQ9 A;  3H0G K;  3S2H K;  5IYB K;  3S16 C;  3S1N C;  4BXX C;  1R9T C;  5IYD K;  3EQL A;  2JA5 K;  2NVT K;  1TWG K;  2R7Z K;  1TWC C;  2NVX C;  3S1M C;  1Y1V C;  2PMZ D;  3I4N C;  4XLN A;  3HOU K;  4OIP A;  1I50 K;  4XSX A;  2E2H C;  4A93 K;  5IYC C;  1ZYR A;  4A3M C;  1YNN A;  2NVQ K;  4LK1 A;  2A6H A;  4C3H K;  2PMZ L;  3S1R C;  4QIW L;  3PO3 C;  5C44 C;  4NOI A;  4Y7N K;  1I6V A;  5TMF A;  5FLM K;  3GTK K;  3S15 K;  5C4X K;  3GTQ K;  4A3D K;  4XSZ A;  4ZH4 A;  5IP7 K;  1TWF C;  2Y0S D;  1I3Q C;  4A3G C;  2CW0 A;  1TWH K;  2R92 C;  4YFN A;  3GTG K;  3GTO K;  3H3V D;  3M4O K;  3S2D C;  1I6H C;  5M3M K;  5C4J K;  5C3E K;  2WAQ D;  5IP9 K;  5M5X K;  3S14 C;  4A3K K;  3HOY C;  2PA8 D;  2R93 K;  4AYB L;  3H0G C;  4BXX K;  3PO2 C;  3S1N K;  3GTP K;  5FJ8 K;  3GTJ K;  4OIR A;  1SFO K;  3WOD A;  3S17 K;  4GZY A;  3S1Q C;  3I4N K;  4A3E K;  3HOU C;  3HOZ K;  4BY7 K;  4A93 C;  3HOV C;  2VUM K;  3CQZ C;  1WCM C;  4A3M K;  4KMU A;  4A3F C;  4A3L C;  4A3C C;  3PO3 K;  1TWA C;  5FLM C;  3FKI K;  3GTK C;  3RZO C;  4G7O A;  2E2I K;  3HOW K;  2NVY K;  2WAQ L;  4OIQ A;  4YFK A;  1K83 K;  4BBS K;  4BBR K;  2E2J K;  3HOX C;  2YU9 C;  2JA8 C;  3GTM K;  1I3Q K;  2Y0S L;  3GTL K;  3M3Y C;  3K7A K;  4Y52 K;  3GTO C;  3M4O C;  2A68 A;  1XPP A;  2B63 K;  1SMY A;  5IYB C;  3RZD K;  3I4M C;  4Q5S A;  3S2H C;  4OIN A;  4MEY A;  2NVT C;  5IYD C;  4C3I K;  2JA5 C;  1TWC K;  2NVX K;  3S1M K;  4OIO A;  2R7Z C;  1Y1V K;  5M3F K;  1SFO C;  1I50 C;  1Y1W K;  2E2H K;  3HKZ L;  3S17 C;  3S1Q K;  4A3E C;  5M5Y K;  1YNJ A;  2JA7 K;  4A3C K;  1HQM A;  3HOV K;  5IYC K;  3HKZ D;  3S1R K;  1WCM K;  4A3J C;  5C44 K;  2O5J A;  4X6A C;  5M5W K;  4A3B K;  4A3L K;  3GTQ C;  4Y7N C;  2A69 A;  4JK1 A;  2JA6 C;  3S15 C;  4KN4 A;  1BDF A;  4A3D C;  3RZO K;  1IW7 A;  2NVY C;  4Q4Z A;  4BBS C;  1TWF K;  2R92 K;  3GTG C;  3DXJ A;  4QJV A;  4BBR C;  2E2J C;  4BY1 K;  3S2D K;  4A3I K;  4XLP A;  1TWH C;  5IP9 C;  4A3G K;  4LK0 A;  3GTL C;  1I6H K;  4X6A K;  2R93 C;  3S16 K;  5C3E C;  1R9T K;  3S14 K;  4C2M K;  3RZD C;  3GTP C;  2PPB A;  4QJV B;  1TWG C;  4G7Z A;  3PO2 K;  2O5I A;  2WB1 D;  3GTJ C;  4YG2 A;  4KN7 A;  4LJZ A;  3HOZ C;  4BY7 C;  4YFX A;  2WB1 L;  1Y1W C;  3CQZ K;  4MEX A;  2NVQ C;  4QIW D;  2JA7 C;  2VUM C;  4A3F K; 
#chains in the Genus database with same CATH topology
 2BE5 A;  3FKI C;  4A3B C;  5IP7 C;  5IOT A;  1I3Q A;  4G0W A;  3M3Y K;  4KMD A;  1ZBS A;  3TFJ A;  3CAG A;  4BXX C;  1IQ0 A;  3S1N C;  3N0C A;  3BUE A;  1TWC C;  1Y1V C;  3H0G A;  2PMZ D;  4OIP A;  1I50 K;  3ADA C;  4A93 K;  4LOW A;  4GTF A;  4A3M C;  4WJ4 A;  1WOP A;  4Y7N K;  5C4X K;  3ERE D;  3GTL A;  4RMF A;  2V6U A;  2CW0 A;  4YFN A;  1I6H C;  1BS2 A;  3AD7 C;  5IP9 K;  5M5X K;  4AYB L;  4G0V A;  1Y1V A;  3H0G C;  1ZXO A;  1O29 A;  2JA5 A;  1F7V A;  1SFO K;  5JFE A;  4PAA A;  3S0X A;  2GAH C;  4WIL A;  1F7U A;  3HOU C;  2VUM K;  4WJ3 M;  3G4C A;  4KMU A;  4C3H C;  1XZP B;  2JA6 A;  4KAS A;  2NVY K;  4OIQ A;  3N0B A;  3NUH A;  1WSR A;  2JA8 C;  1I3Q K;  1EH1 A;  2JH3 A;  2Y0S L;  5HL8 A;  3FHZ A;  1HI9 A;  5IOS A;  1XPP A;  1SMY A;  5TJ3 A;  1B4B A;  3T01 A;  4KDD A;  4KAW X;  4C3I K;  3A8K A;  3S1M K;  5M3F K;  2E2H K;  5IYC K;  5M5W K;  3JST A;  4J3N A;  4JK1 A;  3RZO K;  1IW7 A;  1TWF K;  2E2J C;  4BY1 K;  1TWH C;  1WIH A;  1I6H K;  3GTL C;  4X6A K;  3AQP A;  2R93 C;  3S16 K;  1R9T K;  3GTP A;  1F93 A;  1PJ7 A;  1WOR A;  2WB1 D;  4YG2 A;  2R93 A;  4BY7 C;  1TWF A;  5CJ9 A;  2NVQ C;  2JA7 C;  3L4K A;  1TWC A;  1DD5 A;  4A3J K;  3HOW C;  2JA6 K;  4KB2 A;  1O25 A;  4AYB D;  4C3J K;  3FOF A;  5TMC A;  3LAP A;  1JOE A;  3GTM C;  1C0A A;  4A3I C;  4A3K C;  3K7A C;  3T00 A;  3S2H K;  5IYB K;  1B4A A;  3GTK A;  1XZQ B;  3QX3 A;  2FQO A;  5IYD K;  3AD8 C;  2JA5 K;  1TWG K;  3S1M C;  1USM A;  4XSX A;  1VH2 A;  3GEI A;  1ZYR A;  1VGX A;  5JVO A;  1BJT A;  4QIW L;  3PO3 C;  4GTB A;  5FLM K;  4G0U A;  3GTQ K;  4XSZ A;  4ZH4 A;  1EQR A;  5IOQ A;  5IOR A;  2R92 C;  3GTG K;  3GTO K;  3M4O K;  3S2D C;  5C4J K;  5C3E K;  2WAQ D;  3S14 C;  3HOY C;  2R93 K;  1BGW A;  1YX2 A;  2ZUE A;  3PO2 C;  3GTP K;  3S1N K;  5FJ8 K;  3GTJ K;  1WQF A;  3GTQ A;  1WCM A;  4GZY A;  4BLA A;  1EK8 A;  3I4N K;  4BY7 K;  3GTG A;  3CQZ A;  1WCM C;  1SFO A;  4A3M K;  3GDZ A;  4A3L C;  3BP8 C;  1YCL A;  1TWA C;  3FKI K;  5E68 A;  2E2I K;  3LAJ A;  2WAQ L;  4C3J C;  1Y1W A;  3M3Y C;  4C2M C;  1O2A A;  3RZD K;  1O26 A;  4OIN A;  4MEY A;  1XXC A;  4KMH A;  3FKI A;  1RU0 A;  1SFO C;  3S17 C;  1VLO A;  2GSU A;  4A3C K;  3HOV K;  3S1R K;  3G4A A;  5C44 K;  4Y7N C;  1PJ5 A;  1O28 A;  4BBS C;  3DXJ A;  2CFA B;  4QJV A;  4O2D A;  1K83 A;  1WOS A;  4LK0 A;  4GTL A;  1AB4 A;  5C3E C;  1EI6 A;  1ISE A;  3FOE A;  3A8J A;  4G7Z A;  4KAT A;  3GTJ C;  1R9T A;  3GSI A;  3L4J A;  3HOZ C;  2WB1 L;  3CQZ K;  2YU9 A;  2XCQ A;  1UV7 A;  4QIW D;  2VUM C;  4A3F K;  5L46 A;  5C4X C;  2Y3P A;  4LR2 A;  5D4D A;  1K83 C;  4LLG A;  1J6V A;  2A6E A;  3GTO A;  5EGE A;  4GTA A;  2JA8 K;  4Y52 C;  4BY1 C;  3I4M K;  4MQ9 A;  3H0G K;  1R9T C;  1O24 A;  2ZFZ A;  4C3I C;  2VUM A;  1VRQ C;  2E2H C;  1WOO A;  1DCH A;  2NVQ K;  2PMZ L;  3Q3Q A;  4AH6 A;  3S1R C;  5C44 C;  4NOI A;  2NVY A;  3GTK K;  3S15 K;  3TTG A;  1TWG A;  4A3D K;  2B63 A;  5IP7 K;  1I3Q C;  5EGH A;  2V6S A;  2GAG C;  3H3V D;  2XCO A;  1VJE A;  3SZY A;  2PA8 D;  4DDQ A;  4BXX K;  1J6W A;  2PHC B;  4KC6 A;  3WOD A;  3S1Q C;  4A3E K;  1F9N A;  3HOZ K;  4A93 C;  3GEH A;  3CQZ C;  1I50 A;  4A3F C;  3PO3 K;  1WQH A;  5FLM C;  4G7O A;  3HOW K;  4YFK A;  4P5A A;  4BBR K;  1IE0 A;  1O2B A;  1O27 A;  4C45 A;  2JA7 A;  1TWH A;  4Y52 K;  3GTO C;  3M4O C;  3I4M C;  3S2H C;  2NVT C;  5IYD C;  2P8T A;  2JA5 C;  2NVX K;  4GT9 A;  4OIO A;  1Y1V K;  1I50 C;  1Y1W K;  3HKZ L;  1USO A;  1JVI A;  2RH6 A;  1XXB A;  3IPJ A;  1XZP A;  4BKW A;  4LQY A;  1WCM K;  2O5J A;  4BLB A;  2E2H A;  1G51 A;  4A3B K;  1GE9 A;  4A3L K;  3LPX A;  2A69 A;  2JA6 C;  3VA7 A;  3S15 C;  1BDF A;  4A3D C;  2GSN A;  2NVY C;  4FM9 A;  4A3I K;  4XLP A;  2V6T A;  2P5M A;  1O2F B;  3S14 K;  3PO2 K;  2ZUF A;  3TFI A;  3OPF A;  4KN7 A;  4LJZ A;  4YFX A;  5CHP A;  4P9S A;  4A3C C;  1WQG A;  2E2I A;  1JQW A;  4GTD A;  4P5B A;  1TWA K;  4G7H A;  2E2I C;  3HOX K;  2XCR B;  2YU9 K;  3H3V L;  4GTC A;  1XZQ A;  3ORE A;  2PA8 L;  5C4J C;  2B63 C;  3HOY K;  1J98 A;  3S16 C;  4KAR A;  3OEP A;  4KM9 A;  3EQL A;  4PAB A;  2NVT K;  2R7Z K;  2D6F C;  2NVX C;  3GEE A;  4KM8 A;  3GIR A;  4XLN A;  1ZQ1 C;  2W7V A;  3HOU K;  3I4N C;  1INN A;  5IYC C;  1YNN A;  2A6H A;  4LK1 A;  4C3H K;  1I6V A;  5TMF A;  3AD9 C;  1TWF C;  2Y0S D;  4FZB A;  4A3G C;  1TWH K;  4M1X A;  4GFQ A;  3T02 A;  4X6A C;  5M3M K;  2RGR A;  4A3K K;  1PJ6 A;  4KB4 A;  2KWA A;  4OIR A;  3S17 K;  3A8I A;  3GTM A;  3HOV C;  3V4G A;  1DCP A;  1KQ4 A;  3GTK C;  3RZO C;  3HXA A;  1K83 K;  4BBS K;  2E2J K;  3TFH A;  1J6X A;  3HOX C;  2YU9 C;  3GTM K;  3GTL K;  3K7A K;  1DCO A;  2A68 A;  2B63 K;  5IYB C;  4Q5S A;  3N3Y A;  1V5V A;  3GTJ A;  3AQO A;  1TWC K;  2R7Z C;  3S1Q K;  1IBA A;  4XCH A;  4A3E C;  5M5Y K;  1YNJ A;  2JA7 K;  1HQM A;  2R92 A;  3HKZ D;  4A3J C;  4GTE A;  1L0W A;  3GTQ C;  1TWA A;  2FQT A;  4KN4 A;  3SZZ A;  1WSV A;  1ZVU A;  4Q4Z A;  2R92 K;  3GTG C;  4BBR C;  3S2D K;  4A3G K;  4KMA A;  4ILD A;  5IP9 C;  2GSO A;  1IL2 A;  2R7Z A;  4C2M K;  3RZD C;  3GTP C;  2PPB A;  1XXA A;  2CFA A;  1TWG C;  4QJV B;  3AH5 A;  2O5I A;  3BP3 A;  2EBB A;  1Y1W C;  1EFW A;  1IS1 A;  4MEX A;  1X31 C;  3MML B;  2NVX A; 
#chains in the Genus database with same CATH homology
 4A3J K;  2BE5 A;  5C4X C;  3FKI C;  4A3B C;  5D4D A;  3HOW C;  5IP7 C;  1TWA K;  4G7H A;  2JA6 K;  1K83 C;  4AYB D;  2E2I C;  4LLG A;  4C3J K;  2A6E A;  3HOX K;  2YU9 K;  3H3V L;  5TMC A;  3M3Y K;  2JA8 K;  3GTM C;  4Y52 C;  5C4J C;  2PA8 L;  4BY1 C;  2B63 C;  3I4M K;  4A3I C;  4A3K C;  3HOY K;  3K7A C;  4MQ9 A;  3H0G K;  3S2H K;  5IYB K;  3S16 C;  3S1N C;  4BXX C;  1R9T C;  5IYD K;  3EQL A;  2JA5 K;  2NVT K;  1TWG K;  2R7Z K;  1TWC C;  2NVX C;  3S1M C;  1Y1V C;  2PMZ D;  3I4N C;  4XLN A;  3HOU K;  4OIP A;  1I50 K;  4XSX A;  2E2H C;  4A93 K;  5IYC C;  1ZYR A;  4A3M C;  1YNN A;  2NVQ K;  4LK1 A;  2A6H A;  4C3H K;  2PMZ L;  3S1R C;  4QIW L;  3PO3 C;  5C44 C;  4NOI A;  4Y7N K;  1I6V A;  5TMF A;  5FLM K;  3GTK K;  3S15 K;  5C4X K;  3GTQ K;  4A3D K;  4XSZ A;  4ZH4 A;  5IP7 K;  1TWF C;  2Y0S D;  1I3Q C;  4A3G C;  2CW0 A;  1TWH K;  2R92 C;  4YFN A;  3GTG K;  3GTO K;  3H3V D;  3M4O K;  3S2D C;  1I6H C;  5M3M K;  5C4J K;  5C3E K;  2WAQ D;  5IP9 K;  5M5X K;  3S14 C;  4A3K K;  3HOY C;  2PA8 D;  2R93 K;  4AYB L;  3H0G C;  4BXX K;  3PO2 C;  3S1N K;  3GTP K;  5FJ8 K;  3GTJ K;  4OIR A;  1SFO K;  3WOD A;  3S17 K;  4GZY A;  3S1Q C;  3I4N K;  4A3E K;  3HOU C;  3HOZ K;  4BY7 K;  4A93 C;  3HOV C;  2VUM K;  3CQZ C;  1WCM C;  4A3M K;  4KMU A;  4A3F C;  4A3L C;  4A3C C;  3PO3 K;  1TWA C;  5FLM C;  3FKI K;  3GTK C;  3RZO C;  4G7O A;  2E2I K;  3HOW K;  2NVY K;  2WAQ L;  4OIQ A;  4YFK A;  1K83 K;  4BBS K;  4BBR K;  2E2J K;  3HOX C;  2YU9 C;  2JA8 C;  3GTM K;  1I3Q K;  2Y0S L;  3GTL K;  3M3Y C;  3K7A K;  4Y52 K;  3GTO C;  3M4O C;  2A68 A;  1XPP A;  2B63 K;  1SMY A;  5IYB C;  3RZD K;  3I4M C;  4Q5S A;  3S2H C;  4OIN A;  4MEY A;  2NVT C;  5IYD C;  4C3I K;  2JA5 C;  1TWC K;  2NVX K;  3S1M K;  4OIO A;  2R7Z C;  1Y1V K;  5M3F K;  1SFO C;  1I50 C;  1Y1W K;  2E2H K;  3HKZ L;  3S17 C;  3S1Q K;  4A3E C;  5M5Y K;  1YNJ A;  2JA7 K;  4A3C K;  1HQM A;  3HOV K;  5IYC K;  3HKZ D;  3S1R K;  1WCM K;  4A3J C;  5C44 K;  2O5J A;  4X6A C;  5M5W K;  4A3B K;  4A3L K;  3GTQ C;  4Y7N C;  2A69 A;  4JK1 A;  2JA6 C;  3S15 C;  4KN4 A;  1BDF A;  4A3D C;  3RZO K;  1IW7 A;  2NVY C;  4Q4Z A;  4BBS C;  1TWF K;  2R92 K;  3GTG C;  3DXJ A;  4QJV A;  4BBR C;  2E2J C;  4BY1 K;  3S2D K;  4A3I K;  4XLP A;  1TWH C;  5IP9 C;  4A3G K;  4LK0 A;  3GTL C;  1I6H K;  4X6A K;  2R93 C;  3S16 K;  5C3E C;  1R9T K;  3S14 K;  4C2M K;  3RZD C;  3GTP C;  2PPB A;  4QJV B;  1TWG C;  4G7Z A;  3PO2 K;  2O5I A;  2WB1 D;  3GTJ C;  4YG2 A;  4KN7 A;  4LJZ A;  3HOZ C;  4BY7 C;  4YFX A;  2WB1 L;  1Y1W C;  3CQZ K;  4MEX A;  2NVQ C;  4QIW D;  2JA7 C;  2VUM C;  4A3F K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...