1Y1VK

Refined rna polymerase ii-tfiis complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1vK00
5IP7C 4C3HK 5M3MK 5M3FK 4G7ZA 2NVTK 3GTMK 3HOYK 3GTOC 4MQ9A 5M5XK 4X6AC 2WAQL 1TWCC 4Q4ZA 2B63C 5IYDK 1SFOC 4BY1K 2R93K 5IP9C 3GTJC 3GTLC 3I4MK 3HOUC 4AYBD 1TWGC 4Y7NC 1I6HC 4OIQA 4C2MK 2E2IK 1WCMK 3GTQC 3PO2K 1TWHC 1Y1VK 3CQZK 4BBRK 3RZDK 2JA7K 1K83C 3FKIC 4LK1A 1TWAK 4OIPA 3HOWC 3M4OC 3S1QC 2Y0SL 5C4JK 3HOZK 4A3GK 4A3FK 5IYCK 3K7AC 5FLMK 3EQLA 2E2HK 3DXJA 2R92C 5IYBC 2A68A 4A3KK 4A3MC 4G7HA 2NVQK 3S17C 4A93C 4A3LC 3M3YC 5C3EK 5C44K 2NVXC 4LLGA 4OINA 3GTPC 1IW7A 3S15K 5FJ8K 4BY7K 3H0GC 3S1RK 2A69A 4A3EK 3GTKC 4A3CC 2VUMK 4ZH4A 3S14K 3PO3C 3S1NK 3PO2C 4XLNA 3GTGC 1R9TC 3H3VD 4A3BK 4A3JC 5IP7K 4Y52C 4MEYA 5IYBK 4A3MK 3HOXC 4OIRA 4AYBL 3GTOK 4G7OA 3M3YK 3S2DC 2NVYC 3S2HC 4X6AK 3I4NC 2JA8C 3S16C 1Y1WC 1TWCK 2B63K 3HOVC 3S1MC 1SFOK 4QIWD 2PMZD 2R7ZC 1I3QC 4BBSK 5IP9K 3GTJK 3GTLK 5D4DA 2E2JC 3HOUK 3RZOC 1TWGK 1YNNA 4Y7NK 1I6HK 2PPBA 3GTQK 2WB1D 2NVYK 1TWHK 2CW0A 5C4XC 1ZYRA 4A3DC 1Y1WK 3HOVK 4BXXC 4KMUA 2JA6C 1K83K 3FKIK 4MEXA 2YU9C 3HOWK 3M4OK 3S2DK 3S1QK 2JA5C 1SMYA 2A6EA 4YG2A 2R93C 4LJZA 4BBSC 3K7AK 2NVTC 3H3VL 1TWFC 4QJVB 2R92K 3GTMC 4LK0A 3HOYC 3S17K 4A93K 4A3LK 2A6HA 2NVXK 1I6VA 1YNJA 3GTPK 2YU9K 2O5JA 2PA8D 3H0GK 5IYDC 3HKZD 3GTKK 4BY1C 4XSXA 4A3CK 3PO3K 4QIWL 2PMZL 3GTGK 4C3JK 1R9TK 3I4MC 5TMFA 4QJVA 5M5YK 1TWFK 4A3JK 4Y52K 4OIOA 4C3IK 3HOXK 4A3IC 2E2IC 1WCMC 4YFXA 2WAQD 5M5WK 5TMCA 1Y1VC 1I50C 3CQZC 4BBRC 3RZDC 2JA7C 2WB1L 3I4NK 3S2HK 2JA8K 3S16K 1HQMA 1TWAC 3S1MK 4A3GC 5C4JC 2O5IA 4YFNA 4XLPA 3HOZC 1I3QK 2R7ZK 4A3FC 1XPPA 3WODA 5IYCC 5FLMC 2E2JK 3RZOK 2E2HC 4XSZA 4A3IK 4GZYA 4A3KC 2NVQC 4Q5SA 1I50K 2BE5A 4JK1A 5C4XK 5C44C 5C3EC 4A3DK 4BXXK 1BDFA 2Y0SD 2JA6K 3S15C 4BY7C 4KN4A 3S1RC 4A3EC 2JA5K 2VUMC 2PA8L 4YFKA 4NOIA 3HKZL 3S14C 3S1NC 4KN7A 4A3BC
chains in the Genus database with same CATH superfamily
2NVTK 4KARA 3GSIA 5IOQA 3GTOC 1ISEA 2WAQL 1WCMA 1B4AA 1TWCC 2JH3A 1TWAA 1XXAA 1V5VA 1O29A 2E2HA 1WCMK 3N0BA 4KMDA 1TWAK 3IPJA 2EBBA 3K7AC 2E2HK 3DXJA 4LR2A 5IYBC 4A3MC 4A93C 2NVQK 3GEIA 4LLGA 3TFIA 4BLAA 3S15K 3OREA 2A69A 3PO3C 2B63A 3LAJA 4XLNA 3GTGC 3H3VD 5IP7K 2XCRB 1BJTA 5IYBK 4A3MK 5L46A 4LOWA 3GTJA 4G7OA 4AYBL 5IOTA 1TWGA 4G0UA 2B63K 3S1MC 4QIWD 3GTJK 5D4DA 3HOUK 1TWGK 2PPBA 1O27A 2R92A 3OEPA 4BXXC 4KATA 4KMUA 1K83K 3HOWK 1WORA 3L4KA 3GTPA 2JA5C 2R93C 1XZQA 4GTAA 4M1XA 2R92K 4LK0A 3TFHA 3S17K 2A6HA 1I6VA 3GTPK 1DCOA 2PA8D 3HKZD 2NVYA 4XSXA 1PJ6A 3AD7C 4C3JK 3VA7A 4XCHA 1I3QA 2V6SA 4C2MC 4GTCA 2E2IC 1O28A 5TMCA 1Y1VC 3NUHA 3I4NK 4A3GC 3HOZC 1G51A 2JA6A 1I3QK 4A3FC 1XPPA 5IORA 4KB4A 4GZYA 2XCQA 3BP8C 3G4AA 3JSTA 2JA6K 1F7UA 1B4BA 1ZXOA 3S1NC 1JVIA 1DD5A 4C3HK 5M3FK 3HOYK 1JOEA 1WIHA 5IYDK 1I50A 2JA7A 4BY1K 3S0XA 4DDQA 1I6HC 4OIQA 1VRQC 3PO2K 3RZDK 2JA7K 3FKIC 3HXAA 4LK1A 5IOSA 1F9NA 3S1QC 5C4JK 3GDZA 3EQLA 2VUMA 1O24A 2A68A 1XXCA 4A3LC 1RU0A 3M3YC 5C3EK 4O2DA 5C44K 2NVXC 4OINA 3GTOA 1YCLA 3S1RK 1BS2A 3GTKC 4A3CC 1XZPA 2VUMK 3S14K 1TWCA 3S2DK 1R9TC 4A3BK 4FM9A 4C3IC 4OIRA 3GTOK 3M3YK 3S2HC 1F93A 3T01A 1TWCK 3HOVC 2GSOA 2PMZD 2R7ZC 3N3YA 1UV7A 3OPFA 2E2JC 3RZOC 1XZQB 1YNNA 4KB2A 4P5AA 2WB1D 5CJ9A 1ZYRA 3LPXA 1EQRA 1IE0A 3HOVK 4AH6A 4GTBA 2YU9C 1SMYA 4LJZA 4WJ3M 3K7AK 4GTDA 1TWFC 3GTGA 3GTMC 1YX2A 4A93K 1YNJA 2YU9K 3A8KA 3PO3K 3GTGK 1K83A 3I4MC 5M5YK 1TWFK 1EFWA 4A3IC 3N0CA 1C0AA 2WAQD 5M5WK 3CQZC 4BBRC 3MMLB 2P5MA 4J3NA 3S1MK 2O5IA 4YFNA 1J98A 2CFAA 3V4GA 5IYCC 5FLMC 2JA5A 2R93A 2V6UA 4A3IK 4PABA 4A3KC 4Q5SA 1J6WA 1GE9A 4BXXK 4BY7C 4A3EC 2JA5K 1DCHA 3L4JA 4YFKA 4NOIA 2R93K 4PAAA 2FQOA 1ZQ1C 3FOFA 1O2AA 4MQ9A 4WJ4A 2E2IA 4X6AC 5EGHA 4Q4ZA 1Y1VA 1SFOC 3BUEA 3CAGA 4KMAA 2Y3PA 5IP9C 3GTLC 4AYBD 4Y7NC 1WQFA 4C2MK 4P5BA 2E2IK 2RH6A 3GTQC 1TWHC 1Y1VK 1O25A 2GAGC 5JVOA 3AQOA 3M4OC 2FQTA 4A3GK 2Y0SL 3HOZK 4A3FK 3FOEA 1XZPB 3TFJA 4G0WA 5EGEA 1IL2A 4GTFA 1IW7A 3T02A 5JFEA 3H0GC 4GTLA 1WQGA 3S1NK 4KM8A 4A3JC 4Y52C 4BKWA 3HOXC 1WOPA 1XXBA 1EH1A 2JA8C 3S16C 1Y1WC 1IS1A 3FKIA 4BLBA 4BBSK 2V6TA 5CHPA 1I6HK 5C4XC 3Q3QA 4A3DC 1Y1WK 3FKIK 5HL8A 1WQHA 3S1QK 3GEEA 5TJ3A 2A6EA 4YG2A 1WSVA 1AB4A 4GFQA 4BBSC 3GTKA 2NVTC 3H3VL 1R9TA 1WSRA 4A3LK 2NVXK 4KASA 2GSNA 3GTKK 4A3CK 3AQPA 4QIWL 1R9TK 2CFAB 4QJVA 2R7ZA 1X31C 4OIOA 4C3IK 1WCMC 2P8TA 1ZBSA 3S2HK 3BP3A 1TWAC 4G0VA 4XLPA 2R7ZK 2YU9A 3QX3A 2W7VA 2E2JK 3RZOK 2E2HC 3GEHA 1O26A 2NVQC 3AD9C 1DCPA 1TWFA 3GTMA 1ZVUA 4RMFA 3S15C 4KN4A 2PA8L 1L0WA 3HKZL 5IP7C 5M3MK 4G7ZA 1IQ0A 3GTMK 2PHCB 5M5XK 2ZUFA 1JQWA 2B63C 3CQZA 2ZUEA 3SZYA 1O2BA 1PJ7A 3GTJC 3A8JA 3I4MK 5E68A 3HOUC 2XCOA 1TWGC 3GIRA 4GT9A 4ILDA 3CQZK 4BBRK 1K83C 4OIPA 3HOWC 1USMA 1USOA 4KAWX 5IYCK 5FLMK 3TTGA 3AD8C 1EI6A 1F7VA 2R92C 3ERED 4A3KK 3S17C 4G7HA 2KWAA 3GTPC 1PJ5A 5FJ8K 4BY7K 4A3EK 4ZH4A 4C3JC 1SFOA 4MEYA 4P9SA 3GTLA 1EK8A 1VGXA 2NVYC 4X6AK 3I4NC 3GTQA 1VJEA 1TWHA 3AH5A 1SFOK 3FHZA 1WOSA 1I3QC 5IP9K 3GTLK 4KMHA 4Y7NK 3GTQK 2NVYK 1TWHK 2CW0A 1O2FB 1VH2A 3T00A 4LQYA 1HI9A 2JA6C 4MEXA 3M4OK 1BGWA 1J6VA 2GAHC 2GSUA 3H0GA 4FZBA 4C3HC 4QJVB 3HOYC 3A8IA 2O5JA 1J6XA 3H0GK 5IYDC 4BY1C 1Y1WA 2PMZL 4WILA 5TMFA 4A3JK 4Y52K 3G4CA 3HOXK 4KC6A 1WOOA 4YFXA 3LAPA 1KQ4A 3PO2C 1I50C 4KM9A 3RZDC 2JA7C 2WB1L 2JA8K 3S16K 1HQMA 1IBAA 1INNA 5C4JC 2NVXA 3ADAC 2D6FC 3WODA 4KDDA 4XSZA 2RGRA 3SZZA 1VLOA 1I50K 2BE5A 4JK1A 5C4XK 5C44C 5C3EC 4A3DK 4GTEA 1BDFA 2Y0SD 4C45A 2ZFZA 3S1RC 2VUMC 3S14C 3S2DC 4KN7A 4A3BC
chains in the Genus database with same CATH topology
5IP7C 4C3HK 5M3MK 5M3FK 4G7ZA 2NVTK 3GTMK 3HOYK 3GTOC 4MQ9A 5M5XK 4X6AC 2WAQL 1TWCC 4Q4ZA 2B63C 5IYDK 1SFOC 4BY1K 2R93K 5IP9C 3GTJC 3GTLC 3I4MK 3HOUC 4AYBD 1TWGC 4Y7NC 1I6HC 4OIQA 4C2MK 2E2IK 1WCMK 3GTQC 3PO2K 1TWHC 1Y1VK 3CQZK 4BBRK 3RZDK 2JA7K 1K83C 3FKIC 4LK1A 1TWAK 4OIPA 3HOWC 3M4OC 3S1QC 2Y0SL 5C4JK 3HOZK 4A3GK 4A3FK 5IYCK 3K7AC 5FLMK 3EQLA 2E2HK 3DXJA 2R92C 5IYBC 2A68A 4A3KK 4A3MC 4G7HA 2NVQK 3S17C 4A93C 4A3LC 3M3YC 5C3EK 5C44K 2NVXC 4LLGA 4OINA 3GTPC 1IW7A 3S15K 5FJ8K 4BY7K 3H0GC 3S1RK 2A69A 4A3EK 3GTKC 4A3CC 2VUMK 4ZH4A 3S14K 3PO3C 3S1NK 3PO2C 4XLNA 3GTGC 1R9TC 3H3VD 4A3BK 4A3JC 5IP7K 4Y52C 4MEYA 5IYBK 4A3MK 3HOXC 4OIRA 4AYBL 3GTOK 4G7OA 3M3YK 3S2DC 2NVYC 3S2HC 4X6AK 3I4NC 2JA8C 3S16C 1Y1WC 1TWCK 2B63K 3HOVC 3S1MC 1SFOK 4QIWD 2PMZD 2R7ZC 1I3QC 4BBSK 5IP9K 3GTJK 3GTLK 5D4DA 2E2JC 3HOUK 3RZOC 1TWGK 1YNNA 4Y7NK 1I6HK 2PPBA 3GTQK 2WB1D 2NVYK 1TWHK 2CW0A 5C4XC 1ZYRA 4A3DC 1Y1WK 3HOVK 4BXXC 4KMUA 2JA6C 1K83K 3FKIK 4MEXA 2YU9C 3HOWK 3M4OK 3S2DK 3S1QK 2JA5C 1SMYA 2A6EA 4YG2A 2R93C 4LJZA 4BBSC 3K7AK 2NVTC 3H3VL 1TWFC 4QJVB 2R92K 3GTMC 4LK0A 3HOYC 3S17K 4A93K 4A3LK 2A6HA 2NVXK 1I6VA 1YNJA 3GTPK 2YU9K 2O5JA 2PA8D 3H0GK 5IYDC 3HKZD 3GTKK 4BY1C 4XSXA 4A3CK 3PO3K 4QIWL 2PMZL 3GTGK 4C3JK 1R9TK 3I4MC 5TMFA 4QJVA 5M5YK 1TWFK 4A3JK 4Y52K 4OIOA 4C3IK 3HOXK 4A3IC 2E2IC 1WCMC 4YFXA 2WAQD 5M5WK 5TMCA 1Y1VC 1I50C 3CQZC 4BBRC 3RZDC 2JA7C 2WB1L 3I4NK 3S2HK 2JA8K 3S16K 1HQMA 1TWAC 3S1MK 4A3GC 5C4JC 2O5IA 4YFNA 4XLPA 3HOZC 1I3QK 2R7ZK 4A3FC 1XPPA 3WODA 5IYCC 5FLMC 2E2JK 3RZOK 2E2HC 4XSZA 4A3IK 4GZYA 4A3KC 2NVQC 4Q5SA 1I50K 2BE5A 4JK1A 5C4XK 5C44C 5C3EC 4A3DK 4BXXK 1BDFA 2Y0SD 2JA6K 3S15C 4BY7C 4KN4A 3S1RC 4A3EC 2JA5K 2VUMC 2PA8L 4YFKA 4NOIA 3HKZL 3S14C 3S1NC 4KN7A 4A3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 C;  4C3H K;  5M3M K;  5M3F K;  4G7Z A;  2NVT K;  3GTM K;  3HOY K;  3GTO C;  4MQ9 A;  5M5X K;  4X6A C;  2WAQ L;  1TWC C;  4Q4Z A;  2B63 C;  5IYD K;  1SFO C;  4BY1 K;  2R93 K;  5IP9 C;  3GTJ C;  3GTL C;  3I4M K;  3HOU C;  4AYB D;  1TWG C;  4Y7N C;  1I6H C;  4OIQ A;  4C2M K;  2E2I K;  1WCM K;  3GTQ C;  3PO2 K;  1TWH C;  1Y1V K;  3CQZ K;  4BBR K;  3RZD K;  2JA7 K;  1K83 C;  3FKI C;  4LK1 A;  1TWA K;  4OIP A;  3HOW C;  3M4O C;  3S1Q C;  2Y0S L;  5C4J K;  3HOZ K;  4A3G K;  4A3F K;  5IYC K;  3K7A C;  5FLM K;  3EQL A;  2E2H K;  3DXJ A;  2R92 C;  5IYB C;  2A68 A;  4A3K K;  4A3M C;  4G7H A;  2NVQ K;  3S17 C;  4A93 C;  4A3L C;  3M3Y C;  5C3E K;  5C44 K;  2NVX C;  4LLG A;  4OIN A;  3GTP C;  1IW7 A;  3S15 K;  5FJ8 K;  4BY7 K;  3H0G C;  3S1R K;  2A69 A;  4A3E K;  3GTK C;  4A3C C;  2VUM K;  4ZH4 A;  3S14 K;  3PO3 C;  3S1N K;  3PO2 C;  4XLN A;  3GTG C;  1R9T C;  3H3V D;  4A3B K;  4A3J C;  5IP7 K;  4Y52 C;  4MEY A;  5IYB K;  4A3M K;  3HOX C;  4OIR A;  4AYB L;  3GTO K;  4G7O A;  3M3Y K;  3S2D C;  2NVY C;  3S2H C;  4X6A K;  3I4N C;  2JA8 C;  3S16 C;  1Y1W C;  1TWC K;  2B63 K;  3HOV C;  3S1M C;  1SFO K;  4QIW D;  2PMZ D;  2R7Z C;  1I3Q C;  4BBS K;  5IP9 K;  3GTJ K;  3GTL K;  5D4D A;  2E2J C;  3HOU K;  3RZO C;  1TWG K;  1YNN A;  4Y7N K;  1I6H K;  2PPB A;  3GTQ K;  2WB1 D;  2NVY K;  1TWH K;  2CW0 A;  5C4X C;  1ZYR A;  4A3D C;  1Y1W K;  3HOV K;  4BXX C;  4KMU A;  2JA6 C;  1K83 K;  3FKI K;  4MEX A;  2YU9 C;  3HOW K;  3M4O K;  3S2D K;  3S1Q K;  2JA5 C;  1SMY A;  2A6E A;  4YG2 A;  2R93 C;  4LJZ A;  4BBS C;  3K7A K;  2NVT C;  3H3V L;  1TWF C;  4QJV B;  2R92 K;  3GTM C;  4LK0 A;  3HOY C;  3S17 K;  4A93 K;  4A3L K;  2A6H A;  2NVX K;  1I6V A;  1YNJ A;  3GTP K;  2YU9 K;  2O5J A;  2PA8 D;  3H0G K;  5IYD C;  3HKZ D;  3GTK K;  4BY1 C;  4XSX A;  4A3C K;  3PO3 K;  4QIW L;  2PMZ L;  3GTG K;  4C3J K;  1R9T K;  3I4M C;  5TMF A;  4QJV A;  5M5Y K;  1TWF K;  4A3J K;  4Y52 K;  4OIO A;  4C3I K;  3HOX K;  4A3I C;  2E2I C;  1WCM C;  4YFX A;  2WAQ D;  5M5W K;  5TMC A;  1Y1V C;  1I50 C;  3CQZ C;  4BBR C;  3RZD C;  2JA7 C;  2WB1 L;  3I4N K;  3S2H K;  2JA8 K;  3S16 K;  1HQM A;  1TWA C;  3S1M K;  4A3G C;  5C4J C;  2O5I A;  4YFN A;  4XLP A;  3HOZ C;  1I3Q K;  2R7Z K;  4A3F C;  1XPP A;  3WOD A;  5IYC C;  5FLM C;  2E2J K;  3RZO K;  2E2H C;  4XSZ A;  4A3I K;  4GZY A;  4A3K C;  2NVQ C;  4Q5S A;  1I50 K;  2BE5 A;  4JK1 A;  5C4X K;  5C44 C;  5C3E C;  4A3D K;  4BXX K;  1BDF A;  2Y0S D;  2JA6 K;  3S15 C;  4BY7 C;  4KN4 A;  3S1R C;  4A3E C;  2JA5 K;  2VUM C;  2PA8 L;  4YFK A;  4NOI A;  3HKZ L;  3S14 C;  3S1N C;  4KN7 A;  4A3B C; 
#chains in the Genus database with same CATH topology
 2NVT K;  4KAR A;  3GSI A;  5IOQ A;  3GTO C;  1ISE A;  2WAQ L;  1WCM A;  1B4A A;  1TWC C;  2JH3 A;  1TWA A;  1XXA A;  1V5V A;  1O29 A;  2E2H A;  1WCM K;  3N0B A;  4KMD A;  1TWA K;  3IPJ A;  2EBB A;  3K7A C;  2E2H K;  3DXJ A;  4LR2 A;  5IYB C;  4A3M C;  4A93 C;  2NVQ K;  3GEI A;  4LLG A;  3TFI A;  4BLA A;  3S15 K;  3ORE A;  2A69 A;  3PO3 C;  2B63 A;  3LAJ A;  4XLN A;  3GTG C;  3H3V D;  5IP7 K;  2XCR B;  1BJT A;  5IYB K;  4A3M K;  5L46 A;  4LOW A;  3GTJ A;  4G7O A;  4AYB L;  5IOT A;  1TWG A;  4G0U A;  2B63 K;  3S1M C;  4QIW D;  3GTJ K;  5D4D A;  3HOU K;  1TWG K;  2PPB A;  1O27 A;  2R92 A;  3OEP A;  4BXX C;  4KAT A;  4KMU A;  1K83 K;  3HOW K;  1WOR A;  3L4K A;  3GTP A;  2JA5 C;  2R93 C;  1XZQ A;  4GTA A;  4M1X A;  2R92 K;  4LK0 A;  3TFH A;  3S17 K;  2A6H A;  1I6V A;  3GTP K;  1DCO A;  2PA8 D;  3HKZ D;  2NVY A;  4XSX A;  1PJ6 A;  3AD7 C;  4C3J K;  3VA7 A;  4XCH A;  1I3Q A;  2V6S A;  4C2M C;  4GTC A;  2E2I C;  1O28 A;  5TMC A;  1Y1V C;  3NUH A;  3I4N K;  4A3G C;  3HOZ C;  1G51 A;  2JA6 A;  1I3Q K;  4A3F C;  1XPP A;  5IOR A;  4KB4 A;  4GZY A;  2XCQ A;  3BP8 C;  3G4A A;  3JST A;  2JA6 K;  1F7U A;  1B4B A;  1ZXO A;  3S1N C;  1JVI A;  1DD5 A;  4C3H K;  5M3F K;  3HOY K;  1JOE A;  1WIH A;  5IYD K;  1I50 A;  2JA7 A;  4BY1 K;  3S0X A;  4DDQ A;  1I6H C;  4OIQ A;  1VRQ C;  3PO2 K;  3RZD K;  2JA7 K;  3FKI C;  3HXA A;  4LK1 A;  5IOS A;  1F9N A;  3S1Q C;  5C4J K;  3GDZ A;  3EQL A;  2VUM A;  1O24 A;  2A68 A;  1XXC A;  4A3L C;  1RU0 A;  3M3Y C;  5C3E K;  4O2D A;  5C44 K;  2NVX C;  4OIN A;  3GTO A;  1YCL A;  3S1R K;  1BS2 A;  3GTK C;  4A3C C;  1XZP A;  2VUM K;  3S14 K;  1TWC A;  3S2D K;  1R9T C;  4A3B K;  4FM9 A;  4C3I C;  4OIR A;  3GTO K;  3M3Y K;  3S2H C;  1F93 A;  3T01 A;  1TWC K;  3HOV C;  2GSO A;  2PMZ D;  2R7Z C;  3N3Y A;  1UV7 A;  3OPF A;  2E2J C;  3RZO C;  1XZQ B;  1YNN A;  4KB2 A;  4P5A A;  2WB1 D;  5CJ9 A;  1ZYR A;  3LPX A;  1EQR A;  1IE0 A;  3HOV K;  4AH6 A;  4GTB A;  2YU9 C;  1SMY A;  4LJZ A;  4WJ3 M;  3K7A K;  4GTD A;  1TWF C;  3GTG A;  3GTM C;  1YX2 A;  4A93 K;  1YNJ A;  2YU9 K;  3A8K A;  3PO3 K;  3GTG K;  1K83 A;  3I4M C;  5M5Y K;  1TWF K;  1EFW A;  4A3I C;  3N0C A;  1C0A A;  2WAQ D;  5M5W K;  3CQZ C;  4BBR C;  3MML B;  2P5M A;  4J3N A;  3S1M K;  2O5I A;  4YFN A;  1J98 A;  2CFA A;  3V4G A;  5IYC C;  5FLM C;  2JA5 A;  2R93 A;  2V6U A;  4A3I K;  4PAB A;  4A3K C;  4Q5S A;  1J6W A;  1GE9 A;  4BXX K;  4BY7 C;  4A3E C;  2JA5 K;  1DCH A;  3L4J A;  4YFK A;  4NOI A;  2R93 K;  4PAA A;  2FQO A;  1ZQ1 C;  3FOF A;  1O2A A;  4MQ9 A;  4WJ4 A;  2E2I A;  4X6A C;  5EGH A;  4Q4Z A;  1Y1V A;  1SFO C;  3BUE A;  3CAG A;  4KMA A;  2Y3P A;  5IP9 C;  3GTL C;  4AYB D;  4Y7N C;  1WQF A;  4C2M K;  4P5B A;  2E2I K;  2RH6 A;  3GTQ C;  1TWH C;  1Y1V K;  1O25 A;  2GAG C;  5JVO A;  3AQO A;  3M4O C;  2FQT A;  4A3G K;  2Y0S L;  3HOZ K;  4A3F K;  3FOE A;  1XZP B;  3TFJ A;  4G0W A;  5EGE A;  1IL2 A;  4GTF A;  1IW7 A;  3T02 A;  5JFE A;  3H0G C;  4GTL A;  1WQG A;  3S1N K;  4KM8 A;  4A3J C;  4Y52 C;  4BKW A;  3HOX C;  1WOP A;  1XXB A;  1EH1 A;  2JA8 C;  3S16 C;  1Y1W C;  1IS1 A;  3FKI A;  4BLB A;  4BBS K;  2V6T A;  5CHP A;  1I6H K;  5C4X C;  3Q3Q A;  4A3D C;  1Y1W K;  3FKI K;  5HL8 A;  1WQH A;  3S1Q K;  3GEE A;  5TJ3 A;  2A6E A;  4YG2 A;  1WSV A;  1AB4 A;  4GFQ A;  4BBS C;  3GTK A;  2NVT C;  3H3V L;  1R9T A;  1WSR A;  4A3L K;  2NVX K;  4KAS A;  2GSN A;  3GTK K;  4A3C K;  3AQP A;  4QIW L;  1R9T K;  2CFA B;  4QJV A;  2R7Z A;  1X31 C;  4OIO A;  4C3I K;  1WCM C;  2P8T A;  1ZBS A;  3S2H K;  3BP3 A;  1TWA C;  4G0V A;  4XLP A;  2R7Z K;  2YU9 A;  3QX3 A;  2W7V A;  2E2J K;  3RZO K;  2E2H C;  3GEH A;  1O26 A;  2NVQ C;  3AD9 C;  1DCP A;  1TWF A;  3GTM A;  1ZVU A;  4RMF A;  3S15 C;  4KN4 A;  2PA8 L;  1L0W A;  3HKZ L;  5IP7 C;  5M3M K;  4G7Z A;  1IQ0 A;  3GTM K;  2PHC B;  5M5X K;  2ZUF A;  1JQW A;  2B63 C;  3CQZ A;  2ZUE A;  3SZY A;  1O2B A;  1PJ7 A;  3GTJ C;  3A8J A;  3I4M K;  5E68 A;  3HOU C;  2XCO A;  1TWG C;  3GIR A;  4GT9 A;  4ILD A;  3CQZ K;  4BBR K;  1K83 C;  4OIP A;  3HOW C;  1USM A;  1USO A;  4KAW X;  5IYC K;  5FLM K;  3TTG A;  3AD8 C;  1EI6 A;  1F7V A;  2R92 C;  3ERE D;  4A3K K;  3S17 C;  4G7H A;  2KWA A;  3GTP C;  1PJ5 A;  5FJ8 K;  4BY7 K;  4A3E K;  4ZH4 A;  4C3J C;  1SFO A;  4MEY A;  4P9S A;  3GTL A;  1EK8 A;  1VGX A;  2NVY C;  4X6A K;  3I4N C;  3GTQ A;  1VJE A;  1TWH A;  3AH5 A;  1SFO K;  3FHZ A;  1WOS A;  1I3Q C;  5IP9 K;  3GTL K;  4KMH A;  4Y7N K;  3GTQ K;  2NVY K;  1TWH K;  2CW0 A;  1O2F B;  1VH2 A;  3T00 A;  4LQY A;  1HI9 A;  2JA6 C;  4MEX A;  3M4O K;  1BGW A;  1J6V A;  2GAH C;  2GSU A;  3H0G A;  4FZB A;  4C3H C;  4QJV B;  3HOY C;  3A8I A;  2O5J A;  1J6X A;  3H0G K;  5IYD C;  4BY1 C;  1Y1W A;  2PMZ L;  4WIL A;  5TMF A;  4A3J K;  4Y52 K;  3G4C A;  3HOX K;  4KC6 A;  1WOO A;  4YFX A;  3LAP A;  1KQ4 A;  3PO2 C;  1I50 C;  4KM9 A;  3RZD C;  2JA7 C;  2WB1 L;  2JA8 K;  3S16 K;  1HQM A;  1IBA A;  1INN A;  5C4J C;  2NVX A;  3ADA C;  2D6F C;  3WOD A;  4KDD A;  4XSZ A;  2RGR A;  3SZZ A;  1VLO A;  1I50 K;  2BE5 A;  4JK1 A;  5C4X K;  5C44 C;  5C3E C;  4A3D K;  4GTE A;  1BDF A;  2Y0S D;  4C45 A;  2ZFZ A;  3S1R C;  2VUM C;  3S14 C;  3S2D C;  4KN7 A;  4A3B C; 
#chains in the Genus database with same CATH homology
 5IP7 C;  4C3H K;  5M3M K;  5M3F K;  4G7Z A;  2NVT K;  3GTM K;  3HOY K;  3GTO C;  4MQ9 A;  5M5X K;  4X6A C;  2WAQ L;  1TWC C;  4Q4Z A;  2B63 C;  5IYD K;  1SFO C;  4BY1 K;  2R93 K;  5IP9 C;  3GTJ C;  3GTL C;  3I4M K;  3HOU C;  4AYB D;  1TWG C;  4Y7N C;  1I6H C;  4OIQ A;  4C2M K;  2E2I K;  1WCM K;  3GTQ C;  3PO2 K;  1TWH C;  1Y1V K;  3CQZ K;  4BBR K;  3RZD K;  2JA7 K;  1K83 C;  3FKI C;  4LK1 A;  1TWA K;  4OIP A;  3HOW C;  3M4O C;  3S1Q C;  2Y0S L;  5C4J K;  3HOZ K;  4A3G K;  4A3F K;  5IYC K;  3K7A C;  5FLM K;  3EQL A;  2E2H K;  3DXJ A;  2R92 C;  5IYB C;  2A68 A;  4A3K K;  4A3M C;  4G7H A;  2NVQ K;  3S17 C;  4A93 C;  4A3L C;  3M3Y C;  5C3E K;  5C44 K;  2NVX C;  4LLG A;  4OIN A;  3GTP C;  1IW7 A;  3S15 K;  5FJ8 K;  4BY7 K;  3H0G C;  3S1R K;  2A69 A;  4A3E K;  3GTK C;  4A3C C;  2VUM K;  4ZH4 A;  3S14 K;  3PO3 C;  3S1N K;  3PO2 C;  4XLN A;  3GTG C;  1R9T C;  3H3V D;  4A3B K;  4A3J C;  5IP7 K;  4Y52 C;  4MEY A;  5IYB K;  4A3M K;  3HOX C;  4OIR A;  4AYB L;  3GTO K;  4G7O A;  3M3Y K;  3S2D C;  2NVY C;  3S2H C;  4X6A K;  3I4N C;  2JA8 C;  3S16 C;  1Y1W C;  1TWC K;  2B63 K;  3HOV C;  3S1M C;  1SFO K;  4QIW D;  2PMZ D;  2R7Z C;  1I3Q C;  4BBS K;  5IP9 K;  3GTJ K;  3GTL K;  5D4D A;  2E2J C;  3HOU K;  3RZO C;  1TWG K;  1YNN A;  4Y7N K;  1I6H K;  2PPB A;  3GTQ K;  2WB1 D;  2NVY K;  1TWH K;  2CW0 A;  5C4X C;  1ZYR A;  4A3D C;  1Y1W K;  3HOV K;  4BXX C;  4KMU A;  2JA6 C;  1K83 K;  3FKI K;  4MEX A;  2YU9 C;  3HOW K;  3M4O K;  3S2D K;  3S1Q K;  2JA5 C;  1SMY A;  2A6E A;  4YG2 A;  2R93 C;  4LJZ A;  4BBS C;  3K7A K;  2NVT C;  3H3V L;  1TWF C;  4QJV B;  2R92 K;  3GTM C;  4LK0 A;  3HOY C;  3S17 K;  4A93 K;  4A3L K;  2A6H A;  2NVX K;  1I6V A;  1YNJ A;  3GTP K;  2YU9 K;  2O5J A;  2PA8 D;  3H0G K;  5IYD C;  3HKZ D;  3GTK K;  4BY1 C;  4XSX A;  4A3C K;  3PO3 K;  4QIW L;  2PMZ L;  3GTG K;  4C3J K;  1R9T K;  3I4M C;  5TMF A;  4QJV A;  5M5Y K;  1TWF K;  4A3J K;  4Y52 K;  4OIO A;  4C3I K;  3HOX K;  4A3I C;  2E2I C;  1WCM C;  4YFX A;  2WAQ D;  5M5W K;  5TMC A;  1Y1V C;  1I50 C;  3CQZ C;  4BBR C;  3RZD C;  2JA7 C;  2WB1 L;  3I4N K;  3S2H K;  2JA8 K;  3S16 K;  1HQM A;  1TWA C;  3S1M K;  4A3G C;  5C4J C;  2O5I A;  4YFN A;  4XLP A;  3HOZ C;  1I3Q K;  2R7Z K;  4A3F C;  1XPP A;  3WOD A;  5IYC C;  5FLM C;  2E2J K;  3RZO K;  2E2H C;  4XSZ A;  4A3I K;  4GZY A;  4A3K C;  2NVQ C;  4Q5S A;  1I50 K;  2BE5 A;  4JK1 A;  5C4X K;  5C44 C;  5C3E C;  4A3D K;  4BXX K;  1BDF A;  2Y0S D;  2JA6 K;  3S15 C;  4BY7 C;  4KN4 A;  3S1R C;  4A3E C;  2JA5 K;  2VUM C;  2PA8 L;  4YFK A;  4NOI A;  3HKZ L;  3S14 C;  3S1N C;  4KN7 A;  4A3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...