1Y1VK

Refined rna polymerase ii-tfiis complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1vK00
2WAQD 1R9TK 1TWFC 3GTQC 3GTOK 3S2DC 3GTMK 4MEYA 4BY7C 4BBRC 4A3FC 5C4JC 2PA8L 5M5YK 4QJVB 1TWGC 3S1RK 2JA7K 3S2HC 3S1QC 2VUMK 3HOXK 3WODA 3S14C 3RZDC 5C44C 4A3CK 4C2MK 2E2IK 2E2HK 1I3QK 4Y52C 3HOUC 1K83K 4MEXA 4BBSK 4OINA 1R9TC 3HKZL 3GTMC 2JA8K 5IYCK 5IP9K 3K7AC 1BDFA 4C3JK 4A3JC 2JA6K 4Y7NK 3S1RC 3S16C 3CQZK 3I4MK 3GTPC 2NVXK 4BXXC 3M3YC 1TWCK 4G7HA 2E2JC 3I4NK 4Q5SA 2E2HC 4OIQA 3GTKK 1HQMA 3GTGK 4OIRA 3H3VL 4JK1A 3S17C 4A3BC 2JA8C 2PA8D 5IYCC 5C3EC 2NVYC 3HOZC 3H0GK 3CQZC 5FLMC 3I4MC 3RZOK 4LLGA 4ZH4A 1TWCC 3HKZD 3GTKC 4XSXA 3GTGC 1I6HK 2R93K 1ZYRA 5TMCA 3FKIC 1Y1VK 5M3MK 4A3DC 3GTJK 4KMUA 3PO3C 3GTOC 4AYBL 4YFNA 4X6AK 2PMZL 3HOYK 5IYBK 4A3EK 3H3VD 4LJZA 2O5JA 2JA7C 1YNJA 3HOWK 2VUMC 1I6HC 3HOXC 4C3IK 4YFKA 5D4DA 4A3CC 2E2IC 4MQ9A 2B63K 2WB1L 1I3QC 2R7ZK 4BBSC 1K83C 3HOVK 4QIWL 4XSZA 3S1MK 3M4OK 2A69A 3GTLK 4LK1A 5IP9C 5IYBC 4A3IK 3HOYC 4LK0A 2JA6C 4Y7NC 3PO2K 1XPPA 3S15K 4G7ZA 4OIOA 4XLNA 1SMYA 3HOWC 4YG2A 4A3GK 2NVXC 2YU9K 4NOIA 4YFXA 2A68A 2NVQK 3I4NC 4AYBD 5C4XK 2R7ZC 1TWHK 5M3FK 2PMZD 1SFOK 4C3HK 2PPBA 4A93K 5M5XK 2JA5K 3S1NK 4A3IC 5TMFA 2BE5A 4A3MK 1TWFK 3DXJA 3S15C 3H0GC 3RZOC 4BY7K 2Y0SL 2WB1D 4A3FK 1Y1WK 2R92K 1TWGK 1I50K 4QIWD 3S1QK 4BY1K 4OIPA 3RZDK 5C44K 2R93C 1WCMK 4A93C 2JA5C 3S1NC 1Y1VC 4Y52K 3HOUK 1YNNA 4A3LK 3GTJC 5IP7K 4KN4A 4X6AC 3S16K 3K7AK 4A3JK 1Y1WC 2NVTK 4A3EC 4KN7A 2R92C 1I50C 3GTPK 5M5WK 4BXXK 4BY1C 2A6EA 2WAQL 3M3YK 2E2JK 4A3KK 1WCMC 1IW7A 2B63C 4XLPA 4G7OA 4A3LC 1TWAK 5IP7C 3HOVC 5IYDK 2Y0SD 3S17K 4A3BK 4QJVA 5C3EK 2O5IA 3S1MC 4GZYA 3M4OC 3GTLC 3EQLA 2NVYK 2NVTC 3HOZK 3GTQK 3PO2C 5FLMK 3S2DK 4A3GC 2YU9C 4BBRK 4A3KC 5C4JK 4Q4ZA 2NVQC 2A6HA 3S2HK 5FJ8K 1I6VA 5C4XC 1TWHC 1TWAC 3S14K 5IYDC 1SFOC 3FKIK 2CW0A 4A3DK 4A3MC 3PO3K
chains in the Genus database with same CATH superfamily
1R9TK 3GTMK 4MEYA 4LR2A 3S1QC 1Y1WA 5CJ9A 1F7VA 1O26A 1I3QK 4BBSK 3HKZL 5IYCK 3S16C 3K7AC 1BDFA 1DCOA 4Y7NK 3S1RC 2JA6K 1IQ0A 1WIHA 3I4MK 2NVXK 1WORA 2E2JC 3I4NK 4C2MC 1ZQ1C 4BLBA 1VH2A 3S17C 5C3EC 1O25A 3HOZC 2FQTA 3RZOK 2NVYA 4ZH4A 3T00A 1DD5A 4LOWA 1O27A 1ZYRA 3GTJK 3FKIA 3PO3C 5EGHA 3T02A 4X6AK 1UV7A 4P5BA 4LJZA 3S0XA 1YNJA 3GDZA 3GEIA 3HOXC 2JA7A 4DDQA 4YFKA 2VUMA 4A3CC 4GTEA 2WB1L 1WQGA 2E2IA 3L4JA 4XSZA 3M4OK 4G0VA 4C3JC 4LK0A 3TFHA 5JFEA 3S15K 4OIOA 1SMYA 4YG2A 4KMDA 4RMFA 4NOIA 1VJEA 5C4XK 1TWHK 2XCQA 2PMZD 1SFOK 4C3HK 2GSNA 1TWFK 4KDDA 2R92K 1TWGK 4KB2A 1YCLA 4QIWD 2XCOA 5C44K 1WCMK 4A93C 3HXAA 3S1NC 4Y52K 2R93A 5IP7K 4KN4A 1Y1VA 1WOSA 3N3YA 4A3EC 3GEEA 3GTPK 2A6EA 2RH6A 4A3KK 4KASA 4KC6A 1VLOA 4G7OA 3HOVC 1F93A 5L46A 3EQLA 1RU0A 3GTLA 4A3GC 5IOSA 1WOOA 5EGEA 4Q4ZA 3S2HK 2A6HA 3S14K 1TWAC 1IL2A 4A3DK 3GTOK 3GTQC 3S2DC 1WOPA 4KAWX 1G51A 5C4JC 4QJVB 3WODA 2EBBA 4GTAA 3RZDC 2E2HK 3AD8C 1K83K 4MEXA 1DCHA 3HOUC 1R9TC 3QX3A 3GTMC 3OPFA 4A3JC 1XXBA 1JOEA 3CQZK 3Q3QA 4FZBA 3M3YC 4Q5SA 4XCHA 4JK1A 2PA8D 5IYCC 1TWAA 1XZPB 2NVYC 3H0GK 3I4MC 3GEHA 3GTQA 3VA7A 4BLAA 4PABA 5TMCA 1ZBSA 1DCPA 3FKIC 1VRQC 5M3MK 5JVOA 1XZQA 2PMZL 1R9TA 3GTMA 3H3VD 2O5JA 1V5VA 2JA7C 2VUMC 2GAGC 4C3IK 2P5MA 2E2IC 3TFJA 2B63K 2R7ZK 4QIWL 1I3QA 3S1MK 2A69A 3SZYA 5IP9C 1XPPA 4G7ZA 4XLNA 2JA6A 2YU9K 4YFXA 3GIRA 2NVQK 2NVXA 4AYBD 1PJ6A 3A8KA 2JA5K 2BE5A 3S15C 3FOFA 1J98A 2V6TA 2XCRB 1I50K 3S1QK 5TJ3A 4OIPA 2R93C 1Y1VC 4WILA 4A3LK 3A8IA 3GTJA 1JVIA 1C0AA 3S16K 3K7AK 3TFIA 2NVTK 2R92C 1B4BA 2E2JK 1WCMC 2GSOA 4KM9A 3G4CA 5IP7C 3S17K 5C3EK 3GTLC 3HOZK 2P8TA 4GFQA 3PO2C 2GAHC 4BBRK 4A3KC 3N0BA 5FJ8K 1ZVUA 3ADAC 4M1XA 4GTFA 2ZFZA 1B4AA 2CW0A 1TWHA 1SFOA 3BP3A 4A3MC 3PO3K 4GTDA 3MMLB 4BY7C 1TWFA 4A3FC 2PA8L 3S2HC 4ILDA 2R92A 3HOXK 4KARA 3S14C 1TWGA 4A3CK 1YX2A 1WCMA 2PHCB 1EFWA 4KMAA 2JA8K 4C3JK 3BP8C 3NUHA 5IOQA 4BXXC 1INNA 1TWCK 4G7HA 3GTPA 2E2HC 3GTKK 3GTGK 2V6UA 3H3VL 2JH3A 4A3BC 4P9SA 3L4KA 3CQZC 5FLMC 4G0WA 1J6VA 4LLGA 1L0WA 4WJ3M 1TWCA 3ERED 4XSXA 1I6HK 1HI9A 3AQOA 2KWAA 4KMUA 4AYBL 4GTCA 3GTOA 3HOYK 5IYBK 4A3EK 4WJ4A 3HOWK 3AD7C 1I3QC 1EI6A 1O28A 3HOVK 4BBSC 2E2HA 4KMHA 1K83A 4A3IK 2JA6C 4Y7NC 5HL8A 4A3GK 2NVXC 4LQYA 3CQZA 2A68A 1WQFA 3I4NC 4FM9A 1IBAA 2R7ZC 5M3FK 3FHZA 2PPBA 3G4AA 5M5XK 5TMFA 1WQHA 3DXJA 3RZOC 3AQPA 2V6SA 3H0GA 1Y1WK 3GSIA 1ZXOA 5CHPA 1IE0A 1J6WA 3SZZA 1JQWA 4BY1K 3RZDK 2JA5C 3HOUK 1YNNA 3GTJC 4C45A 4X6AC 3N0CA 4A3JK 1I50C 5M5WK 3M3YK 1BJTA 3FOEA 1O2AA 4XLPA 4A3LC 2CFAB 5IYDK 2Y0SD 2R7ZA 2GSUA 1VGXA 4QJVA 2O5IA 1O29A 2B63A 3M4OC 4G0UA 2NVYK 2NVTC 1USMA 4GTBA 5IORA 3OEPA 1EK8A 1O24A 5IOTA 3T01A 5E68A 2YU9A 1I6VA 5C4XC 1TWHC 1SFOC 2Y3PA 3FKIK 4C3HC 1XXAA 2W7VA 4KATA 2WAQD 3OREA 1TWFC 3LAJA 2JA5A 1PJ5A 1BS2A 4KB4A 4BKWA 4BBRC 3S1RK 5M5YK 1TWGC 2JA7K 3AD9C 2VUMK 1XZPA 1I50A 4GTLA 5C44C 3CAGA 4C2MK 2E2IK 4Y52C 1O2FB 4OINA 4J3NA 1ISEA 5IP9K 1BGWA 1EH1A 1WSRA 3GTPC 1EQRA 4OIQA 1HQMA 4OIRA 1WSVA 2JA8C 1TWCC 1X31C 1XXCA 3HKZD 3GTKC 3GTGC 2R93K 4AH6A 1Y1VK 4A3DC 3LPXA 3GTOC 4YFNA 1GE9A 1IS1A 2FQOA 2CFAA 4O2DA 1I6HC 3A8JA 5D4DA 4MQ9A 3V4GA 1K83C 3GTLK 3HOYC 4LK1A 5IYBC 1F7UA 3PO2K 3HOWC 4P5AA 1XZQB 3GTKA 4A93K 3GTGA 1KQ4A 3S1NK 1O2BA 4A3IC 4A3MK 1USOA 3H0GC 1AB4A 3IPJA 4BY7K 2Y0SL 2WB1D 4A3FK 3LAPA 2RGRA 3BUEA 1PJ7A 1Y1WC 4KN7A 4BXXK 4BY1C 2WAQL 4C3IC 4KM8A 1IW7A 2B63C 2D6FC 1TWAK 2ZUEA 4PAAA 4GT9A 3AH5A 4A3BK 4GZYA 3S1MC 3TTGA 1F9NA 3GTQK 5FLMK 3S2DK 2YU9C 3JSTA 5C4JK 2NVQC 5IYDC 1J6XA 2ZUFA
chains in the Genus database with same CATH topology
2WAQD 1R9TK 1TWFC 3GTQC 3GTOK 3S2DC 3GTMK 4MEYA 4BY7C 4BBRC 4A3FC 5C4JC 2PA8L 5M5YK 4QJVB 1TWGC 3S1RK 2JA7K 3S2HC 3S1QC 2VUMK 3HOXK 3WODA 3S14C 3RZDC 5C44C 4A3CK 4C2MK 2E2IK 2E2HK 1I3QK 4Y52C 3HOUC 1K83K 4MEXA 4BBSK 4OINA 1R9TC 3HKZL 3GTMC 2JA8K 5IYCK 5IP9K 3K7AC 1BDFA 4C3JK 4A3JC 2JA6K 4Y7NK 3S1RC 3S16C 3CQZK 3I4MK 3GTPC 2NVXK 4BXXC 3M3YC 1TWCK 4G7HA 2E2JC 3I4NK 4Q5SA 2E2HC 4OIQA 3GTKK 1HQMA 3GTGK 4OIRA 3H3VL 4JK1A 3S17C 4A3BC 2JA8C 2PA8D 5IYCC 5C3EC 2NVYC 3HOZC 3H0GK 3CQZC 5FLMC 3I4MC 3RZOK 4LLGA 4ZH4A 1TWCC 3HKZD 3GTKC 4XSXA 3GTGC 1I6HK 2R93K 1ZYRA 5TMCA 3FKIC 1Y1VK 5M3MK 4A3DC 3GTJK 4KMUA 3PO3C 3GTOC 4AYBL 4YFNA 4X6AK 2PMZL 3HOYK 5IYBK 4A3EK 3H3VD 4LJZA 2O5JA 2JA7C 1YNJA 3HOWK 2VUMC 1I6HC 3HOXC 4C3IK 4YFKA 5D4DA 4A3CC 2E2IC 4MQ9A 2B63K 2WB1L 1I3QC 2R7ZK 4BBSC 1K83C 3HOVK 4QIWL 4XSZA 3S1MK 3M4OK 2A69A 3GTLK 4LK1A 5IP9C 5IYBC 4A3IK 3HOYC 4LK0A 2JA6C 4Y7NC 3PO2K 1XPPA 3S15K 4G7ZA 4OIOA 4XLNA 1SMYA 3HOWC 4YG2A 4A3GK 2NVXC 2YU9K 4NOIA 4YFXA 2A68A 2NVQK 3I4NC 4AYBD 5C4XK 2R7ZC 1TWHK 5M3FK 2PMZD 1SFOK 4C3HK 2PPBA 4A93K 5M5XK 2JA5K 3S1NK 4A3IC 5TMFA 2BE5A 4A3MK 1TWFK 3DXJA 3S15C 3H0GC 3RZOC 4BY7K 2Y0SL 2WB1D 4A3FK 1Y1WK 2R92K 1TWGK 1I50K 4QIWD 3S1QK 4BY1K 4OIPA 3RZDK 5C44K 2R93C 1WCMK 4A93C 2JA5C 3S1NC 1Y1VC 4Y52K 3HOUK 1YNNA 4A3LK 3GTJC 5IP7K 4KN4A 4X6AC 3S16K 3K7AK 4A3JK 1Y1WC 2NVTK 4A3EC 4KN7A 2R92C 1I50C 3GTPK 5M5WK 4BXXK 4BY1C 2A6EA 2WAQL 3M3YK 2E2JK 4A3KK 1WCMC 1IW7A 2B63C 4XLPA 4G7OA 4A3LC 1TWAK 5IP7C 3HOVC 5IYDK 2Y0SD 3S17K 4A3BK 4QJVA 5C3EK 2O5IA 3S1MC 4GZYA 3M4OC 3GTLC 3EQLA 2NVYK 2NVTC 3HOZK 3GTQK 3PO2C 5FLMK 3S2DK 4A3GC 2YU9C 4BBRK 4A3KC 5C4JK 4Q4ZA 2NVQC 2A6HA 3S2HK 5FJ8K 1I6VA 5C4XC 1TWHC 1TWAC 3S14K 5IYDC 1SFOC 3FKIK 2CW0A 4A3DK 4A3MC 3PO3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ D;  1R9T K;  1TWF C;  3GTQ C;  3GTO K;  3S2D C;  3GTM K;  4MEY A;  4BY7 C;  4BBR C;  4A3F C;  5C4J C;  2PA8 L;  5M5Y K;  4QJV B;  1TWG C;  3S1R K;  2JA7 K;  3S2H C;  3S1Q C;  2VUM K;  3HOX K;  3WOD A;  3S14 C;  3RZD C;  5C44 C;  4A3C K;  4C2M K;  2E2I K;  2E2H K;  1I3Q K;  4Y52 C;  3HOU C;  1K83 K;  4MEX A;  4BBS K;  4OIN A;  1R9T C;  3HKZ L;  3GTM C;  2JA8 K;  5IYC K;  5IP9 K;  3K7A C;  1BDF A;  4C3J K;  4A3J C;  2JA6 K;  4Y7N K;  3S1R C;  3S16 C;  3CQZ K;  3I4M K;  3GTP C;  2NVX K;  4BXX C;  3M3Y C;  1TWC K;  4G7H A;  2E2J C;  3I4N K;  4Q5S A;  2E2H C;  4OIQ A;  3GTK K;  1HQM A;  3GTG K;  4OIR A;  3H3V L;  4JK1 A;  3S17 C;  4A3B C;  2JA8 C;  2PA8 D;  5IYC C;  5C3E C;  2NVY C;  3HOZ C;  3H0G K;  3CQZ C;  5FLM C;  3I4M C;  3RZO K;  4LLG A;  4ZH4 A;  1TWC C;  3HKZ D;  3GTK C;  4XSX A;  3GTG C;  1I6H K;  2R93 K;  1ZYR A;  5TMC A;  3FKI C;  1Y1V K;  5M3M K;  4A3D C;  3GTJ K;  4KMU A;  3PO3 C;  3GTO C;  4AYB L;  4YFN A;  4X6A K;  2PMZ L;  3HOY K;  5IYB K;  4A3E K;  3H3V D;  4LJZ A;  2O5J A;  2JA7 C;  1YNJ A;  3HOW K;  2VUM C;  1I6H C;  3HOX C;  4C3I K;  4YFK A;  5D4D A;  4A3C C;  2E2I C;  4MQ9 A;  2B63 K;  2WB1 L;  1I3Q C;  2R7Z K;  4BBS C;  1K83 C;  3HOV K;  4QIW L;  4XSZ A;  3S1M K;  3M4O K;  2A69 A;  3GTL K;  4LK1 A;  5IP9 C;  5IYB C;  4A3I K;  3HOY C;  4LK0 A;  2JA6 C;  4Y7N C;  3PO2 K;  1XPP A;  3S15 K;  4G7Z A;  4OIO A;  4XLN A;  1SMY A;  3HOW C;  4YG2 A;  4A3G K;  2NVX C;  2YU9 K;  4NOI A;  4YFX A;  2A68 A;  2NVQ K;  3I4N C;  4AYB D;  5C4X K;  2R7Z C;  1TWH K;  5M3F K;  2PMZ D;  1SFO K;  4C3H K;  2PPB A;  4A93 K;  5M5X K;  2JA5 K;  3S1N K;  4A3I C;  5TMF A;  2BE5 A;  4A3M K;  1TWF K;  3DXJ A;  3S15 C;  3H0G C;  3RZO C;  4BY7 K;  2Y0S L;  2WB1 D;  4A3F K;  1Y1W K;  2R92 K;  1TWG K;  1I50 K;  4QIW D;  3S1Q K;  4BY1 K;  4OIP A;  3RZD K;  5C44 K;  2R93 C;  1WCM K;  4A93 C;  2JA5 C;  3S1N C;  1Y1V C;  4Y52 K;  3HOU K;  1YNN A;  4A3L K;  3GTJ C;  5IP7 K;  4KN4 A;  4X6A C;  3S16 K;  3K7A K;  4A3J K;  1Y1W C;  2NVT K;  4A3E C;  4KN7 A;  2R92 C;  1I50 C;  3GTP K;  5M5W K;  4BXX K;  4BY1 C;  2A6E A;  2WAQ L;  3M3Y K;  2E2J K;  4A3K K;  1WCM C;  1IW7 A;  2B63 C;  4XLP A;  4G7O A;  4A3L C;  1TWA K;  5IP7 C;  3HOV C;  5IYD K;  2Y0S D;  3S17 K;  4A3B K;  4QJV A;  5C3E K;  2O5I A;  3S1M C;  4GZY A;  3M4O C;  3GTL C;  3EQL A;  2NVY K;  2NVT C;  3HOZ K;  3GTQ K;  3PO2 C;  5FLM K;  3S2D K;  4A3G C;  2YU9 C;  4BBR K;  4A3K C;  5C4J K;  4Q4Z A;  2NVQ C;  2A6H A;  3S2H K;  5FJ8 K;  1I6V A;  5C4X C;  1TWH C;  1TWA C;  3S14 K;  5IYD C;  1SFO C;  3FKI K;  2CW0 A;  4A3D K;  4A3M C;  3PO3 K; 
#chains in the Genus database with same CATH topology
 1R9T K;  3GTM K;  4MEY A;  4LR2 A;  3S1Q C;  1Y1W A;  5CJ9 A;  1F7V A;  1O26 A;  1I3Q K;  4BBS K;  3HKZ L;  5IYC K;  3S16 C;  3K7A C;  1BDF A;  1DCO A;  4Y7N K;  3S1R C;  2JA6 K;  1IQ0 A;  1WIH A;  3I4M K;  2NVX K;  1WOR A;  2E2J C;  3I4N K;  4C2M C;  1ZQ1 C;  4BLB A;  1VH2 A;  3S17 C;  5C3E C;  1O25 A;  3HOZ C;  2FQT A;  3RZO K;  2NVY A;  4ZH4 A;  3T00 A;  1DD5 A;  4LOW A;  1O27 A;  1ZYR A;  3GTJ K;  3FKI A;  3PO3 C;  5EGH A;  3T02 A;  4X6A K;  1UV7 A;  4P5B A;  4LJZ A;  3S0X A;  1YNJ A;  3GDZ A;  3GEI A;  3HOX C;  2JA7 A;  4DDQ A;  4YFK A;  2VUM A;  4A3C C;  4GTE A;  2WB1 L;  1WQG A;  2E2I A;  3L4J A;  4XSZ A;  3M4O K;  4G0V A;  4C3J C;  4LK0 A;  3TFH A;  5JFE A;  3S15 K;  4OIO A;  1SMY A;  4YG2 A;  4KMD A;  4RMF A;  4NOI A;  1VJE A;  5C4X K;  1TWH K;  2XCQ A;  2PMZ D;  1SFO K;  4C3H K;  2GSN A;  1TWF K;  4KDD A;  2R92 K;  1TWG K;  4KB2 A;  1YCL A;  4QIW D;  2XCO A;  5C44 K;  1WCM K;  4A93 C;  3HXA A;  3S1N C;  4Y52 K;  2R93 A;  5IP7 K;  4KN4 A;  1Y1V A;  1WOS A;  3N3Y A;  4A3E C;  3GEE A;  3GTP K;  2A6E A;  2RH6 A;  4A3K K;  4KAS A;  4KC6 A;  1VLO A;  4G7O A;  3HOV C;  1F93 A;  5L46 A;  3EQL A;  1RU0 A;  3GTL A;  4A3G C;  5IOS A;  1WOO A;  5EGE A;  4Q4Z A;  3S2H K;  2A6H A;  3S14 K;  1TWA C;  1IL2 A;  4A3D K;  3GTO K;  3GTQ C;  3S2D C;  1WOP A;  4KAW X;  1G51 A;  5C4J C;  4QJV B;  3WOD A;  2EBB A;  4GTA A;  3RZD C;  2E2H K;  3AD8 C;  1K83 K;  4MEX A;  1DCH A;  3HOU C;  1R9T C;  3QX3 A;  3GTM C;  3OPF A;  4A3J C;  1XXB A;  1JOE A;  3CQZ K;  3Q3Q A;  4FZB A;  3M3Y C;  4Q5S A;  4XCH A;  4JK1 A;  2PA8 D;  5IYC C;  1TWA A;  1XZP B;  2NVY C;  3H0G K;  3I4M C;  3GEH A;  3GTQ A;  3VA7 A;  4BLA A;  4PAB A;  5TMC A;  1ZBS A;  1DCP A;  3FKI C;  1VRQ C;  5M3M K;  5JVO A;  1XZQ A;  2PMZ L;  1R9T A;  3GTM A;  3H3V D;  2O5J A;  1V5V A;  2JA7 C;  2VUM C;  2GAG C;  4C3I K;  2P5M A;  2E2I C;  3TFJ A;  2B63 K;  2R7Z K;  4QIW L;  1I3Q A;  3S1M K;  2A69 A;  3SZY A;  5IP9 C;  1XPP A;  4G7Z A;  4XLN A;  2JA6 A;  2YU9 K;  4YFX A;  3GIR A;  2NVQ K;  2NVX A;  4AYB D;  1PJ6 A;  3A8K A;  2JA5 K;  2BE5 A;  3S15 C;  3FOF A;  1J98 A;  2V6T A;  2XCR B;  1I50 K;  3S1Q K;  5TJ3 A;  4OIP A;  2R93 C;  1Y1V C;  4WIL A;  4A3L K;  3A8I A;  3GTJ A;  1JVI A;  1C0A A;  3S16 K;  3K7A K;  3TFI A;  2NVT K;  2R92 C;  1B4B A;  2E2J K;  1WCM C;  2GSO A;  4KM9 A;  3G4C A;  5IP7 C;  3S17 K;  5C3E K;  3GTL C;  3HOZ K;  2P8T A;  4GFQ A;  3PO2 C;  2GAH C;  4BBR K;  4A3K C;  3N0B A;  5FJ8 K;  1ZVU A;  3ADA C;  4M1X A;  4GTF A;  2ZFZ A;  1B4A A;  2CW0 A;  1TWH A;  1SFO A;  3BP3 A;  4A3M C;  3PO3 K;  4GTD A;  3MML B;  4BY7 C;  1TWF A;  4A3F C;  2PA8 L;  3S2H C;  4ILD A;  2R92 A;  3HOX K;  4KAR A;  3S14 C;  1TWG A;  4A3C K;  1YX2 A;  1WCM A;  2PHC B;  1EFW A;  4KMA A;  2JA8 K;  4C3J K;  3BP8 C;  3NUH A;  5IOQ A;  4BXX C;  1INN A;  1TWC K;  4G7H A;  3GTP A;  2E2H C;  3GTK K;  3GTG K;  2V6U A;  3H3V L;  2JH3 A;  4A3B C;  4P9S A;  3L4K A;  3CQZ C;  5FLM C;  4G0W A;  1J6V A;  4LLG A;  1L0W A;  4WJ3 M;  1TWC A;  3ERE D;  4XSX A;  1I6H K;  1HI9 A;  3AQO A;  2KWA A;  4KMU A;  4AYB L;  4GTC A;  3GTO A;  3HOY K;  5IYB K;  4A3E K;  4WJ4 A;  3HOW K;  3AD7 C;  1I3Q C;  1EI6 A;  1O28 A;  3HOV K;  4BBS C;  2E2H A;  4KMH A;  1K83 A;  4A3I K;  2JA6 C;  4Y7N C;  5HL8 A;  4A3G K;  2NVX C;  4LQY A;  3CQZ A;  2A68 A;  1WQF A;  3I4N C;  4FM9 A;  1IBA A;  2R7Z C;  5M3F K;  3FHZ A;  2PPB A;  3G4A A;  5M5X K;  5TMF A;  1WQH A;  3DXJ A;  3RZO C;  3AQP A;  2V6S A;  3H0G A;  1Y1W K;  3GSI A;  1ZXO A;  5CHP A;  1IE0 A;  1J6W A;  3SZZ A;  1JQW A;  4BY1 K;  3RZD K;  2JA5 C;  3HOU K;  1YNN A;  3GTJ C;  4C45 A;  4X6A C;  3N0C A;  4A3J K;  1I50 C;  5M5W K;  3M3Y K;  1BJT A;  3FOE A;  1O2A A;  4XLP A;  4A3L C;  2CFA B;  5IYD K;  2Y0S D;  2R7Z A;  2GSU A;  1VGX A;  4QJV A;  2O5I A;  1O29 A;  2B63 A;  3M4O C;  4G0U A;  2NVY K;  2NVT C;  1USM A;  4GTB A;  5IOR A;  3OEP A;  1EK8 A;  1O24 A;  5IOT A;  3T01 A;  5E68 A;  2YU9 A;  1I6V A;  5C4X C;  1TWH C;  1SFO C;  2Y3P A;  3FKI K;  4C3H C;  1XXA A;  2W7V A;  4KAT A;  2WAQ D;  3ORE A;  1TWF C;  3LAJ A;  2JA5 A;  1PJ5 A;  1BS2 A;  4KB4 A;  4BKW A;  4BBR C;  3S1R K;  5M5Y K;  1TWG C;  2JA7 K;  3AD9 C;  2VUM K;  1XZP A;  1I50 A;  4GTL A;  5C44 C;  3CAG A;  4C2M K;  2E2I K;  4Y52 C;  1O2F B;  4OIN A;  4J3N A;  1ISE A;  5IP9 K;  1BGW A;  1EH1 A;  1WSR A;  3GTP C;  1EQR A;  4OIQ A;  1HQM A;  4OIR A;  1WSV A;  2JA8 C;  1TWC C;  1X31 C;  1XXC A;  3HKZ D;  3GTK C;  3GTG C;  2R93 K;  4AH6 A;  1Y1V K;  4A3D C;  3LPX A;  3GTO C;  4YFN A;  1GE9 A;  1IS1 A;  2FQO A;  2CFA A;  4O2D A;  1I6H C;  3A8J A;  5D4D A;  4MQ9 A;  3V4G A;  1K83 C;  3GTL K;  3HOY C;  4LK1 A;  5IYB C;  1F7U A;  3PO2 K;  3HOW C;  4P5A A;  1XZQ B;  3GTK A;  4A93 K;  3GTG A;  1KQ4 A;  3S1N K;  1O2B A;  4A3I C;  4A3M K;  1USO A;  3H0G C;  1AB4 A;  3IPJ A;  4BY7 K;  2Y0S L;  2WB1 D;  4A3F K;  3LAP A;  2RGR A;  3BUE A;  1PJ7 A;  1Y1W C;  4KN7 A;  4BXX K;  4BY1 C;  2WAQ L;  4C3I C;  4KM8 A;  1IW7 A;  2B63 C;  2D6F C;  1TWA K;  2ZUE A;  4PAA A;  4GT9 A;  3AH5 A;  4A3B K;  4GZY A;  3S1M C;  3TTG A;  1F9N A;  3GTQ K;  5FLM K;  3S2D K;  2YU9 C;  3JST A;  5C4J K;  2NVQ C;  5IYD C;  1J6X A;  2ZUF A; 
#chains in the Genus database with same CATH homology
 2WAQ D;  1R9T K;  1TWF C;  3GTQ C;  3GTO K;  3S2D C;  3GTM K;  4MEY A;  4BY7 C;  4BBR C;  4A3F C;  5C4J C;  2PA8 L;  5M5Y K;  4QJV B;  1TWG C;  3S1R K;  2JA7 K;  3S2H C;  3S1Q C;  2VUM K;  3HOX K;  3WOD A;  3S14 C;  3RZD C;  5C44 C;  4A3C K;  4C2M K;  2E2I K;  2E2H K;  1I3Q K;  4Y52 C;  3HOU C;  1K83 K;  4MEX A;  4BBS K;  4OIN A;  1R9T C;  3HKZ L;  3GTM C;  2JA8 K;  5IYC K;  5IP9 K;  3K7A C;  1BDF A;  4C3J K;  4A3J C;  2JA6 K;  4Y7N K;  3S1R C;  3S16 C;  3CQZ K;  3I4M K;  3GTP C;  2NVX K;  4BXX C;  3M3Y C;  1TWC K;  4G7H A;  2E2J C;  3I4N K;  4Q5S A;  2E2H C;  4OIQ A;  3GTK K;  1HQM A;  3GTG K;  4OIR A;  3H3V L;  4JK1 A;  3S17 C;  4A3B C;  2JA8 C;  2PA8 D;  5IYC C;  5C3E C;  2NVY C;  3HOZ C;  3H0G K;  3CQZ C;  5FLM C;  3I4M C;  3RZO K;  4LLG A;  4ZH4 A;  1TWC C;  3HKZ D;  3GTK C;  4XSX A;  3GTG C;  1I6H K;  2R93 K;  1ZYR A;  5TMC A;  3FKI C;  1Y1V K;  5M3M K;  4A3D C;  3GTJ K;  4KMU A;  3PO3 C;  3GTO C;  4AYB L;  4YFN A;  4X6A K;  2PMZ L;  3HOY K;  5IYB K;  4A3E K;  3H3V D;  4LJZ A;  2O5J A;  2JA7 C;  1YNJ A;  3HOW K;  2VUM C;  1I6H C;  3HOX C;  4C3I K;  4YFK A;  5D4D A;  4A3C C;  2E2I C;  4MQ9 A;  2B63 K;  2WB1 L;  1I3Q C;  2R7Z K;  4BBS C;  1K83 C;  3HOV K;  4QIW L;  4XSZ A;  3S1M K;  3M4O K;  2A69 A;  3GTL K;  4LK1 A;  5IP9 C;  5IYB C;  4A3I K;  3HOY C;  4LK0 A;  2JA6 C;  4Y7N C;  3PO2 K;  1XPP A;  3S15 K;  4G7Z A;  4OIO A;  4XLN A;  1SMY A;  3HOW C;  4YG2 A;  4A3G K;  2NVX C;  2YU9 K;  4NOI A;  4YFX A;  2A68 A;  2NVQ K;  3I4N C;  4AYB D;  5C4X K;  2R7Z C;  1TWH K;  5M3F K;  2PMZ D;  1SFO K;  4C3H K;  2PPB A;  4A93 K;  5M5X K;  2JA5 K;  3S1N K;  4A3I C;  5TMF A;  2BE5 A;  4A3M K;  1TWF K;  3DXJ A;  3S15 C;  3H0G C;  3RZO C;  4BY7 K;  2Y0S L;  2WB1 D;  4A3F K;  1Y1W K;  2R92 K;  1TWG K;  1I50 K;  4QIW D;  3S1Q K;  4BY1 K;  4OIP A;  3RZD K;  5C44 K;  2R93 C;  1WCM K;  4A93 C;  2JA5 C;  3S1N C;  1Y1V C;  4Y52 K;  3HOU K;  1YNN A;  4A3L K;  3GTJ C;  5IP7 K;  4KN4 A;  4X6A C;  3S16 K;  3K7A K;  4A3J K;  1Y1W C;  2NVT K;  4A3E C;  4KN7 A;  2R92 C;  1I50 C;  3GTP K;  5M5W K;  4BXX K;  4BY1 C;  2A6E A;  2WAQ L;  3M3Y K;  2E2J K;  4A3K K;  1WCM C;  1IW7 A;  2B63 C;  4XLP A;  4G7O A;  4A3L C;  1TWA K;  5IP7 C;  3HOV C;  5IYD K;  2Y0S D;  3S17 K;  4A3B K;  4QJV A;  5C3E K;  2O5I A;  3S1M C;  4GZY A;  3M4O C;  3GTL C;  3EQL A;  2NVY K;  2NVT C;  3HOZ K;  3GTQ K;  3PO2 C;  5FLM K;  3S2D K;  4A3G C;  2YU9 C;  4BBR K;  4A3K C;  5C4J K;  4Q4Z A;  2NVQ C;  2A6H A;  3S2H K;  5FJ8 K;  1I6V A;  5C4X C;  1TWH C;  1TWA C;  3S14 K;  5IYD C;  1SFO C;  3FKI K;  2CW0 A;  4A3D K;  4A3M C;  3PO3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...