1Y1VK

Refined rna polymerase ii-tfiis complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1vK00
4OIPA 1WCMC 5C44C 2B63C 3S1QK 5C4JK 5D4DA 1I6HK 5IP9C 2NVYC 4A3EK 2PA8L 3S14K 1I50C 4QIWD 3S1MC 4A3FK 2JA5K 1TWFC 3GTPK 5M3MK 4A3MC 1TWAC 4XSZA 4OIQA 2E2HK 3S2HC 1I6VA 3FKIK 5IYCC 2R92C 1I3QK 4A3BC 2R7ZC 5M5WK 2PPBA 4A3GK 3PO3K 4LK0A 3PO2K 4OIOA 1K83C 4BBSC 2WB1D 1BDFA 2JA7C 4BY1C 4G7OA 3I4NK 4Q5SA 4MQ9A 4Y52K 4G7HA 3CQZC 4LK1A 5TMCA 3M4OC 4A3CK 3GTQK 1SFOK 4X6AC 4A3DC 4A3LC 5IYBC 2NVXK 4QJVB 1TWHC 4AYBL 4BBRK 1R9TC 3M3YK 4A93K 1IW7A 1TWCK 4A3KC 2NVTK 3GTLC 4Y7NC 4KN7A 1TWGC 1WCMK 2Y0SD 5C44K 4A3JK 4A3IC 3S1RC 3HKZL 4YFNA 3HOZC 2R93K 3H0GK 4C3IK 3GTMC 3HOVK 3S1MK 2E2JK 4BY7K 3S2DC 4KMUA 3RZDC 1TWAK 3GTGK 2E2IK 3S2HK 4C2MK 3S16K 4YFKA 3GTJK 2O5IA 4MEYA 4A3BK 5M3FK 3I4MK 2VUMC 3HOYC 4BBSK 1K83K 3RZOC 1Y1WK 2JA6C 3S1NC 4GZYA 3S15C 5IP7C 2PMZL 5C3EK 5IYDC 3GTOK 4LLGA 2PA8D 4X6AK 5FJ8K 3HOXC 5FLMK 3S17C 2NVQC 5C4JC 5IYBK 3H3VL 1HQMA 1R9TK 3S1QC 4A3DK 4A3EC 3S14C 2CW0A 2BE5A 3GTKC 3GTPC 1Y1VK 2WAQL 4BY1K 2B63K 2A6EA 4QJVA 4A3IK 4Q4ZA 4KN4A 5IP9K 2NVYK 2YU9C 1I3QC 1I50K 4OINA 5C4XC 1TWFK 3HOUC 3HOWC 4A3MK 3PO3C 3EQLA 3RZDK 5M5YK 3PO2C 4BXXC 4QIWL 3I4NC 5IYCK 4Y52C 2R92K 4A3CC 4AYBD 4OIRA 2R7ZK 2A6HA 4XLPA 1SFOC 3HOYK 3K7AC 4JK1A 2NVXC 3RZOK 2JA7K 3M3YC 2WAQD 2JA8C 3CQZK 3HKZD 4ZH4A 2NVTC 3S15K 3M4OK 2WB1L 4NOIA 4A3JC 4XSXA 4C3JK 3HOXK 3S17K 4A3LK 2NVQK 2O5JA 1TWHK 1I6HC 2R93C 3H0GC 4A3KK 4A3FC 2JA5C 3GTKK 3HOVC 3GTLK 2E2JC 4BY7C 4Y7NK 1TWGK 3S1RK 3DXJA 2E2HC 2E2IC 3GTGC 1YNJA 3WODA 3FKIC 3HOZK 3S16C 1YNNA 4YFXA 2YU9K 3GTJC 2Y0SL 5C4XK 3GTMK 5M5XK 3HOUK 3S2DK 4A3GC 3HOWK 3I4MC 2PMZD 4YG2A 4BXXK 1Y1WC 4C3HK 3H3VD 5C3EC 4LJZA 1XPPA 3GTOC 3GTQC 2A68A 4G7ZA 1SMYA 2VUMK 1ZYRA 5TMFA 5FLMC 3K7AK 4XLNA 2JA6K 3S1NK 4BBRC 4A93C 1TWCC 2JA8K 5IP7K 2A69A 5IYDK 1Y1VC 4MEXA
chains in the Genus database with same CATH superfamily
4OIPA 2B63C 3GEHA 5C4JK 1I6HK 5IP9C 4QIWD 2JA5K 5M3MK 5JVOA 2E2HK 1WOPA 1WORA 2FQOA 4A3BC 1SFOA 1BS2A 4A3GK 4LK0A 4BBSC 2WB1D 4G7OA 4Q5SA 3I4NK 2GSOA 4G7HA 3CQZC 5TMCA 4GTBA 4KARA 4AH6A 4X6AC 4C3JC 4A3DC 1VH2A 5HL8A 2NVXK 4A93K 2R93A 1O24A 3M3YK 2JA5A 4A3KC 4KM8A 2E2HA 1WCMK 4A3IC 3HOZC 3GTJA 3H0GK 1IE0A 2E2JK 1TWAK 4PAAA 1B4AA 4YFKA 1XXCA 4GTLA 3IPJA 3OPFA 4P5AA 1WIHA 3ADAC 2V6SA 4GTCA 1WOOA 3A8JA 1WCMA 3NUHA 3HOXC 3T00A 5FLMK 3S1QC 1WQHA 3H0GA 1HQMA 5IYBK 1R9TK 4A3EC 1TWFA 3GTPC 1TWAA 2A6EA 4Q4ZA 1YX2A 2NVYK 2R7ZA 1HI9A 4FZBA 3EQLA 1V5VA 5IOTA 1ZQ1C 1O28A 2R92K 4Y52C 4OIRA 3AQPA 4XLPA 1BJTA 1R9TA 1TWHA 3K7AC 3RZOK 2JA7K 3ERED 3L4KA 4ZH4A 2NVTC 3AD9C 1WSVA 4A3JC 3TTGA 3GTMA 4C3IC 4KM9A 3HOVC 1USOA 4Y7NK 1YCLA 3GTGC 4LOWA 2E2IC 1YNJA 3FHZA 2P8TA 1XZPA 3FKIC 3S16C 1YNNA 2Y0SL 5C4XK 5IOQA 4GTEA 1JOEA 4YG2A 4BXXK 2ZUFA 4LR2A 3GTOC 2VUMK 3S1NK 4BBRC 2GSUA 3GIRA 5IYDK 1Y1VC 3N0BA 3BP3A 3AH5A 2ZFZA 1IQ0A 3S14K 1I50C 4A3FK 4A3MC 4XSZA 1WQGA 4OIQA 2XCQA 3S2HC 3OREA 3PO3K 1JQWA 1BDFA 1O27A 2V6TA 2ZUEA 3G4CA 3M4OC 4A3CK 1INNA 3GEEA 1X31C 1SFOK 4A3LC 3GDZA 4AYBL 2CFAA 4KB2A 1TWGC 4YFNA 2R93K 3A8IA 4BY7K 3S2DC 4KMUA 3RZDC 3TFJA 4C2MK 1EFWA 3GTJK 2O5IA 4A3BK 5M3FK 3S0XA 3I4MK 3HOYC 2EBBA 4BBSK 1Y1WK 5C3EK 2B63A 4X6AK 3TFHA 3S17C 4A3DK 2NVQC 5C4JC 4KASA 2CW0A 2BE5A 4C45A 3GTKC 4A3IK 2YU9C 1J6XA 1ZVUA 1TWFK 1IBAA 4KMHA 3MMLB 1Y1WA 5M5YK 1XZQB 3CQZA 3I4NC 5IYCK 2R7ZK 5JFEA 4JK1A 2NVXC 3M3YC 2P5MA 1PJ5A 4RMFA 4XCHA 5IOSA 3HOXK 1J6WA 2O5JA 1TWHK 3H0GC 3OEPA 1DD5A 4GTAA 2E2JC 3GTLK 1RU0A 3S1RK 3DXJA 4KMAA 1EQRA 1EI6A 3GTMK 5M5XK 2JH3A 3LAPA 1DCPA 4C3HK 4DDQA 3GTQC 1XPPA 2A68A 1B4BA 2RH6A 5FLMC 4XLNA 3K7AK 2JA6K 4J3NA 1TWCC 3GEIA 3GTLA 5IP7K 2A69A 2GSNA 3GTPA 4MEXA 5C44C 5D4DA 2NVYC 2PA8L 3S1MC 1PJ6A 1I6VA 3FKIK 1EH1A 2R92C 1I3QK 1O2AA 5M5WK 2GAHC 2Y3PA 3PO2K 2JA6A 1K83C 4GTFA 3L4JA 2JA7C 1DCOA 1KQ4A 5CHPA 3AD7C 4MQ9A 4QJVB 4BBRK 2PHCB 1IW7A 3A8KA 4Y7NC 1AB4A 2Y0SD 3FOEA 4BY1C 3GTGA 1PJ7A 2E2IA 3HKZL 3FKIA 1I3QA 4G0VA 1WQFA 1O29A 3SZYA 3S2HK 3TFIA 1ZBSA 3GTOA 1USMA 1UV7A 5E68A 1VRQC 2VUMC 3S1NC 4KDDA 4GZYA 3S15C 1Y1VA 2PMZL 5IYDC 4WJ3M 4LLGA 5EGEA 3H3VL 1I50A 4G0UA 3S14C 2B63K 4KN4A 5IP9K 1J98A 2W7VA 3HOUC 3HOWC 3PO3C 3RZDK 4QIWL 4A3CC 4AYBD 1ISEA 1SFOC 3HOYK 3JSTA 3N3YA 3CQZK 2JA8C 1VGXA 3FOFA 1F7UA 2WB1L 1TWGA 4NOIA 1L0WA 4WJ4A 4C3JK 3S17K 2NVQK 1I6HC 2R93C 4A3KK 1J6VA 2JA5C 1EK8A 1F9NA 3GTKK 4BY7C 2XCRB 2GAGC 2E2HC 4C2MC 3HOZK 4YFXA 1O2FB 3GTJC 2YU9K 2D6FC 4A3GC 3I4MC 1ZXOA 1Y1WC 1O25A 4G0WA 3QX3A 5C3EC 4LJZA 1DCHA 3T02A 4G7ZA 1XZQA 1ZYRA 5TMFA 4A93C 3T01A 3GTKA 4KC6A 1WCMC 1IL2A 3S1QK 1XXBA 2YU9A 3SZZA 4A3EK 1TWFC 3GTPK 1TWAC 5CJ9A 4GFQA 5IYCC 3HXAA 2R7ZC 2V6UA 1WOSA 4BKWA 5EGHA 2PPBA 2NVXA 4OIOA 4LQYA 2XCOA 4Y52K 4LK1A 3GTQK 5IYBC 1R9TC 1TWHC 1C0AA 3V4GA 1TWCK 3AQOA 3LPXA 5L46A 2NVTK 3GTLC 4KN7A 4A3JK 3S1RC 5C44K 4C3IK 1GE9A 3GTMC 1O2BA 3AD8C 3HOVK 3S1MK 3GTGK 2E2IK 3S16K 4P9SA 3GTQA 4C3HC 4BLBA 4MEYA 3Q3QA 1BGWA 3VA7A 1K83K 3RZOC 2JA6C 1TWCA 4P5BA 3N0CA 1F7VA 5IP7C 1G51A 3GTOK 2PA8D 5FJ8K 4WILA 2NVYA 4FM9A 1JVIA 4PABA 1XZPB 4GTDA 1Y1VK 1F93A 2WAQL 4BY1K 4QJVA 4O2DA 2R92A 3BP8C 3CAGA 1I3QC 1I50K 4OINA 5C4XC 1K83A 4KATA 4A3MK 3PO2C 2JA7A 4BXXC 4ILDA 5IORA 1VLOA 5TJ3A 2A6HA 2WAQD 4GT9A 3S15K 3HKZD 3M4OK 2RGRA 3BUEA 4XSXA 1XXAA 4A3LK 4A3FC 1TWGK 1O26A 1IS1A 3WODA 2FQTA 2KWAA 4KMDA 3LAJA 3HOUK 3S2DK 2VUMA 3HOWK 2PMZD 1WSRA 3H3VD 2CFAB 1VJEA 4KB4A 1SMYA 4BLAA 4M1XA 4KAWX 2JA8K 3G4AA 3GSIA
chains in the Genus database with same CATH topology
4OIPA 1WCMC 5C44C 2B63C 3S1QK 5C4JK 5D4DA 1I6HK 5IP9C 2NVYC 4A3EK 2PA8L 3S14K 1I50C 4QIWD 3S1MC 4A3FK 2JA5K 1TWFC 3GTPK 5M3MK 4A3MC 1TWAC 4XSZA 4OIQA 2E2HK 3S2HC 1I6VA 3FKIK 5IYCC 2R92C 1I3QK 4A3BC 2R7ZC 5M5WK 2PPBA 4A3GK 3PO3K 4LK0A 3PO2K 4OIOA 1K83C 4BBSC 2WB1D 1BDFA 2JA7C 4BY1C 4G7OA 3I4NK 4Q5SA 4MQ9A 4Y52K 4G7HA 3CQZC 4LK1A 5TMCA 3M4OC 4A3CK 3GTQK 1SFOK 4X6AC 4A3DC 4A3LC 5IYBC 2NVXK 4QJVB 1TWHC 4AYBL 4BBRK 1R9TC 3M3YK 4A93K 1IW7A 1TWCK 4A3KC 2NVTK 3GTLC 4Y7NC 4KN7A 1TWGC 1WCMK 2Y0SD 5C44K 4A3JK 4A3IC 3S1RC 3HKZL 4YFNA 3HOZC 2R93K 3H0GK 4C3IK 3GTMC 3HOVK 3S1MK 2E2JK 4BY7K 3S2DC 4KMUA 3RZDC 1TWAK 3GTGK 2E2IK 3S2HK 4C2MK 3S16K 4YFKA 3GTJK 2O5IA 4MEYA 4A3BK 5M3FK 3I4MK 2VUMC 3HOYC 4BBSK 1K83K 3RZOC 1Y1WK 2JA6C 3S1NC 4GZYA 3S15C 5IP7C 2PMZL 5C3EK 5IYDC 3GTOK 4LLGA 2PA8D 4X6AK 5FJ8K 3HOXC 5FLMK 3S17C 2NVQC 5C4JC 5IYBK 3H3VL 1HQMA 1R9TK 3S1QC 4A3DK 4A3EC 3S14C 2CW0A 2BE5A 3GTKC 3GTPC 1Y1VK 2WAQL 4BY1K 2B63K 2A6EA 4QJVA 4A3IK 4Q4ZA 4KN4A 5IP9K 2NVYK 2YU9C 1I3QC 1I50K 4OINA 5C4XC 1TWFK 3HOUC 3HOWC 4A3MK 3PO3C 3EQLA 3RZDK 5M5YK 3PO2C 4BXXC 4QIWL 3I4NC 5IYCK 4Y52C 2R92K 4A3CC 4AYBD 4OIRA 2R7ZK 2A6HA 4XLPA 1SFOC 3HOYK 3K7AC 4JK1A 2NVXC 3RZOK 2JA7K 3M3YC 2WAQD 2JA8C 3CQZK 3HKZD 4ZH4A 2NVTC 3S15K 3M4OK 2WB1L 4NOIA 4A3JC 4XSXA 4C3JK 3HOXK 3S17K 4A3LK 2NVQK 2O5JA 1TWHK 1I6HC 2R93C 3H0GC 4A3KK 4A3FC 2JA5C 3GTKK 3HOVC 3GTLK 2E2JC 4BY7C 4Y7NK 1TWGK 3S1RK 3DXJA 2E2HC 2E2IC 3GTGC 1YNJA 3WODA 3FKIC 3HOZK 3S16C 1YNNA 4YFXA 2YU9K 3GTJC 2Y0SL 5C4XK 3GTMK 5M5XK 3HOUK 3S2DK 4A3GC 3HOWK 3I4MC 2PMZD 4YG2A 4BXXK 1Y1WC 4C3HK 3H3VD 5C3EC 4LJZA 1XPPA 3GTOC 3GTQC 2A68A 4G7ZA 1SMYA 2VUMK 1ZYRA 5TMFA 5FLMC 3K7AK 4XLNA 2JA6K 3S1NK 4BBRC 4A93C 1TWCC 2JA8K 5IP7K 2A69A 5IYDK 1Y1VC 4MEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP A;  1WCM C;  5C44 C;  2B63 C;  3S1Q K;  5C4J K;  5D4D A;  1I6H K;  5IP9 C;  2NVY C;  4A3E K;  2PA8 L;  3S14 K;  1I50 C;  4QIW D;  3S1M C;  4A3F K;  2JA5 K;  1TWF C;  3GTP K;  5M3M K;  4A3M C;  1TWA C;  4XSZ A;  4OIQ A;  2E2H K;  3S2H C;  1I6V A;  3FKI K;  5IYC C;  2R92 C;  1I3Q K;  4A3B C;  2R7Z C;  5M5W K;  2PPB A;  4A3G K;  3PO3 K;  4LK0 A;  3PO2 K;  4OIO A;  1K83 C;  4BBS C;  2WB1 D;  1BDF A;  2JA7 C;  4BY1 C;  4G7O A;  3I4N K;  4Q5S A;  4MQ9 A;  4Y52 K;  4G7H A;  3CQZ C;  4LK1 A;  5TMC A;  3M4O C;  4A3C K;  3GTQ K;  1SFO K;  4X6A C;  4A3D C;  4A3L C;  5IYB C;  2NVX K;  4QJV B;  1TWH C;  4AYB L;  4BBR K;  1R9T C;  3M3Y K;  4A93 K;  1IW7 A;  1TWC K;  4A3K C;  2NVT K;  3GTL C;  4Y7N C;  4KN7 A;  1TWG C;  1WCM K;  2Y0S D;  5C44 K;  4A3J K;  4A3I C;  3S1R C;  3HKZ L;  4YFN A;  3HOZ C;  2R93 K;  3H0G K;  4C3I K;  3GTM C;  3HOV K;  3S1M K;  2E2J K;  4BY7 K;  3S2D C;  4KMU A;  3RZD C;  1TWA K;  3GTG K;  2E2I K;  3S2H K;  4C2M K;  3S16 K;  4YFK A;  3GTJ K;  2O5I A;  4MEY A;  4A3B K;  5M3F K;  3I4M K;  2VUM C;  3HOY C;  4BBS K;  1K83 K;  3RZO C;  1Y1W K;  2JA6 C;  3S1N C;  4GZY A;  3S15 C;  5IP7 C;  2PMZ L;  5C3E K;  5IYD C;  3GTO K;  4LLG A;  2PA8 D;  4X6A K;  5FJ8 K;  3HOX C;  5FLM K;  3S17 C;  2NVQ C;  5C4J C;  5IYB K;  3H3V L;  1HQM A;  1R9T K;  3S1Q C;  4A3D K;  4A3E C;  3S14 C;  2CW0 A;  2BE5 A;  3GTK C;  3GTP C;  1Y1V K;  2WAQ L;  4BY1 K;  2B63 K;  2A6E A;  4QJV A;  4A3I K;  4Q4Z A;  4KN4 A;  5IP9 K;  2NVY K;  2YU9 C;  1I3Q C;  1I50 K;  4OIN A;  5C4X C;  1TWF K;  3HOU C;  3HOW C;  4A3M K;  3PO3 C;  3EQL A;  3RZD K;  5M5Y K;  3PO2 C;  4BXX C;  4QIW L;  3I4N C;  5IYC K;  4Y52 C;  2R92 K;  4A3C C;  4AYB D;  4OIR A;  2R7Z K;  2A6H A;  4XLP A;  1SFO C;  3HOY K;  3K7A C;  4JK1 A;  2NVX C;  3RZO K;  2JA7 K;  3M3Y C;  2WAQ D;  2JA8 C;  3CQZ K;  3HKZ D;  4ZH4 A;  2NVT C;  3S15 K;  3M4O K;  2WB1 L;  4NOI A;  4A3J C;  4XSX A;  4C3J K;  3HOX K;  3S17 K;  4A3L K;  2NVQ K;  2O5J A;  1TWH K;  1I6H C;  2R93 C;  3H0G C;  4A3K K;  4A3F C;  2JA5 C;  3GTK K;  3HOV C;  3GTL K;  2E2J C;  4BY7 C;  4Y7N K;  1TWG K;  3S1R K;  3DXJ A;  2E2H C;  2E2I C;  3GTG C;  1YNJ A;  3WOD A;  3FKI C;  3HOZ K;  3S16 C;  1YNN A;  4YFX A;  2YU9 K;  3GTJ C;  2Y0S L;  5C4X K;  3GTM K;  5M5X K;  3HOU K;  3S2D K;  4A3G C;  3HOW K;  3I4M C;  2PMZ D;  4YG2 A;  4BXX K;  1Y1W C;  4C3H K;  3H3V D;  5C3E C;  4LJZ A;  1XPP A;  3GTO C;  3GTQ C;  2A68 A;  4G7Z A;  1SMY A;  2VUM K;  1ZYR A;  5TMF A;  5FLM C;  3K7A K;  4XLN A;  2JA6 K;  3S1N K;  4BBR C;  4A93 C;  1TWC C;  2JA8 K;  5IP7 K;  2A69 A;  5IYD K;  1Y1V C;  4MEX A; 
#chains in the Genus database with same CATH topology
 4OIP A;  2B63 C;  3GEH A;  5C4J K;  1I6H K;  5IP9 C;  4QIW D;  2JA5 K;  5M3M K;  5JVO A;  2E2H K;  1WOP A;  1WOR A;  2FQO A;  4A3B C;  1SFO A;  1BS2 A;  4A3G K;  4LK0 A;  4BBS C;  2WB1 D;  4G7O A;  4Q5S A;  3I4N K;  2GSO A;  4G7H A;  3CQZ C;  5TMC A;  4GTB A;  4KAR A;  4AH6 A;  4X6A C;  4C3J C;  4A3D C;  1VH2 A;  5HL8 A;  2NVX K;  4A93 K;  2R93 A;  1O24 A;  3M3Y K;  2JA5 A;  4A3K C;  4KM8 A;  2E2H A;  1WCM K;  4A3I C;  3HOZ C;  3GTJ A;  3H0G K;  1IE0 A;  2E2J K;  1TWA K;  4PAA A;  1B4A A;  4YFK A;  1XXC A;  4GTL A;  3IPJ A;  3OPF A;  4P5A A;  1WIH A;  3ADA C;  2V6S A;  4GTC A;  1WOO A;  3A8J A;  1WCM A;  3NUH A;  3HOX C;  3T00 A;  5FLM K;  3S1Q C;  1WQH A;  3H0G A;  1HQM A;  5IYB K;  1R9T K;  4A3E C;  1TWF A;  3GTP C;  1TWA A;  2A6E A;  4Q4Z A;  1YX2 A;  2NVY K;  2R7Z A;  1HI9 A;  4FZB A;  3EQL A;  1V5V A;  5IOT A;  1ZQ1 C;  1O28 A;  2R92 K;  4Y52 C;  4OIR A;  3AQP A;  4XLP A;  1BJT A;  1R9T A;  1TWH A;  3K7A C;  3RZO K;  2JA7 K;  3ERE D;  3L4K A;  4ZH4 A;  2NVT C;  3AD9 C;  1WSV A;  4A3J C;  3TTG A;  3GTM A;  4C3I C;  4KM9 A;  3HOV C;  1USO A;  4Y7N K;  1YCL A;  3GTG C;  4LOW A;  2E2I C;  1YNJ A;  3FHZ A;  2P8T A;  1XZP A;  3FKI C;  3S16 C;  1YNN A;  2Y0S L;  5C4X K;  5IOQ A;  4GTE A;  1JOE A;  4YG2 A;  4BXX K;  2ZUF A;  4LR2 A;  3GTO C;  2VUM K;  3S1N K;  4BBR C;  2GSU A;  3GIR A;  5IYD K;  1Y1V C;  3N0B A;  3BP3 A;  3AH5 A;  2ZFZ A;  1IQ0 A;  3S14 K;  1I50 C;  4A3F K;  4A3M C;  4XSZ A;  1WQG A;  4OIQ A;  2XCQ A;  3S2H C;  3ORE A;  3PO3 K;  1JQW A;  1BDF A;  1O27 A;  2V6T A;  2ZUE A;  3G4C A;  3M4O C;  4A3C K;  1INN A;  3GEE A;  1X31 C;  1SFO K;  4A3L C;  3GDZ A;  4AYB L;  2CFA A;  4KB2 A;  1TWG C;  4YFN A;  2R93 K;  3A8I A;  4BY7 K;  3S2D C;  4KMU A;  3RZD C;  3TFJ A;  4C2M K;  1EFW A;  3GTJ K;  2O5I A;  4A3B K;  5M3F K;  3S0X A;  3I4M K;  3HOY C;  2EBB A;  4BBS K;  1Y1W K;  5C3E K;  2B63 A;  4X6A K;  3TFH A;  3S17 C;  4A3D K;  2NVQ C;  5C4J C;  4KAS A;  2CW0 A;  2BE5 A;  4C45 A;  3GTK C;  4A3I K;  2YU9 C;  1J6X A;  1ZVU A;  1TWF K;  1IBA A;  4KMH A;  3MML B;  1Y1W A;  5M5Y K;  1XZQ B;  3CQZ A;  3I4N C;  5IYC K;  2R7Z K;  5JFE A;  4JK1 A;  2NVX C;  3M3Y C;  2P5M A;  1PJ5 A;  4RMF A;  4XCH A;  5IOS A;  3HOX K;  1J6W A;  2O5J A;  1TWH K;  3H0G C;  3OEP A;  1DD5 A;  4GTA A;  2E2J C;  3GTL K;  1RU0 A;  3S1R K;  3DXJ A;  4KMA A;  1EQR A;  1EI6 A;  3GTM K;  5M5X K;  2JH3 A;  3LAP A;  1DCP A;  4C3H K;  4DDQ A;  3GTQ C;  1XPP A;  2A68 A;  1B4B A;  2RH6 A;  5FLM C;  4XLN A;  3K7A K;  2JA6 K;  4J3N A;  1TWC C;  3GEI A;  3GTL A;  5IP7 K;  2A69 A;  2GSN A;  3GTP A;  4MEX A;  5C44 C;  5D4D A;  2NVY C;  2PA8 L;  3S1M C;  1PJ6 A;  1I6V A;  3FKI K;  1EH1 A;  2R92 C;  1I3Q K;  1O2A A;  5M5W K;  2GAH C;  2Y3P A;  3PO2 K;  2JA6 A;  1K83 C;  4GTF A;  3L4J A;  2JA7 C;  1DCO A;  1KQ4 A;  5CHP A;  3AD7 C;  4MQ9 A;  4QJV B;  4BBR K;  2PHC B;  1IW7 A;  3A8K A;  4Y7N C;  1AB4 A;  2Y0S D;  3FOE A;  4BY1 C;  3GTG A;  1PJ7 A;  2E2I A;  3HKZ L;  3FKI A;  1I3Q A;  4G0V A;  1WQF A;  1O29 A;  3SZY A;  3S2H K;  3TFI A;  1ZBS A;  3GTO A;  1USM A;  1UV7 A;  5E68 A;  1VRQ C;  2VUM C;  3S1N C;  4KDD A;  4GZY A;  3S15 C;  1Y1V A;  2PMZ L;  5IYD C;  4WJ3 M;  4LLG A;  5EGE A;  3H3V L;  1I50 A;  4G0U A;  3S14 C;  2B63 K;  4KN4 A;  5IP9 K;  1J98 A;  2W7V A;  3HOU C;  3HOW C;  3PO3 C;  3RZD K;  4QIW L;  4A3C C;  4AYB D;  1ISE A;  1SFO C;  3HOY K;  3JST A;  3N3Y A;  3CQZ K;  2JA8 C;  1VGX A;  3FOF A;  1F7U A;  2WB1 L;  1TWG A;  4NOI A;  1L0W A;  4WJ4 A;  4C3J K;  3S17 K;  2NVQ K;  1I6H C;  2R93 C;  4A3K K;  1J6V A;  2JA5 C;  1EK8 A;  1F9N A;  3GTK K;  4BY7 C;  2XCR B;  2GAG C;  2E2H C;  4C2M C;  3HOZ K;  4YFX A;  1O2F B;  3GTJ C;  2YU9 K;  2D6F C;  4A3G C;  3I4M C;  1ZXO A;  1Y1W C;  1O25 A;  4G0W A;  3QX3 A;  5C3E C;  4LJZ A;  1DCH A;  3T02 A;  4G7Z A;  1XZQ A;  1ZYR A;  5TMF A;  4A93 C;  3T01 A;  3GTK A;  4KC6 A;  1WCM C;  1IL2 A;  3S1Q K;  1XXB A;  2YU9 A;  3SZZ A;  4A3E K;  1TWF C;  3GTP K;  1TWA C;  5CJ9 A;  4GFQ A;  5IYC C;  3HXA A;  2R7Z C;  2V6U A;  1WOS A;  4BKW A;  5EGH A;  2PPB A;  2NVX A;  4OIO A;  4LQY A;  2XCO A;  4Y52 K;  4LK1 A;  3GTQ K;  5IYB C;  1R9T C;  1TWH C;  1C0A A;  3V4G A;  1TWC K;  3AQO A;  3LPX A;  5L46 A;  2NVT K;  3GTL C;  4KN7 A;  4A3J K;  3S1R C;  5C44 K;  4C3I K;  1GE9 A;  3GTM C;  1O2B A;  3AD8 C;  3HOV K;  3S1M K;  3GTG K;  2E2I K;  3S16 K;  4P9S A;  3GTQ A;  4C3H C;  4BLB A;  4MEY A;  3Q3Q A;  1BGW A;  3VA7 A;  1K83 K;  3RZO C;  2JA6 C;  1TWC A;  4P5B A;  3N0C A;  1F7V A;  5IP7 C;  1G51 A;  3GTO K;  2PA8 D;  5FJ8 K;  4WIL A;  2NVY A;  4FM9 A;  1JVI A;  4PAB A;  1XZP B;  4GTD A;  1Y1V K;  1F93 A;  2WAQ L;  4BY1 K;  4QJV A;  4O2D A;  2R92 A;  3BP8 C;  3CAG A;  1I3Q C;  1I50 K;  4OIN A;  5C4X C;  1K83 A;  4KAT A;  4A3M K;  3PO2 C;  2JA7 A;  4BXX C;  4ILD A;  5IOR A;  1VLO A;  5TJ3 A;  2A6H A;  2WAQ D;  4GT9 A;  3S15 K;  3HKZ D;  3M4O K;  2RGR A;  3BUE A;  4XSX A;  1XXA A;  4A3L K;  4A3F C;  1TWG K;  1O26 A;  1IS1 A;  3WOD A;  2FQT A;  2KWA A;  4KMD A;  3LAJ A;  3HOU K;  3S2D K;  2VUM A;  3HOW K;  2PMZ D;  1WSR A;  3H3V D;  2CFA B;  1VJE A;  4KB4 A;  1SMY A;  4BLA A;  4M1X A;  4KAW X;  2JA8 K;  3G4A A;  3GSI A; 
#chains in the Genus database with same CATH homology
 4OIP A;  1WCM C;  5C44 C;  2B63 C;  3S1Q K;  5C4J K;  5D4D A;  1I6H K;  5IP9 C;  2NVY C;  4A3E K;  2PA8 L;  3S14 K;  1I50 C;  4QIW D;  3S1M C;  4A3F K;  2JA5 K;  1TWF C;  3GTP K;  5M3M K;  4A3M C;  1TWA C;  4XSZ A;  4OIQ A;  2E2H K;  3S2H C;  1I6V A;  3FKI K;  5IYC C;  2R92 C;  1I3Q K;  4A3B C;  2R7Z C;  5M5W K;  2PPB A;  4A3G K;  3PO3 K;  4LK0 A;  3PO2 K;  4OIO A;  1K83 C;  4BBS C;  2WB1 D;  1BDF A;  2JA7 C;  4BY1 C;  4G7O A;  3I4N K;  4Q5S A;  4MQ9 A;  4Y52 K;  4G7H A;  3CQZ C;  4LK1 A;  5TMC A;  3M4O C;  4A3C K;  3GTQ K;  1SFO K;  4X6A C;  4A3D C;  4A3L C;  5IYB C;  2NVX K;  4QJV B;  1TWH C;  4AYB L;  4BBR K;  1R9T C;  3M3Y K;  4A93 K;  1IW7 A;  1TWC K;  4A3K C;  2NVT K;  3GTL C;  4Y7N C;  4KN7 A;  1TWG C;  1WCM K;  2Y0S D;  5C44 K;  4A3J K;  4A3I C;  3S1R C;  3HKZ L;  4YFN A;  3HOZ C;  2R93 K;  3H0G K;  4C3I K;  3GTM C;  3HOV K;  3S1M K;  2E2J K;  4BY7 K;  3S2D C;  4KMU A;  3RZD C;  1TWA K;  3GTG K;  2E2I K;  3S2H K;  4C2M K;  3S16 K;  4YFK A;  3GTJ K;  2O5I A;  4MEY A;  4A3B K;  5M3F K;  3I4M K;  2VUM C;  3HOY C;  4BBS K;  1K83 K;  3RZO C;  1Y1W K;  2JA6 C;  3S1N C;  4GZY A;  3S15 C;  5IP7 C;  2PMZ L;  5C3E K;  5IYD C;  3GTO K;  4LLG A;  2PA8 D;  4X6A K;  5FJ8 K;  3HOX C;  5FLM K;  3S17 C;  2NVQ C;  5C4J C;  5IYB K;  3H3V L;  1HQM A;  1R9T K;  3S1Q C;  4A3D K;  4A3E C;  3S14 C;  2CW0 A;  2BE5 A;  3GTK C;  3GTP C;  1Y1V K;  2WAQ L;  4BY1 K;  2B63 K;  2A6E A;  4QJV A;  4A3I K;  4Q4Z A;  4KN4 A;  5IP9 K;  2NVY K;  2YU9 C;  1I3Q C;  1I50 K;  4OIN A;  5C4X C;  1TWF K;  3HOU C;  3HOW C;  4A3M K;  3PO3 C;  3EQL A;  3RZD K;  5M5Y K;  3PO2 C;  4BXX C;  4QIW L;  3I4N C;  5IYC K;  4Y52 C;  2R92 K;  4A3C C;  4AYB D;  4OIR A;  2R7Z K;  2A6H A;  4XLP A;  1SFO C;  3HOY K;  3K7A C;  4JK1 A;  2NVX C;  3RZO K;  2JA7 K;  3M3Y C;  2WAQ D;  2JA8 C;  3CQZ K;  3HKZ D;  4ZH4 A;  2NVT C;  3S15 K;  3M4O K;  2WB1 L;  4NOI A;  4A3J C;  4XSX A;  4C3J K;  3HOX K;  3S17 K;  4A3L K;  2NVQ K;  2O5J A;  1TWH K;  1I6H C;  2R93 C;  3H0G C;  4A3K K;  4A3F C;  2JA5 C;  3GTK K;  3HOV C;  3GTL K;  2E2J C;  4BY7 C;  4Y7N K;  1TWG K;  3S1R K;  3DXJ A;  2E2H C;  2E2I C;  3GTG C;  1YNJ A;  3WOD A;  3FKI C;  3HOZ K;  3S16 C;  1YNN A;  4YFX A;  2YU9 K;  3GTJ C;  2Y0S L;  5C4X K;  3GTM K;  5M5X K;  3HOU K;  3S2D K;  4A3G C;  3HOW K;  3I4M C;  2PMZ D;  4YG2 A;  4BXX K;  1Y1W C;  4C3H K;  3H3V D;  5C3E C;  4LJZ A;  1XPP A;  3GTO C;  3GTQ C;  2A68 A;  4G7Z A;  1SMY A;  2VUM K;  1ZYR A;  5TMF A;  5FLM C;  3K7A K;  4XLN A;  2JA6 K;  3S1N K;  4BBR C;  4A93 C;  1TWC C;  2JA8 K;  5IP7 K;  2A69 A;  5IYD K;  1Y1V C;  4MEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...