1UV7A

Periplasmic domain of epsm from vibrio cholerae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
76
Chain Sequence
b'QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGVVEVKRLQLKRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL SECRETION PATHWAY PROTEIN M
publication title The Crystal Structure of the Periplasmic Domain of the Type II Secretion System Protein Epsm from Vibrio Cholerae: The Simplest Version of the Ferredoxin Fold
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport
total genus 18
structure length 76
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 1uv7A00
5HL8A 1UV7A 2W7VA
chains in the Genus database with same CATH superfamily
1B4BA 1YCLA 1VJEA 3H3VL 4AH6A 4LK1A 1IS1A 2ZFZA 2NVYA 3GEEA 1HQMA 3BP3A 4Q4ZA 4GTCA 5M3FK 3M3YC 1JOEA 4LJZA 5JVOA 1XXBA 2JA6A 2E2HK 1BGWA 4G0UA 3H0GK 4A3KC 1Y1WA 1UV7A 5IYCC 4C3HK 5JFEA 1I50K 1ZVUA 1F7VA 3GTOA 3RZDK 5C4XK 3AQPA 1SFOA 1R9TA 2PMZL 4A3JK 5C44K 3LPXA 1TWFK 2VUMA 2WB1L 4AYBL 5IP7K 1KQ4A 3H0GC 3A8IA 3S1NK 1WOOA 4C3HC 3LAPA 4FM9A 1I50C 3RZDC 5C4XC 3AD7C 2A6HA 4C3IK 2CW0A 4A3GK 1USOA 4A3JC 5C44C 3T02A 1GE9A 1J6XA 1TWFC 2JA5K 3RZOC 2NVXC 3BUEA 1TWAK 5IP7C 1RU0A 4C3JK 3GTKK 2XCOA 1O27A 4BY7K 1DCOA 2V6SA 3S1NC 3DXJA 5IOTA 3GTGA 5IOQA 1WQGA 2A6EA 5EGHA 4C3IC 4G0VA 3GTJA 4A3GC 4J3NA 3HOYK 4MEYA 4BLBA 1B4AA 4M1XA 4GTLA 1WCMA 2JA5C 2W7VA 4JK1A 2O5IA 4KN4A 4A3DK 2E2IC 4C3JC 2P5MA 1BJTA 1J6WA 2E2JK 3GTMA 2YU9A 1IL2A 4KMAA 1JVIA 4QJVB 1VLOA 4KMUA 3HKZL 3K7AK 4C2MK 3AD8C 2JA7K 5E68A 3HOYC 3PO3K 4A93K 1EK8A 1VGXA 1C0AA 5CJ9A 1TWCA 3HOZK 4G7ZA 4A3DC 2NVQK 5IP9K 3S0XA 1WORA 3FKIK 4KM9A 1Y1VK 2E2JC 2V6UA 4A3EC 2B63K 4KMHA 1F93A 2XCRB 4P5BA 3K7AC 4WILA 4C2MC 4BY1K 2JA7C 3PO3C 4A93C 1WIHA 1TWGK 2WAQL 3S2DK 2NVTC 3A8KA 4KM8A 4LOWA 4MEXA 3HOZC 2NVQC 2Y0SD 4Y52K 2PHCB 5IP9C 3FKIC 1F7UA 1O26A 3T00A 5TMFA 1O24A 3EQLA 2GSOA 3GTLK 2B63C 3H0GA 3ADAC 1ISEA 4KARA 2CFAA 2R7ZC 3N3YA 3LAJA 3H3VD 3AD9C 3G4AA 1G51A 1O29A 4BY1C 3GTPK 1XZQA 1I50A 2D6FC 3T01A 1IE0A 3OPFA 1TWGC 3S2DC 2FQTA 5IYDK 3TFIA 4ZH4A 5M5WK 4LLGA 1TWFA 2R92A 2NVXA 1EQRA 1I3QK 1XXAA 5TJ3A 5HL8A 1EH1A 3GDZA 4GFQA 3GTLC 3GSIA 3L4JA 4KATA 2E2HC 3GTPC 2PMZD 2PA8D 4KN7A 4A3IK 3FOEA 4G7OA 2JH3A 1I6VA 3FHZA 2O5JA 5IYDC 2WB1D 2JA6K 4GTDA 3S2HK 4AYBD 1Y1WK 2RH6A 4P5AA 3N0CA 1HI9A 2JA5A 1I3QC 1WSVA 4YFKA 4GTAA 4LQYA 2ZUEA 4A3MK 5FLMK 2E2IA 3TTGA 3PO2K 1SFOK 1IW7A 3IPJA 1ZYRA 3MMLB 4XSXA 3V4GA 4A3LK 2VUMK 4A3CK 2JA6C 3JSTA 1ZBSA 1Y1WC 3HOXK 4BBSK 1XPPA 1XXCA 2Y3PA 3S17K 1YNJA 1F9NA 1O25A 1O28A 4A3MC 1WOPA 5EGEA 5C3EK 4P9SA 1SFOC 3A8JA 2XCQA 1L0WA 3FOFA 1SMYA 3GTQA 4A3LC 1TWAC 3N0BA 4G0WA 1PJ6A 3CAGA 3GTKC 4KDDA 4BY7C 3S1MK 1BDFA 4ILDA 4GTEA 4BBRK 4BXXK 4A3CC 4XLPA 2JA7A 4BBSC 2ZUFA 1XZPB 3S17C 1O2BA 2GSNA 4BLAA 3AQOA 5C3EC 1I6HK 3FKIA 4PAAA 3HKZD 1VH2A 1DCHA 4OIOA 1TWHK 1DD5A 1XZQB 3QX3A 2R7ZA 3S1MC 1J98A 4BBRC 4BXXC 2A69A 1BS2A 3VA7A 1PJ7A 3I4NK 1TWGA 4YG2A 3S1RK 4NOIA 5C4JK 2RGRA 4A3BK 1I6HC 3SZZA 5IORA 1WSRA 3HXAA 2JA8K 4BKWA 1K83K 4LR2A 1J6VA 4FZBA 4QIWL 2BE5A 1WOSA 1YX2A 2KWAA 3GEIA 1TWHC 4PABA 3Q3QA 1Y1VC 1TWCK 2E2HA 3GTPA 4C45A 1VRQC 3M3YK 3TFHA 3BP8C 3I4NC 1O2AA 4O2DA 3S1RC 2Y0SL 4WJ4A 5C4JC 4XLNA 4A3BC 4GT9A 5IYCK 5IOSA 2JA8C 1K83C 4QJVA 5TMCA 2A68A 4Y52C 2R93K 3ERED 3CQZK 5IYBK 3HOWK 5M3MK 4KASA 1TWCC 4WJ3M 2EBBA 2NVYK 1ZXOA 1INNA 1YNNA 4G7HA 3HOVK 3NUHA 3TFJA 1USMA 4YFXA 2R93C 3HOWC 3CQZC 5IYBC 3S16K 2PA8L 1TWAA 4A3FK 3GTKA 1X31C 3GTOK 2R92K 3RZOK 2NVXK 1R9TK 2NVYC 3SZYA 3HOVC 3OEPA 4A3IC 1DCPA 4XSZA 3S1QK 5FJ8K 3S2HC 4GTBA 3S16C 1JQWA 3HOUK 1WQFA 5FLMC 4A3FC 4RMFA 3I4MK 3PO2C 3GTOC 2R92C 5D4DA 1R9TC 1O2FB 4Y7NK 2E2IK 4GTFA 2VUMC 4OIQA 4KC6A 3S1QC 4X6AK 4KMDA 3HOXC 1IQ0A 3GTGK 1EI6A 1V5VA 3HOUC 2GAHC 3L4KA 3OREA 1TWHA 3I4MC 1IBAA 5L46A 1Y1VA 3AH5A 2CFAB 3GTJK 4XCHA 4YFNA 4Y7NC 1WQHA 2B63A 3GIRA 3M4OK 1AB4A 1WCMK 4OIPA 3GTQK 4MQ9A 4GZYA 4A3EK 2V6TA 2P8TA 4X6AC 3S14K 4OINA 3GTGC 1K83A 3GTMK 2YU9K 5CHPA 2GSUA 1PJ5A 2NVTK 3GTJC 2FQOA 3S15K 1EFWA 3WODA 3GTLA 4KB2A 3M4OC 1WCMC 4KAWX 2PPBA 3GTQC 4Q5SA 2WAQD 4OIRA 4QIWD 4LK0A 3GEHA 2GAGC 1ZQ1C 3S14C 5M5XK 4DDQA 2R7ZK 3GTMC 2YU9C 5M5YK 4A3KK 4KB4A 2R93A 3CQZA 3G4CA 1I3QA 3S15C 1XZPA
chains in the Genus database with same CATH topology
5HL8A 1UV7A 2W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL8 A;  1UV7 A;  2W7V A; 
#chains in the Genus database with same CATH topology
 1B4B A;  1YCL A;  1VJE A;  3H3V L;  4AH6 A;  4LK1 A;  1IS1 A;  2ZFZ A;  2NVY A;  3GEE A;  1HQM A;  3BP3 A;  4Q4Z A;  4GTC A;  5M3F K;  3M3Y C;  1JOE A;  4LJZ A;  5JVO A;  1XXB A;  2JA6 A;  2E2H K;  1BGW A;  4G0U A;  3H0G K;  4A3K C;  1Y1W A;  1UV7 A;  5IYC C;  4C3H K;  5JFE A;  1I50 K;  1ZVU A;  1F7V A;  3GTO A;  3RZD K;  5C4X K;  3AQP A;  1SFO A;  1R9T A;  2PMZ L;  4A3J K;  5C44 K;  3LPX A;  1TWF K;  2VUM A;  2WB1 L;  4AYB L;  5IP7 K;  1KQ4 A;  3H0G C;  3A8I A;  3S1N K;  1WOO A;  4C3H C;  3LAP A;  4FM9 A;  1I50 C;  3RZD C;  5C4X C;  3AD7 C;  2A6H A;  4C3I K;  2CW0 A;  4A3G K;  1USO A;  4A3J C;  5C44 C;  3T02 A;  1GE9 A;  1J6X A;  1TWF C;  2JA5 K;  3RZO C;  2NVX C;  3BUE A;  1TWA K;  5IP7 C;  1RU0 A;  4C3J K;  3GTK K;  2XCO A;  1O27 A;  4BY7 K;  1DCO A;  2V6S A;  3S1N C;  3DXJ A;  5IOT A;  3GTG A;  5IOQ A;  1WQG A;  2A6E A;  5EGH A;  4C3I C;  4G0V A;  3GTJ A;  4A3G C;  4J3N A;  3HOY K;  4MEY A;  4BLB A;  1B4A A;  4M1X A;  4GTL A;  1WCM A;  2JA5 C;  2W7V A;  4JK1 A;  2O5I A;  4KN4 A;  4A3D K;  2E2I C;  4C3J C;  2P5M A;  1BJT A;  1J6W A;  2E2J K;  3GTM A;  2YU9 A;  1IL2 A;  4KMA A;  1JVI A;  4QJV B;  1VLO A;  4KMU A;  3HKZ L;  3K7A K;  4C2M K;  3AD8 C;  2JA7 K;  5E68 A;  3HOY C;  3PO3 K;  4A93 K;  1EK8 A;  1VGX A;  1C0A A;  5CJ9 A;  1TWC A;  3HOZ K;  4G7Z A;  4A3D C;  2NVQ K;  5IP9 K;  3S0X A;  1WOR A;  3FKI K;  4KM9 A;  1Y1V K;  2E2J C;  2V6U A;  4A3E C;  2B63 K;  4KMH A;  1F93 A;  2XCR B;  4P5B A;  3K7A C;  4WIL A;  4C2M C;  4BY1 K;  2JA7 C;  3PO3 C;  4A93 C;  1WIH A;  1TWG K;  2WAQ L;  3S2D K;  2NVT C;  3A8K A;  4KM8 A;  4LOW A;  4MEX A;  3HOZ C;  2NVQ C;  2Y0S D;  4Y52 K;  2PHC B;  5IP9 C;  3FKI C;  1F7U A;  1O26 A;  3T00 A;  5TMF A;  1O24 A;  3EQL A;  2GSO A;  3GTL K;  2B63 C;  3H0G A;  3ADA C;  1ISE A;  4KAR A;  2CFA A;  2R7Z C;  3N3Y A;  3LAJ A;  3H3V D;  3AD9 C;  3G4A A;  1G51 A;  1O29 A;  4BY1 C;  3GTP K;  1XZQ A;  1I50 A;  2D6F C;  3T01 A;  1IE0 A;  3OPF A;  1TWG C;  3S2D C;  2FQT A;  5IYD K;  3TFI A;  4ZH4 A;  5M5W K;  4LLG A;  1TWF A;  2R92 A;  2NVX A;  1EQR A;  1I3Q K;  1XXA A;  5TJ3 A;  5HL8 A;  1EH1 A;  3GDZ A;  4GFQ A;  3GTL C;  3GSI A;  3L4J A;  4KAT A;  2E2H C;  3GTP C;  2PMZ D;  2PA8 D;  4KN7 A;  4A3I K;  3FOE A;  4G7O A;  2JH3 A;  1I6V A;  3FHZ A;  2O5J A;  5IYD C;  2WB1 D;  2JA6 K;  4GTD A;  3S2H K;  4AYB D;  1Y1W K;  2RH6 A;  4P5A A;  3N0C A;  1HI9 A;  2JA5 A;  1I3Q C;  1WSV A;  4YFK A;  4GTA A;  4LQY A;  2ZUE A;  4A3M K;  5FLM K;  2E2I A;  3TTG A;  3PO2 K;  1SFO K;  1IW7 A;  3IPJ A;  1ZYR A;  3MML B;  4XSX A;  3V4G A;  4A3L K;  2VUM K;  4A3C K;  2JA6 C;  3JST A;  1ZBS A;  1Y1W C;  3HOX K;  4BBS K;  1XPP A;  1XXC A;  2Y3P A;  3S17 K;  1YNJ A;  1F9N A;  1O25 A;  1O28 A;  4A3M C;  1WOP A;  5EGE A;  5C3E K;  4P9S A;  1SFO C;  3A8J A;  2XCQ A;  1L0W A;  3FOF A;  1SMY A;  3GTQ A;  4A3L C;  1TWA C;  3N0B A;  4G0W A;  1PJ6 A;  3CAG A;  3GTK C;  4KDD A;  4BY7 C;  3S1M K;  1BDF A;  4ILD A;  4GTE A;  4BBR K;  4BXX K;  4A3C C;  4XLP A;  2JA7 A;  4BBS C;  2ZUF A;  1XZP B;  3S17 C;  1O2B A;  2GSN A;  4BLA A;  3AQO A;  5C3E C;  1I6H K;  3FKI A;  4PAA A;  3HKZ D;  1VH2 A;  1DCH A;  4OIO A;  1TWH K;  1DD5 A;  1XZQ B;  3QX3 A;  2R7Z A;  3S1M C;  1J98 A;  4BBR C;  4BXX C;  2A69 A;  1BS2 A;  3VA7 A;  1PJ7 A;  3I4N K;  1TWG A;  4YG2 A;  3S1R K;  4NOI A;  5C4J K;  2RGR A;  4A3B K;  1I6H C;  3SZZ A;  5IOR A;  1WSR A;  3HXA A;  2JA8 K;  4BKW A;  1K83 K;  4LR2 A;  1J6V A;  4FZB A;  4QIW L;  2BE5 A;  1WOS A;  1YX2 A;  2KWA A;  3GEI A;  1TWH C;  4PAB A;  3Q3Q A;  1Y1V C;  1TWC K;  2E2H A;  3GTP A;  4C45 A;  1VRQ C;  3M3Y K;  3TFH A;  3BP8 C;  3I4N C;  1O2A A;  4O2D A;  3S1R C;  2Y0S L;  4WJ4 A;  5C4J C;  4XLN A;  4A3B C;  4GT9 A;  5IYC K;  5IOS A;  2JA8 C;  1K83 C;  4QJV A;  5TMC A;  2A68 A;  4Y52 C;  2R93 K;  3ERE D;  3CQZ K;  5IYB K;  3HOW K;  5M3M K;  4KAS A;  1TWC C;  4WJ3 M;  2EBB A;  2NVY K;  1ZXO A;  1INN A;  1YNN A;  4G7H A;  3HOV K;  3NUH A;  3TFJ A;  1USM A;  4YFX A;  2R93 C;  3HOW C;  3CQZ C;  5IYB C;  3S16 K;  2PA8 L;  1TWA A;  4A3F K;  3GTK A;  1X31 C;  3GTO K;  2R92 K;  3RZO K;  2NVX K;  1R9T K;  2NVY C;  3SZY A;  3HOV C;  3OEP A;  4A3I C;  1DCP A;  4XSZ A;  3S1Q K;  5FJ8 K;  3S2H C;  4GTB A;  3S16 C;  1JQW A;  3HOU K;  1WQF A;  5FLM C;  4A3F C;  4RMF A;  3I4M K;  3PO2 C;  3GTO C;  2R92 C;  5D4D A;  1R9T C;  1O2F B;  4Y7N K;  2E2I K;  4GTF A;  2VUM C;  4OIQ A;  4KC6 A;  3S1Q C;  4X6A K;  4KMD A;  3HOX C;  1IQ0 A;  3GTG K;  1EI6 A;  1V5V A;  3HOU C;  2GAH C;  3L4K A;  3ORE A;  1TWH A;  3I4M C;  1IBA A;  5L46 A;  1Y1V A;  3AH5 A;  2CFA B;  3GTJ K;  4XCH A;  4YFN A;  4Y7N C;  1WQH A;  2B63 A;  3GIR A;  3M4O K;  1AB4 A;  1WCM K;  4OIP A;  3GTQ K;  4MQ9 A;  4GZY A;  4A3E K;  2V6T A;  2P8T A;  4X6A C;  3S14 K;  4OIN A;  3GTG C;  1K83 A;  3GTM K;  2YU9 K;  5CHP A;  2GSU A;  1PJ5 A;  2NVT K;  3GTJ C;  2FQO A;  3S15 K;  1EFW A;  3WOD A;  3GTL A;  4KB2 A;  3M4O C;  1WCM C;  4KAW X;  2PPB A;  3GTQ C;  4Q5S A;  2WAQ D;  4OIR A;  4QIW D;  4LK0 A;  3GEH A;  2GAG C;  1ZQ1 C;  3S14 C;  5M5X K;  4DDQ A;  2R7Z K;  3GTM C;  2YU9 C;  5M5Y K;  4A3K K;  4KB4 A;  2R93 A;  3CQZ A;  3G4C A;  1I3Q A;  3S15 C;  1XZP A; 
#chains in the Genus database with same CATH homology
 5HL8 A;  1UV7 A;  2W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...