1UV7A

Periplasmic domain of epsm from vibrio cholerae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
76
Chain Sequence
QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGVVEVKRLQLKRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of the Periplasmic Domain of the Type II Secretion System Protein Epsm from Vibrio Cholerae: The Simplest Version of the Ferredoxin Fold
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport
molecule keywords GENERAL SECRETION PATHWAY PROTEIN M
total genus 18
structure length 76
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 1uv7A00
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH superfamily
4J3NA 1ZBSA 3GTQA 2A6EA 4A3EC 5TMCA 1EFWA 5C3EK 2FQTA 1JOEA 1VRQC 4Q4ZA 1SMYA 1ZVUA 2B63A 1RU0A 2JA7C 4JK1A 3GTGA 1O2AA 4MEYA 3S1QK 3CQZC 1BJTA 3FKIC 3AQPA 5IOSA 3CAGA 5D4DA 3L4KA 2O5IA 1WQHA 2JA6A 3VA7A 3ERED 3CQZK 3HOWC 4GTCA 3S15C 5C44C 3S1RK 2V6TA 3FHZA 3H0GA 1F7UA 2Y3PA 1R9TK 2EBBA 3WODA 3HOXC 3A8IA 5CJ9A 1I3QA 3I4NK 1XXCA 1XXAA 4C2MC 5IYDK 5IP7C 4LQYA 1WSRA 3GTPC 3PO3K 4O2DA 3N3YA 2YU9K 5JFEA 1O26A 3H0GK 5IYCC 3RZOC 5C4JC 2NVYK 1BDFA 1WCMK 5C3EC 5TJ3A 5IOTA 2YU9C 1YX2A 2R93A 1TWFC 2R93K 3G4CA 4C3IC 2R7ZC 3GTLK 2JA6K 2WAQL 3MMLB 3HOZC 4WJ3M 2XCOA 3BP8C 4GTFA 2VUMC 1R9TC 5FLMC 3S2DK 2R7ZK 1Y1VA 3OPFA 4KMAA 5CHPA 3Q3QA 1O2FB 5M3MK 5FLMK 3S2DC 4A3KK 1GE9A 2R92K 1I6VA 4A3LK 3GTMC 1I3QK 1TWAK 4BBSK 4OIPA 5M5XK 3M3YK 1R9TA 3RZDK 1KQ4A 1I6HC 5E68A 3GTOK 2XCQA 1WQFA 3N0BA 2BE5A 1DCHA 2PHCB 4KASA 1O28A 1IW7A 2NVXK 5IP9C 4KDDA 4KATA 3I4MK 3GTGK 3G4AA 4FM9A 2NVXC 2B63K 3K7AC 1G51A 4KN7A 3S1QC 3HXAA 4G0WA 2JA5A 2JA7A 1J98A 3FOEA 3T02A 5EGEA 4A93K 1ISEA 3GEHA 1XPPA 1K83C 4ZH4A 1XZPA 4X6AK 5L46A 2PPBA 3RZDC 3H3VD 3HOXK 1SFOA 3DXJA 4A3KC 4P5AA 1VGXA 1DCOA 3S1NC 1TWFA 3TFJA 3I4NC 1HQMA 2E2HA 1XZQA 3BUEA 2WAQD 2PA8L 2XCRB 3PO2K 5IP7K 4P5BA 2WB1D 3GTPA 3A8KA 2NVQC 1EQRA 1VH2A 3AD7C 4GTLA 3S16C 3S2HK 1Y1VC 1SFOC 3RZOK 5HL8A 4NOIA 5IORA 3S0XA 1WCMC 4BXXK 1Y1WC 5EGHA 1ZQ1C 2E2IC 3GTKA 1INNA 4C3IK 2R93C 3S1MK 3FKIK 1TWCC 1ZXOA 2A69A 4QJVB 5TMFA 1I50A 4KM9A 3AQOA 4G7ZA 2VUMK 1O2BA 3GEEA 4C3JC 3GTJA 1B4BA 3S14K 4YG2A 1IQ0A 1O29A 4BBRC 4BLAA 1EK8A 3HKZL 4GTBA 4C3JK 3S14C 1PJ7A 1J6XA 4G0VA 1WQGA 1TWGC 1WSVA 4A3IK 4XLPA 4A3DC 1TWGK 3OREA 3GTQK 4YFNA 4BY1C 1XXBA 4A3JC 2NVYC 4KN4A 4KM8A 2NVQK 3LAPA 4KAWX 2ZUEA 1F9NA 1WORA 4KC6A 4BY7K 2W7VA 5IOQA 4BY1K 3I4MC 2FQOA 3PO3C 2B63C 4KB4A 4BXXC 3GTGC 2ZUFA 1JQWA 3GIRA 3K7AK 2PMZD 1J6VA 1O24A 2GSOA 2Y0SL 3NUHA 1X31C 2JA7K 1K83K 1K83A 3T01A 3SZYA 2R92C 2Y0SD 4XSXA 4GZYA 1TWHK 4WILA 4AH6A 3HKZD 4BBSC 3N0CA 4XSZA 5IYDC 4Q5SA 2JA8C 3M3YC 4XCHA 4LJZA 4A3FC 1PJ6A 1YNNA 1EH1A 4A3EK 1Y1WA 2CW0A 4LR2A 1DD5A 3BP3A 4A3FK 5IYCK 1TWAC 3S16K 5IYBC 4P9SA 3EQLA 3HOVC 3S2HC 2V6UA 4KARA 2E2IK 3HOWK 3S17C 2ZFZA 5FJ8K 2R7ZA 3GTKC 4DDQA 2E2IA 3M4OC 1DCPA 4C3HC 4A3GC 1USMA 4GTAA 1TWFK 2GAHC 2PA8D 4GTEA 4GT9A 3GTJK 3QX3A 4AYBL 1C0AA 3GTMK 4MEXA 1WOSA 1HI9A 3FOFA 4G7OA 4YFKA 4BBRK 2JH3A 2NVYA 3S15K 5M5YK 5M5WK 4ILDA 3AD9C 3GTMA 4Y7NK 1TWHC 4WJ4A 3H3VL 3S1NK 1TWGA 4RMFA 3HOVK 3SZZA 5C4JK 4G7HA 1YCLA 4KB2A 3GDZA 2E2JK 1PJ5A 2D6FC 4KMDA 1IL2A 4OIQA 3HOUC 3GTQC 3GSIA 1Y1VK 3GTPK 4A3JK 1I6HK 2V6SA 1ZYRA 4BY7C 1VLOA 2NVXA 2NVTC 4A93C 3JSTA 4PABA 3T00A 3CQZA 4A3BC 1O27A 1L0WA 5M3FK 4G0UA 3S17K 1IE0A 3GTOA 4GTDA 1SFOK 1I50K 2JA5C 3M4OK 3TTGA 2JA6C 4OINA 4A3BK 1Y1WK 2A68A 4LLGA 4C45A 4M1XA 1TWAA 3S1MC 2P5MA 4AYBD 5C44K 3L4JA 3S1RC 3AH5A 4OIRA 1B4AA 3LPXA 2R92A 4A3MC 5C4XC 2E2JC 3OEPA 4X6AC 4GFQA 1BGWA 1I3QC 3TFHA 4Y7NC 4KMHA 4PAAA 4A3CK 1YNJA 4YFXA 3GEIA 2E2HC 1JVIA 1V5VA 3GTLA 4LOWA 4FZBA 3HOUK 4QJVA 5IYBK 3V4GA 4MQ9A 2A6HA 3H0GC 3PO2C 5JVOA 4A3IC 4Y52C 3HOYK 1WCMA 2PMZL 5IP9K 4A3DK 3AD8C 1UV7A 4BLBA 2YU9A 2GAGC 1XZQB 4XLNA 3GTKK 2NVTK 1TWCA 1F93A 1IBAA 1VJEA 3HOZK 1TWHA 4C3HK 3GTLC 4A3GK 1USOA 1WIHA 4BKWA 3ADAC 1I50C 2JA5K 3LAJA 3GTJC 1TWCK 2CFAB 4LK1A 4KMUA 1IS1A 1AB4A 2O5JA 4A3CC 1BS2A 1WOOA 1XZPB 1F7VA 2E2HK 1WOPA 4A3LC 5C4XK 4QIWD 4A3MK 2RH6A 2GSUA 2WB1L 3IPJA 2KWAA 4C2MK 1O25A 2VUMA 3A8JA 3HOYC 2JA8K 2CFAA 4Y52K 1EI6A 4LK0A 4QIWL 3GTOC 2P8TA 3TFIA 4OIOA 2RGRA 3FKIA 1J6WA 2GSNA
chains in the Genus database with same CATH topology
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7V A;  5HL8 A;  1UV7 A; 
#chains in the Genus database with same CATH topology
 4J3N A;  1ZBS A;  3GTQ A;  2A6E A;  4A3E C;  5TMC A;  1EFW A;  5C3E K;  2FQT A;  1JOE A;  1VRQ C;  4Q4Z A;  1SMY A;  1ZVU A;  2B63 A;  1RU0 A;  2JA7 C;  4JK1 A;  3GTG A;  1O2A A;  4MEY A;  3S1Q K;  3CQZ C;  1BJT A;  3FKI C;  3AQP A;  5IOS A;  3CAG A;  5D4D A;  3L4K A;  2O5I A;  1WQH A;  2JA6 A;  3VA7 A;  3ERE D;  3CQZ K;  3HOW C;  4GTC A;  3S15 C;  5C44 C;  3S1R K;  2V6T A;  3FHZ A;  3H0G A;  1F7U A;  2Y3P A;  1R9T K;  2EBB A;  3WOD A;  3HOX C;  3A8I A;  5CJ9 A;  1I3Q A;  3I4N K;  1XXC A;  1XXA A;  4C2M C;  5IYD K;  5IP7 C;  4LQY A;  1WSR A;  3GTP C;  3PO3 K;  4O2D A;  3N3Y A;  2YU9 K;  5JFE A;  1O26 A;  3H0G K;  5IYC C;  3RZO C;  5C4J C;  2NVY K;  1BDF A;  1WCM K;  5C3E C;  5TJ3 A;  5IOT A;  2YU9 C;  1YX2 A;  2R93 A;  1TWF C;  2R93 K;  3G4C A;  4C3I C;  2R7Z C;  3GTL K;  2JA6 K;  2WAQ L;  3MML B;  3HOZ C;  4WJ3 M;  2XCO A;  3BP8 C;  4GTF A;  2VUM C;  1R9T C;  5FLM C;  3S2D K;  2R7Z K;  1Y1V A;  3OPF A;  4KMA A;  5CHP A;  3Q3Q A;  1O2F B;  5M3M K;  5FLM K;  3S2D C;  4A3K K;  1GE9 A;  2R92 K;  1I6V A;  4A3L K;  3GTM C;  1I3Q K;  1TWA K;  4BBS K;  4OIP A;  5M5X K;  3M3Y K;  1R9T A;  3RZD K;  1KQ4 A;  1I6H C;  5E68 A;  3GTO K;  2XCQ A;  1WQF A;  3N0B A;  2BE5 A;  1DCH A;  2PHC B;  4KAS A;  1O28 A;  1IW7 A;  2NVX K;  5IP9 C;  4KDD A;  4KAT A;  3I4M K;  3GTG K;  3G4A A;  4FM9 A;  2NVX C;  2B63 K;  3K7A C;  1G51 A;  4KN7 A;  3S1Q C;  3HXA A;  4G0W A;  2JA5 A;  2JA7 A;  1J98 A;  3FOE A;  3T02 A;  5EGE A;  4A93 K;  1ISE A;  3GEH A;  1XPP A;  1K83 C;  4ZH4 A;  1XZP A;  4X6A K;  5L46 A;  2PPB A;  3RZD C;  3H3V D;  3HOX K;  1SFO A;  3DXJ A;  4A3K C;  4P5A A;  1VGX A;  1DCO A;  3S1N C;  1TWF A;  3TFJ A;  3I4N C;  1HQM A;  2E2H A;  1XZQ A;  3BUE A;  2WAQ D;  2PA8 L;  2XCR B;  3PO2 K;  5IP7 K;  4P5B A;  2WB1 D;  3GTP A;  3A8K A;  2NVQ C;  1EQR A;  1VH2 A;  3AD7 C;  4GTL A;  3S16 C;  3S2H K;  1Y1V C;  1SFO C;  3RZO K;  5HL8 A;  4NOI A;  5IOR A;  3S0X A;  1WCM C;  4BXX K;  1Y1W C;  5EGH A;  1ZQ1 C;  2E2I C;  3GTK A;  1INN A;  4C3I K;  2R93 C;  3S1M K;  3FKI K;  1TWC C;  1ZXO A;  2A69 A;  4QJV B;  5TMF A;  1I50 A;  4KM9 A;  3AQO A;  4G7Z A;  2VUM K;  1O2B A;  3GEE A;  4C3J C;  3GTJ A;  1B4B A;  3S14 K;  4YG2 A;  1IQ0 A;  1O29 A;  4BBR C;  4BLA A;  1EK8 A;  3HKZ L;  4GTB A;  4C3J K;  3S14 C;  1PJ7 A;  1J6X A;  4G0V A;  1WQG A;  1TWG C;  1WSV A;  4A3I K;  4XLP A;  4A3D C;  1TWG K;  3ORE A;  3GTQ K;  4YFN A;  4BY1 C;  1XXB A;  4A3J C;  2NVY C;  4KN4 A;  4KM8 A;  2NVQ K;  3LAP A;  4KAW X;  2ZUE A;  1F9N A;  1WOR A;  4KC6 A;  4BY7 K;  2W7V A;  5IOQ A;  4BY1 K;  3I4M C;  2FQO A;  3PO3 C;  2B63 C;  4KB4 A;  4BXX C;  3GTG C;  2ZUF A;  1JQW A;  3GIR A;  3K7A K;  2PMZ D;  1J6V A;  1O24 A;  2GSO A;  2Y0S L;  3NUH A;  1X31 C;  2JA7 K;  1K83 K;  1K83 A;  3T01 A;  3SZY A;  2R92 C;  2Y0S D;  4XSX A;  4GZY A;  1TWH K;  4WIL A;  4AH6 A;  3HKZ D;  4BBS C;  3N0C A;  4XSZ A;  5IYD C;  4Q5S A;  2JA8 C;  3M3Y C;  4XCH A;  4LJZ A;  4A3F C;  1PJ6 A;  1YNN A;  1EH1 A;  4A3E K;  1Y1W A;  2CW0 A;  4LR2 A;  1DD5 A;  3BP3 A;  4A3F K;  5IYC K;  1TWA C;  3S16 K;  5IYB C;  4P9S A;  3EQL A;  3HOV C;  3S2H C;  2V6U A;  4KAR A;  2E2I K;  3HOW K;  3S17 C;  2ZFZ A;  5FJ8 K;  2R7Z A;  3GTK C;  4DDQ A;  2E2I A;  3M4O C;  1DCP A;  4C3H C;  4A3G C;  1USM A;  4GTA A;  1TWF K;  2GAH C;  2PA8 D;  4GTE A;  4GT9 A;  3GTJ K;  3QX3 A;  4AYB L;  1C0A A;  3GTM K;  4MEX A;  1WOS A;  1HI9 A;  3FOF A;  4G7O A;  4YFK A;  4BBR K;  2JH3 A;  2NVY A;  3S15 K;  5M5Y K;  5M5W K;  4ILD A;  3AD9 C;  3GTM A;  4Y7N K;  1TWH C;  4WJ4 A;  3H3V L;  3S1N K;  1TWG A;  4RMF A;  3HOV K;  3SZZ A;  5C4J K;  4G7H A;  1YCL A;  4KB2 A;  3GDZ A;  2E2J K;  1PJ5 A;  2D6F C;  4KMD A;  1IL2 A;  4OIQ A;  3HOU C;  3GTQ C;  3GSI A;  1Y1V K;  3GTP K;  4A3J K;  1I6H K;  2V6S A;  1ZYR A;  4BY7 C;  1VLO A;  2NVX A;  2NVT C;  4A93 C;  3JST A;  4PAB A;  3T00 A;  3CQZ A;  4A3B C;  1O27 A;  1L0W A;  5M3F K;  4G0U A;  3S17 K;  1IE0 A;  3GTO A;  4GTD A;  1SFO K;  1I50 K;  2JA5 C;  3M4O K;  3TTG A;  2JA6 C;  4OIN A;  4A3B K;  1Y1W K;  2A68 A;  4LLG A;  4C45 A;  4M1X A;  1TWA A;  3S1M C;  2P5M A;  4AYB D;  5C44 K;  3L4J A;  3S1R C;  3AH5 A;  4OIR A;  1B4A A;  3LPX A;  2R92 A;  4A3M C;  5C4X C;  2E2J C;  3OEP A;  4X6A C;  4GFQ A;  1BGW A;  1I3Q C;  3TFH A;  4Y7N C;  4KMH A;  4PAA A;  4A3C K;  1YNJ A;  4YFX A;  3GEI A;  2E2H C;  1JVI A;  1V5V A;  3GTL A;  4LOW A;  4FZB A;  3HOU K;  4QJV A;  5IYB K;  3V4G A;  4MQ9 A;  2A6H A;  3H0G C;  3PO2 C;  5JVO A;  4A3I C;  4Y52 C;  3HOY K;  1WCM A;  2PMZ L;  5IP9 K;  4A3D K;  3AD8 C;  1UV7 A;  4BLB A;  2YU9 A;  2GAG C;  1XZQ B;  4XLN A;  3GTK K;  2NVT K;  1TWC A;  1F93 A;  1IBA A;  1VJE A;  3HOZ K;  1TWH A;  4C3H K;  3GTL C;  4A3G K;  1USO A;  1WIH A;  4BKW A;  3ADA C;  1I50 C;  2JA5 K;  3LAJ A;  3GTJ C;  1TWC K;  2CFA B;  4LK1 A;  4KMU A;  1IS1 A;  1AB4 A;  2O5J A;  4A3C C;  1BS2 A;  1WOO A;  1XZP B;  1F7V A;  2E2H K;  1WOP A;  4A3L C;  5C4X K;  4QIW D;  4A3M K;  2RH6 A;  2GSU A;  2WB1 L;  3IPJ A;  2KWA A;  4C2M K;  1O25 A;  2VUM A;  3A8J A;  3HOY C;  2JA8 K;  2CFA A;  4Y52 K;  1EI6 A;  4LK0 A;  4QIW L;  3GTO C;  2P8T A;  3TFI A;  4OIO A;  2RGR A;  3FKI A;  1J6W A;  2GSN A; 
#chains in the Genus database with same CATH homology
 2W7V A;  5HL8 A;  1UV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...