1UV7A

Periplasmic domain of epsm from vibrio cholerae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
76
Chain Sequence
QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGVVEVKRLQLKRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL SECRETION PATHWAY PROTEIN M
publication title The Crystal Structure of the Periplasmic Domain of the Type II Secretion System Protein Epsm from Vibrio Cholerae: The Simplest Version of the Ferredoxin Fold
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport
total genus 18
structure length 76
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 1uv7A00
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH superfamily
4A3FC 3GTKC 3GEIA 5IYCC 3H0GK 4BBSK 1ZBSA 2E2HK 4KAWX 1WSVA 2VUMK 2R7ZK 3NUHA 1O2AA 1J6VA 3S0XA 1I50C 1XXBA 2NVTK 5C44K 3GTQA 4QIWD 2NVYC 4A3CC 2GAHC 2RGRA 1WORA 3I4NC 3WODA 4LR2A 3S17C 3TFHA 3M3YC 1WSRA 1EH1A 2EBBA 1YNNA 2V6TA 1TWFC 1I3QC 5IYBC 3GTLK 4YFNA 2P8TA 4KASA 5IYDK 3LAJA 1ZQ1C 4LQYA 4A3LK 4P5AA 1KQ4A 2Y0SL 3FKIK 2E2JC 2D6FC 5IP7C 1XZPB 3TFJA 3GTPA 2V6SA 4NOIA 1I6HK 2Y3PA 2WAQL 3GTKA 1RU0A 4C3IK 2JA7C 1XZPA 1K83C 1BDFA 1TWCK 5M5XK 3N0CA 3RZDC 1IQ0A 5M5YK 3RZOC 4Q4ZA 1F93A 4LLGA 1F7VA 3I4MK 4DDQA 2E2IK 1R9TC 2A69A 3HOXC 3L4JA 2O5JA 5L46A 2FQTA 3GTGC 1I50A 2V6UA 3AD7C 2NVYA 1O25A 3HXAA 4BLBA 3S1QK 4KARA 4GFQA 1JOEA 3ERED 1TWFK 1JQWA 1WIHA 2NVXC 2B63K 5FLMK 2WB1L 4P5BA 5IORA 1G51A 3S2DK 1O2FB 1ZXOA 2JA6K 4A3JK 1TWFA 4ZH4A 1USMA 2BE5A 1I3QA 2JA5A 1C0AA 4A3KC 2R92C 4KMAA 3CQZA 1TWHK 4KB2A 1EQRA 4GTFA 1VGXA 1TWAA 3SZYA 1Y1VK 2JA8C 4PABA 2CW0A 5IP9C 4MQ9A 3S16K 1INNA 5JFEA 3PO3C 3GTOC 2JA7A 1R9TK 1K83A 4A3DC 2YU9A 2XCOA 4YFXA 2A6EA 3T00A 1B4BA 4JK1A 1BS2A 3HKZD 5TMCA 3S2HK 4MEYA 1O24A 1JVIA 4KMUA 3PO2K 3GTGA 4P9SA 1F9NA 4KMHA 4BKWA 5C4XC 4RMFA 4BY1K 5EGEA 3HOUK 2NVXA 4GTAA 4M1XA 2GAGC 4G0WA 1BJTA 4BXXC 4WJ4A 5CJ9A 1TWGC 4C2MC 3H3VL 4KDDA 2R92A 1DCOA 4AYBL 5C4JK 3S1MK 3DXJA 3GTQK 4BBRC 1Y1WC 4G7ZA 1PJ5A 4Y52K 2Y0SD 3S15C 4X6AC 4J3NA 3GTOA 4YG2A 4C45A 5IOQA 3HOYC 4A3BK 4GT9A 3M4OK 4A3GC 2WAQD 4A3MC 5IOSA 4OIRA 2JA5C 4AH6A 1GE9A 4KATA 3S1NK 1ISEA 3CQZC 3GTPK 3BP3A 4KM9A 3OPFA 1TWAC 3VA7A 4A3FK 4WILA 3HOZC 4A3EC 3GTKK 5IYCK 4Q5SA 1TWGA 3T02A 5JVOA 2WB1D 3LPXA 1HI9A 1I50K 2YU9C 4KB4A 5CHPA 2NVYK 4A3CK 5C3EC 3S15K 3I4NK 1Y1WA 1XXAA 3AH5A 3S17K 3M3YK 3EQLA 3K7AC 3N3YA 1YX2A 4QJVB 5HL8A 1O29A 4KN7A 4ILDA 3FHZA 1I3QK 5IYBK 1PJ6A 2JA5K 3GEEA 1L0WA 4A3IC 4QJVA 3CQZK 1USOA 1J6WA 2GSOA 1TWAK 2E2JK 5IP7K 5EGHA 4XCHA 4BY7C 2ZFZA 4FZBA 4FM9A 4LK1A 3HOWC 1F7UA 2JA7K 1WCMC 1ZYRA 1K83K 3AQPA 4C3HC 4LK0A 2PPBA 3RZDK 3RZOK 2R93C 1IW7A 3S14C 2YU9K 3HOVC 3BP8C 3BUEA 1SFOA 4C3JC 3HOXK 2NVQC 3GTJA 1V5VA 1YNJA 3S1RC 3GTGK 2GSUA 5D4DA 3H3VD 3FOEA 1IE0A 5E68A 4AYBD 4OIOA 3H0GC 4BBSC 2NVXK 1YCLA 2E2HC 1X31C 2VUMC 1VJEA 5M5WK 3GIRA 2FQOA 3N0BA 4A3KK 2R92K 2NVTC 5C44C 1VH2A 4OIQA 1J6XA 4GTLA 4G7OA 2JA8K 1SMYA 3GTMA 2XCQA 4XSXA 5IP9K 4C3HK 3TFIA 3A8IA 4KM8A 2PMZL 4YFKA 3GTLC 4KMDA 3PO3K 3GTOK 1WCMA 4KN4A 5IYDC 4Y7NC 5M3MK 4A3DK 2R93A 3A8JA 3FKIC 4O2DA 3HKZL 1B4AA 1VRQC 1I6HC 2O5IA 5C4XK 3FOFA 4C3IC 1IBAA 1UV7A 1HQMA 3H0GA 1TWCC 3AQOA 2E2HA 2VUMA 1DCPA 3AD8C 2R7ZA 4BXXK 1ZVUA 2PA8L 3AD9C 1TWGK 3I4MC 2E2IC 1O26A 1PJ7A 4C2MK 4GTEA 4MEXA 4PAAA 1AB4A 1WQHA 3S1QC 1WOOA 4BBRK 2JH3A 2RH6A 1EI6A 1SFOC 5TJ3A 2B63C 1Y1WK 3GTJC 5FLMC 2ZUFA 4Y7NK 3TTGA 3S2DC 2JA6C 4A3JC 4QIWL 3GTLA 3G4AA 4X6AK 4GZYA 4LOWA 4KC6A 1WQFA 1WOSA 1TWHC 1VLOA 3HOYK 4A93C 1Y1VC 4A3GK 3FKIA 1IL2A 4A3MK 3A8KA 3T01A 4GTBA 3S16C 4OIPA 3Q3QA 1DD5A 3GEHA 3QX3A 3HOZK 2P5MA 4A3EK 1TWCA 1XPPA 2PHCB 3CAGA 3GTMC 2KWAA 5TMFA 3OEPA 2E2IA 3IPJA 1XXCA 3JSTA 2A6HA 3V4GA 1BGWA 3PO2C 3S2HC 1WOPA 1DCHA 1SFOK 2GSNA 3GTJK 2ZUEA 3OREA 4BY1C 5C3EK 3HOUC 1EK8A 2B63A 4G7HA 3G4CA 3ADAC 3K7AK 1XZQB 2JA6A 2A68A 5M3FK 4A93K 3MMLB 2CFAB 4XLPA 1O27A 4XSZA 5C4JC 1EFWA 4WJ3M 1TWHA 3S1MC 2W7VA 1XZQA 5FJ8K 4A3IK 1Y1VA 2R7ZC 3GTQC 2CFAA 2PMZD 3GSIA 1WQGA 3LAPA 2XCRB 4OINA 4Y52C 4G0VA 1O28A 3GTMK 4BLAA 5IOTA 4G0UA 4BY7K 1R9TA 4XLNA 3HOWK 4LJZA 3SZZA 4A3BC 1WCMK 3M4OC 1J98A 3GDZA 4GTDA 2R93K 3S14K 3HOVK 1I6VA 3L4KA 4GTCA 3S1NC 4C3JK 2NVQK 1IS1A 4A3LC 1O2BA 3GTPC 3S1RK 2PA8D
chains in the Genus database with same CATH topology
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7V A;  5HL8 A;  1UV7 A; 
#chains in the Genus database with same CATH topology
 4A3F C;  3GTK C;  3GEI A;  5IYC C;  3H0G K;  4BBS K;  1ZBS A;  2E2H K;  4KAW X;  1WSV A;  2VUM K;  2R7Z K;  3NUH A;  1O2A A;  1J6V A;  3S0X A;  1I50 C;  1XXB A;  2NVT K;  5C44 K;  3GTQ A;  4QIW D;  2NVY C;  4A3C C;  2GAH C;  2RGR A;  1WOR A;  3I4N C;  3WOD A;  4LR2 A;  3S17 C;  3TFH A;  3M3Y C;  1WSR A;  1EH1 A;  2EBB A;  1YNN A;  2V6T A;  1TWF C;  1I3Q C;  5IYB C;  3GTL K;  4YFN A;  2P8T A;  4KAS A;  5IYD K;  3LAJ A;  1ZQ1 C;  4LQY A;  4A3L K;  4P5A A;  1KQ4 A;  2Y0S L;  3FKI K;  2E2J C;  2D6F C;  5IP7 C;  1XZP B;  3TFJ A;  3GTP A;  2V6S A;  4NOI A;  1I6H K;  2Y3P A;  2WAQ L;  3GTK A;  1RU0 A;  4C3I K;  2JA7 C;  1XZP A;  1K83 C;  1BDF A;  1TWC K;  5M5X K;  3N0C A;  3RZD C;  1IQ0 A;  5M5Y K;  3RZO C;  4Q4Z A;  1F93 A;  4LLG A;  1F7V A;  3I4M K;  4DDQ A;  2E2I K;  1R9T C;  2A69 A;  3HOX C;  3L4J A;  2O5J A;  5L46 A;  2FQT A;  3GTG C;  1I50 A;  2V6U A;  3AD7 C;  2NVY A;  1O25 A;  3HXA A;  4BLB A;  3S1Q K;  4KAR A;  4GFQ A;  1JOE A;  3ERE D;  1TWF K;  1JQW A;  1WIH A;  2NVX C;  2B63 K;  5FLM K;  2WB1 L;  4P5B A;  5IOR A;  1G51 A;  3S2D K;  1O2F B;  1ZXO A;  2JA6 K;  4A3J K;  1TWF A;  4ZH4 A;  1USM A;  2BE5 A;  1I3Q A;  2JA5 A;  1C0A A;  4A3K C;  2R92 C;  4KMA A;  3CQZ A;  1TWH K;  4KB2 A;  1EQR A;  4GTF A;  1VGX A;  1TWA A;  3SZY A;  1Y1V K;  2JA8 C;  4PAB A;  2CW0 A;  5IP9 C;  4MQ9 A;  3S16 K;  1INN A;  5JFE A;  3PO3 C;  3GTO C;  2JA7 A;  1R9T K;  1K83 A;  4A3D C;  2YU9 A;  2XCO A;  4YFX A;  2A6E A;  3T00 A;  1B4B A;  4JK1 A;  1BS2 A;  3HKZ D;  5TMC A;  3S2H K;  4MEY A;  1O24 A;  1JVI A;  4KMU A;  3PO2 K;  3GTG A;  4P9S A;  1F9N A;  4KMH A;  4BKW A;  5C4X C;  4RMF A;  4BY1 K;  5EGE A;  3HOU K;  2NVX A;  4GTA A;  4M1X A;  2GAG C;  4G0W A;  1BJT A;  4BXX C;  4WJ4 A;  5CJ9 A;  1TWG C;  4C2M C;  3H3V L;  4KDD A;  2R92 A;  1DCO A;  4AYB L;  5C4J K;  3S1M K;  3DXJ A;  3GTQ K;  4BBR C;  1Y1W C;  4G7Z A;  1PJ5 A;  4Y52 K;  2Y0S D;  3S15 C;  4X6A C;  4J3N A;  3GTO A;  4YG2 A;  4C45 A;  5IOQ A;  3HOY C;  4A3B K;  4GT9 A;  3M4O K;  4A3G C;  2WAQ D;  4A3M C;  5IOS A;  4OIR A;  2JA5 C;  4AH6 A;  1GE9 A;  4KAT A;  3S1N K;  1ISE A;  3CQZ C;  3GTP K;  3BP3 A;  4KM9 A;  3OPF A;  1TWA C;  3VA7 A;  4A3F K;  4WIL A;  3HOZ C;  4A3E C;  3GTK K;  5IYC K;  4Q5S A;  1TWG A;  3T02 A;  5JVO A;  2WB1 D;  3LPX A;  1HI9 A;  1I50 K;  2YU9 C;  4KB4 A;  5CHP A;  2NVY K;  4A3C K;  5C3E C;  3S15 K;  3I4N K;  1Y1W A;  1XXA A;  3AH5 A;  3S17 K;  3M3Y K;  3EQL A;  3K7A C;  3N3Y A;  1YX2 A;  4QJV B;  5HL8 A;  1O29 A;  4KN7 A;  4ILD A;  3FHZ A;  1I3Q K;  5IYB K;  1PJ6 A;  2JA5 K;  3GEE A;  1L0W A;  4A3I C;  4QJV A;  3CQZ K;  1USO A;  1J6W A;  2GSO A;  1TWA K;  2E2J K;  5IP7 K;  5EGH A;  4XCH A;  4BY7 C;  2ZFZ A;  4FZB A;  4FM9 A;  4LK1 A;  3HOW C;  1F7U A;  2JA7 K;  1WCM C;  1ZYR A;  1K83 K;  3AQP A;  4C3H C;  4LK0 A;  2PPB A;  3RZD K;  3RZO K;  2R93 C;  1IW7 A;  3S14 C;  2YU9 K;  3HOV C;  3BP8 C;  3BUE A;  1SFO A;  4C3J C;  3HOX K;  2NVQ C;  3GTJ A;  1V5V A;  1YNJ A;  3S1R C;  3GTG K;  2GSU A;  5D4D A;  3H3V D;  3FOE A;  1IE0 A;  5E68 A;  4AYB D;  4OIO A;  3H0G C;  4BBS C;  2NVX K;  1YCL A;  2E2H C;  1X31 C;  2VUM C;  1VJE A;  5M5W K;  3GIR A;  2FQO A;  3N0B A;  4A3K K;  2R92 K;  2NVT C;  5C44 C;  1VH2 A;  4OIQ A;  1J6X A;  4GTL A;  4G7O A;  2JA8 K;  1SMY A;  3GTM A;  2XCQ A;  4XSX A;  5IP9 K;  4C3H K;  3TFI A;  3A8I A;  4KM8 A;  2PMZ L;  4YFK A;  3GTL C;  4KMD A;  3PO3 K;  3GTO K;  1WCM A;  4KN4 A;  5IYD C;  4Y7N C;  5M3M K;  4A3D K;  2R93 A;  3A8J A;  3FKI C;  4O2D A;  3HKZ L;  1B4A A;  1VRQ C;  1I6H C;  2O5I A;  5C4X K;  3FOF A;  4C3I C;  1IBA A;  1UV7 A;  1HQM A;  3H0G A;  1TWC C;  3AQO A;  2E2H A;  2VUM A;  1DCP A;  3AD8 C;  2R7Z A;  4BXX K;  1ZVU A;  2PA8 L;  3AD9 C;  1TWG K;  3I4M C;  2E2I C;  1O26 A;  1PJ7 A;  4C2M K;  4GTE A;  4MEX A;  4PAA A;  1AB4 A;  1WQH A;  3S1Q C;  1WOO A;  4BBR K;  2JH3 A;  2RH6 A;  1EI6 A;  1SFO C;  5TJ3 A;  2B63 C;  1Y1W K;  3GTJ C;  5FLM C;  2ZUF A;  4Y7N K;  3TTG A;  3S2D C;  2JA6 C;  4A3J C;  4QIW L;  3GTL A;  3G4A A;  4X6A K;  4GZY A;  4LOW A;  4KC6 A;  1WQF A;  1WOS A;  1TWH C;  1VLO A;  3HOY K;  4A93 C;  1Y1V C;  4A3G K;  3FKI A;  1IL2 A;  4A3M K;  3A8K A;  3T01 A;  4GTB A;  3S16 C;  4OIP A;  3Q3Q A;  1DD5 A;  3GEH A;  3QX3 A;  3HOZ K;  2P5M A;  4A3E K;  1TWC A;  1XPP A;  2PHC B;  3CAG A;  3GTM C;  2KWA A;  5TMF A;  3OEP A;  2E2I A;  3IPJ A;  1XXC A;  3JST A;  2A6H A;  3V4G A;  1BGW A;  3PO2 C;  3S2H C;  1WOP A;  1DCH A;  1SFO K;  2GSN A;  3GTJ K;  2ZUE A;  3ORE A;  4BY1 C;  5C3E K;  3HOU C;  1EK8 A;  2B63 A;  4G7H A;  3G4C A;  3ADA C;  3K7A K;  1XZQ B;  2JA6 A;  2A68 A;  5M3F K;  4A93 K;  3MML B;  2CFA B;  4XLP A;  1O27 A;  4XSZ A;  5C4J C;  1EFW A;  4WJ3 M;  1TWH A;  3S1M C;  2W7V A;  1XZQ A;  5FJ8 K;  4A3I K;  1Y1V A;  2R7Z C;  3GTQ C;  2CFA A;  2PMZ D;  3GSI A;  1WQG A;  3LAP A;  2XCR B;  4OIN A;  4Y52 C;  4G0V A;  1O28 A;  3GTM K;  4BLA A;  5IOT A;  4G0U A;  4BY7 K;  1R9T A;  4XLN A;  3HOW K;  4LJZ A;  3SZZ A;  4A3B C;  1WCM K;  3M4O C;  1J98 A;  3GDZ A;  4GTD A;  2R93 K;  3S14 K;  3HOV K;  1I6V A;  3L4K A;  4GTC A;  3S1N C;  4C3J K;  2NVQ K;  1IS1 A;  4A3L C;  1O2B A;  3GTP C;  3S1R K;  2PA8 D; 
#chains in the Genus database with same CATH homology
 2W7V A;  5HL8 A;  1UV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...