1UV7A

Periplasmic domain of epsm from vibrio cholerae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
76
Chain Sequence
QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGVVEVKRLQLKRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL SECRETION PATHWAY PROTEIN M
publication title The Crystal Structure of the Periplasmic Domain of the Type II Secretion System Protein Epsm from Vibrio Cholerae: The Simplest Version of the Ferredoxin Fold
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport
total genus 18
structure length 76
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 1uv7A00
5HL8A 2W7VA 1UV7A
chains in the Genus database with same CATH superfamily
2CW0A 4ILDA 4J3NA 2V6TA 2ZUFA 3H3VD 2JA6A 1SFOA 4GTCA 4C3JK 2JA8K 3H3VL 2PPBA 4A3KK 2VUMC 1I3QA 2PA8L 1RU0A 3N0CA 2YU9K 3G4AA 4BY7C 4A3GC 5L46A 1XZQA 1TWHA 2NVQC 1PJ5A 3AD7C 3FKIC 1IQ0A 4KC6A 4A3JC 3H0GA 4BXXK 4KDDA 1TWAA 3TTGA 2XCOA 5IYBC 5HL8A 4A3IK 1Y1WK 3GTPK 4A3FC 1WCMK 1EQRA 4BLBA 4Y7NK 3PO3C 1X31C 3GTMA 1J6VA 4C3IC 1O28A 4GTBA 3ERED 3S1QK 1J6XA 2PMZL 3HOWK 4KARA 5IYDK 3A8IA 2JA5A 3GTGK 5FJ8K 2E2IA 3TFHA 2VUMA 1TWGC 3GTKK 4KN4A 1XZQB 1L0WA 3HOUC 3IPJA 2NVYA 4G7ZA 3S1MC 3FOFA 1EH1A 5M5WK 3RZOC 1XZPB 3CQZC 3S16C 2Y0SL 2R92C 1V5VA 1HQMA 4G7HA 3K7AK 3FKIA 4KASA 4G7OA 4A3MK 2Y3PA 3PO2K 1INNA 1TWCA 3LAPA 3GTQC 1TWFC 3DXJA 3S1RC 3S2DC 4YFKA 3I4NC 5C4XC 3S14K 4QJVB 2A69A 3GSIA 2W7VA 5IOSA 1I50A 2NVXK 4G0VA 4JK1A 3S17K 4C3JC 3OPFA 2JA8C 1USMA 1BS2A 4KN7A 3LPXA 4QIWL 3WODA 4OINA 4A93K 1GE9A 4P9SA 3HOXK 4A3KC 2O5JA 1JQWA 5EGHA 2YU9C 3EQLA 3CQZA 5IORA 2R92A 2R93K 1ISEA 2GSUA 3OEPA 3GDZA 1HI9A 4BBRK 5M3MK 4OIRA 3GTJK 1ZVUA 3S0XA 1DCPA 3A8JA 4WJ4A 2FQTA 3NUHA 1ZYRA 2E2HK 1F93A 2A68A 4GTFA 4GTAA 4LR2A 4GZYA 4A3IC 1Y1WC 3GTPC 1WCMC 4Y7NC 3HKZL 1XPPA 1IL2A 4G0UA 3S1QC 4GT9A 3HOWC 5IYDC 2PA8D 3BP8C 4KB4A 4NOIA 4XSXA 3GTGC 2JA7K 3A8KA 3G4CA 4LK1A 3GTKC 3CAGA 2YU9A 1WOSA 4KM9A 4C3HK 2JA6K 1SFOK 5M3FK 3TFIA 1I6VA 2PHCB 2XCQA 1O24A 1VH2A 5C4JK 1XZPA 1WQGA 3K7AC 4A3EK 4KB2A 4A3MC 3T01A 3PO2C 1Y1VA 1IS1A 1EFWA 3S1NK 1B4AA 1XXBA 1TWHK 3GTOK 3AQOA 3GTPA 2PMZD 3T00A 1WCMA 2FQOA 2R7ZK 2NVXC 1TWAK 4A3BK 2WB1L 5IOTA 4LLGA 4QJVA 3S17C 3GTGA 1EI6A 1WOPA 5CHPA 4A3DK 2CFAB 4ZH4A 4A93C 3GTKA 4BBSC 5E68A 2Y0SD 3HOXC 3QX3A 1O26A 2JA5K 1BJTA 4KMUA 2A6HA 3JSTA 4MEXA 3S2HK 1KQ4A 2E2IK 1VRQC 2R93C 1WQHA 1J98A 3HOYK 1SMYA 3T02A 4X6AK 4BBRC 5TMCA 2NVYK 4MQ9A 1BGWA 3GTJC 4FZBA 3SZYA 1O27A 1K83K 1WOOA 2EBBA 2D6FC 5C44K 2E2HC 1XXAA 1TWCK 1YNJA 3RZDK 2JH3A 2O5IA 4MEYA 3V4GA 4QIWD 3GTLK 4O2DA 5FLMK 1TWGA 5EGEA 3L4KA 4Y52K 2JA7C 2P5MA 4YFNA 1I50K 1WSVA 4LJZA 4PABA 1WIHA 1ZBSA 3M4OK 4C3HC 2JA6C 4BY1K 2NVTK 2R93A 2WAQL 1J6WA 1DD5A 4C2MK 5C4JC 2GSOA 3GTQA 4A3EC 5IYCK 3OREA 3AD8C 3GTJA 1TWFA 4BXXC 3I4MK 1DCHA 3MMLB 1R9TK 3S1NC 4XSZA 3HKZD 3GTOC 4XCHA 2B63K 3M3YK 3HOZK 4M1XA 2ZFZA 1F9NA 4GTEA 4RMFA 1VGXA 5M5YK 4XLNA 3HOVK 2R7ZC 1WSRA 3BUEA 3HXAA 4A3BC 1I6HK 4GTDA 2JA7A 4KM8A 4A3DC 1YCLA 1IBAA 1O2AA 2A6EA 3GEEA 1ZQ1C 2CFAA 1O29A 1O2BA 2JA5C 4P5BA 1I3QK 3S2HC 2E2IC 5M5XK 4A3CK 1AB4A 2ZUEA 4A3LK 4XLPA 3HOYC 4X6AC 3VA7A 2GSNA 4KATA 3N0BA 4FM9A 1YX2A 4OIOA 2NVYC 3GEHA 4GFQA 2GAGC 1Y1WA 5IP9K 4BKWA 1DCOA 1K83C 4LK0A 5IP7K 3GTOA 1WORA 5C3EK 2RGRA 5CJ9A 5C44C 3H0GK 4BLAA 1YNNA 3S14C 1BDFA 1VLOA 2WB1D 2E2JK 1Y1VK 3SZZA 1TWCC 3AD9C 3Q3QA 2R7ZA 3RZDC 5TMFA 3S15K 5D4DA 1WQFA 5TJ3A 3GTLC 2V6UA 5FLMC 3L4JA 3GTMK 4GTLA 4OIPA 4DDQA 1JVIA 2KWAA 1ZXOA 4Y52C 4YFXA 3FHZA 4Q4ZA 1I50C 3M4OC 2VUMK 5JVOA 4BY1C 2NVTC 4G0WA 1O2FB 4BY7K 4A3GK 4C2MC 3FOEA 1IW7A 5IYCC 4YG2A 1G51A 4OIQA 2NVQK 2BE5A 4KMHA 1K83A 3FKIK 3I4MC 3LAJA 1R9TC 4KMDA 3N3YA 5IOQA 4A3JK 1O25A 1F7UA 2B63C 3M3YC 2NVXA 3HOZC 3ADAC 1VJEA 1XXCA 5IYBK 3HOVC 3GTLA 1IE0A 4A3FK 4PAAA 4AYBD 3PO3K 4P5AA 4C3IK 4AYBL 1I6HC 3BP3A 1F7VA 2WAQD 1SFOC 2XCRB 3AQPA 2V6SA 1UV7A 1JOEA 1TWGK 1B4BA 1PJ6A 3HOUK 1I3QC 3GIRA 3S1MK 4BBSK 1PJ7A 4KAWX 3RZOK 4A3CC 1EK8A 4A3LC 3CQZK 4Q5SA 4WILA 3S16K 2R92K 4WJ3M 2E2HA 2RH6A 1R9TA 1TWHC 3TFJA 5IP9C 5IP7C 4KMAA 1C0AA 3AH5A 2B63A 5C3EC 3GTQK 3H0GC 4LQYA 1TWFK 3S1RK 1Y1VC 4AH6A 2E2JC 1TWAC 3S2DK 2GAHC 3I4NK 3S15C 1USOA 5C4XK 3GEIA 5JFEA 2P8TA 4C45A 3GTMC 4LOWA
chains in the Genus database with same CATH topology
5HL8A 2W7VA 1UV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL8 A;  2W7V A;  1UV7 A; 
#chains in the Genus database with same CATH topology
 2CW0 A;  4ILD A;  4J3N A;  2V6T A;  2ZUF A;  3H3V D;  2JA6 A;  1SFO A;  4GTC A;  4C3J K;  2JA8 K;  3H3V L;  2PPB A;  4A3K K;  2VUM C;  1I3Q A;  2PA8 L;  1RU0 A;  3N0C A;  2YU9 K;  3G4A A;  4BY7 C;  4A3G C;  5L46 A;  1XZQ A;  1TWH A;  2NVQ C;  1PJ5 A;  3AD7 C;  3FKI C;  1IQ0 A;  4KC6 A;  4A3J C;  3H0G A;  4BXX K;  4KDD A;  1TWA A;  3TTG A;  2XCO A;  5IYB C;  5HL8 A;  4A3I K;  1Y1W K;  3GTP K;  4A3F C;  1WCM K;  1EQR A;  4BLB A;  4Y7N K;  3PO3 C;  1X31 C;  3GTM A;  1J6V A;  4C3I C;  1O28 A;  4GTB A;  3ERE D;  3S1Q K;  1J6X A;  2PMZ L;  3HOW K;  4KAR A;  5IYD K;  3A8I A;  2JA5 A;  3GTG K;  5FJ8 K;  2E2I A;  3TFH A;  2VUM A;  1TWG C;  3GTK K;  4KN4 A;  1XZQ B;  1L0W A;  3HOU C;  3IPJ A;  2NVY A;  4G7Z A;  3S1M C;  3FOF A;  1EH1 A;  5M5W K;  3RZO C;  1XZP B;  3CQZ C;  3S16 C;  2Y0S L;  2R92 C;  1V5V A;  1HQM A;  4G7H A;  3K7A K;  3FKI A;  4KAS A;  4G7O A;  4A3M K;  2Y3P A;  3PO2 K;  1INN A;  1TWC A;  3LAP A;  3GTQ C;  1TWF C;  3DXJ A;  3S1R C;  3S2D C;  4YFK A;  3I4N C;  5C4X C;  3S14 K;  4QJV B;  2A69 A;  3GSI A;  2W7V A;  5IOS A;  1I50 A;  2NVX K;  4G0V A;  4JK1 A;  3S17 K;  4C3J C;  3OPF A;  2JA8 C;  1USM A;  1BS2 A;  4KN7 A;  3LPX A;  4QIW L;  3WOD A;  4OIN A;  4A93 K;  1GE9 A;  4P9S A;  3HOX K;  4A3K C;  2O5J A;  1JQW A;  5EGH A;  2YU9 C;  3EQL A;  3CQZ A;  5IOR A;  2R92 A;  2R93 K;  1ISE A;  2GSU A;  3OEP A;  3GDZ A;  1HI9 A;  4BBR K;  5M3M K;  4OIR A;  3GTJ K;  1ZVU A;  3S0X A;  1DCP A;  3A8J A;  4WJ4 A;  2FQT A;  3NUH A;  1ZYR A;  2E2H K;  1F93 A;  2A68 A;  4GTF A;  4GTA A;  4LR2 A;  4GZY A;  4A3I C;  1Y1W C;  3GTP C;  1WCM C;  4Y7N C;  3HKZ L;  1XPP A;  1IL2 A;  4G0U A;  3S1Q C;  4GT9 A;  3HOW C;  5IYD C;  2PA8 D;  3BP8 C;  4KB4 A;  4NOI A;  4XSX A;  3GTG C;  2JA7 K;  3A8K A;  3G4C A;  4LK1 A;  3GTK C;  3CAG A;  2YU9 A;  1WOS A;  4KM9 A;  4C3H K;  2JA6 K;  1SFO K;  5M3F K;  3TFI A;  1I6V A;  2PHC B;  2XCQ A;  1O24 A;  1VH2 A;  5C4J K;  1XZP A;  1WQG A;  3K7A C;  4A3E K;  4KB2 A;  4A3M C;  3T01 A;  3PO2 C;  1Y1V A;  1IS1 A;  1EFW A;  3S1N K;  1B4A A;  1XXB A;  1TWH K;  3GTO K;  3AQO A;  3GTP A;  2PMZ D;  3T00 A;  1WCM A;  2FQO A;  2R7Z K;  2NVX C;  1TWA K;  4A3B K;  2WB1 L;  5IOT A;  4LLG A;  4QJV A;  3S17 C;  3GTG A;  1EI6 A;  1WOP A;  5CHP A;  4A3D K;  2CFA B;  4ZH4 A;  4A93 C;  3GTK A;  4BBS C;  5E68 A;  2Y0S D;  3HOX C;  3QX3 A;  1O26 A;  2JA5 K;  1BJT A;  4KMU A;  2A6H A;  3JST A;  4MEX A;  3S2H K;  1KQ4 A;  2E2I K;  1VRQ C;  2R93 C;  1WQH A;  1J98 A;  3HOY K;  1SMY A;  3T02 A;  4X6A K;  4BBR C;  5TMC A;  2NVY K;  4MQ9 A;  1BGW A;  3GTJ C;  4FZB A;  3SZY A;  1O27 A;  1K83 K;  1WOO A;  2EBB A;  2D6F C;  5C44 K;  2E2H C;  1XXA A;  1TWC K;  1YNJ A;  3RZD K;  2JH3 A;  2O5I A;  4MEY A;  3V4G A;  4QIW D;  3GTL K;  4O2D A;  5FLM K;  1TWG A;  5EGE A;  3L4K A;  4Y52 K;  2JA7 C;  2P5M A;  4YFN A;  1I50 K;  1WSV A;  4LJZ A;  4PAB A;  1WIH A;  1ZBS A;  3M4O K;  4C3H C;  2JA6 C;  4BY1 K;  2NVT K;  2R93 A;  2WAQ L;  1J6W A;  1DD5 A;  4C2M K;  5C4J C;  2GSO A;  3GTQ A;  4A3E C;  5IYC K;  3ORE A;  3AD8 C;  3GTJ A;  1TWF A;  4BXX C;  3I4M K;  1DCH A;  3MML B;  1R9T K;  3S1N C;  4XSZ A;  3HKZ D;  3GTO C;  4XCH A;  2B63 K;  3M3Y K;  3HOZ K;  4M1X A;  2ZFZ A;  1F9N A;  4GTE A;  4RMF A;  1VGX A;  5M5Y K;  4XLN A;  3HOV K;  2R7Z C;  1WSR A;  3BUE A;  3HXA A;  4A3B C;  1I6H K;  4GTD A;  2JA7 A;  4KM8 A;  4A3D C;  1YCL A;  1IBA A;  1O2A A;  2A6E A;  3GEE A;  1ZQ1 C;  2CFA A;  1O29 A;  1O2B A;  2JA5 C;  4P5B A;  1I3Q K;  3S2H C;  2E2I C;  5M5X K;  4A3C K;  1AB4 A;  2ZUE A;  4A3L K;  4XLP A;  3HOY C;  4X6A C;  3VA7 A;  2GSN A;  4KAT A;  3N0B A;  4FM9 A;  1YX2 A;  4OIO A;  2NVY C;  3GEH A;  4GFQ A;  2GAG C;  1Y1W A;  5IP9 K;  4BKW A;  1DCO A;  1K83 C;  4LK0 A;  5IP7 K;  3GTO A;  1WOR A;  5C3E K;  2RGR A;  5CJ9 A;  5C44 C;  3H0G K;  4BLA A;  1YNN A;  3S14 C;  1BDF A;  1VLO A;  2WB1 D;  2E2J K;  1Y1V K;  3SZZ A;  1TWC C;  3AD9 C;  3Q3Q A;  2R7Z A;  3RZD C;  5TMF A;  3S15 K;  5D4D A;  1WQF A;  5TJ3 A;  3GTL C;  2V6U A;  5FLM C;  3L4J A;  3GTM K;  4GTL A;  4OIP A;  4DDQ A;  1JVI A;  2KWA A;  1ZXO A;  4Y52 C;  4YFX A;  3FHZ A;  4Q4Z A;  1I50 C;  3M4O C;  2VUM K;  5JVO A;  4BY1 C;  2NVT C;  4G0W A;  1O2F B;  4BY7 K;  4A3G K;  4C2M C;  3FOE A;  1IW7 A;  5IYC C;  4YG2 A;  1G51 A;  4OIQ A;  2NVQ K;  2BE5 A;  4KMH A;  1K83 A;  3FKI K;  3I4M C;  3LAJ A;  1R9T C;  4KMD A;  3N3Y A;  5IOQ A;  4A3J K;  1O25 A;  1F7U A;  2B63 C;  3M3Y C;  2NVX A;  3HOZ C;  3ADA C;  1VJE A;  1XXC A;  5IYB K;  3HOV C;  3GTL A;  1IE0 A;  4A3F K;  4PAA A;  4AYB D;  3PO3 K;  4P5A A;  4C3I K;  4AYB L;  1I6H C;  3BP3 A;  1F7V A;  2WAQ D;  1SFO C;  2XCR B;  3AQP A;  2V6S A;  1UV7 A;  1JOE A;  1TWG K;  1B4B A;  1PJ6 A;  3HOU K;  1I3Q C;  3GIR A;  3S1M K;  4BBS K;  1PJ7 A;  4KAW X;  3RZO K;  4A3C C;  1EK8 A;  4A3L C;  3CQZ K;  4Q5S A;  4WIL A;  3S16 K;  2R92 K;  4WJ3 M;  2E2H A;  2RH6 A;  1R9T A;  1TWH C;  3TFJ A;  5IP9 C;  5IP7 C;  4KMA A;  1C0A A;  3AH5 A;  2B63 A;  5C3E C;  3GTQ K;  3H0G C;  4LQY A;  1TWF K;  3S1R K;  1Y1V C;  4AH6 A;  2E2J C;  1TWA C;  3S2D K;  2GAH C;  3I4N K;  3S15 C;  1USO A;  5C4X K;  3GEI A;  5JFE A;  2P8T A;  4C45 A;  3GTM C;  4LOW A; 
#chains in the Genus database with same CATH homology
 5HL8 A;  2W7V A;  1UV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...