1UV7A

Periplasmic domain of epsm from vibrio cholerae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
76
Chain Sequence
QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGVVEVKRLQLKRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport
molecule keywords GENERAL SECRETION PATHWAY PROTEIN M
publication title The Crystal Structure of the Periplasmic Domain of the Type II Secretion System Protein Epsm from Vibrio Cholerae: The Simplest Version of the Ferredoxin Fold
pubmed doi rcsb
source organism Vibrio cholerae
total genus 18
structure length 76
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 1uv7A00
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH superfamily
2Y0SL 1EQRA 1R9TK 1I50K 3M4OC 1Y1VA 5CHPA 1O26A 3HKZL 3IPJA 3N0CA 1WSRA 3N0BA 4C3JC 1YCLA 4XLPA 3MMLB 4OIPA 3HOXK 4C2MK 3S14C 4KARA 3S2DK 2E2HK 1IE0A 5JVOA 4C3IC 3GTJC 5C4XC 2ZFZA 5IOSA 4PAAA 2P8TA 2Y3PA 4A3MK 4KATA 1XPPA 2A69A 4LJZA 3S17K 1F7UA 5IOQA 1SFOA 1I6VA 1I50A 4C3HK 4DDQA 3GEHA 2NVYK 1XXAA 4LK1A 1XZPB 3HOVC 1JQWA 1O27A 4ZH4A 2R92K 2YU9A 3GTMA 3HOUC 1O2FB 4KN7A 3GIRA 1EFWA 4FM9A 4Y7NK 3GTLK 2ZUEA 3FKIK 4J3NA 1WOPA 2E2IK 3BP8C 1TWCK 1TWGC 5EGHA 2R93A 4O2DA 3GEIA 1XXCA 3S16C 2VUMA 3GTPC 2NVXK 2R7ZK 3GTKA 2PPBA 4G7HA 3HOYC 1TWFK 4MEYA 5TMCA 3HOWC 3S15C 1WOOA 1USMA 1EH1A 4YG2A 1J98A 3RZDK 3LAPA 2P5MA 3A8IA 1TWHC 1DCHA 2V6TA 4WJ4A 1Y1WA 3CQZA 4BLBA 5L46A 5M3MK 1YX2A 3OEPA 4RMFA 4Y52C 3HXAA 4A3LK 5M5YK 3L4KA 4A3FC 3TTGA 1O28A 5FLMC 2D6FC 2R7ZA 3PO2C 1TWAA 3GSIA 3AQOA 1J6XA 1F9NA 4X6AC 4Q4ZA 3GTOC 3TFJA 1WOSA 1DCOA 5C3EK 2XCRB 3FHZA 5C44C 3T01A 3S1RK 1WCMK 2JA5C 1DD5A 2EBBA 3QX3A 3OREA 4BY1C 4A3EC 2NVQC 4A3KK 2A6HA 4A93C 1O24A 3T02A 1IS1A 4KMHA 3K7AC 5IYCK 2GSNA 3H3VD 1HI9A 2JA6A 2Y0SD 3VA7A 1USOA 3GTGC 4A3IC 4FZBA 3JSTA 3I4MK 1JVIA 1X31C 3S1NC 1SFOK 3PO3K 4XSXA 3S1MC 1PJ6A 1IW7A 4BY7C 4BLAA 5IP7K 1JOEA 2PA8L 3GTMK 3BP3A 2YU9K 1Y1VC 2E2JC 4OIRA 1DCPA 1V5VA 3H0GC 1VGXA 2CW0A 1AB4A 3AD7C 5IYBK 1XZQA 3GTQK 5M5WK 1BS2A 3ADAC 4BBSC 2JA7C 3A8JA 3GTJA 1K83C 4KDDA 5TJ3A 1G51A 4KM9A 2R93K 1ISEA 2VUMK 3A8KA 3RZOK 2GSOA 1I3QC 3GTKK 1R9TC 4GTDA 1I50C 3S0XA 1XXBA 4BBRK 3GTPK 3GDZA 2GSUA 3HOXC 2A6EA 1WQFA 4C2MC 1Y1WK 3GTQA 1I6HK 3S2DC 3CQZK 2E2HC 2WB1D 3S1QK 4P5BA 2PHCB 4KMUA 3TFHA 1YNNA 3CAGA 1SMYA 4KB2A 3I4NK 1VLOA 4YFNA 1HQMA 4G0UA 1VH2A 4A3CC 4A3MC 1TWAK 2CFAA 4GZYA 4QJVB 2RH6A 4ILDA 4GTLA 1EI6A 3TFIA 1TWGA 3HOZK 1WIHA 4QIWD 2O5JA 3GTPA 5IOTA 5FLMK 4C3HC 3S2HK 2B63C 2NVYC 5IP9K 2A68A 2BE5A 2O5IA 2R92C 2V6UA 3G4AA 3V4GA 1TWHA 4A3EK 1O29A 4Y7NC 3GTLC 3FKIC 2JA6K 1BJTA 3GEEA 4A3GK 4LOWA 5D4DA 2E2IC 1PJ5A 2NVTK 3AH5A 4MEXA 1TWCC 5IYDK 4KASA 5FJ8K 2W7VA 3K7AK 4M1XA 2JA8K 4NOIA 2NVXC 4A3DK 5C4JK 2KWAA 1RU0A 5JFEA 4KM8A 4A3JK 1TWFC 4KAWX 1B4AA 3GTGK 4OINA 4AYBD 3M3YK 3GTOA 4P9SA 1IQ0A 3N3YA 2JA5A 2ZUFA 3M4OK 4G0VA 4C3JK 1XZPA 4GTAA 2WAQL 1VJEA 3S14K 4A3LC 3HKZD 4C3IK 3GTJK 5C4XK 1BGWA 3LAJA 4GFQA 2PA8D 1O2BA 3GTGA 1BDFA 4GT9A 4G7OA 1UV7A 4OIQA 3WODA 3S1RC 4KMDA 1WCMC 2PMZL 4BXXC 4G7ZA 1WQHA 1L0WA 4KC6A 4LQYA 3SZZA 4A3KC 4PABA 3H3VL 5M5XK 4WJ3M 3HOVK 4KN4A 4YFXA 3DXJA 4GTEA 3AD8C 3HOUK 2XCQA 3FOEA 1WORA 5IYCC 5CJ9A 3H0GA 1J6VA 4LR2A 3I4MC 4A3BC 1IL2A 2JA7A 1F7VA 3AQPA 1K83A 3OPFA 1ZYRA 3T00A 1SFOC 1TWGK 4GTFA 3PO3C 3S16K 4AH6A 3L4JA 4A3CK 5M3FK 5HL8A 1I3QA 1GE9A 3HOYK 3HOWK 5IP7C 3S15K 1R9TA 3GTMC 2YU9C 1WSVA 4Q5SA 1ZXOA 2FQOA 5TMFA 2B63K 4XLNA 1J6WA 1TWHK 4BKWA 4KB4A 4LK0A 4MQ9A 5IYBC 4XCHA 3GTQC 2E2HA 4Y52K 3S17C 2R93C 2VUMC 5IORA 4A3FK 3RZOC 2V6SA 2FQTA 3GTKC 3PO2K 4X6AK 3GTOK 1O25A 5C44K 3EQLA 4BBRC 2WB1L 3LPXA 2JA5K 3SZYA 2B63A 4BY1K 2NVYA 2NVQK 1Y1WC 1I6HC 3CQZC 2R92A 3S1QC 4OIOA 4A93K 3G4CA 1XZQB 2GAHC 3I4NC 2GAGC 4YFKA 3GTLA 4QIWL 1C0AA 3FKIA 2R7ZC 1TWAC 2E2IA 4KMAA 4A3IK 1TWCA 1ZVUA 4C45A 3HOZC 3RZDC 1YNJA 4GTBA 2WAQD 5E68A 1VRQC 2NVXA 3S1NK 3S2HC 4JK1A 3S1MK 1TWFA 5IP9C 2RGRA 1F93A 4LLGA 1PJ7A 4BY7K 3NUHA 3ERED 4BXXK 1KQ4A 1Y1VK 4XSZA 2E2JK 1IBAA 5EGEA 3FOFA 2XCOA 1O2AA 3H0GK 2PMZD 2JA6C 1B4BA 4A3GC 2JH3A 1ZBSA 2NVTC 5IYDC 4BBSK 4AYBL 5C3EC 2JA7K 1K83K 2CFAB 2JA8C 1EK8A 4A3DC 4G0WA 5C4JC 1ZQ1C 3Q3QA 3BUEA 4QJVA 4A3JC 3M3YC 4A3BK 1WQGA 1I3QK 4P5AA 4WILA 3AD9C 4GTCA 1INNA 1WCMA
chains in the Genus database with same CATH topology
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV7 A;  5HL8 A;  2W7V A; 
#chains in the Genus database with same CATH topology
 2Y0S L;  1EQR A;  1R9T K;  1I50 K;  3M4O C;  1Y1V A;  5CHP A;  1O26 A;  3HKZ L;  3IPJ A;  3N0C A;  1WSR A;  3N0B A;  4C3J C;  1YCL A;  4XLP A;  3MML B;  4OIP A;  3HOX K;  4C2M K;  3S14 C;  4KAR A;  3S2D K;  2E2H K;  1IE0 A;  5JVO A;  4C3I C;  3GTJ C;  5C4X C;  2ZFZ A;  5IOS A;  4PAA A;  2P8T A;  2Y3P A;  4A3M K;  4KAT A;  1XPP A;  2A69 A;  4LJZ A;  3S17 K;  1F7U A;  5IOQ A;  1SFO A;  1I6V A;  1I50 A;  4C3H K;  4DDQ A;  3GEH A;  2NVY K;  1XXA A;  4LK1 A;  1XZP B;  3HOV C;  1JQW A;  1O27 A;  4ZH4 A;  2R92 K;  2YU9 A;  3GTM A;  3HOU C;  1O2F B;  4KN7 A;  3GIR A;  1EFW A;  4FM9 A;  4Y7N K;  3GTL K;  2ZUE A;  3FKI K;  4J3N A;  1WOP A;  2E2I K;  3BP8 C;  1TWC K;  1TWG C;  5EGH A;  2R93 A;  4O2D A;  3GEI A;  1XXC A;  3S16 C;  2VUM A;  3GTP C;  2NVX K;  2R7Z K;  3GTK A;  2PPB A;  4G7H A;  3HOY C;  1TWF K;  4MEY A;  5TMC A;  3HOW C;  3S15 C;  1WOO A;  1USM A;  1EH1 A;  4YG2 A;  1J98 A;  3RZD K;  3LAP A;  2P5M A;  3A8I A;  1TWH C;  1DCH A;  2V6T A;  4WJ4 A;  1Y1W A;  3CQZ A;  4BLB A;  5L46 A;  5M3M K;  1YX2 A;  3OEP A;  4RMF A;  4Y52 C;  3HXA A;  4A3L K;  5M5Y K;  3L4K A;  4A3F C;  3TTG A;  1O28 A;  5FLM C;  2D6F C;  2R7Z A;  3PO2 C;  1TWA A;  3GSI A;  3AQO A;  1J6X A;  1F9N A;  4X6A C;  4Q4Z A;  3GTO C;  3TFJ A;  1WOS A;  1DCO A;  5C3E K;  2XCR B;  3FHZ A;  5C44 C;  3T01 A;  3S1R K;  1WCM K;  2JA5 C;  1DD5 A;  2EBB A;  3QX3 A;  3ORE A;  4BY1 C;  4A3E C;  2NVQ C;  4A3K K;  2A6H A;  4A93 C;  1O24 A;  3T02 A;  1IS1 A;  4KMH A;  3K7A C;  5IYC K;  2GSN A;  3H3V D;  1HI9 A;  2JA6 A;  2Y0S D;  3VA7 A;  1USO A;  3GTG C;  4A3I C;  4FZB A;  3JST A;  3I4M K;  1JVI A;  1X31 C;  3S1N C;  1SFO K;  3PO3 K;  4XSX A;  3S1M C;  1PJ6 A;  1IW7 A;  4BY7 C;  4BLA A;  5IP7 K;  1JOE A;  2PA8 L;  3GTM K;  3BP3 A;  2YU9 K;  1Y1V C;  2E2J C;  4OIR A;  1DCP A;  1V5V A;  3H0G C;  1VGX A;  2CW0 A;  1AB4 A;  3AD7 C;  5IYB K;  1XZQ A;  3GTQ K;  5M5W K;  1BS2 A;  3ADA C;  4BBS C;  2JA7 C;  3A8J A;  3GTJ A;  1K83 C;  4KDD A;  5TJ3 A;  1G51 A;  4KM9 A;  2R93 K;  1ISE A;  2VUM K;  3A8K A;  3RZO K;  2GSO A;  1I3Q C;  3GTK K;  1R9T C;  4GTD A;  1I50 C;  3S0X A;  1XXB A;  4BBR K;  3GTP K;  3GDZ A;  2GSU A;  3HOX C;  2A6E A;  1WQF A;  4C2M C;  1Y1W K;  3GTQ A;  1I6H K;  3S2D C;  3CQZ K;  2E2H C;  2WB1 D;  3S1Q K;  4P5B A;  2PHC B;  4KMU A;  3TFH A;  1YNN A;  3CAG A;  1SMY A;  4KB2 A;  3I4N K;  1VLO A;  4YFN A;  1HQM A;  4G0U A;  1VH2 A;  4A3C C;  4A3M C;  1TWA K;  2CFA A;  4GZY A;  4QJV B;  2RH6 A;  4ILD A;  4GTL A;  1EI6 A;  3TFI A;  1TWG A;  3HOZ K;  1WIH A;  4QIW D;  2O5J A;  3GTP A;  5IOT A;  5FLM K;  4C3H C;  3S2H K;  2B63 C;  2NVY C;  5IP9 K;  2A68 A;  2BE5 A;  2O5I A;  2R92 C;  2V6U A;  3G4A A;  3V4G A;  1TWH A;  4A3E K;  1O29 A;  4Y7N C;  3GTL C;  3FKI C;  2JA6 K;  1BJT A;  3GEE A;  4A3G K;  4LOW A;  5D4D A;  2E2I C;  1PJ5 A;  2NVT K;  3AH5 A;  4MEX A;  1TWC C;  5IYD K;  4KAS A;  5FJ8 K;  2W7V A;  3K7A K;  4M1X A;  2JA8 K;  4NOI A;  2NVX C;  4A3D K;  5C4J K;  2KWA A;  1RU0 A;  5JFE A;  4KM8 A;  4A3J K;  1TWF C;  4KAW X;  1B4A A;  3GTG K;  4OIN A;  4AYB D;  3M3Y K;  3GTO A;  4P9S A;  1IQ0 A;  3N3Y A;  2JA5 A;  2ZUF A;  3M4O K;  4G0V A;  4C3J K;  1XZP A;  4GTA A;  2WAQ L;  1VJE A;  3S14 K;  4A3L C;  3HKZ D;  4C3I K;  3GTJ K;  5C4X K;  1BGW A;  3LAJ A;  4GFQ A;  2PA8 D;  1O2B A;  3GTG A;  1BDF A;  4GT9 A;  4G7O A;  1UV7 A;  4OIQ A;  3WOD A;  3S1R C;  4KMD A;  1WCM C;  2PMZ L;  4BXX C;  4G7Z A;  1WQH A;  1L0W A;  4KC6 A;  4LQY A;  3SZZ A;  4A3K C;  4PAB A;  3H3V L;  5M5X K;  4WJ3 M;  3HOV K;  4KN4 A;  4YFX A;  3DXJ A;  4GTE A;  3AD8 C;  3HOU K;  2XCQ A;  3FOE A;  1WOR A;  5IYC C;  5CJ9 A;  3H0G A;  1J6V A;  4LR2 A;  3I4M C;  4A3B C;  1IL2 A;  2JA7 A;  1F7V A;  3AQP A;  1K83 A;  3OPF A;  1ZYR A;  3T00 A;  1SFO C;  1TWG K;  4GTF A;  3PO3 C;  3S16 K;  4AH6 A;  3L4J A;  4A3C K;  5M3F K;  5HL8 A;  1I3Q A;  1GE9 A;  3HOY K;  3HOW K;  5IP7 C;  3S15 K;  1R9T A;  3GTM C;  2YU9 C;  1WSV A;  4Q5S A;  1ZXO A;  2FQO A;  5TMF A;  2B63 K;  4XLN A;  1J6W A;  1TWH K;  4BKW A;  4KB4 A;  4LK0 A;  4MQ9 A;  5IYB C;  4XCH A;  3GTQ C;  2E2H A;  4Y52 K;  3S17 C;  2R93 C;  2VUM C;  5IOR A;  4A3F K;  3RZO C;  2V6S A;  2FQT A;  3GTK C;  3PO2 K;  4X6A K;  3GTO K;  1O25 A;  5C44 K;  3EQL A;  4BBR C;  2WB1 L;  3LPX A;  2JA5 K;  3SZY A;  2B63 A;  4BY1 K;  2NVY A;  2NVQ K;  1Y1W C;  1I6H C;  3CQZ C;  2R92 A;  3S1Q C;  4OIO A;  4A93 K;  3G4C A;  1XZQ B;  2GAH C;  3I4N C;  2GAG C;  4YFK A;  3GTL A;  4QIW L;  1C0A A;  3FKI A;  2R7Z C;  1TWA C;  2E2I A;  4KMA A;  4A3I K;  1TWC A;  1ZVU A;  4C45 A;  3HOZ C;  3RZD C;  1YNJ A;  4GTB A;  2WAQ D;  5E68 A;  1VRQ C;  2NVX A;  3S1N K;  3S2H C;  4JK1 A;  3S1M K;  1TWF A;  5IP9 C;  2RGR A;  1F93 A;  4LLG A;  1PJ7 A;  4BY7 K;  3NUH A;  3ERE D;  4BXX K;  1KQ4 A;  1Y1V K;  4XSZ A;  2E2J K;  1IBA A;  5EGE A;  3FOF A;  2XCO A;  1O2A A;  3H0G K;  2PMZ D;  2JA6 C;  1B4B A;  4A3G C;  2JH3 A;  1ZBS A;  2NVT C;  5IYD C;  4BBS K;  4AYB L;  5C3E C;  2JA7 K;  1K83 K;  2CFA B;  2JA8 C;  1EK8 A;  4A3D C;  4G0W A;  5C4J C;  1ZQ1 C;  3Q3Q A;  3BUE A;  4QJV A;  4A3J C;  3M3Y C;  4A3B K;  1WQG A;  1I3Q K;  4P5A A;  4WIL A;  3AD9 C;  4GTC A;  1INN A;  1WCM A; 
#chains in the Genus database with same CATH homology
 1UV7 A;  5HL8 A;  2W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...