3GTKK

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtkK00
2JA8K 4A93K 1I6HK 2E2HK 2NVQC 3GTKC 2A6HA 2R7ZK 1I50C 4JK1A 3M3YK 3S16K 2R93C 4XLPA 4A3KC 4BY1C 2PMZL 4A3DK 4C3IK 3GTQK 3GTMC 4A3IC 3S2HK 5C3EC 4YFNA 2A6EA 4BBRK 3PO2C 1YNNA 4A3KK 3FKIK 4MEXA 4Q5SA 4A3FC 3GTMK 1TWGK 1IW7A 3S1NC 3M4OK 5C3EK 5C44K 5M3FK 4XSZA 5IP9C 2NVXK 4YFKA 4A3BK 4KN7A 4MEYA 4LK1A 4A93C 4LLGA 3S1QK 4A3FK 3I4MC 3DXJA 2JA5K 3HOVK 3M3YC 2R93K 2O5JA 1TWAK 4A3EC 4OIQA 3WODA 3CQZC 5IP7K 3H3VD 3S2HC 3S1MC 3S1QC 2JA7C 2CW0A 5IYDC 4YFXA 2JA5C 5C4XC 1Y1WC 2E2JK 4LK0A 4C2MK 4A3JC 3HKZL 5IYCK 4AYBD 4KN4A 3CQZK 5IP7C 5TMCA 2JA8C 3HOWC 3M4OC 4BY7K 1I6HC 1SFOC 4A3BC 4X6AK 3HOUC 4A3MC 2E2JC 2VUMC 4A3LC 2R92C 4C3HK 2NVYK 4BXXK 1SFOK 4OINA 3GTLK 2WAQD 3GTPC 4A3CK 4A3MK 2WAQL 2B63K 3S14C 4BBSC 2A69A 1BDFA 2Y0SL 2NVQK 3GTKK 2R92K 4LJZA 2A68A 1Y1VC 1TWCC 2B63C 4BXXC 1K83C 2NVTK 4A3JK 2NVXC 4ZH4A 3H3VL 3HOZK 4XSXA 4BY7C 3S15C 3RZDC 4KMUA 4YG2A 4AYBL 3HOVC 2JA6C 3GTOK 3HOUK 2E2IK 4Y7NK 2NVTC 4A3EK 5FLMK 2WB1D 2VUMK 3I4NK 4G7HA 3S17K 4A3LK 3HOZC 1I6VA 1TWGC 4Q4ZA 1WCMK 3S1MK 4A3GC 1XPPA 5C44C 3GTLC 3GTPK 4A3CC 3RZOK 1HQMA 4Y7NC 3K7AC 3S1RC 3PO3C 5M5YK 1TWFK 5IYCC 3GTQC 3I4MK 4NOIA 1TWHC 1R9TC 2BE5A 3HOWK 1TWCK 1TWAC 3HOXC 5M5XK 4X6AC 5C4JK 3RZOC 2Y0SD 3FKIC 2E2HC 5IYBK 3HOYK 4Y52K 5IYDK 4MQ9A 1TWHK 1R9TK 4QJVB 1I50K 3S16C 2JA6K 3GTOC 1Y1WK 5D4DA 4OIOA 3S17C 3I4NC 2YU9K 3EQLA 5C4JC 4C3JK 1WCMC 4OIRA 3GTJC 3HOYC 2WB1L 3GTGC 1Y1VK 2O5IA 2PMZD 2PA8D 3S1RK 1I3QC 2PA8L 2YU9C 1YNJA 3HKZD 3S1NK 4OIPA 2NVYC 5M5WK 2JA7K 3GTGK 3S15K 4QIWD 5IP9K 2R7ZC 3HOXK 4QIWL 2PPBA 3S14K 5FLMC 5FJ8K 4A3DC 4Y52C 5IYBC 4G7OA 3H0GK 3S2DK 4G7ZA 5M3MK 4A3GK 1K83K 4BBSK 4BBRC 5TMFA 3PO2K 3K7AK 3PO3K 3GTJK 1TWFC 3RZDK 3H0GC 3S2DC 5C4XK 4GZYA 1SMYA 2E2IC 4BY1K 4XLNA 1ZYRA 1I3QK 4QJVA 4A3IK
chains in the Genus database with same CATH superfamily
3GTKC 1XXBA 2A6HA 1J6XA 4JK1A 3M3YK 4XLPA 4P5BA 1DCPA 1F93A 3S2HK 3H0GA 5C3EC 2A6EA 3PO2C 1J98A 4ILDA 2RGRA 3SZYA 3FKIK 4A3KK 4XCHA 4GTBA 1B4AA 4YFKA 4A3BK 4GTEA 2R93A 1WSRA 3I4MC 3HOVK 4KAWX 2O5JA 1GE9A 5L46A 3CQZC 1PJ7A 3S1MC 3S1QC 2P5MA 5IYDC 2JA5C 1I50A 3LPXA 5IP7C 3TTGA 2JA8C 3HOWC 4A3MC 4PAAA 3VA7A 4A3LC 1VH2A 2R92C 5IOTA 2NVYK 1SFOK 3GTQA 5IORA 2B63K 3N0BA 3GTLA 1XXAA 4LJZA 2A68A 1Y1VC 3S0XA 1TWCC 2XCRB 4BXXC 4ZH4A 4XSXA 3GTOA 4KASA 3RZDC 5HL8A 3HOVC 2JA6C 3FKIA 2E2IK 3FOEA 2NVTC 1L0WA 3GEEA 2WB1D 3I4NK 4A3LK 4G7HA 3HOZC 1I6VA 4Q4ZA 4WILA 4G0VA 4LOWA 4Y7NC 3S1RC 3GTPA 1TWCK 1R9TA 3RZOC 1EK8A 3FKIC 4MQ9A 1TWHK 1I50K 3S16C 2JA6K 1Y1WK 2GAGC 5D4DA 3S17C 2NVXA 4C3JK 2VUMA 1DD5A 3HOYC 1WIHA 1YX2A 2PA8L 5M5WK 2JA7K 1WOPA 4QIWD 1C0AA 2PPBA 1XZQB 3GEHA 2KWAA 3AD7C 3H0GK 3S2DK 2RH6A 1WOOA 4BBRC 3GDZA 3TFIA 3PO3K 4KATA 3RZDK 5C4XK 4GZYA 3CQZA 1J6WA 3T00A 2E2IC 1IL2A 1ZYRA 1I3QK 4GTFA 4A93K 4KDDA 5TJ3A 3GIRA 1UV7A 2R93C 4BY1C 5CHPA 2PMZL 4A3DK 4C3IK 5E68A 3AH5A 4C3HC 3TFHA 4C2MC 3TFJA 3GTMK 1DCHA 3M4OK 3BP8C 5C44K 4G0UA 5IP9C 2NVXK 3ERED 4LK1A 3S1QK 4A3FK 2NVYA 3M3YC 5EGHA 2B63A 4RMFA 4A3EC 3WODA 4BLAA 1WQGA 5IP7K 2CFAB 3S2HC 1JQWA 2JA7C 5C4XC 1TWFA 1Y1WC 2E2JK 4A3JC 4GTDA 4C2MK 4AYBD 4KN4A 3CAGA 1O27A 5TMCA 4G0WA 3M4OC 1ZBSA 2E2IA 4A3BC 4X6AK 3HOUC 1O29A 2VUMC 2R7ZA 2FQOA 3AD9C 1ZVUA 4KARA 4C3HK 4GTLA 4OINA 4A3CK 2WAQD 1I3QA 3BP3A 1K83C 2NVTK 5IOSA 1O26A 3S15C 2D6FC 4Y7NK 5FLMK 2VUMK 4WJ4A 1WCMK 1IE0A 3OREA 3S1MK 5C44C 4A3CC 3RZOK 1IQ0A 1TWHC 3NUHA 3HOWK 1WQHA 1XZQA 5IYBK 2Y3PA 1O25A 2P8TA 4QJVB 4OIOA 3I4NC 3A8IA 3EQLA 4DDQA 1WCMC 2WB1L 1ZXOA 1Y1VK 3SZZA 3S1RK 1VGXA 2YU9C 1YNJA 5CJ9A 1USOA 3IPJA 4OIPA 2R7ZC 4KMAA 5IYBC 4G7ZA 5M3MK 1PJ5A 1VLOA 1K83K 5TMFA 3AQOA 1EQRA 4KM8A 1V5VA 4QJVA 4BBSK 1I6HK 1I50C 4BKWA 3S16K 4A3KC 3GTQK 3GTMC 4A3IC 1BS2A 4LQYA 4YFNA 4BBRK 1IBAA 1YNNA 4MEXA 4A3FC 3T01A 1IW7A 5C3EK 5M3FK 4P9SA 1YCLA 4A93C 4LLGA 1JVIA 1WOSA 3DXJA 2JA5K 2R93K 1XZPB 3H3VD 2CW0A 4O2DA 4LK0A 3HKZL 2YU9A 4BY7K 2V6UA 1SFOC 1J6VA 3GEIA 1WCMA 4BXXK 3GTLK 3GTPC 4BBSC 4M1XA 2A69A 2Y0SL 2NVQK 4C45A 4FZBA 1VJEA 4A3JK 2NVXC 3HOZK 1ISEA 4KMUA 2W7VA 4YG2A 4AYBL 3GTOK 3HOUK 4A3EK 1TWGC 2PHCB 1Y1VA 4A3GC 2XCOA 3GTLC 1JOEA 3GTPK 1HQMA 3K7AC 1RU0A 3GTQC 4NOIA 1O28A 2BE5A 2EBBA 2R92A 1TWAC 1F7VA 3OPFA 5M5XK 4X6AC 1TWHA 1DCOA 2JA6A 1BGWA 3BUEA 1EI6A 2E2HC 3HOYK 1R9TK 5IOQA 3GTOC 2GSNA 4GT9A 2YU9K 5C4JC 4OIRA 3GTJC 3Q3QA 2O5IA 2PA8D 3V4GA 4KM9A 2FQTA 2V6SA 4C3JC 3S1NK 3S15K 4KB4A 3GTGK 4LR2A 4QIWL 3S14K 2JA7A 5FLMC 1F9NA 1O2AA 4KC6A 1O2BA 3ADAC 4J3NA 1EH1A 3GTJK 1KQ4A 3H0GC 3S2DC 3A8JA 1SMYA 4BY1K 4XLNA 4A3IK 1B4BA 3QX3A 2JA8K 2E2HK 2NVQC 3GTKA 2R7ZK 3FOFA 4GTAA 2CFAA 2ZUEA 1AB4A 3N0CA 5JVOA 4BLBA 2JH3A 4Q5SA 1EFWA 1TWGK 3MMLB 3S1NC 3GTMA 4XSZA 4KN7A 4MEYA 4PABA 3JSTA 3HXAA 3AD8C 4GFQA 1WSVA 1TWAK 4OIQA 2ZUFA 3GTGA 4WJ3M 4YFXA 4KMDA 5IYCK 3CQZK 1I6HC 2ZFZA 5JFEA 2XCQA 3L4JA 2GSOA 2E2JC 3GTJA 1INNA 3LAJA 3AQPA 2WAQL 4A3MK 3S14C 2E2HA 1BDFA 3GTKK 1WORA 2R92K 3GSIA 1VRQC 4KB2A 3H3VL 1F7UA 4BY7C 1PJ6A 5EGEA 1O2FB 1X31C 3S17K 3N3YA 1K83A 1TWGA 2GSUA 4AH6A 4P5AA 1XPPA 3OEPA 3FHZA 3T02A 3G4AA 3PO3C 5M5YK 1TWFK 5IYCC 4GTCA 1WQFA 2GAHC 1R9TC 3I4MK 1TWAA 3HOXC 1USMA 5C4JK 2Y0SD 3LAPA 4Y52K 1XXCA 5IYDK 3G4CA 4C3IC 1ZQ1C 3L4KA 3GTGC 1IS1A 2PMZD 1I3QC 3HKZD 2NVYC 5IP9K 1TWCA 3A8KA 3HOXK 2JA5A 4FM9A 5FJ8K 4A3DC 4Y52C 4G7OA 4KMHA 4A3GK 2V6TA 1BJTA 1G51A 3PO2K 1Y1WA 3K7AK 1O24A 1TWFC 1XZPA 1SFOA 1HI9A 2B63C
chains in the Genus database with same CATH topology
2JA8K 4A93K 1I6HK 2E2HK 2NVQC 3GTKC 2A6HA 2R7ZK 1I50C 4JK1A 3M3YK 3S16K 2R93C 4XLPA 4A3KC 4BY1C 2PMZL 4A3DK 4C3IK 3GTQK 3GTMC 4A3IC 3S2HK 5C3EC 4YFNA 2A6EA 4BBRK 3PO2C 1YNNA 4A3KK 3FKIK 4MEXA 4Q5SA 4A3FC 3GTMK 1TWGK 1IW7A 3S1NC 3M4OK 5C3EK 5C44K 5M3FK 4XSZA 5IP9C 2NVXK 4YFKA 4A3BK 4KN7A 4MEYA 4LK1A 4A93C 4LLGA 3S1QK 4A3FK 3I4MC 3DXJA 2JA5K 3HOVK 3M3YC 2R93K 2O5JA 1TWAK 4A3EC 4OIQA 3WODA 3CQZC 5IP7K 3H3VD 3S2HC 3S1MC 3S1QC 2JA7C 2CW0A 5IYDC 4YFXA 2JA5C 5C4XC 1Y1WC 2E2JK 4LK0A 4C2MK 4A3JC 3HKZL 5IYCK 4AYBD 4KN4A 3CQZK 5IP7C 5TMCA 2JA8C 3HOWC 3M4OC 4BY7K 1I6HC 1SFOC 4A3BC 4X6AK 3HOUC 4A3MC 2E2JC 2VUMC 4A3LC 2R92C 4C3HK 2NVYK 4BXXK 1SFOK 4OINA 3GTLK 2WAQD 3GTPC 4A3CK 4A3MK 2WAQL 2B63K 3S14C 4BBSC 2A69A 1BDFA 2Y0SL 2NVQK 3GTKK 2R92K 4LJZA 2A68A 1Y1VC 1TWCC 2B63C 4BXXC 1K83C 2NVTK 4A3JK 2NVXC 4ZH4A 3H3VL 3HOZK 4XSXA 4BY7C 3S15C 3RZDC 4KMUA 4YG2A 4AYBL 3HOVC 2JA6C 3GTOK 3HOUK 2E2IK 4Y7NK 2NVTC 4A3EK 5FLMK 2WB1D 2VUMK 3I4NK 4G7HA 3S17K 4A3LK 3HOZC 1I6VA 1TWGC 4Q4ZA 1WCMK 3S1MK 4A3GC 1XPPA 5C44C 3GTLC 3GTPK 4A3CC 3RZOK 1HQMA 4Y7NC 3K7AC 3S1RC 3PO3C 5M5YK 1TWFK 5IYCC 3GTQC 3I4MK 4NOIA 1TWHC 1R9TC 2BE5A 3HOWK 1TWCK 1TWAC 3HOXC 5M5XK 4X6AC 5C4JK 3RZOC 2Y0SD 3FKIC 2E2HC 5IYBK 3HOYK 4Y52K 5IYDK 4MQ9A 1TWHK 1R9TK 4QJVB 1I50K 3S16C 2JA6K 3GTOC 1Y1WK 5D4DA 4OIOA 3S17C 3I4NC 2YU9K 3EQLA 5C4JC 4C3JK 1WCMC 4OIRA 3GTJC 3HOYC 2WB1L 3GTGC 1Y1VK 2O5IA 2PMZD 2PA8D 3S1RK 1I3QC 2PA8L 2YU9C 1YNJA 3HKZD 3S1NK 4OIPA 2NVYC 5M5WK 2JA7K 3GTGK 3S15K 4QIWD 5IP9K 2R7ZC 3HOXK 4QIWL 2PPBA 3S14K 5FLMC 5FJ8K 4A3DC 4Y52C 5IYBC 4G7OA 3H0GK 3S2DK 4G7ZA 5M3MK 4A3GK 1K83K 4BBSK 4BBRC 5TMFA 3PO2K 3K7AK 3PO3K 3GTJK 1TWFC 3RZDK 3H0GC 3S2DC 5C4XK 4GZYA 1SMYA 2E2IC 4BY1K 4XLNA 1ZYRA 1I3QK 4QJVA 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 K;  4A93 K;  1I6H K;  2E2H K;  2NVQ C;  3GTK C;  2A6H A;  2R7Z K;  1I50 C;  4JK1 A;  3M3Y K;  3S16 K;  2R93 C;  4XLP A;  4A3K C;  4BY1 C;  2PMZ L;  4A3D K;  4C3I K;  3GTQ K;  3GTM C;  4A3I C;  3S2H K;  5C3E C;  4YFN A;  2A6E A;  4BBR K;  3PO2 C;  1YNN A;  4A3K K;  3FKI K;  4MEX A;  4Q5S A;  4A3F C;  3GTM K;  1TWG K;  1IW7 A;  3S1N C;  3M4O K;  5C3E K;  5C44 K;  5M3F K;  4XSZ A;  5IP9 C;  2NVX K;  4YFK A;  4A3B K;  4KN7 A;  4MEY A;  4LK1 A;  4A93 C;  4LLG A;  3S1Q K;  4A3F K;  3I4M C;  3DXJ A;  2JA5 K;  3HOV K;  3M3Y C;  2R93 K;  2O5J A;  1TWA K;  4A3E C;  4OIQ A;  3WOD A;  3CQZ C;  5IP7 K;  3H3V D;  3S2H C;  3S1M C;  3S1Q C;  2JA7 C;  2CW0 A;  5IYD C;  4YFX A;  2JA5 C;  5C4X C;  1Y1W C;  2E2J K;  4LK0 A;  4C2M K;  4A3J C;  3HKZ L;  5IYC K;  4AYB D;  4KN4 A;  3CQZ K;  5IP7 C;  5TMC A;  2JA8 C;  3HOW C;  3M4O C;  4BY7 K;  1I6H C;  1SFO C;  4A3B C;  4X6A K;  3HOU C;  4A3M C;  2E2J C;  2VUM C;  4A3L C;  2R92 C;  4C3H K;  2NVY K;  4BXX K;  1SFO K;  4OIN A;  3GTL K;  2WAQ D;  3GTP C;  4A3C K;  4A3M K;  2WAQ L;  2B63 K;  3S14 C;  4BBS C;  2A69 A;  1BDF A;  2Y0S L;  2NVQ K;  3GTK K;  2R92 K;  4LJZ A;  2A68 A;  1Y1V C;  1TWC C;  2B63 C;  4BXX C;  1K83 C;  2NVT K;  4A3J K;  2NVX C;  4ZH4 A;  3H3V L;  3HOZ K;  4XSX A;  4BY7 C;  3S15 C;  3RZD C;  4KMU A;  4YG2 A;  4AYB L;  3HOV C;  2JA6 C;  3GTO K;  3HOU K;  2E2I K;  4Y7N K;  2NVT C;  4A3E K;  5FLM K;  2WB1 D;  2VUM K;  3I4N K;  4G7H A;  3S17 K;  4A3L K;  3HOZ C;  1I6V A;  1TWG C;  4Q4Z A;  1WCM K;  3S1M K;  4A3G C;  1XPP A;  5C44 C;  3GTL C;  3GTP K;  4A3C C;  3RZO K;  1HQM A;  4Y7N C;  3K7A C;  3S1R C;  3PO3 C;  5M5Y K;  1TWF K;  5IYC C;  3GTQ C;  3I4M K;  4NOI A;  1TWH C;  1R9T C;  2BE5 A;  3HOW K;  1TWC K;  1TWA C;  3HOX C;  5M5X K;  4X6A C;  5C4J K;  3RZO C;  2Y0S D;  3FKI C;  2E2H C;  5IYB K;  3HOY K;  4Y52 K;  5IYD K;  4MQ9 A;  1TWH K;  1R9T K;  4QJV B;  1I50 K;  3S16 C;  2JA6 K;  3GTO C;  1Y1W K;  5D4D A;  4OIO A;  3S17 C;  3I4N C;  2YU9 K;  3EQL A;  5C4J C;  4C3J K;  1WCM C;  4OIR A;  3GTJ C;  3HOY C;  2WB1 L;  3GTG C;  1Y1V K;  2O5I A;  2PMZ D;  2PA8 D;  3S1R K;  1I3Q C;  2PA8 L;  2YU9 C;  1YNJ A;  3HKZ D;  3S1N K;  4OIP A;  2NVY C;  5M5W K;  2JA7 K;  3GTG K;  3S15 K;  4QIW D;  5IP9 K;  2R7Z C;  3HOX K;  4QIW L;  2PPB A;  3S14 K;  5FLM C;  5FJ8 K;  4A3D C;  4Y52 C;  5IYB C;  4G7O A;  3H0G K;  3S2D K;  4G7Z A;  5M3M K;  4A3G K;  1K83 K;  4BBS K;  4BBR C;  5TMF A;  3PO2 K;  3K7A K;  3PO3 K;  3GTJ K;  1TWF C;  3RZD K;  3H0G C;  3S2D C;  5C4X K;  4GZY A;  1SMY A;  2E2I C;  4BY1 K;  4XLN A;  1ZYR A;  1I3Q K;  4QJV A;  4A3I K; 
#chains in the Genus database with same CATH topology
 3GTK C;  1XXB A;  2A6H A;  1J6X A;  4JK1 A;  3M3Y K;  4XLP A;  4P5B A;  1DCP A;  1F93 A;  3S2H K;  3H0G A;  5C3E C;  2A6E A;  3PO2 C;  1J98 A;  4ILD A;  2RGR A;  3SZY A;  3FKI K;  4A3K K;  4XCH A;  4GTB A;  1B4A A;  4YFK A;  4A3B K;  4GTE A;  2R93 A;  1WSR A;  3I4M C;  3HOV K;  4KAW X;  2O5J A;  1GE9 A;  5L46 A;  3CQZ C;  1PJ7 A;  3S1M C;  3S1Q C;  2P5M A;  5IYD C;  2JA5 C;  1I50 A;  3LPX A;  5IP7 C;  3TTG A;  2JA8 C;  3HOW C;  4A3M C;  4PAA A;  3VA7 A;  4A3L C;  1VH2 A;  2R92 C;  5IOT A;  2NVY K;  1SFO K;  3GTQ A;  5IOR A;  2B63 K;  3N0B A;  3GTL A;  1XXA A;  4LJZ A;  2A68 A;  1Y1V C;  3S0X A;  1TWC C;  2XCR B;  4BXX C;  4ZH4 A;  4XSX A;  3GTO A;  4KAS A;  3RZD C;  5HL8 A;  3HOV C;  2JA6 C;  3FKI A;  2E2I K;  3FOE A;  2NVT C;  1L0W A;  3GEE A;  2WB1 D;  3I4N K;  4A3L K;  4G7H A;  3HOZ C;  1I6V A;  4Q4Z A;  4WIL A;  4G0V A;  4LOW A;  4Y7N C;  3S1R C;  3GTP A;  1TWC K;  1R9T A;  3RZO C;  1EK8 A;  3FKI C;  4MQ9 A;  1TWH K;  1I50 K;  3S16 C;  2JA6 K;  1Y1W K;  2GAG C;  5D4D A;  3S17 C;  2NVX A;  4C3J K;  2VUM A;  1DD5 A;  3HOY C;  1WIH A;  1YX2 A;  2PA8 L;  5M5W K;  2JA7 K;  1WOP A;  4QIW D;  1C0A A;  2PPB A;  1XZQ B;  3GEH A;  2KWA A;  3AD7 C;  3H0G K;  3S2D K;  2RH6 A;  1WOO A;  4BBR C;  3GDZ A;  3TFI A;  3PO3 K;  4KAT A;  3RZD K;  5C4X K;  4GZY A;  3CQZ A;  1J6W A;  3T00 A;  2E2I C;  1IL2 A;  1ZYR A;  1I3Q K;  4GTF A;  4A93 K;  4KDD A;  5TJ3 A;  3GIR A;  1UV7 A;  2R93 C;  4BY1 C;  5CHP A;  2PMZ L;  4A3D K;  4C3I K;  5E68 A;  3AH5 A;  4C3H C;  3TFH A;  4C2M C;  3TFJ A;  3GTM K;  1DCH A;  3M4O K;  3BP8 C;  5C44 K;  4G0U A;  5IP9 C;  2NVX K;  3ERE D;  4LK1 A;  3S1Q K;  4A3F K;  2NVY A;  3M3Y C;  5EGH A;  2B63 A;  4RMF A;  4A3E C;  3WOD A;  4BLA A;  1WQG A;  5IP7 K;  2CFA B;  3S2H C;  1JQW A;  2JA7 C;  5C4X C;  1TWF A;  1Y1W C;  2E2J K;  4A3J C;  4GTD A;  4C2M K;  4AYB D;  4KN4 A;  3CAG A;  1O27 A;  5TMC A;  4G0W A;  3M4O C;  1ZBS A;  2E2I A;  4A3B C;  4X6A K;  3HOU C;  1O29 A;  2VUM C;  2R7Z A;  2FQO A;  3AD9 C;  1ZVU A;  4KAR A;  4C3H K;  4GTL A;  4OIN A;  4A3C K;  2WAQ D;  1I3Q A;  3BP3 A;  1K83 C;  2NVT K;  5IOS A;  1O26 A;  3S15 C;  2D6F C;  4Y7N K;  5FLM K;  2VUM K;  4WJ4 A;  1WCM K;  1IE0 A;  3ORE A;  3S1M K;  5C44 C;  4A3C C;  3RZO K;  1IQ0 A;  1TWH C;  3NUH A;  3HOW K;  1WQH A;  1XZQ A;  5IYB K;  2Y3P A;  1O25 A;  2P8T A;  4QJV B;  4OIO A;  3I4N C;  3A8I A;  3EQL A;  4DDQ A;  1WCM C;  2WB1 L;  1ZXO A;  1Y1V K;  3SZZ A;  3S1R K;  1VGX A;  2YU9 C;  1YNJ A;  5CJ9 A;  1USO A;  3IPJ A;  4OIP A;  2R7Z C;  4KMA A;  5IYB C;  4G7Z A;  5M3M K;  1PJ5 A;  1VLO A;  1K83 K;  5TMF A;  3AQO A;  1EQR A;  4KM8 A;  1V5V A;  4QJV A;  4BBS K;  1I6H K;  1I50 C;  4BKW A;  3S16 K;  4A3K C;  3GTQ K;  3GTM C;  4A3I C;  1BS2 A;  4LQY A;  4YFN A;  4BBR K;  1IBA A;  1YNN A;  4MEX A;  4A3F C;  3T01 A;  1IW7 A;  5C3E K;  5M3F K;  4P9S A;  1YCL A;  4A93 C;  4LLG A;  1JVI A;  1WOS A;  3DXJ A;  2JA5 K;  2R93 K;  1XZP B;  3H3V D;  2CW0 A;  4O2D A;  4LK0 A;  3HKZ L;  2YU9 A;  4BY7 K;  2V6U A;  1SFO C;  1J6V A;  3GEI A;  1WCM A;  4BXX K;  3GTL K;  3GTP C;  4BBS C;  4M1X A;  2A69 A;  2Y0S L;  2NVQ K;  4C45 A;  4FZB A;  1VJE A;  4A3J K;  2NVX C;  3HOZ K;  1ISE A;  4KMU A;  2W7V A;  4YG2 A;  4AYB L;  3GTO K;  3HOU K;  4A3E K;  1TWG C;  2PHC B;  1Y1V A;  4A3G C;  2XCO A;  3GTL C;  1JOE A;  3GTP K;  1HQM A;  3K7A C;  1RU0 A;  3GTQ C;  4NOI A;  1O28 A;  2BE5 A;  2EBB A;  2R92 A;  1TWA C;  1F7V A;  3OPF A;  5M5X K;  4X6A C;  1TWH A;  1DCO A;  2JA6 A;  1BGW A;  3BUE A;  1EI6 A;  2E2H C;  3HOY K;  1R9T K;  5IOQ A;  3GTO C;  2GSN A;  4GT9 A;  2YU9 K;  5C4J C;  4OIR A;  3GTJ C;  3Q3Q A;  2O5I A;  2PA8 D;  3V4G A;  4KM9 A;  2FQT A;  2V6S A;  4C3J C;  3S1N K;  3S15 K;  4KB4 A;  3GTG K;  4LR2 A;  4QIW L;  3S14 K;  2JA7 A;  5FLM C;  1F9N A;  1O2A A;  4KC6 A;  1O2B A;  3ADA C;  4J3N A;  1EH1 A;  3GTJ K;  1KQ4 A;  3H0G C;  3S2D C;  3A8J A;  1SMY A;  4BY1 K;  4XLN A;  4A3I K;  1B4B A;  3QX3 A;  2JA8 K;  2E2H K;  2NVQ C;  3GTK A;  2R7Z K;  3FOF A;  4GTA A;  2CFA A;  2ZUE A;  1AB4 A;  3N0C A;  5JVO A;  4BLB A;  2JH3 A;  4Q5S A;  1EFW A;  1TWG K;  3MML B;  3S1N C;  3GTM A;  4XSZ A;  4KN7 A;  4MEY A;  4PAB A;  3JST A;  3HXA A;  3AD8 C;  4GFQ A;  1WSV A;  1TWA K;  4OIQ A;  2ZUF A;  3GTG A;  4WJ3 M;  4YFX A;  4KMD A;  5IYC K;  3CQZ K;  1I6H C;  2ZFZ A;  5JFE A;  2XCQ A;  3L4J A;  2GSO A;  2E2J C;  3GTJ A;  1INN A;  3LAJ A;  3AQP A;  2WAQ L;  4A3M K;  3S14 C;  2E2H A;  1BDF A;  3GTK K;  1WOR A;  2R92 K;  3GSI A;  1VRQ C;  4KB2 A;  3H3V L;  1F7U A;  4BY7 C;  1PJ6 A;  5EGE A;  1O2F B;  1X31 C;  3S17 K;  3N3Y A;  1K83 A;  1TWG A;  2GSU A;  4AH6 A;  4P5A A;  1XPP A;  3OEP A;  3FHZ A;  3T02 A;  3G4A A;  3PO3 C;  5M5Y K;  1TWF K;  5IYC C;  4GTC A;  1WQF A;  2GAH C;  1R9T C;  3I4M K;  1TWA A;  3HOX C;  1USM A;  5C4J K;  2Y0S D;  3LAP A;  4Y52 K;  1XXC A;  5IYD K;  3G4C A;  4C3I C;  1ZQ1 C;  3L4K A;  3GTG C;  1IS1 A;  2PMZ D;  1I3Q C;  3HKZ D;  2NVY C;  5IP9 K;  1TWC A;  3A8K A;  3HOX K;  2JA5 A;  4FM9 A;  5FJ8 K;  4A3D C;  4Y52 C;  4G7O A;  4KMH A;  4A3G K;  2V6T A;  1BJT A;  1G51 A;  3PO2 K;  1Y1W A;  3K7A K;  1O24 A;  1TWF C;  1XZP A;  1SFO A;  1HI9 A;  2B63 C; 
#chains in the Genus database with same CATH homology
 2JA8 K;  4A93 K;  1I6H K;  2E2H K;  2NVQ C;  3GTK C;  2A6H A;  2R7Z K;  1I50 C;  4JK1 A;  3M3Y K;  3S16 K;  2R93 C;  4XLP A;  4A3K C;  4BY1 C;  2PMZ L;  4A3D K;  4C3I K;  3GTQ K;  3GTM C;  4A3I C;  3S2H K;  5C3E C;  4YFN A;  2A6E A;  4BBR K;  3PO2 C;  1YNN A;  4A3K K;  3FKI K;  4MEX A;  4Q5S A;  4A3F C;  3GTM K;  1TWG K;  1IW7 A;  3S1N C;  3M4O K;  5C3E K;  5C44 K;  5M3F K;  4XSZ A;  5IP9 C;  2NVX K;  4YFK A;  4A3B K;  4KN7 A;  4MEY A;  4LK1 A;  4A93 C;  4LLG A;  3S1Q K;  4A3F K;  3I4M C;  3DXJ A;  2JA5 K;  3HOV K;  3M3Y C;  2R93 K;  2O5J A;  1TWA K;  4A3E C;  4OIQ A;  3WOD A;  3CQZ C;  5IP7 K;  3H3V D;  3S2H C;  3S1M C;  3S1Q C;  2JA7 C;  2CW0 A;  5IYD C;  4YFX A;  2JA5 C;  5C4X C;  1Y1W C;  2E2J K;  4LK0 A;  4C2M K;  4A3J C;  3HKZ L;  5IYC K;  4AYB D;  4KN4 A;  3CQZ K;  5IP7 C;  5TMC A;  2JA8 C;  3HOW C;  3M4O C;  4BY7 K;  1I6H C;  1SFO C;  4A3B C;  4X6A K;  3HOU C;  4A3M C;  2E2J C;  2VUM C;  4A3L C;  2R92 C;  4C3H K;  2NVY K;  4BXX K;  1SFO K;  4OIN A;  3GTL K;  2WAQ D;  3GTP C;  4A3C K;  4A3M K;  2WAQ L;  2B63 K;  3S14 C;  4BBS C;  2A69 A;  1BDF A;  2Y0S L;  2NVQ K;  3GTK K;  2R92 K;  4LJZ A;  2A68 A;  1Y1V C;  1TWC C;  2B63 C;  4BXX C;  1K83 C;  2NVT K;  4A3J K;  2NVX C;  4ZH4 A;  3H3V L;  3HOZ K;  4XSX A;  4BY7 C;  3S15 C;  3RZD C;  4KMU A;  4YG2 A;  4AYB L;  3HOV C;  2JA6 C;  3GTO K;  3HOU K;  2E2I K;  4Y7N K;  2NVT C;  4A3E K;  5FLM K;  2WB1 D;  2VUM K;  3I4N K;  4G7H A;  3S17 K;  4A3L K;  3HOZ C;  1I6V A;  1TWG C;  4Q4Z A;  1WCM K;  3S1M K;  4A3G C;  1XPP A;  5C44 C;  3GTL C;  3GTP K;  4A3C C;  3RZO K;  1HQM A;  4Y7N C;  3K7A C;  3S1R C;  3PO3 C;  5M5Y K;  1TWF K;  5IYC C;  3GTQ C;  3I4M K;  4NOI A;  1TWH C;  1R9T C;  2BE5 A;  3HOW K;  1TWC K;  1TWA C;  3HOX C;  5M5X K;  4X6A C;  5C4J K;  3RZO C;  2Y0S D;  3FKI C;  2E2H C;  5IYB K;  3HOY K;  4Y52 K;  5IYD K;  4MQ9 A;  1TWH K;  1R9T K;  4QJV B;  1I50 K;  3S16 C;  2JA6 K;  3GTO C;  1Y1W K;  5D4D A;  4OIO A;  3S17 C;  3I4N C;  2YU9 K;  3EQL A;  5C4J C;  4C3J K;  1WCM C;  4OIR A;  3GTJ C;  3HOY C;  2WB1 L;  3GTG C;  1Y1V K;  2O5I A;  2PMZ D;  2PA8 D;  3S1R K;  1I3Q C;  2PA8 L;  2YU9 C;  1YNJ A;  3HKZ D;  3S1N K;  4OIP A;  2NVY C;  5M5W K;  2JA7 K;  3GTG K;  3S15 K;  4QIW D;  5IP9 K;  2R7Z C;  3HOX K;  4QIW L;  2PPB A;  3S14 K;  5FLM C;  5FJ8 K;  4A3D C;  4Y52 C;  5IYB C;  4G7O A;  3H0G K;  3S2D K;  4G7Z A;  5M3M K;  4A3G K;  1K83 K;  4BBS K;  4BBR C;  5TMF A;  3PO2 K;  3K7A K;  3PO3 K;  3GTJ K;  1TWF C;  3RZD K;  3H0G C;  3S2D C;  5C4X K;  4GZY A;  1SMY A;  2E2I C;  4BY1 K;  4XLN A;  1ZYR A;  1I3Q K;  4QJV A;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...