3GTKK

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtkK00
4AYBD 1SFOC 3S1MK 5FLMK 2E2HK 4OIQA 4A3KK 3S16C 5M5WK 2E2IK 2PA8L 3S1QK 1TWCC 3S17K 3EQLA 1WCMK 2E2JC 2R93C 2A6HA 3S14C 3HOXK 3HOUK 1R9TK 3FKIK 4A3DK 1IW7A 3H3VD 4YFNA 3GTPK 5IP9C 4A3MC 4BXXK 1SFOK 4QJVA 2JA5C 4C2MK 1HQMA 4XLPA 3S16K 3S1NC 3RZDC 2PPBA 2JA6K 1TWGC 2Y0SD 4Y7NC 2WAQD 2E2JK 3GTKC 4A3EK 3S14K 2R93K 5C3EK 5M5XK 3GTLC 2A68A 2NVTC 3HOZC 1I50C 1TWHC 3I4NC 5M3FK 4LK1A 2PA8D 2NVYC 5TMFA 2WAQL 5IYDC 2JA8C 4A3MK 3GTOC 3GTJC 3HOWC 2JA5K 4XSXA 4X6AK 2R92K 3WODA 5TMCA 4Q4ZA 5M5YK 1TWFC 3GTKK 3GTLK 1Y1WC 4C3HK 3GTMC 3HOZK 4A3GC 1I50K 2A69A 1TWHK 3HOYC 1ZYRA 2JA8K 5IYDK 4KN7A 5C44C 4YFXA 3GTJK 3HOWK 4BBSC 4G7OA 4ZH4A 5C4JC 4OIOA 3PO2C 2JA7C 4LK0A 4LLGA 3H0GC 1TWCK 1TWFK 3GTQC 4BBRC 5IYBC 3S2DC 2O5IA 1I3QC 4BY1C 1BDFA 5C4XC 4KN4A 1Y1WK 3GTMK 4OIPA 4A3GK 2NVXC 4Y52C 5IP9K 5C44K 4MEYA 4A3BC 4QIWD 4QJVB 4MEXA 4XLNA 4OINA 4BY7C 5C4JK 3PO2K 2JA7K 3GTGC 3S1NK 2CW0A 3RZDK 2VUMC 1YNJA 3GTQK 4BBRK 5IYBK 1TWGK 4QIWL 1I3QK 4Y7NK 2YU9C 2A6EA 5C4XK 4BY1K 3HOVC 4YFKA 3S1MC 3K7AC 5D4DA 5FLMC 3S1RC 2E2HC 4A3JC 2NVTK 3S15C 2PMZL 4C3IK 3I4NK 3M4OK 2NVYK 2E2IC 3GTOK 3S17C 1Y1VC 4JK1A 4LJZA 4BY7K 4A93C 3GTGK 2VUMK 3PO3C 2R7ZC 3RZOC 4A3DC 2YU9K 1TWAC 2BE5A 3HOVK 1K83C 3CQZC 3S2DK 3K7AK 3S1RK 5IP7C 3S15K 4A3JK 3HKZD 3HOYK 2NVQC 1SMYA 4XSZA 3S2HC 1I6HC 2JA6C 3M3YC 1Y1VK 2O5JA 4AYBL 4A3CC 4A3LC 4BBSK 4NOIA 4A3EC 4A93K 5C3EC 3HKZL 2B63C 4Q5SA 4A3FK 3PO3K 1XPPA 3H0GK 5FJ8K 2PMZD 5IYCC 4YG2A 4A3IC 4OIRA 3I4MC 2R7ZK 1TWAK 3RZOK 3M4OC 2WB1D 1K83K 3CQZK 4A3FC 5M3MK 4GZYA 4C3JK 5IP7K 4X6AC 2NVXK 4A3KC 2R92C 4Y52K 4KMUA 2NVQK 3H3VL 3S2HK 1I6HK 3M3YK 4A3BK 2WB1L 1I6VA 3S1QC 4A3CK 1WCMC 4A3LK 3HOXC 2B63K 4G7ZA 3HOUC 4MQ9A 3DXJA 1R9TC 3FKIC 5IYCK 4A3IK 3I4MK 1YNNA 2Y0SL 3GTPC 4G7HA 4BXXC
chains in the Genus database with same CATH superfamily
4AYBD 1SFOC 3GTMA 4KMDA 2PA8L 1USMA 2R93C 3HOUK 1O27A 1R9TK 2JA7A 3FKIK 1VJEA 2ZFZA 4A3DK 2KWAA 5JVOA 4C45A 4YFNA 4G0VA 3S1NC 3MMLB 4G0UA 2NVYA 1ZXOA 4Y7NC 2WAQD 2E2JK 3GTKC 5C3EK 5EGEA 2A68A 3HOZC 4RMFA 3FOFA 2PA8D 4A3MK 3GTJC 2JA5K 2R92K 3WODA 5TMCA 4KARA 5M5YK 1ZBSA 1O2AA 4PABA 2A69A 3HOYC 1O26A 1BGWA 1AB4A 1VGXA 4BBSC 5C4JC 3H0GC 1TWFK 1I3QC 1WOPA 1BJTA 5C4XC 4KN4A 4OIPA 2GSOA 3NUHA 3G4CA 4GTLA 1VLOA 3VA7A 4XLNA 4OINA 3PO2K 3GTGC 3S1NK 2CW0A 2R92A 4Y7NK 4BY1K 1USOA 1WCMA 4YFKA 3N0BA 3S1MC 1WOSA 1Y1VC 3TFJA 1ZVUA 3GTPA 1SFOA 3Q3QA 2R7ZC 3RZOC 1HI9A 3SZZA 2BE5A 4P5BA 2R93A 1DCOA 4FZBA 3HKZD 3HOYK 1WQFA 1SMYA 4XSZA 2JA6C 4A3LC 4BBSK 3AH5A 4A3EC 4A93K 3JSTA 2B63C 3S0XA 1XZPB 3L4JA 3PO3K 1WORA 3H0GK 5FJ8K 4YG2A 1IS1A 1K83K 3GTKA 3GSIA 2NVQK 3TFIA 1F7VA 3M3YK 1I6VA 1ZQ1C 4A3CK 3GTJA 3HOUC 1R9TC 1JQWA 3FKIC 3I4MK 1WQGA 4G7HA 3S1MK 2GAHC 3ADAC 5M5WK 1J6VA 1TWCC 2W7VA 2E2JC 2A6HA 4PAAA 1EFWA 3CAGA 1IW7A 4A3MC 1I3QA 4BXXK 4QJVA 4GTBA 2JA5C 4GTAA 3A8KA 4XLPA 3S16K 3RZDC 2JA6K 3GTOA 4BKWA 4A3EK 3S14K 3N0CA 2PHCB 3GTGA 4XCHA 5TMFA 2WAQL 4XSXA 4BLBA 1G51A 1TWFC 2GSNA 1Y1VA 4WJ4A 1I50K 2P5MA 1DCPA 4KB2A 2R7ZA 4OIOA 3PO2C 4LK0A 1TWCK 5JFEA 2O5IA 1IQ0A 4BY1C 2JA6A 1Y1WK 2B63A 1J6WA 1XZQA 2CFAA 2NVXC 4A3GK 4O2DA 4A3BC 5C44K 4MEYA 3AQPA 1O29A 4QIWD 4GTEA 3HXAA 4WJ3M 3RZDK 3GTQK 4BBRK 3L4KA 2A6EA 5D4DA 5FLMC 1F7UA 2E2HC 3IPJA 3T02A 4C3IK 1R9TA 3FKIA 2E2IC 1WSVA 2V6SA 5CHPA 4BY7K 4A93C 1XXAA 1B4BA 3BUEA 4AH6A 2VUMK 3PO3C 4KMHA 4GT9A 2YU9K 1EQRA 3HOVK 1K83C 3K7AK 4C2MC 2NVQC 3M3YC 4A3CC 4NOIA 2JA5A 3HKZL 2D6FC 3I4MC 4GZYA 4OIRA 1TWAK 1PJ5A 2WB1D 3CQZK 3T00A 4X6AC 2NVXK 4KMUA 3QX3A 1I6HK 4GTFA 4A3BK 1YCLA 4P5AA 1O25A 2XCQA 2ZUFA 4A3IK 1B4AA 1TWFA 4BXXC 4KB4A 5FLMK 2E2HK 4A3KK 3S16C 2E2IK 3OREA 4LQYA 3S14C 4KM9A 5IP9C 4FM9A 4C2MK 2PPBA 1DD5A 1F93A 1TWGC 1IL2A 3BP3A 5M5XK 3OEPA 2RGRA 2NVTC 1XXCA 1I50C 4LK1A 2NVYC 1O24A 2ZUEA 4X6AK 3AD9C 4Q4ZA 1IBAA 2E2IA 1EI6A 3GTLK 1Y1WC 4A3GC 1TWHK 3H0GA 2FQOA 2JA8K 5IYDK 3V4GA 5C44C 3GEEA 3HOWK 3N3YA 1K83A 5IOSA 4G7OA 1XZPA 4GTDA 1EH1A 3GTQC 4BBRC 4KDDA 1BDFA 3GTMK 4Y52C 4C3IC 2FQTA 1WOOA 2V6UA 4KASA 5IP9K 3GEHA 5IOQA 4MEXA 4BY7C 4LOWA 2JA7K 2VUMC 1GE9A 5IYBK 3S2DK 1TWGK 4QIWL 2YU9C 1J6XA 3HOVC 4KATA 3K7AC 2NVTK 2CFAB 2PMZL 2NVYK 2V6TA 1O2FB 3GIRA 3S17C 4JK1A 4LR2A 4LJZA 3AQOA 3TFHA 4DDQA 1TWAC 3AD8C 3CQZC 4P9SA 4BLAA 3S1RK 3LPXA 1JVIA 3S15K 4A3JK 5IOTA 1YX2A 1I6HC 2O5JA 2GAGC 4Q5SA 3GEIA 1XPPA 2JH3A 2PMZD 1INNA 4A3IC 1TWGA 4C3JK 5IP7K 4A3KC 4Y52K 3H3VL 1I50A 1JOEA 3S2HK 2WB1L 3LAJA 1XXBA 4MQ9A 4C3HC 3FHZA 5IYCK 1F9NA 1TWCA 2Y0SL 3M4OK 1V5VA 4A3FK 4M1XA 4OIQA 1Y1WA 4G0WA 1VRQC 3S1QK 3S17K 3EQLA 1WCMK 3AD7C 1IE0A 3HOXK 3BP8C 1WQHA 3H3VD 5E68A 1KQ4A 3GTQA 3GTPK 1SFOK 1HQMA 1O2BA 2GSUA 5TJ3A 1ISEA 2Y0SD 2R93K 3GTLC 1TWHC 3I4NC 5M3FK 2VUMA 5IYDC 2JA8C 3GTOC 2YU9A 3HOWC 3SZYA 5IORA 4GTCA 1DCHA 4WILA 3LAPA 3GTKK 4C3HK 3GTMC 3HOZK 1ZYRA 2RH6A 4KN7A 1TWAA 4YFXA 3GTJK 3CQZA 4ZH4A 1UV7A 2Y3PA 2JA7C 5CJ9A 2NVXA 4LLGA 5IYBC 3S2DC 1C0AA 3GDZA 4KM8A 3OPFA 4QJVB 5C4JK 1VH2A 4GFQA 5L46A 2E2HA 1L0WA 2XCRB 3FOEA 1YNJA 4KAWX 3TTGA 1I3QK 1WIHA 2EBBA 5C4XK 1RU0A 5EGHA 1O28A 3S1RC 3S15C 1BS2A 4A3JC 3A8IA 3I4NK 3GTOK 2P8TA 3GTGK 4A3DC 4KMAA 4C3JC 5IP7C 3S2HC 4ILDA 1PJ6A 1X31C 1Y1VK 4AYBL 1EK8A 3ERED 1J98A 5C3EC 5IYCC 2R7ZK 3RZOK 3M4OC 4KC6A 3T01A 4A3FC 5M3MK 3GTLA 2R92C 1XZQB 4J3NA 5HL8A 1TWHA 3S1QC 1PJ7A 1WCMC 1WSRA 4A3LK 2XCOA 3A8JA 3HOXC 2B63K 4G7ZA 3DXJA 1YNNA 3GTPC 3G4AA
chains in the Genus database with same CATH topology
4AYBD 1SFOC 3S1MK 5FLMK 2E2HK 4OIQA 4A3KK 3S16C 5M5WK 2E2IK 2PA8L 3S1QK 1TWCC 3S17K 3EQLA 1WCMK 2E2JC 2R93C 2A6HA 3S14C 3HOXK 3HOUK 1R9TK 3FKIK 4A3DK 1IW7A 3H3VD 4YFNA 3GTPK 5IP9C 4A3MC 4BXXK 1SFOK 4QJVA 2JA5C 4C2MK 1HQMA 4XLPA 3S16K 3S1NC 3RZDC 2PPBA 2JA6K 1TWGC 2Y0SD 4Y7NC 2WAQD 2E2JK 3GTKC 4A3EK 3S14K 2R93K 5C3EK 5M5XK 3GTLC 2A68A 2NVTC 3HOZC 1I50C 1TWHC 3I4NC 5M3FK 4LK1A 2PA8D 2NVYC 5TMFA 2WAQL 5IYDC 2JA8C 4A3MK 3GTOC 3GTJC 3HOWC 2JA5K 4XSXA 4X6AK 2R92K 3WODA 5TMCA 4Q4ZA 5M5YK 1TWFC 3GTKK 3GTLK 1Y1WC 4C3HK 3GTMC 3HOZK 4A3GC 1I50K 2A69A 1TWHK 3HOYC 1ZYRA 2JA8K 5IYDK 4KN7A 5C44C 4YFXA 3GTJK 3HOWK 4BBSC 4G7OA 4ZH4A 5C4JC 4OIOA 3PO2C 2JA7C 4LK0A 4LLGA 3H0GC 1TWCK 1TWFK 3GTQC 4BBRC 5IYBC 3S2DC 2O5IA 1I3QC 4BY1C 1BDFA 5C4XC 4KN4A 1Y1WK 3GTMK 4OIPA 4A3GK 2NVXC 4Y52C 5IP9K 5C44K 4MEYA 4A3BC 4QIWD 4QJVB 4MEXA 4XLNA 4OINA 4BY7C 5C4JK 3PO2K 2JA7K 3GTGC 3S1NK 2CW0A 3RZDK 2VUMC 1YNJA 3GTQK 4BBRK 5IYBK 1TWGK 4QIWL 1I3QK 4Y7NK 2YU9C 2A6EA 5C4XK 4BY1K 3HOVC 4YFKA 3S1MC 3K7AC 5D4DA 5FLMC 3S1RC 2E2HC 4A3JC 2NVTK 3S15C 2PMZL 4C3IK 3I4NK 3M4OK 2NVYK 2E2IC 3GTOK 3S17C 1Y1VC 4JK1A 4LJZA 4BY7K 4A93C 3GTGK 2VUMK 3PO3C 2R7ZC 3RZOC 4A3DC 2YU9K 1TWAC 2BE5A 3HOVK 1K83C 3CQZC 3S2DK 3K7AK 3S1RK 5IP7C 3S15K 4A3JK 3HKZD 3HOYK 2NVQC 1SMYA 4XSZA 3S2HC 1I6HC 2JA6C 3M3YC 1Y1VK 2O5JA 4AYBL 4A3CC 4A3LC 4BBSK 4NOIA 4A3EC 4A93K 5C3EC 3HKZL 2B63C 4Q5SA 4A3FK 3PO3K 1XPPA 3H0GK 5FJ8K 2PMZD 5IYCC 4YG2A 4A3IC 4OIRA 3I4MC 2R7ZK 1TWAK 3RZOK 3M4OC 2WB1D 1K83K 3CQZK 4A3FC 5M3MK 4GZYA 4C3JK 5IP7K 4X6AC 2NVXK 4A3KC 2R92C 4Y52K 4KMUA 2NVQK 3H3VL 3S2HK 1I6HK 3M3YK 4A3BK 2WB1L 1I6VA 3S1QC 4A3CK 1WCMC 4A3LK 3HOXC 2B63K 4G7ZA 3HOUC 4MQ9A 3DXJA 1R9TC 3FKIC 5IYCK 4A3IK 3I4MK 1YNNA 2Y0SL 3GTPC 4G7HA 4BXXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB D;  1SFO C;  3S1M K;  5FLM K;  2E2H K;  4OIQ A;  4A3K K;  3S16 C;  5M5W K;  2E2I K;  2PA8 L;  3S1Q K;  1TWC C;  3S17 K;  3EQL A;  1WCM K;  2E2J C;  2R93 C;  2A6H A;  3S14 C;  3HOX K;  3HOU K;  1R9T K;  3FKI K;  4A3D K;  1IW7 A;  3H3V D;  4YFN A;  3GTP K;  5IP9 C;  4A3M C;  4BXX K;  1SFO K;  4QJV A;  2JA5 C;  4C2M K;  1HQM A;  4XLP A;  3S16 K;  3S1N C;  3RZD C;  2PPB A;  2JA6 K;  1TWG C;  2Y0S D;  4Y7N C;  2WAQ D;  2E2J K;  3GTK C;  4A3E K;  3S14 K;  2R93 K;  5C3E K;  5M5X K;  3GTL C;  2A68 A;  2NVT C;  3HOZ C;  1I50 C;  1TWH C;  3I4N C;  5M3F K;  4LK1 A;  2PA8 D;  2NVY C;  5TMF A;  2WAQ L;  5IYD C;  2JA8 C;  4A3M K;  3GTO C;  3GTJ C;  3HOW C;  2JA5 K;  4XSX A;  4X6A K;  2R92 K;  3WOD A;  5TMC A;  4Q4Z A;  5M5Y K;  1TWF C;  3GTK K;  3GTL K;  1Y1W C;  4C3H K;  3GTM C;  3HOZ K;  4A3G C;  1I50 K;  2A69 A;  1TWH K;  3HOY C;  1ZYR A;  2JA8 K;  5IYD K;  4KN7 A;  5C44 C;  4YFX A;  3GTJ K;  3HOW K;  4BBS C;  4G7O A;  4ZH4 A;  5C4J C;  4OIO A;  3PO2 C;  2JA7 C;  4LK0 A;  4LLG A;  3H0G C;  1TWC K;  1TWF K;  3GTQ C;  4BBR C;  5IYB C;  3S2D C;  2O5I A;  1I3Q C;  4BY1 C;  1BDF A;  5C4X C;  4KN4 A;  1Y1W K;  3GTM K;  4OIP A;  4A3G K;  2NVX C;  4Y52 C;  5IP9 K;  5C44 K;  4MEY A;  4A3B C;  4QIW D;  4QJV B;  4MEX A;  4XLN A;  4OIN A;  4BY7 C;  5C4J K;  3PO2 K;  2JA7 K;  3GTG C;  3S1N K;  2CW0 A;  3RZD K;  2VUM C;  1YNJ A;  3GTQ K;  4BBR K;  5IYB K;  1TWG K;  4QIW L;  1I3Q K;  4Y7N K;  2YU9 C;  2A6E A;  5C4X K;  4BY1 K;  3HOV C;  4YFK A;  3S1M C;  3K7A C;  5D4D A;  5FLM C;  3S1R C;  2E2H C;  4A3J C;  2NVT K;  3S15 C;  2PMZ L;  4C3I K;  3I4N K;  3M4O K;  2NVY K;  2E2I C;  3GTO K;  3S17 C;  1Y1V C;  4JK1 A;  4LJZ A;  4BY7 K;  4A93 C;  3GTG K;  2VUM K;  3PO3 C;  2R7Z C;  3RZO C;  4A3D C;  2YU9 K;  1TWA C;  2BE5 A;  3HOV K;  1K83 C;  3CQZ C;  3S2D K;  3K7A K;  3S1R K;  5IP7 C;  3S15 K;  4A3J K;  3HKZ D;  3HOY K;  2NVQ C;  1SMY A;  4XSZ A;  3S2H C;  1I6H C;  2JA6 C;  3M3Y C;  1Y1V K;  2O5J A;  4AYB L;  4A3C C;  4A3L C;  4BBS K;  4NOI A;  4A3E C;  4A93 K;  5C3E C;  3HKZ L;  2B63 C;  4Q5S A;  4A3F K;  3PO3 K;  1XPP A;  3H0G K;  5FJ8 K;  2PMZ D;  5IYC C;  4YG2 A;  4A3I C;  4OIR A;  3I4M C;  2R7Z K;  1TWA K;  3RZO K;  3M4O C;  2WB1 D;  1K83 K;  3CQZ K;  4A3F C;  5M3M K;  4GZY A;  4C3J K;  5IP7 K;  4X6A C;  2NVX K;  4A3K C;  2R92 C;  4Y52 K;  4KMU A;  2NVQ K;  3H3V L;  3S2H K;  1I6H K;  3M3Y K;  4A3B K;  2WB1 L;  1I6V A;  3S1Q C;  4A3C K;  1WCM C;  4A3L K;  3HOX C;  2B63 K;  4G7Z A;  3HOU C;  4MQ9 A;  3DXJ A;  1R9T C;  3FKI C;  5IYC K;  4A3I K;  3I4M K;  1YNN A;  2Y0S L;  3GTP C;  4G7H A;  4BXX C; 
#chains in the Genus database with same CATH topology
 4AYB D;  1SFO C;  3GTM A;  4KMD A;  2PA8 L;  1USM A;  2R93 C;  3HOU K;  1O27 A;  1R9T K;  2JA7 A;  3FKI K;  1VJE A;  2ZFZ A;  4A3D K;  2KWA A;  5JVO A;  4C45 A;  4YFN A;  4G0V A;  3S1N C;  3MML B;  4G0U A;  2NVY A;  1ZXO A;  4Y7N C;  2WAQ D;  2E2J K;  3GTK C;  5C3E K;  5EGE A;  2A68 A;  3HOZ C;  4RMF A;  3FOF A;  2PA8 D;  4A3M K;  3GTJ C;  2JA5 K;  2R92 K;  3WOD A;  5TMC A;  4KAR A;  5M5Y K;  1ZBS A;  1O2A A;  4PAB A;  2A69 A;  3HOY C;  1O26 A;  1BGW A;  1AB4 A;  1VGX A;  4BBS C;  5C4J C;  3H0G C;  1TWF K;  1I3Q C;  1WOP A;  1BJT A;  5C4X C;  4KN4 A;  4OIP A;  2GSO A;  3NUH A;  3G4C A;  4GTL A;  1VLO A;  3VA7 A;  4XLN A;  4OIN A;  3PO2 K;  3GTG C;  3S1N K;  2CW0 A;  2R92 A;  4Y7N K;  4BY1 K;  1USO A;  1WCM A;  4YFK A;  3N0B A;  3S1M C;  1WOS A;  1Y1V C;  3TFJ A;  1ZVU A;  3GTP A;  1SFO A;  3Q3Q A;  2R7Z C;  3RZO C;  1HI9 A;  3SZZ A;  2BE5 A;  4P5B A;  2R93 A;  1DCO A;  4FZB A;  3HKZ D;  3HOY K;  1WQF A;  1SMY A;  4XSZ A;  2JA6 C;  4A3L C;  4BBS K;  3AH5 A;  4A3E C;  4A93 K;  3JST A;  2B63 C;  3S0X A;  1XZP B;  3L4J A;  3PO3 K;  1WOR A;  3H0G K;  5FJ8 K;  4YG2 A;  1IS1 A;  1K83 K;  3GTK A;  3GSI A;  2NVQ K;  3TFI A;  1F7V A;  3M3Y K;  1I6V A;  1ZQ1 C;  4A3C K;  3GTJ A;  3HOU C;  1R9T C;  1JQW A;  3FKI C;  3I4M K;  1WQG A;  4G7H A;  3S1M K;  2GAH C;  3ADA C;  5M5W K;  1J6V A;  1TWC C;  2W7V A;  2E2J C;  2A6H A;  4PAA A;  1EFW A;  3CAG A;  1IW7 A;  4A3M C;  1I3Q A;  4BXX K;  4QJV A;  4GTB A;  2JA5 C;  4GTA A;  3A8K A;  4XLP A;  3S16 K;  3RZD C;  2JA6 K;  3GTO A;  4BKW A;  4A3E K;  3S14 K;  3N0C A;  2PHC B;  3GTG A;  4XCH A;  5TMF A;  2WAQ L;  4XSX A;  4BLB A;  1G51 A;  1TWF C;  2GSN A;  1Y1V A;  4WJ4 A;  1I50 K;  2P5M A;  1DCP A;  4KB2 A;  2R7Z A;  4OIO A;  3PO2 C;  4LK0 A;  1TWC K;  5JFE A;  2O5I A;  1IQ0 A;  4BY1 C;  2JA6 A;  1Y1W K;  2B63 A;  1J6W A;  1XZQ A;  2CFA A;  2NVX C;  4A3G K;  4O2D A;  4A3B C;  5C44 K;  4MEY A;  3AQP A;  1O29 A;  4QIW D;  4GTE A;  3HXA A;  4WJ3 M;  3RZD K;  3GTQ K;  4BBR K;  3L4K A;  2A6E A;  5D4D A;  5FLM C;  1F7U A;  2E2H C;  3IPJ A;  3T02 A;  4C3I K;  1R9T A;  3FKI A;  2E2I C;  1WSV A;  2V6S A;  5CHP A;  4BY7 K;  4A93 C;  1XXA A;  1B4B A;  3BUE A;  4AH6 A;  2VUM K;  3PO3 C;  4KMH A;  4GT9 A;  2YU9 K;  1EQR A;  3HOV K;  1K83 C;  3K7A K;  4C2M C;  2NVQ C;  3M3Y C;  4A3C C;  4NOI A;  2JA5 A;  3HKZ L;  2D6F C;  3I4M C;  4GZY A;  4OIR A;  1TWA K;  1PJ5 A;  2WB1 D;  3CQZ K;  3T00 A;  4X6A C;  2NVX K;  4KMU A;  3QX3 A;  1I6H K;  4GTF A;  4A3B K;  1YCL A;  4P5A A;  1O25 A;  2XCQ A;  2ZUF A;  4A3I K;  1B4A A;  1TWF A;  4BXX C;  4KB4 A;  5FLM K;  2E2H K;  4A3K K;  3S16 C;  2E2I K;  3ORE A;  4LQY A;  3S14 C;  4KM9 A;  5IP9 C;  4FM9 A;  4C2M K;  2PPB A;  1DD5 A;  1F93 A;  1TWG C;  1IL2 A;  3BP3 A;  5M5X K;  3OEP A;  2RGR A;  2NVT C;  1XXC A;  1I50 C;  4LK1 A;  2NVY C;  1O24 A;  2ZUE A;  4X6A K;  3AD9 C;  4Q4Z A;  1IBA A;  2E2I A;  1EI6 A;  3GTL K;  1Y1W C;  4A3G C;  1TWH K;  3H0G A;  2FQO A;  2JA8 K;  5IYD K;  3V4G A;  5C44 C;  3GEE A;  3HOW K;  3N3Y A;  1K83 A;  5IOS A;  4G7O A;  1XZP A;  4GTD A;  1EH1 A;  3GTQ C;  4BBR C;  4KDD A;  1BDF A;  3GTM K;  4Y52 C;  4C3I C;  2FQT A;  1WOO A;  2V6U A;  4KAS A;  5IP9 K;  3GEH A;  5IOQ A;  4MEX A;  4BY7 C;  4LOW A;  2JA7 K;  2VUM C;  1GE9 A;  5IYB K;  3S2D K;  1TWG K;  4QIW L;  2YU9 C;  1J6X A;  3HOV C;  4KAT A;  3K7A C;  2NVT K;  2CFA B;  2PMZ L;  2NVY K;  2V6T A;  1O2F B;  3GIR A;  3S17 C;  4JK1 A;  4LR2 A;  4LJZ A;  3AQO A;  3TFH A;  4DDQ A;  1TWA C;  3AD8 C;  3CQZ C;  4P9S A;  4BLA A;  3S1R K;  3LPX A;  1JVI A;  3S15 K;  4A3J K;  5IOT A;  1YX2 A;  1I6H C;  2O5J A;  2GAG C;  4Q5S A;  3GEI A;  1XPP A;  2JH3 A;  2PMZ D;  1INN A;  4A3I C;  1TWG A;  4C3J K;  5IP7 K;  4A3K C;  4Y52 K;  3H3V L;  1I50 A;  1JOE A;  3S2H K;  2WB1 L;  3LAJ A;  1XXB A;  4MQ9 A;  4C3H C;  3FHZ A;  5IYC K;  1F9N A;  1TWC A;  2Y0S L;  3M4O K;  1V5V A;  4A3F K;  4M1X A;  4OIQ A;  1Y1W A;  4G0W A;  1VRQ C;  3S1Q K;  3S17 K;  3EQL A;  1WCM K;  3AD7 C;  1IE0 A;  3HOX K;  3BP8 C;  1WQH A;  3H3V D;  5E68 A;  1KQ4 A;  3GTQ A;  3GTP K;  1SFO K;  1HQM A;  1O2B A;  2GSU A;  5TJ3 A;  1ISE A;  2Y0S D;  2R93 K;  3GTL C;  1TWH C;  3I4N C;  5M3F K;  2VUM A;  5IYD C;  2JA8 C;  3GTO C;  2YU9 A;  3HOW C;  3SZY A;  5IOR A;  4GTC A;  1DCH A;  4WIL A;  3LAP A;  3GTK K;  4C3H K;  3GTM C;  3HOZ K;  1ZYR A;  2RH6 A;  4KN7 A;  1TWA A;  4YFX A;  3GTJ K;  3CQZ A;  4ZH4 A;  1UV7 A;  2Y3P A;  2JA7 C;  5CJ9 A;  2NVX A;  4LLG A;  5IYB C;  3S2D C;  1C0A A;  3GDZ A;  4KM8 A;  3OPF A;  4QJV B;  5C4J K;  1VH2 A;  4GFQ A;  5L46 A;  2E2H A;  1L0W A;  2XCR B;  3FOE A;  1YNJ A;  4KAW X;  3TTG A;  1I3Q K;  1WIH A;  2EBB A;  5C4X K;  1RU0 A;  5EGH A;  1O28 A;  3S1R C;  3S15 C;  1BS2 A;  4A3J C;  3A8I A;  3I4N K;  3GTO K;  2P8T A;  3GTG K;  4A3D C;  4KMA A;  4C3J C;  5IP7 C;  3S2H C;  4ILD A;  1PJ6 A;  1X31 C;  1Y1V K;  4AYB L;  1EK8 A;  3ERE D;  1J98 A;  5C3E C;  5IYC C;  2R7Z K;  3RZO K;  3M4O C;  4KC6 A;  3T01 A;  4A3F C;  5M3M K;  3GTL A;  2R92 C;  1XZQ B;  4J3N A;  5HL8 A;  1TWH A;  3S1Q C;  1PJ7 A;  1WCM C;  1WSR A;  4A3L K;  2XCO A;  3A8J A;  3HOX C;  2B63 K;  4G7Z A;  3DXJ A;  1YNN A;  3GTP C;  3G4A A; 
#chains in the Genus database with same CATH homology
 4AYB D;  1SFO C;  3S1M K;  5FLM K;  2E2H K;  4OIQ A;  4A3K K;  3S16 C;  5M5W K;  2E2I K;  2PA8 L;  3S1Q K;  1TWC C;  3S17 K;  3EQL A;  1WCM K;  2E2J C;  2R93 C;  2A6H A;  3S14 C;  3HOX K;  3HOU K;  1R9T K;  3FKI K;  4A3D K;  1IW7 A;  3H3V D;  4YFN A;  3GTP K;  5IP9 C;  4A3M C;  4BXX K;  1SFO K;  4QJV A;  2JA5 C;  4C2M K;  1HQM A;  4XLP A;  3S16 K;  3S1N C;  3RZD C;  2PPB A;  2JA6 K;  1TWG C;  2Y0S D;  4Y7N C;  2WAQ D;  2E2J K;  3GTK C;  4A3E K;  3S14 K;  2R93 K;  5C3E K;  5M5X K;  3GTL C;  2A68 A;  2NVT C;  3HOZ C;  1I50 C;  1TWH C;  3I4N C;  5M3F K;  4LK1 A;  2PA8 D;  2NVY C;  5TMF A;  2WAQ L;  5IYD C;  2JA8 C;  4A3M K;  3GTO C;  3GTJ C;  3HOW C;  2JA5 K;  4XSX A;  4X6A K;  2R92 K;  3WOD A;  5TMC A;  4Q4Z A;  5M5Y K;  1TWF C;  3GTK K;  3GTL K;  1Y1W C;  4C3H K;  3GTM C;  3HOZ K;  4A3G C;  1I50 K;  2A69 A;  1TWH K;  3HOY C;  1ZYR A;  2JA8 K;  5IYD K;  4KN7 A;  5C44 C;  4YFX A;  3GTJ K;  3HOW K;  4BBS C;  4G7O A;  4ZH4 A;  5C4J C;  4OIO A;  3PO2 C;  2JA7 C;  4LK0 A;  4LLG A;  3H0G C;  1TWC K;  1TWF K;  3GTQ C;  4BBR C;  5IYB C;  3S2D C;  2O5I A;  1I3Q C;  4BY1 C;  1BDF A;  5C4X C;  4KN4 A;  1Y1W K;  3GTM K;  4OIP A;  4A3G K;  2NVX C;  4Y52 C;  5IP9 K;  5C44 K;  4MEY A;  4A3B C;  4QIW D;  4QJV B;  4MEX A;  4XLN A;  4OIN A;  4BY7 C;  5C4J K;  3PO2 K;  2JA7 K;  3GTG C;  3S1N K;  2CW0 A;  3RZD K;  2VUM C;  1YNJ A;  3GTQ K;  4BBR K;  5IYB K;  1TWG K;  4QIW L;  1I3Q K;  4Y7N K;  2YU9 C;  2A6E A;  5C4X K;  4BY1 K;  3HOV C;  4YFK A;  3S1M C;  3K7A C;  5D4D A;  5FLM C;  3S1R C;  2E2H C;  4A3J C;  2NVT K;  3S15 C;  2PMZ L;  4C3I K;  3I4N K;  3M4O K;  2NVY K;  2E2I C;  3GTO K;  3S17 C;  1Y1V C;  4JK1 A;  4LJZ A;  4BY7 K;  4A93 C;  3GTG K;  2VUM K;  3PO3 C;  2R7Z C;  3RZO C;  4A3D C;  2YU9 K;  1TWA C;  2BE5 A;  3HOV K;  1K83 C;  3CQZ C;  3S2D K;  3K7A K;  3S1R K;  5IP7 C;  3S15 K;  4A3J K;  3HKZ D;  3HOY K;  2NVQ C;  1SMY A;  4XSZ A;  3S2H C;  1I6H C;  2JA6 C;  3M3Y C;  1Y1V K;  2O5J A;  4AYB L;  4A3C C;  4A3L C;  4BBS K;  4NOI A;  4A3E C;  4A93 K;  5C3E C;  3HKZ L;  2B63 C;  4Q5S A;  4A3F K;  3PO3 K;  1XPP A;  3H0G K;  5FJ8 K;  2PMZ D;  5IYC C;  4YG2 A;  4A3I C;  4OIR A;  3I4M C;  2R7Z K;  1TWA K;  3RZO K;  3M4O C;  2WB1 D;  1K83 K;  3CQZ K;  4A3F C;  5M3M K;  4GZY A;  4C3J K;  5IP7 K;  4X6A C;  2NVX K;  4A3K C;  2R92 C;  4Y52 K;  4KMU A;  2NVQ K;  3H3V L;  3S2H K;  1I6H K;  3M3Y K;  4A3B K;  2WB1 L;  1I6V A;  3S1Q C;  4A3C K;  1WCM C;  4A3L K;  3HOX C;  2B63 K;  4G7Z A;  3HOU C;  4MQ9 A;  3DXJ A;  1R9T C;  3FKI C;  5IYC K;  4A3I K;  3I4M K;  1YNN A;  2Y0S L;  3GTP C;  4G7H A;  4BXX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...