3GTKK

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtkK00
1HQMA 1TWCC 5M5WK 4Y7NC 2Y0SL 5C4XC 2NVQC 1TWFK 4QIWL 3CQZC 5C44C 5M3FK 3HOVC 4BBSK 3H0GC 3HOUC 2NVTK 3M3YK 3S1RC 3S1MK 1Y1WC 2YU9K 4A3GK 1I6HC 3K7AC 3FKIK 1WCMK 2R93C 3GTOC 1XPPA 3M4OK 4A3BK 4C3HK 3M3YC 2R92C 3S16C 5C44K 4XLNA 4BBRK 3S2HK 3S2DK 4G7HA 5C3EC 4A3JK 3GTOK 4A3MC 1K83C 1Y1VC 2PA8L 5FLMC 2JA7K 3M4OC 4A3CC 3RZDC 4C3JK 2WAQD 4OIPA 1I6HK 4MEYA 4MQ9A 2E2IK 4KMUA 2VUMK 4A93K 3H0GK 4A3JC 3HOWC 1ZYRA 4Y52K 5FLMK 2JA7C 4QJVB 3S16K 4BBSC 4JK1A 2B63K 3CQZK 3S15C 4LLGA 3HOUK 5IYCC 1TWCK 4OIOA 4Y7NK 3GTQC 4Y52C 3K7AK 4QIWD 4OIRA 3PO3K 1WCMC 3HOZK 4A3IK 2JA8C 4BXXC 3HKZD 3GTPC 4A3FC 3HOYC 2NVYK 4YFNA 4YFXA 4AYBD 4BY7C 4OIQA 2A6HA 3I4MK 3H3VD 2A6EA 3S2DC 1TWFC 4LK1A 1I50C 1IW7A 2PA8D 4A3KK 3GTGC 5IP7K 4A3DC 3S17C 3S1NK 4GZYA 3H3VL 4YG2A 2A69A 2PPBA 2JA6C 3I4NK 4AYBL 2PMZD 3S14K 4A93C 1R9TC 4X6AK 4A3CK 2Y0SD 4C2MK 3HKZL 5IYCK 4A3KC 1Y1WK 2YU9C 4A3GC 4G7OA 3GTJC 1TWAC 3GTLK 5C4JC 2WB1D 5IYDC 2R7ZK 1YNNA 4C3IK 5TMCA 1TWGK 2E2JK 5IP9K 4A3EK 3GTKK 3S14C 3I4NC 4X6AC 3HOXK 2O5JA 3S1QC 1I50K 2NVTC 3GTQK 5FJ8K 5IYBK 2E2HK 3DXJA 3S1NC 1BDFA 1YNJA 3PO2C 1SMYA 2BE5A 3GTMK 3GTPK 2B63C 3EQLA 4A3LK 4Q4ZA 4NOIA 4Q5SA 3I4MC 2NVXK 4XSZA 2E2HC 3PO3C 1SFOK 4KN7A 4BY1C 2R7ZC 3GTGK 5IP7C 4A3DK 1I3QK 1TWGC 5IP9C 4A3EC 3GTKC 3S2HC 5C4XK 5IYDK 4QJVA 5C3EK 2PMZL 4KN4A 4OINA 2JA5K 1TWHK 2VUMC 3S1QK 2NVYC 5M5XK 4MEXA 1TWAK 3GTLC 3S17K 3HOXC 3FKIC 4XLPA 2JA6K 2R93K 1R9TK 2CW0A 1TWHC 3S1RK 4LJZA 1K83K 1Y1VK 3RZOK 3S1MC 2O5IA 4A3LC 4BBRC 2A68A 3GTJK 3GTMC 2NVQK 2WAQL 5C4JK 2JA5C 3PO2K 4LK0A 4A3MK 3HOVK 4A3IC 2JA8K 4BXXK 4BY1K 4ZH4A 3RZOC 5IYBC 3HOWK 1I6VA 4XSXA 2R92K 1I3QC 4BY7K 3WODA 2NVXC 4YFKA 2E2IC 5M5YK 5M3MK 3HOZC 2WB1L 5TMFA 4A3FK 1SFOC 3HOYK 3S15K 5D4DA 4A3BC 3RZDK 2E2JC 4G7ZA
chains in the Genus database with same CATH superfamily
1PJ7A 1USOA 5C4XC 4QIWL 5C44C 3H0GC 1VRQC 2YU9K 3K7AC 1F9NA 4GT9A 4PAAA 3GTOC 4A3BK 2GSUA 2R92C 5C44K 3S2DK 4A3MC 1GE9A 4A3CC 4C3JK 3GTGA 2WAQD 1HI9A 4P5AA 4KM9A 1WQGA 4MQ9A 1BJTA 4Y52K 3S16K 4BBSC 3OEPA 5TJ3A 4PABA 5IYCC 3A8KA 4OIOA 1XZPA 4C45A 1WCMC 3HOZK 2E2IA 3L4JA 3GTPA 4KMAA 1B4AA 2NVYK 4YFNA 4XCHA 4OIQA 2A6HA 1I50C 2NVYA 4A3KK 1XXAA 3GTGC 2CFAB 3S17C 3S1NK 3LAJA 2A69A 1YCLA 1O2AA 4A93C 4KB2A 2R7ZA 3G4CA 4A3GC 4A3KC 3GTLK 2WB1D 3N0BA 4GTFA 1BGWA 3HOXK 2O5JA 2NVTC 5CJ9A 1BDFA 3PO2C 1DD5A 3AQOA 1XXBA 4Q5SA 2E2HA 3GSIA 3HXAA 2JA6A 4BY1C 3TFJA 4GTAA 3S2HC 1TWFA 4KN4A 4OINA 2VUMC 3S1QK 1UV7A 2P8TA 3GTLA 4MEXA 3GTLC 4WJ3M 2D6FC 2YU9A 1XZPB 5IOTA 4BBRC 4RMFA 1JQWA 2WAQL 2JA5C 4BXXK 4BY1K 2GAGC 5IYBC 3GIRA 4LOWA 2V6SA 2E2IC 5M5YK 3HOYK 1PJ5A 3RZDK 1ZQ1C 4GTEA 4DDQA 4G7ZA 1TWCC 4Y7NC 1EFWA 2NVQC 3CQZC 3FOEA 1F7VA 3S1RC 3S1MK 1Y1WA 3GEIA 3GEHA 1I6HC 1J98A 1WCMK 2R93C 1XPPA 1IL2A 5EGHA 1O28A 4BBRK 1WQHA 2FQTA 4A3JK 5FLMC 1EH1A 2JA7K 3RZDC 4C3HC 1I6HK 4OIPA 1O25A 4GTLA 4GTDA 4A3JC 3HOWC 3Q3QA 4ILDA 2B63K 1EK8A 1DCOA 1WSRA 1WORA 4LLGA 5IORA 3GTQA 5E68A 3PO3K 3BP8C 4FZBA 3HOYC 4YFXA 4BY7C 1VLOA 1IW7A 2V6TA 2VUMA 4GZYA 1DCHA 4X6AK 2JA6C 4KARA 1R9TA 1JVIA 1O2BA 2Y0SD 1WOOA 4C2MK 1Y1WK 3GTJC 1TWAC 3LAPA 1L0WA 5IYDC 2R7ZK 1O24A 4KMDA 4C3IK 3BUEA 1Y1VA 4M1XA 3GTKK 3S14C 3I4NC 1WQFA 3IPJA 3GTQK 4GTBA 1SMYA 1WOSA 4GTCA 2B63C 3EQLA 5IOSA 4NOIA 4WJ4A 1SFOK 3CAGA 3SZZA 2R7ZC 1EQRA 1I3QK 1IE0A 3S0XA 2R92A 4A3EC 2PMZL 3ERED 1TWHK 2NVYC 5JVOA 3OREA 1WIHA 1C0AA 3FKIC 3NUHA 4LQYA 2JA6K 2R93K 4C3IC 3GTOA 1R9TK 3TTGA 2CFAA 1TWAA 2A68A 3GTJK 5C4JK 1WOPA 4A3MK 3RZOC 2R92K 1I3QC 2NVXC 3L4KA 4YFKA 1JOEA 5M3MK 1SFOC 4A3BC 5D4DA 5M5WK 2Y0SL 1TWFK 3V4GA 2NVTK 1IQ0A 1Y1WC 3AD7C 3QX3A 3AQPA 5HL8A 1F7UA 2XCQA 1WSVA 2W7VA 3GTKA 3VA7A 3S16C 3TFHA 3MMLB 3GTOK 1K83C 4BLBA 2E2IK 2GSOA 4KMUA 2VUMK 3H0GK 4BLAA 1AB4A 1VGXA 3GTMA 1G51A 4JK1A 1XZQB 3OPFA 3S15C 4KAWX 3GDZA 4Y52C 4BXXC 3HKZD 4KB4A 1IBAA 1TWFC 1PJ6A 2B63A 4G0VA 2GAHC 5IP7K 4A3DC 1VH2A 2ZUEA 3H3VL 4AYBL 2PMZD 4A3CK 5IYCK 2PHCB 3TFIA 2JA5A 5TMCA 1K83A 5IP9K 1O29A 1ZXOA 1V5VA 1I50K 1X31C 3S1QC 3A8IA 1XXCA 1XZQA 5IYBK 2E2HK 3DXJA 1O27A 3S1NC 1YNJA 3GTMK 3ADAC 4Q4ZA 3BP3A 1J6XA 4XSZA 5CHPA 2Y3PA 2E2HC 4LR2A 4KN7A 3SZYA 3GTGK 5IP7C 4A3DK 4C3JC 5IP9C 5C4XK 5IYDK 5C3EK 3FOFA 2JA5K 5M5XK 1DCPA 3T00A 3S17K 4FM9A 3G4AA 4KDDA 4LJZA 1Y1VK 4GFQA 4O2DA 3S1RK 3S1MC 1F93A 2NVQK 3PO2K 4LK0A 3HOVK 3T01A 2GSNA 3HOWK 1I6VA 4XSXA 1RU0A 1KQ4A 4AH6A 2WB1L 5TMFA 4A3FK 1BS2A 2XCOA 2E2JC 1HQMA 5M3FK 3HOVC 4BBSK 3HOUC 1I50A 1J6WA 3M3YK 4A3GK 3FKIK 3LPXA 4G0WA 3M4OK 3FHZA 1YX2A 4C3HK 3M3YC 3GEEA 4XLNA 3S2HK 3T02A 4G7HA 5C3EC 3M4OC 1Y1VC 2PA8L 4MEYA 2KWAA 1B4BA 4P9SA 4A93K 1ZYRA 2JA7A 5FLMK 2JA7C 4QJVB 1J6VA 3N0CA 3CQZK 1ZVUA 3HOUK 1TWCK 4Y7NK 3GTQC 3K7AK 4QIWD 4J3NA 4OIRA 2FQOA 4P5BA 4A3IK 2JA8C 1INNA 1VJEA 4A3FC 3GTPC 1O26A 1TWGA 4AYBD 3I4MK 3H3VD 2A6EA 2XCRB 3S2DC 4LK1A 3H0GA 4G0UA 2PA8D 2RGRA 4BKWA 1ISEA 4YG2A 2PPBA 3N3YA 3I4NK 3S14K 2RH6A 3FKIA 1R9TC 3HKZL 2YU9C 4G7OA 2EBBA 5C4JC 5JFEA 5IOQA 3JSTA 1YNNA 1TWGK 2V6UA 2E2JK 4A3EK 4X6AC 2JH3A 1SFOA 3AD8C 5FJ8K 1TWCA 1IS1A 3CQZA 2BE5A 3GTPK 4A3LK 4C2MC 4KM8A 3I4MC 2NVXK 1WCMA 2ZUFA 3PO3C 5EGEA 3AH5A 1TWGC 3GTJA 3GTKC 2ZFZA 4QJVA 1TWAK 3HOXC 4XLPA 2R93A 3A8JA 1TWHA 2CW0A 1TWHC 3RZOK 4KC6A 1K83K 4KATA 1EI6A 2O5IA 4A3LC 4WILA 1ZBSA 1USMA 3GTMC 2P5MA 4A3IC 2JA8K 4KASA 4ZH4A 5L46A 2NVXA 1I3QA 3WODA 4BY7K 1O2FB 3HOZC 3AD9C 3S15K 4KMHA
chains in the Genus database with same CATH topology
1HQMA 1TWCC 5M5WK 4Y7NC 2Y0SL 5C4XC 2NVQC 1TWFK 4QIWL 3CQZC 5C44C 5M3FK 3HOVC 4BBSK 3H0GC 3HOUC 2NVTK 3M3YK 3S1RC 3S1MK 1Y1WC 2YU9K 4A3GK 1I6HC 3K7AC 3FKIK 1WCMK 2R93C 3GTOC 1XPPA 3M4OK 4A3BK 4C3HK 3M3YC 2R92C 3S16C 5C44K 4XLNA 4BBRK 3S2HK 3S2DK 4G7HA 5C3EC 4A3JK 3GTOK 4A3MC 1K83C 1Y1VC 2PA8L 5FLMC 2JA7K 3M4OC 4A3CC 3RZDC 4C3JK 2WAQD 4OIPA 1I6HK 4MEYA 4MQ9A 2E2IK 4KMUA 2VUMK 4A93K 3H0GK 4A3JC 3HOWC 1ZYRA 4Y52K 5FLMK 2JA7C 4QJVB 3S16K 4BBSC 4JK1A 2B63K 3CQZK 3S15C 4LLGA 3HOUK 5IYCC 1TWCK 4OIOA 4Y7NK 3GTQC 4Y52C 3K7AK 4QIWD 4OIRA 3PO3K 1WCMC 3HOZK 4A3IK 2JA8C 4BXXC 3HKZD 3GTPC 4A3FC 3HOYC 2NVYK 4YFNA 4YFXA 4AYBD 4BY7C 4OIQA 2A6HA 3I4MK 3H3VD 2A6EA 3S2DC 1TWFC 4LK1A 1I50C 1IW7A 2PA8D 4A3KK 3GTGC 5IP7K 4A3DC 3S17C 3S1NK 4GZYA 3H3VL 4YG2A 2A69A 2PPBA 2JA6C 3I4NK 4AYBL 2PMZD 3S14K 4A93C 1R9TC 4X6AK 4A3CK 2Y0SD 4C2MK 3HKZL 5IYCK 4A3KC 1Y1WK 2YU9C 4A3GC 4G7OA 3GTJC 1TWAC 3GTLK 5C4JC 2WB1D 5IYDC 2R7ZK 1YNNA 4C3IK 5TMCA 1TWGK 2E2JK 5IP9K 4A3EK 3GTKK 3S14C 3I4NC 4X6AC 3HOXK 2O5JA 3S1QC 1I50K 2NVTC 3GTQK 5FJ8K 5IYBK 2E2HK 3DXJA 3S1NC 1BDFA 1YNJA 3PO2C 1SMYA 2BE5A 3GTMK 3GTPK 2B63C 3EQLA 4A3LK 4Q4ZA 4NOIA 4Q5SA 3I4MC 2NVXK 4XSZA 2E2HC 3PO3C 1SFOK 4KN7A 4BY1C 2R7ZC 3GTGK 5IP7C 4A3DK 1I3QK 1TWGC 5IP9C 4A3EC 3GTKC 3S2HC 5C4XK 5IYDK 4QJVA 5C3EK 2PMZL 4KN4A 4OINA 2JA5K 1TWHK 2VUMC 3S1QK 2NVYC 5M5XK 4MEXA 1TWAK 3GTLC 3S17K 3HOXC 3FKIC 4XLPA 2JA6K 2R93K 1R9TK 2CW0A 1TWHC 3S1RK 4LJZA 1K83K 1Y1VK 3RZOK 3S1MC 2O5IA 4A3LC 4BBRC 2A68A 3GTJK 3GTMC 2NVQK 2WAQL 5C4JK 2JA5C 3PO2K 4LK0A 4A3MK 3HOVK 4A3IC 2JA8K 4BXXK 4BY1K 4ZH4A 3RZOC 5IYBC 3HOWK 1I6VA 4XSXA 2R92K 1I3QC 4BY7K 3WODA 2NVXC 4YFKA 2E2IC 5M5YK 5M3MK 3HOZC 2WB1L 5TMFA 4A3FK 1SFOC 3HOYK 3S15K 5D4DA 4A3BC 3RZDK 2E2JC 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  1TWC C;  5M5W K;  4Y7N C;  2Y0S L;  5C4X C;  2NVQ C;  1TWF K;  4QIW L;  3CQZ C;  5C44 C;  5M3F K;  3HOV C;  4BBS K;  3H0G C;  3HOU C;  2NVT K;  3M3Y K;  3S1R C;  3S1M K;  1Y1W C;  2YU9 K;  4A3G K;  1I6H C;  3K7A C;  3FKI K;  1WCM K;  2R93 C;  3GTO C;  1XPP A;  3M4O K;  4A3B K;  4C3H K;  3M3Y C;  2R92 C;  3S16 C;  5C44 K;  4XLN A;  4BBR K;  3S2H K;  3S2D K;  4G7H A;  5C3E C;  4A3J K;  3GTO K;  4A3M C;  1K83 C;  1Y1V C;  2PA8 L;  5FLM C;  2JA7 K;  3M4O C;  4A3C C;  3RZD C;  4C3J K;  2WAQ D;  4OIP A;  1I6H K;  4MEY A;  4MQ9 A;  2E2I K;  4KMU A;  2VUM K;  4A93 K;  3H0G K;  4A3J C;  3HOW C;  1ZYR A;  4Y52 K;  5FLM K;  2JA7 C;  4QJV B;  3S16 K;  4BBS C;  4JK1 A;  2B63 K;  3CQZ K;  3S15 C;  4LLG A;  3HOU K;  5IYC C;  1TWC K;  4OIO A;  4Y7N K;  3GTQ C;  4Y52 C;  3K7A K;  4QIW D;  4OIR A;  3PO3 K;  1WCM C;  3HOZ K;  4A3I K;  2JA8 C;  4BXX C;  3HKZ D;  3GTP C;  4A3F C;  3HOY C;  2NVY K;  4YFN A;  4YFX A;  4AYB D;  4BY7 C;  4OIQ A;  2A6H A;  3I4M K;  3H3V D;  2A6E A;  3S2D C;  1TWF C;  4LK1 A;  1I50 C;  1IW7 A;  2PA8 D;  4A3K K;  3GTG C;  5IP7 K;  4A3D C;  3S17 C;  3S1N K;  4GZY A;  3H3V L;  4YG2 A;  2A69 A;  2PPB A;  2JA6 C;  3I4N K;  4AYB L;  2PMZ D;  3S14 K;  4A93 C;  1R9T C;  4X6A K;  4A3C K;  2Y0S D;  4C2M K;  3HKZ L;  5IYC K;  4A3K C;  1Y1W K;  2YU9 C;  4A3G C;  4G7O A;  3GTJ C;  1TWA C;  3GTL K;  5C4J C;  2WB1 D;  5IYD C;  2R7Z K;  1YNN A;  4C3I K;  5TMC A;  1TWG K;  2E2J K;  5IP9 K;  4A3E K;  3GTK K;  3S14 C;  3I4N C;  4X6A C;  3HOX K;  2O5J A;  3S1Q C;  1I50 K;  2NVT C;  3GTQ K;  5FJ8 K;  5IYB K;  2E2H K;  3DXJ A;  3S1N C;  1BDF A;  1YNJ A;  3PO2 C;  1SMY A;  2BE5 A;  3GTM K;  3GTP K;  2B63 C;  3EQL A;  4A3L K;  4Q4Z A;  4NOI A;  4Q5S A;  3I4M C;  2NVX K;  4XSZ A;  2E2H C;  3PO3 C;  1SFO K;  4KN7 A;  4BY1 C;  2R7Z C;  3GTG K;  5IP7 C;  4A3D K;  1I3Q K;  1TWG C;  5IP9 C;  4A3E C;  3GTK C;  3S2H C;  5C4X K;  5IYD K;  4QJV A;  5C3E K;  2PMZ L;  4KN4 A;  4OIN A;  2JA5 K;  1TWH K;  2VUM C;  3S1Q K;  2NVY C;  5M5X K;  4MEX A;  1TWA K;  3GTL C;  3S17 K;  3HOX C;  3FKI C;  4XLP A;  2JA6 K;  2R93 K;  1R9T K;  2CW0 A;  1TWH C;  3S1R K;  4LJZ A;  1K83 K;  1Y1V K;  3RZO K;  3S1M C;  2O5I A;  4A3L C;  4BBR C;  2A68 A;  3GTJ K;  3GTM C;  2NVQ K;  2WAQ L;  5C4J K;  2JA5 C;  3PO2 K;  4LK0 A;  4A3M K;  3HOV K;  4A3I C;  2JA8 K;  4BXX K;  4BY1 K;  4ZH4 A;  3RZO C;  5IYB C;  3HOW K;  1I6V A;  4XSX A;  2R92 K;  1I3Q C;  4BY7 K;  3WOD A;  2NVX C;  4YFK A;  2E2I C;  5M5Y K;  5M3M K;  3HOZ C;  2WB1 L;  5TMF A;  4A3F K;  1SFO C;  3HOY K;  3S15 K;  5D4D A;  4A3B C;  3RZD K;  2E2J C;  4G7Z A; 
#chains in the Genus database with same CATH topology
 1PJ7 A;  1USO A;  5C4X C;  4QIW L;  5C44 C;  3H0G C;  1VRQ C;  2YU9 K;  3K7A C;  1F9N A;  4GT9 A;  4PAA A;  3GTO C;  4A3B K;  2GSU A;  2R92 C;  5C44 K;  3S2D K;  4A3M C;  1GE9 A;  4A3C C;  4C3J K;  3GTG A;  2WAQ D;  1HI9 A;  4P5A A;  4KM9 A;  1WQG A;  4MQ9 A;  1BJT A;  4Y52 K;  3S16 K;  4BBS C;  3OEP A;  5TJ3 A;  4PAB A;  5IYC C;  3A8K A;  4OIO A;  1XZP A;  4C45 A;  1WCM C;  3HOZ K;  2E2I A;  3L4J A;  3GTP A;  4KMA A;  1B4A A;  2NVY K;  4YFN A;  4XCH A;  4OIQ A;  2A6H A;  1I50 C;  2NVY A;  4A3K K;  1XXA A;  3GTG C;  2CFA B;  3S17 C;  3S1N K;  3LAJ A;  2A69 A;  1YCL A;  1O2A A;  4A93 C;  4KB2 A;  2R7Z A;  3G4C A;  4A3G C;  4A3K C;  3GTL K;  2WB1 D;  3N0B A;  4GTF A;  1BGW A;  3HOX K;  2O5J A;  2NVT C;  5CJ9 A;  1BDF A;  3PO2 C;  1DD5 A;  3AQO A;  1XXB A;  4Q5S A;  2E2H A;  3GSI A;  3HXA A;  2JA6 A;  4BY1 C;  3TFJ A;  4GTA A;  3S2H C;  1TWF A;  4KN4 A;  4OIN A;  2VUM C;  3S1Q K;  1UV7 A;  2P8T A;  3GTL A;  4MEX A;  3GTL C;  4WJ3 M;  2D6F C;  2YU9 A;  1XZP B;  5IOT A;  4BBR C;  4RMF A;  1JQW A;  2WAQ L;  2JA5 C;  4BXX K;  4BY1 K;  2GAG C;  5IYB C;  3GIR A;  4LOW A;  2V6S A;  2E2I C;  5M5Y K;  3HOY K;  1PJ5 A;  3RZD K;  1ZQ1 C;  4GTE A;  4DDQ A;  4G7Z A;  1TWC C;  4Y7N C;  1EFW A;  2NVQ C;  3CQZ C;  3FOE A;  1F7V A;  3S1R C;  3S1M K;  1Y1W A;  3GEI A;  3GEH A;  1I6H C;  1J98 A;  1WCM K;  2R93 C;  1XPP A;  1IL2 A;  5EGH A;  1O28 A;  4BBR K;  1WQH A;  2FQT A;  4A3J K;  5FLM C;  1EH1 A;  2JA7 K;  3RZD C;  4C3H C;  1I6H K;  4OIP A;  1O25 A;  4GTL A;  4GTD A;  4A3J C;  3HOW C;  3Q3Q A;  4ILD A;  2B63 K;  1EK8 A;  1DCO A;  1WSR A;  1WOR A;  4LLG A;  5IOR A;  3GTQ A;  5E68 A;  3PO3 K;  3BP8 C;  4FZB A;  3HOY C;  4YFX A;  4BY7 C;  1VLO A;  1IW7 A;  2V6T A;  2VUM A;  4GZY A;  1DCH A;  4X6A K;  2JA6 C;  4KAR A;  1R9T A;  1JVI A;  1O2B A;  2Y0S D;  1WOO A;  4C2M K;  1Y1W K;  3GTJ C;  1TWA C;  3LAP A;  1L0W A;  5IYD C;  2R7Z K;  1O24 A;  4KMD A;  4C3I K;  3BUE A;  1Y1V A;  4M1X A;  3GTK K;  3S14 C;  3I4N C;  1WQF A;  3IPJ A;  3GTQ K;  4GTB A;  1SMY A;  1WOS A;  4GTC A;  2B63 C;  3EQL A;  5IOS A;  4NOI A;  4WJ4 A;  1SFO K;  3CAG A;  3SZZ A;  2R7Z C;  1EQR A;  1I3Q K;  1IE0 A;  3S0X A;  2R92 A;  4A3E C;  2PMZ L;  3ERE D;  1TWH K;  2NVY C;  5JVO A;  3ORE A;  1WIH A;  1C0A A;  3FKI C;  3NUH A;  4LQY A;  2JA6 K;  2R93 K;  4C3I C;  3GTO A;  1R9T K;  3TTG A;  2CFA A;  1TWA A;  2A68 A;  3GTJ K;  5C4J K;  1WOP A;  4A3M K;  3RZO C;  2R92 K;  1I3Q C;  2NVX C;  3L4K A;  4YFK A;  1JOE A;  5M3M K;  1SFO C;  4A3B C;  5D4D A;  5M5W K;  2Y0S L;  1TWF K;  3V4G A;  2NVT K;  1IQ0 A;  1Y1W C;  3AD7 C;  3QX3 A;  3AQP A;  5HL8 A;  1F7U A;  2XCQ A;  1WSV A;  2W7V A;  3GTK A;  3VA7 A;  3S16 C;  3TFH A;  3MML B;  3GTO K;  1K83 C;  4BLB A;  2E2I K;  2GSO A;  4KMU A;  2VUM K;  3H0G K;  4BLA A;  1AB4 A;  1VGX A;  3GTM A;  1G51 A;  4JK1 A;  1XZQ B;  3OPF A;  3S15 C;  4KAW X;  3GDZ A;  4Y52 C;  4BXX C;  3HKZ D;  4KB4 A;  1IBA A;  1TWF C;  1PJ6 A;  2B63 A;  4G0V A;  2GAH C;  5IP7 K;  4A3D C;  1VH2 A;  2ZUE A;  3H3V L;  4AYB L;  2PMZ D;  4A3C K;  5IYC K;  2PHC B;  3TFI A;  2JA5 A;  5TMC A;  1K83 A;  5IP9 K;  1O29 A;  1ZXO A;  1V5V A;  1I50 K;  1X31 C;  3S1Q C;  3A8I A;  1XXC A;  1XZQ A;  5IYB K;  2E2H K;  3DXJ A;  1O27 A;  3S1N C;  1YNJ A;  3GTM K;  3ADA C;  4Q4Z A;  3BP3 A;  1J6X A;  4XSZ A;  5CHP A;  2Y3P A;  2E2H C;  4LR2 A;  4KN7 A;  3SZY A;  3GTG K;  5IP7 C;  4A3D K;  4C3J C;  5IP9 C;  5C4X K;  5IYD K;  5C3E K;  3FOF A;  2JA5 K;  5M5X K;  1DCP A;  3T00 A;  3S17 K;  4FM9 A;  3G4A A;  4KDD A;  4LJZ A;  1Y1V K;  4GFQ A;  4O2D A;  3S1R K;  3S1M C;  1F93 A;  2NVQ K;  3PO2 K;  4LK0 A;  3HOV K;  3T01 A;  2GSN A;  3HOW K;  1I6V A;  4XSX A;  1RU0 A;  1KQ4 A;  4AH6 A;  2WB1 L;  5TMF A;  4A3F K;  1BS2 A;  2XCO A;  2E2J C;  1HQM A;  5M3F K;  3HOV C;  4BBS K;  3HOU C;  1I50 A;  1J6W A;  3M3Y K;  4A3G K;  3FKI K;  3LPX A;  4G0W A;  3M4O K;  3FHZ A;  1YX2 A;  4C3H K;  3M3Y C;  3GEE A;  4XLN A;  3S2H K;  3T02 A;  4G7H A;  5C3E C;  3M4O C;  1Y1V C;  2PA8 L;  4MEY A;  2KWA A;  1B4B A;  4P9S A;  4A93 K;  1ZYR A;  2JA7 A;  5FLM K;  2JA7 C;  4QJV B;  1J6V A;  3N0C A;  3CQZ K;  1ZVU A;  3HOU K;  1TWC K;  4Y7N K;  3GTQ C;  3K7A K;  4QIW D;  4J3N A;  4OIR A;  2FQO A;  4P5B A;  4A3I K;  2JA8 C;  1INN A;  1VJE A;  4A3F C;  3GTP C;  1O26 A;  1TWG A;  4AYB D;  3I4M K;  3H3V D;  2A6E A;  2XCR B;  3S2D C;  4LK1 A;  3H0G A;  4G0U A;  2PA8 D;  2RGR A;  4BKW A;  1ISE A;  4YG2 A;  2PPB A;  3N3Y A;  3I4N K;  3S14 K;  2RH6 A;  3FKI A;  1R9T C;  3HKZ L;  2YU9 C;  4G7O A;  2EBB A;  5C4J C;  5JFE A;  5IOQ A;  3JST A;  1YNN A;  1TWG K;  2V6U A;  2E2J K;  4A3E K;  4X6A C;  2JH3 A;  1SFO A;  3AD8 C;  5FJ8 K;  1TWC A;  1IS1 A;  3CQZ A;  2BE5 A;  3GTP K;  4A3L K;  4C2M C;  4KM8 A;  3I4M C;  2NVX K;  1WCM A;  2ZUF A;  3PO3 C;  5EGE A;  3AH5 A;  1TWG C;  3GTJ A;  3GTK C;  2ZFZ A;  4QJV A;  1TWA K;  3HOX C;  4XLP A;  2R93 A;  3A8J A;  1TWH A;  2CW0 A;  1TWH C;  3RZO K;  4KC6 A;  1K83 K;  4KAT A;  1EI6 A;  2O5I A;  4A3L C;  4WIL A;  1ZBS A;  1USM A;  3GTM C;  2P5M A;  4A3I C;  2JA8 K;  4KAS A;  4ZH4 A;  5L46 A;  2NVX A;  1I3Q A;  3WOD A;  4BY7 K;  1O2F B;  3HOZ C;  3AD9 C;  3S15 K;  4KMH A; 
#chains in the Genus database with same CATH homology
 1HQM A;  1TWC C;  5M5W K;  4Y7N C;  2Y0S L;  5C4X C;  2NVQ C;  1TWF K;  4QIW L;  3CQZ C;  5C44 C;  5M3F K;  3HOV C;  4BBS K;  3H0G C;  3HOU C;  2NVT K;  3M3Y K;  3S1R C;  3S1M K;  1Y1W C;  2YU9 K;  4A3G K;  1I6H C;  3K7A C;  3FKI K;  1WCM K;  2R93 C;  3GTO C;  1XPP A;  3M4O K;  4A3B K;  4C3H K;  3M3Y C;  2R92 C;  3S16 C;  5C44 K;  4XLN A;  4BBR K;  3S2H K;  3S2D K;  4G7H A;  5C3E C;  4A3J K;  3GTO K;  4A3M C;  1K83 C;  1Y1V C;  2PA8 L;  5FLM C;  2JA7 K;  3M4O C;  4A3C C;  3RZD C;  4C3J K;  2WAQ D;  4OIP A;  1I6H K;  4MEY A;  4MQ9 A;  2E2I K;  4KMU A;  2VUM K;  4A93 K;  3H0G K;  4A3J C;  3HOW C;  1ZYR A;  4Y52 K;  5FLM K;  2JA7 C;  4QJV B;  3S16 K;  4BBS C;  4JK1 A;  2B63 K;  3CQZ K;  3S15 C;  4LLG A;  3HOU K;  5IYC C;  1TWC K;  4OIO A;  4Y7N K;  3GTQ C;  4Y52 C;  3K7A K;  4QIW D;  4OIR A;  3PO3 K;  1WCM C;  3HOZ K;  4A3I K;  2JA8 C;  4BXX C;  3HKZ D;  3GTP C;  4A3F C;  3HOY C;  2NVY K;  4YFN A;  4YFX A;  4AYB D;  4BY7 C;  4OIQ A;  2A6H A;  3I4M K;  3H3V D;  2A6E A;  3S2D C;  1TWF C;  4LK1 A;  1I50 C;  1IW7 A;  2PA8 D;  4A3K K;  3GTG C;  5IP7 K;  4A3D C;  3S17 C;  3S1N K;  4GZY A;  3H3V L;  4YG2 A;  2A69 A;  2PPB A;  2JA6 C;  3I4N K;  4AYB L;  2PMZ D;  3S14 K;  4A93 C;  1R9T C;  4X6A K;  4A3C K;  2Y0S D;  4C2M K;  3HKZ L;  5IYC K;  4A3K C;  1Y1W K;  2YU9 C;  4A3G C;  4G7O A;  3GTJ C;  1TWA C;  3GTL K;  5C4J C;  2WB1 D;  5IYD C;  2R7Z K;  1YNN A;  4C3I K;  5TMC A;  1TWG K;  2E2J K;  5IP9 K;  4A3E K;  3GTK K;  3S14 C;  3I4N C;  4X6A C;  3HOX K;  2O5J A;  3S1Q C;  1I50 K;  2NVT C;  3GTQ K;  5FJ8 K;  5IYB K;  2E2H K;  3DXJ A;  3S1N C;  1BDF A;  1YNJ A;  3PO2 C;  1SMY A;  2BE5 A;  3GTM K;  3GTP K;  2B63 C;  3EQL A;  4A3L K;  4Q4Z A;  4NOI A;  4Q5S A;  3I4M C;  2NVX K;  4XSZ A;  2E2H C;  3PO3 C;  1SFO K;  4KN7 A;  4BY1 C;  2R7Z C;  3GTG K;  5IP7 C;  4A3D K;  1I3Q K;  1TWG C;  5IP9 C;  4A3E C;  3GTK C;  3S2H C;  5C4X K;  5IYD K;  4QJV A;  5C3E K;  2PMZ L;  4KN4 A;  4OIN A;  2JA5 K;  1TWH K;  2VUM C;  3S1Q K;  2NVY C;  5M5X K;  4MEX A;  1TWA K;  3GTL C;  3S17 K;  3HOX C;  3FKI C;  4XLP A;  2JA6 K;  2R93 K;  1R9T K;  2CW0 A;  1TWH C;  3S1R K;  4LJZ A;  1K83 K;  1Y1V K;  3RZO K;  3S1M C;  2O5I A;  4A3L C;  4BBR C;  2A68 A;  3GTJ K;  3GTM C;  2NVQ K;  2WAQ L;  5C4J K;  2JA5 C;  3PO2 K;  4LK0 A;  4A3M K;  3HOV K;  4A3I C;  2JA8 K;  4BXX K;  4BY1 K;  4ZH4 A;  3RZO C;  5IYB C;  3HOW K;  1I6V A;  4XSX A;  2R92 K;  1I3Q C;  4BY7 K;  3WOD A;  2NVX C;  4YFK A;  2E2I C;  5M5Y K;  5M3M K;  3HOZ C;  2WB1 L;  5TMF A;  4A3F K;  1SFO C;  3HOY K;  3S15 K;  5D4D A;  4A3B C;  3RZD K;  2E2J C;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...