3GTKK

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtkK00
1I50K 4X6AC 3S1QC 4Y52K 3WODA 3S16K 2CW0A 3GTMC 2NVYK 3S1NK 3I4MK 3M3YK 3RZOK 1ZYRA 4A3MC 3K7AC 2A69A 4LK1A 4MEXA 5M3MK 2JA8C 2VUMK 3GTKK 2NVXC 1SMYA 2NVQK 2PMZL 1Y1WK 4YFXA 1TWCK 5IYDC 3HOVK 4BY1K 3HOXC 3S2HC 5C4JK 4Y7NK 3CQZC 4YFNA 3S1RK 3RZDC 3S17K 5M3FK 3GTLC 4C3IK 1K83K 5C3EK 1I3QK 1TWGC 5C44C 1TWAK 3GTQK 3S2DC 2E2JC 3GTOK 4A3CC 5M5XK 4OIOA 4YFKA 4C2MK 4G7ZA 4BBSC 4A3JK 4A3LC 4A3KK 3GTKC 2B63C 3S1MC 1TWHK 2BE5A 5IP7C 4A3FC 1SFOK 2PPBA 3S15C 4A3BC 3HOUK 1YNNA 3HOYC 1I6HK 2YU9K 3HOZK 2R7ZK 3M4OC 3I4NC 4A3GC 2JA7K 4QIWL 3HOWC 3HKZD 4Q5SA 2PA8L 2R92K 3H3VL 2E2HC 1XPPA 5FLMK 4BXXC 4BBRC 1I6VA 4A3IK 4KN7A 3GTPC 4XLNA 5TMFA 2NVTK 3PO2C 5IP9K 1TWFK 2PMZD 5IP9C 4A93C 1I50C 4Y52C 2A68A 4QJVA 3S1NC 3S16C 1WCMK 4ZH4A 2NVYC 3GTJK 3PO3K 3I4MC 1BDFA 5FJ8K 4XSXA 3M3YC 3RZOC 4BY7K 4A3EK 4XLPA 4AYBL 2JA5K 4GZYA 3S14K 1YNJA 2Y0SL 2JA6K 2VUMC 5IYBK 4MQ9A 3GTGK 2NVQC 2WB1L 5FLMC 1Y1WC 5C4XK 3FKIK 1R9TK 2R93K 2O5IA 1TWCC 3HOVC 2WAQL 3H0GK 4BY1C 4NOIA 5C4JC 1HQMA 4Y7NC 3S1RC 3S17C 2E2IK 5IYCK 1Y1VK 1K83C 5C3EC 1I3QC 4LK0A 3GTQC 1TWAC 4A3DK 3GTOC 4X6AK 3S1QK 3GTMK 4A3JC 4QIWD 4A3KC 4A3MK 2PA8D 3K7AK 4MEYA 2JA8K 3H3VD 5C4XC 1TWHC 4Q4ZA 1SFOC 2NVXK 4YG2A 1I6HC 3HOUC 2YU9C 2R7ZC 3HOZC 5M5YK 5D4DA 5IYDK 2JA7C 4LJZA 4OIPA 3HOXK 3S2HK 4KMUA 3CQZK 3RZDK 2R92C 4LLGA 3GTLK 4C3HK 5C44K 1TWGK 4OIRA 3EQLA 2E2JK 3S2DK 4A3CK 4XSZA 4AYBD 5M5WK 4A3IC 2A6EA 4BBSK 4A3LK 2Y0SD 2NVTC 1TWFC 2WB1D 5TMCA 4QJVB 1IW7A 2B63K 3S1MK 4C3JK 1WCMC 5IP7K 3GTJC 2WAQD 4A3FK 3PO3C 3S15K 3HOYK 4A3BK 4G7HA 4BY7C 4A3EC 4KN4A 3M4OK 2JA5C 3I4NK 3S14C 4A3GK 2JA6C 5IYBC 4OINA 2A6HA 3GTGC 3HOWK 4OIQA 3FKIC 1R9TC 4G7OA 2R93C 2E2HK 3H0GC 2O5JA 4BXXK 4BBRK 4A93K 3DXJA 4JK1A 5IYCC 2E2IC 1Y1VC 3GTPK 3PO2K 4A3DC 3HKZL
chains in the Genus database with same CATH superfamily
4KM8A 3I4MK 1EFWA 4GT9A 4A3MC 1YX2A 2JA8C 1C0AA 2NVXC 1IBAA 1SMYA 3MMLB 1Y1WK 1O28A 3GSIA 5IYDC 5C4JK 4Y7NK 3T01A 4DDQA 3RZDC 1TWFA 4C3IK 1K83K 1TWGC 1XXAA 3L4KA 3S2DC 1WCMA 5M5XK 4G7ZA 1TWAA 4C2MK 4A3JK 3L4JA 4P5AA 2B63C 5TJ3A 3S1MC 4A3BC 3S15C 4C45A 1USOA 3I4NC 3HKZD 3T00A 1BS2A 3GTPC 1WORA 3PO2C 4ILDA 4LOWA 3LAPA 4ZH4A 3GTJK 1XZPB 3I4MC 1BDFA 5FJ8K 3GIRA 4XLPA 2KWAA 2Y0SL 4MQ9A 4KB2A 2WB1L 3IPJA 5FLMC 1Y1WC 1HI9A 3HXAA 3H0GK 5C4JC 4Y7NC 4GTCA 4C3IC 1K83C 2E2IA 2B63A 1Y1VA 1WOPA 4X6AK 3S1QK 4C2MC 3SZZA 3GTMK 4A3JC 1PJ7A 1ZXOA 1JVIA 3NUHA 3K7AK 4MEYA 2RGRA 1YCLA 5JVOA 5D4DA 3HOXK 3TTGA 3OEPA 5C44K 4OIRA 2FQOA 4KASA 2E2JK 3GEHA 4XSZA 5M5WK 4G0VA 4BBSK 2Y0SD 4KAWX 3G4AA 1IE0A 5EGHA 2WB1D 1IW7A 2RH6A 2V6SA 3GTJC 1Y1WA 3Q3QA 3M4OK 1F93A 4BLAA 4KMAA 3FOEA 1ISEA 4G7OA 2P8TA 2E2HK 3H0GC 4BXXK 4BBRK 1JQWA 4GTBA 1V5VA 5IP9K 4X6AC 4KATA 3S1QC 3WODA 3S16K 2CW0A 3GTMC 1WSRA 3K7AC 4MEXA 4XCHA 5M3MK 2VUMK 2V6TA 2GAHC 4YFXA 3T02A 3HOVK 5E68A 3HOXC 3A8KA 4YFNA 3CAGA 3S17K 2GAGC 5C44C 1EK8A 2E2JC 3GTOK 1PJ5A 4BBSC 3AD7C 3GTKC 4GTEA 1DCPA 1TWHK 1O26A 1I6HK 3AD8C 2YU9K 1SFOA 3HOZK 2R7ZK 3M4OC 3H0GA 3OPFA 2R92K 5CHPA 1VJEA 2E2HC 1XPPA 1WQHA 5FLMK 4BXXC 4BBRC 4J3NA 4XLNA 5HL8A 5IP9C 2ZUEA 2A68A 3S16C 4GTAA 4XSXA 2JA6K 2VUMC 5IYBK 1WQFA 1R9TK 3HOVC 3FKIA 1IS1A 4KC6A 3LAJA 3S17C 4WJ4A 3AQOA 3GTOC 1ZQ1C 1WOSA 3GEEA 4KM9A 4PABA 5IOQA 4G0WA 5C4XC 1TWHC 4Q4ZA 1I6HC 1B4BA 2YU9C 2R7ZC 3HOZC 5M5YK 2NVXA 1WIHA 3TFHA 1XXCA 3CQZK 5EGEA 2R92C 1TWGA 2A6EA 4M1XA 2VUMA 4C3JK 5IP7K 1B4AA 4A3FK 3OREA 3VA7A 4KN4A 2JH3A 2JA6C 5IYBC 3HOWK 3LPXA 4OIQA 1R9TC 1G51A 4FM9A 3GTOA 2O5JA 1BGWA 1X31C 1O2BA 3GTPA 4FZBA 1I50K 1TWHA 3A8IA 3S1NK 2NVYK 2YU9A 2R7ZA 3M3YK 2FQTA 3A8JA 4KDDA 4LK1A 2A69A 1F7UA 3GTKK 1DCOA 2R92A 3AH5A 4BLBA 3GEIA 3CQZC 1WSVA 5C3EK 1I3QK 3GTQK 1TWAK 4LR2A 1K83A 3BP3A 1L0WA 4YFKA 1RU0A 2GSUA 3TFJA 1VLOA 4C3JC 1WQGA 2PPBA 5IP7C 4A3FC 2XCRB 3HOUK 2JA7K 4QIWL 3HOWC 4Q5SA 1EI6A 1KQ4A 2PA8L 3H3VL 5JFEA 4G0UA 1I6VA 4KARA 5TMFA 1O2FB 4P9SA 3AD9C 1I50C 3G4CA 3S1NC 2NVYC 3N0BA 1UV7A 1WOOA 3M3YC 3GTJA 4A3EK 4GZYA 2JA5K 3S14K 1YNJA 3CQZA 2GSOA 3GTGK 3S0XA 5C4XK 4O2DA 2O5IA 2R93K 2WAQL 1GE9A 2D6FC 4P5BA 2GSNA 2E2IK 1Y1VK 5C3EC 1I3QC 3GTQC 4A3DK 1TWAC 5CJ9A 2EBBA 3V4GA 1DCHA 1PJ6A 4KB4A 4QIWD 1J6VA 3SZYA 3GTMA 3GDZA 2PA8D 3H3VD 4YG2A 3HOUC 1F7VA 1O25A 2JA7C 4LJZA 4OIPA 3S2HK 3GTLK 1VH2A 4RMFA 4C3HK 1I50A 3EQLA 4A3CK 2NVYA 3BUEA 4A3LK 4GTFA 5TMCA 4QJVB 3GTKA 2WAQD 3HOYK 4A3EC 2JA5C 4A3GK 3N3YA 3S14C 1XZQB 4OINA 2A6HA 4KMHA 3GTGC 5IOTA 1I3QA 3GTQA 2R93C 2E2HA 2E2IC 5IOSA 1Y1VC 4A3DC 4A93K 2ZUFA 4Y52K 4PAAA 1O24A 3RZOK 1ZYRA 2JA7A 1J6XA 4WJ3M 2NVQK 2PMZL 2P5MA 3AQPA 4GTLA 4AH6A 1TWCK 5IORA 4BY1K 3S2HC 1USMA 3S1RK 1BJTA 5M3FK 3GTLC 2CFAB 4C3HC 4GTDA 4A3CC 4OIOA 4A3LC 4A3KK 3FOFA 1J6WA 2JA5A 4WILA 1J98A 3GTGA 2BE5A 1SFOK 3JSTA 4LQYA 1YNNA 3HOYC 1F9NA 2R93A 1ZVUA 4A3GC 1EH1A 3ERED 3N0CA 1IQ0A 2XCOA 2Y3PA 4A3IK 4KN7A 2NVTK 1TWFK 2PMZD 4A93C 4Y52C 4QJVA 1WCMK 3PO3K 1EQRA 1VGXA 3RZOC 4BY7K 2XCQA 4AYBL 1O27A 1XZQA 5L46A 2NVQC 2JA6A 3GTLA 3FKIK 3BP8C 1TWCC 4BY1C 2ZFZA 1R9TA 1XXBA 3TFIA 4NOIA 1HQMA 3S1RC 5IYCK 1ZBSA 3QX3A 4LK0A 4A3KC 1DD5A 4A3MK 2JA8K 4GFQA 1SFOC 2NVXK 5IYDK 1AB4A 1IL2A 4KMUA 3ADAC 3RZDK 4LLGA 2CFAA 1TWGK 3S2DK 1XZPA 4AYBD 4A3IC 2V6UA 3FHZA 2NVTC 1O29A 1TWFC 1O2AA 2B63K 3S1MK 1WCMC 4A3BK 4KMDA 3PO3C 3S15K 4G7HA 4BY7C 1TWCA 1JOEA 3I4NK 2W7VA 3FKIC 1INNA 2PHCB 4BKWA 3DXJA 4JK1A 5IYCC 3GTPK 3PO2K 1VRQC 3HKZL
chains in the Genus database with same CATH topology
1I50K 4X6AC 3S1QC 4Y52K 3WODA 3S16K 2CW0A 3GTMC 2NVYK 3S1NK 3I4MK 3M3YK 3RZOK 1ZYRA 4A3MC 3K7AC 2A69A 4LK1A 4MEXA 5M3MK 2JA8C 2VUMK 3GTKK 2NVXC 1SMYA 2NVQK 2PMZL 1Y1WK 4YFXA 1TWCK 5IYDC 3HOVK 4BY1K 3HOXC 3S2HC 5C4JK 4Y7NK 3CQZC 4YFNA 3S1RK 3RZDC 3S17K 5M3FK 3GTLC 4C3IK 1K83K 5C3EK 1I3QK 1TWGC 5C44C 1TWAK 3GTQK 3S2DC 2E2JC 3GTOK 4A3CC 5M5XK 4OIOA 4YFKA 4C2MK 4G7ZA 4BBSC 4A3JK 4A3LC 4A3KK 3GTKC 2B63C 3S1MC 1TWHK 2BE5A 5IP7C 4A3FC 1SFOK 2PPBA 3S15C 4A3BC 3HOUK 1YNNA 3HOYC 1I6HK 2YU9K 3HOZK 2R7ZK 3M4OC 3I4NC 4A3GC 2JA7K 4QIWL 3HOWC 3HKZD 4Q5SA 2PA8L 2R92K 3H3VL 2E2HC 1XPPA 5FLMK 4BXXC 4BBRC 1I6VA 4A3IK 4KN7A 3GTPC 4XLNA 5TMFA 2NVTK 3PO2C 5IP9K 1TWFK 2PMZD 5IP9C 4A93C 1I50C 4Y52C 2A68A 4QJVA 3S1NC 3S16C 1WCMK 4ZH4A 2NVYC 3GTJK 3PO3K 3I4MC 1BDFA 5FJ8K 4XSXA 3M3YC 3RZOC 4BY7K 4A3EK 4XLPA 4AYBL 2JA5K 4GZYA 3S14K 1YNJA 2Y0SL 2JA6K 2VUMC 5IYBK 4MQ9A 3GTGK 2NVQC 2WB1L 5FLMC 1Y1WC 5C4XK 3FKIK 1R9TK 2R93K 2O5IA 1TWCC 3HOVC 2WAQL 3H0GK 4BY1C 4NOIA 5C4JC 1HQMA 4Y7NC 3S1RC 3S17C 2E2IK 5IYCK 1Y1VK 1K83C 5C3EC 1I3QC 4LK0A 3GTQC 1TWAC 4A3DK 3GTOC 4X6AK 3S1QK 3GTMK 4A3JC 4QIWD 4A3KC 4A3MK 2PA8D 3K7AK 4MEYA 2JA8K 3H3VD 5C4XC 1TWHC 4Q4ZA 1SFOC 2NVXK 4YG2A 1I6HC 3HOUC 2YU9C 2R7ZC 3HOZC 5M5YK 5D4DA 5IYDK 2JA7C 4LJZA 4OIPA 3HOXK 3S2HK 4KMUA 3CQZK 3RZDK 2R92C 4LLGA 3GTLK 4C3HK 5C44K 1TWGK 4OIRA 3EQLA 2E2JK 3S2DK 4A3CK 4XSZA 4AYBD 5M5WK 4A3IC 2A6EA 4BBSK 4A3LK 2Y0SD 2NVTC 1TWFC 2WB1D 5TMCA 4QJVB 1IW7A 2B63K 3S1MK 4C3JK 1WCMC 5IP7K 3GTJC 2WAQD 4A3FK 3PO3C 3S15K 3HOYK 4A3BK 4G7HA 4BY7C 4A3EC 4KN4A 3M4OK 2JA5C 3I4NK 3S14C 4A3GK 2JA6C 5IYBC 4OINA 2A6HA 3GTGC 3HOWK 4OIQA 3FKIC 1R9TC 4G7OA 2R93C 2E2HK 3H0GC 2O5JA 4BXXK 4BBRK 4A93K 3DXJA 4JK1A 5IYCC 2E2IC 1Y1VC 3GTPK 3PO2K 4A3DC 3HKZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 K;  4X6A C;  3S1Q C;  4Y52 K;  3WOD A;  3S16 K;  2CW0 A;  3GTM C;  2NVY K;  3S1N K;  3I4M K;  3M3Y K;  3RZO K;  1ZYR A;  4A3M C;  3K7A C;  2A69 A;  4LK1 A;  4MEX A;  5M3M K;  2JA8 C;  2VUM K;  3GTK K;  2NVX C;  1SMY A;  2NVQ K;  2PMZ L;  1Y1W K;  4YFX A;  1TWC K;  5IYD C;  3HOV K;  4BY1 K;  3HOX C;  3S2H C;  5C4J K;  4Y7N K;  3CQZ C;  4YFN A;  3S1R K;  3RZD C;  3S17 K;  5M3F K;  3GTL C;  4C3I K;  1K83 K;  5C3E K;  1I3Q K;  1TWG C;  5C44 C;  1TWA K;  3GTQ K;  3S2D C;  2E2J C;  3GTO K;  4A3C C;  5M5X K;  4OIO A;  4YFK A;  4C2M K;  4G7Z A;  4BBS C;  4A3J K;  4A3L C;  4A3K K;  3GTK C;  2B63 C;  3S1M C;  1TWH K;  2BE5 A;  5IP7 C;  4A3F C;  1SFO K;  2PPB A;  3S15 C;  4A3B C;  3HOU K;  1YNN A;  3HOY C;  1I6H K;  2YU9 K;  3HOZ K;  2R7Z K;  3M4O C;  3I4N C;  4A3G C;  2JA7 K;  4QIW L;  3HOW C;  3HKZ D;  4Q5S A;  2PA8 L;  2R92 K;  3H3V L;  2E2H C;  1XPP A;  5FLM K;  4BXX C;  4BBR C;  1I6V A;  4A3I K;  4KN7 A;  3GTP C;  4XLN A;  5TMF A;  2NVT K;  3PO2 C;  5IP9 K;  1TWF K;  2PMZ D;  5IP9 C;  4A93 C;  1I50 C;  4Y52 C;  2A68 A;  4QJV A;  3S1N C;  3S16 C;  1WCM K;  4ZH4 A;  2NVY C;  3GTJ K;  3PO3 K;  3I4M C;  1BDF A;  5FJ8 K;  4XSX A;  3M3Y C;  3RZO C;  4BY7 K;  4A3E K;  4XLP A;  4AYB L;  2JA5 K;  4GZY A;  3S14 K;  1YNJ A;  2Y0S L;  2JA6 K;  2VUM C;  5IYB K;  4MQ9 A;  3GTG K;  2NVQ C;  2WB1 L;  5FLM C;  1Y1W C;  5C4X K;  3FKI K;  1R9T K;  2R93 K;  2O5I A;  1TWC C;  3HOV C;  2WAQ L;  3H0G K;  4BY1 C;  4NOI A;  5C4J C;  1HQM A;  4Y7N C;  3S1R C;  3S17 C;  2E2I K;  5IYC K;  1Y1V K;  1K83 C;  5C3E C;  1I3Q C;  4LK0 A;  3GTQ C;  1TWA C;  4A3D K;  3GTO C;  4X6A K;  3S1Q K;  3GTM K;  4A3J C;  4QIW D;  4A3K C;  4A3M K;  2PA8 D;  3K7A K;  4MEY A;  2JA8 K;  3H3V D;  5C4X C;  1TWH C;  4Q4Z A;  1SFO C;  2NVX K;  4YG2 A;  1I6H C;  3HOU C;  2YU9 C;  2R7Z C;  3HOZ C;  5M5Y K;  5D4D A;  5IYD K;  2JA7 C;  4LJZ A;  4OIP A;  3HOX K;  3S2H K;  4KMU A;  3CQZ K;  3RZD K;  2R92 C;  4LLG A;  3GTL K;  4C3H K;  5C44 K;  1TWG K;  4OIR A;  3EQL A;  2E2J K;  3S2D K;  4A3C K;  4XSZ A;  4AYB D;  5M5W K;  4A3I C;  2A6E A;  4BBS K;  4A3L K;  2Y0S D;  2NVT C;  1TWF C;  2WB1 D;  5TMC A;  4QJV B;  1IW7 A;  2B63 K;  3S1M K;  4C3J K;  1WCM C;  5IP7 K;  3GTJ C;  2WAQ D;  4A3F K;  3PO3 C;  3S15 K;  3HOY K;  4A3B K;  4G7H A;  4BY7 C;  4A3E C;  4KN4 A;  3M4O K;  2JA5 C;  3I4N K;  3S14 C;  4A3G K;  2JA6 C;  5IYB C;  4OIN A;  2A6H A;  3GTG C;  3HOW K;  4OIQ A;  3FKI C;  1R9T C;  4G7O A;  2R93 C;  2E2H K;  3H0G C;  2O5J A;  4BXX K;  4BBR K;  4A93 K;  3DXJ A;  4JK1 A;  5IYC C;  2E2I C;  1Y1V C;  3GTP K;  3PO2 K;  4A3D C;  3HKZ L; 
#chains in the Genus database with same CATH topology
 4KM8 A;  3I4M K;  1EFW A;  4GT9 A;  4A3M C;  1YX2 A;  2JA8 C;  1C0A A;  2NVX C;  1IBA A;  1SMY A;  3MML B;  1Y1W K;  1O28 A;  3GSI A;  5IYD C;  5C4J K;  4Y7N K;  3T01 A;  4DDQ A;  3RZD C;  1TWF A;  4C3I K;  1K83 K;  1TWG C;  1XXA A;  3L4K A;  3S2D C;  1WCM A;  5M5X K;  4G7Z A;  1TWA A;  4C2M K;  4A3J K;  3L4J A;  4P5A A;  2B63 C;  5TJ3 A;  3S1M C;  4A3B C;  3S15 C;  4C45 A;  1USO A;  3I4N C;  3HKZ D;  3T00 A;  1BS2 A;  3GTP C;  1WOR A;  3PO2 C;  4ILD A;  4LOW A;  3LAP A;  4ZH4 A;  3GTJ K;  1XZP B;  3I4M C;  1BDF A;  5FJ8 K;  3GIR A;  4XLP A;  2KWA A;  2Y0S L;  4MQ9 A;  4KB2 A;  2WB1 L;  3IPJ A;  5FLM C;  1Y1W C;  1HI9 A;  3HXA A;  3H0G K;  5C4J C;  4Y7N C;  4GTC A;  4C3I C;  1K83 C;  2E2I A;  2B63 A;  1Y1V A;  1WOP A;  4X6A K;  3S1Q K;  4C2M C;  3SZZ A;  3GTM K;  4A3J C;  1PJ7 A;  1ZXO A;  1JVI A;  3NUH A;  3K7A K;  4MEY A;  2RGR A;  1YCL A;  5JVO A;  5D4D A;  3HOX K;  3TTG A;  3OEP A;  5C44 K;  4OIR A;  2FQO A;  4KAS A;  2E2J K;  3GEH A;  4XSZ A;  5M5W K;  4G0V A;  4BBS K;  2Y0S D;  4KAW X;  3G4A A;  1IE0 A;  5EGH A;  2WB1 D;  1IW7 A;  2RH6 A;  2V6S A;  3GTJ C;  1Y1W A;  3Q3Q A;  3M4O K;  1F93 A;  4BLA A;  4KMA A;  3FOE A;  1ISE A;  4G7O A;  2P8T A;  2E2H K;  3H0G C;  4BXX K;  4BBR K;  1JQW A;  4GTB A;  1V5V A;  5IP9 K;  4X6A C;  4KAT A;  3S1Q C;  3WOD A;  3S16 K;  2CW0 A;  3GTM C;  1WSR A;  3K7A C;  4MEX A;  4XCH A;  5M3M K;  2VUM K;  2V6T A;  2GAH C;  4YFX A;  3T02 A;  3HOV K;  5E68 A;  3HOX C;  3A8K A;  4YFN A;  3CAG A;  3S17 K;  2GAG C;  5C44 C;  1EK8 A;  2E2J C;  3GTO K;  1PJ5 A;  4BBS C;  3AD7 C;  3GTK C;  4GTE A;  1DCP A;  1TWH K;  1O26 A;  1I6H K;  3AD8 C;  2YU9 K;  1SFO A;  3HOZ K;  2R7Z K;  3M4O C;  3H0G A;  3OPF A;  2R92 K;  5CHP A;  1VJE A;  2E2H C;  1XPP A;  1WQH A;  5FLM K;  4BXX C;  4BBR C;  4J3N A;  4XLN A;  5HL8 A;  5IP9 C;  2ZUE A;  2A68 A;  3S16 C;  4GTA A;  4XSX A;  2JA6 K;  2VUM C;  5IYB K;  1WQF A;  1R9T K;  3HOV C;  3FKI A;  1IS1 A;  4KC6 A;  3LAJ A;  3S17 C;  4WJ4 A;  3AQO A;  3GTO C;  1ZQ1 C;  1WOS A;  3GEE A;  4KM9 A;  4PAB A;  5IOQ A;  4G0W A;  5C4X C;  1TWH C;  4Q4Z A;  1I6H C;  1B4B A;  2YU9 C;  2R7Z C;  3HOZ C;  5M5Y K;  2NVX A;  1WIH A;  3TFH A;  1XXC A;  3CQZ K;  5EGE A;  2R92 C;  1TWG A;  2A6E A;  4M1X A;  2VUM A;  4C3J K;  5IP7 K;  1B4A A;  4A3F K;  3ORE A;  3VA7 A;  4KN4 A;  2JH3 A;  2JA6 C;  5IYB C;  3HOW K;  3LPX A;  4OIQ A;  1R9T C;  1G51 A;  4FM9 A;  3GTO A;  2O5J A;  1BGW A;  1X31 C;  1O2B A;  3GTP A;  4FZB A;  1I50 K;  1TWH A;  3A8I A;  3S1N K;  2NVY K;  2YU9 A;  2R7Z A;  3M3Y K;  2FQT A;  3A8J A;  4KDD A;  4LK1 A;  2A69 A;  1F7U A;  3GTK K;  1DCO A;  2R92 A;  3AH5 A;  4BLB A;  3GEI A;  3CQZ C;  1WSV A;  5C3E K;  1I3Q K;  3GTQ K;  1TWA K;  4LR2 A;  1K83 A;  3BP3 A;  1L0W A;  4YFK A;  1RU0 A;  2GSU A;  3TFJ A;  1VLO A;  4C3J C;  1WQG A;  2PPB A;  5IP7 C;  4A3F C;  2XCR B;  3HOU K;  2JA7 K;  4QIW L;  3HOW C;  4Q5S A;  1EI6 A;  1KQ4 A;  2PA8 L;  3H3V L;  5JFE A;  4G0U A;  1I6V A;  4KAR A;  5TMF A;  1O2F B;  4P9S A;  3AD9 C;  1I50 C;  3G4C A;  3S1N C;  2NVY C;  3N0B A;  1UV7 A;  1WOO A;  3M3Y C;  3GTJ A;  4A3E K;  4GZY A;  2JA5 K;  3S14 K;  1YNJ A;  3CQZ A;  2GSO A;  3GTG K;  3S0X A;  5C4X K;  4O2D A;  2O5I A;  2R93 K;  2WAQ L;  1GE9 A;  2D6F C;  4P5B A;  2GSN A;  2E2I K;  1Y1V K;  5C3E C;  1I3Q C;  3GTQ C;  4A3D K;  1TWA C;  5CJ9 A;  2EBB A;  3V4G A;  1DCH A;  1PJ6 A;  4KB4 A;  4QIW D;  1J6V A;  3SZY A;  3GTM A;  3GDZ A;  2PA8 D;  3H3V D;  4YG2 A;  3HOU C;  1F7V A;  1O25 A;  2JA7 C;  4LJZ A;  4OIP A;  3S2H K;  3GTL K;  1VH2 A;  4RMF A;  4C3H K;  1I50 A;  3EQL A;  4A3C K;  2NVY A;  3BUE A;  4A3L K;  4GTF A;  5TMC A;  4QJV B;  3GTK A;  2WAQ D;  3HOY K;  4A3E C;  2JA5 C;  4A3G K;  3N3Y A;  3S14 C;  1XZQ B;  4OIN A;  2A6H A;  4KMH A;  3GTG C;  5IOT A;  1I3Q A;  3GTQ A;  2R93 C;  2E2H A;  2E2I C;  5IOS A;  1Y1V C;  4A3D C;  4A93 K;  2ZUF A;  4Y52 K;  4PAA A;  1O24 A;  3RZO K;  1ZYR A;  2JA7 A;  1J6X A;  4WJ3 M;  2NVQ K;  2PMZ L;  2P5M A;  3AQP A;  4GTL A;  4AH6 A;  1TWC K;  5IOR A;  4BY1 K;  3S2H C;  1USM A;  3S1R K;  1BJT A;  5M3F K;  3GTL C;  2CFA B;  4C3H C;  4GTD A;  4A3C C;  4OIO A;  4A3L C;  4A3K K;  3FOF A;  1J6W A;  2JA5 A;  4WIL A;  1J98 A;  3GTG A;  2BE5 A;  1SFO K;  3JST A;  4LQY A;  1YNN A;  3HOY C;  1F9N A;  2R93 A;  1ZVU A;  4A3G C;  1EH1 A;  3ERE D;  3N0C A;  1IQ0 A;  2XCO A;  2Y3P A;  4A3I K;  4KN7 A;  2NVT K;  1TWF K;  2PMZ D;  4A93 C;  4Y52 C;  4QJV A;  1WCM K;  3PO3 K;  1EQR A;  1VGX A;  3RZO C;  4BY7 K;  2XCQ A;  4AYB L;  1O27 A;  1XZQ A;  5L46 A;  2NVQ C;  2JA6 A;  3GTL A;  3FKI K;  3BP8 C;  1TWC C;  4BY1 C;  2ZFZ A;  1R9T A;  1XXB A;  3TFI A;  4NOI A;  1HQM A;  3S1R C;  5IYC K;  1ZBS A;  3QX3 A;  4LK0 A;  4A3K C;  1DD5 A;  4A3M K;  2JA8 K;  4GFQ A;  1SFO C;  2NVX K;  5IYD K;  1AB4 A;  1IL2 A;  4KMU A;  3ADA C;  3RZD K;  4LLG A;  2CFA A;  1TWG K;  3S2D K;  1XZP A;  4AYB D;  4A3I C;  2V6U A;  3FHZ A;  2NVT C;  1O29 A;  1TWF C;  1O2A A;  2B63 K;  3S1M K;  1WCM C;  4A3B K;  4KMD A;  3PO3 C;  3S15 K;  4G7H A;  4BY7 C;  1TWC A;  1JOE A;  3I4N K;  2W7V A;  3FKI C;  1INN A;  2PHC B;  4BKW A;  3DXJ A;  4JK1 A;  5IYC C;  3GTP K;  3PO2 K;  1VRQ C;  3HKZ L; 
#chains in the Genus database with same CATH homology
 1I50 K;  4X6A C;  3S1Q C;  4Y52 K;  3WOD A;  3S16 K;  2CW0 A;  3GTM C;  2NVY K;  3S1N K;  3I4M K;  3M3Y K;  3RZO K;  1ZYR A;  4A3M C;  3K7A C;  2A69 A;  4LK1 A;  4MEX A;  5M3M K;  2JA8 C;  2VUM K;  3GTK K;  2NVX C;  1SMY A;  2NVQ K;  2PMZ L;  1Y1W K;  4YFX A;  1TWC K;  5IYD C;  3HOV K;  4BY1 K;  3HOX C;  3S2H C;  5C4J K;  4Y7N K;  3CQZ C;  4YFN A;  3S1R K;  3RZD C;  3S17 K;  5M3F K;  3GTL C;  4C3I K;  1K83 K;  5C3E K;  1I3Q K;  1TWG C;  5C44 C;  1TWA K;  3GTQ K;  3S2D C;  2E2J C;  3GTO K;  4A3C C;  5M5X K;  4OIO A;  4YFK A;  4C2M K;  4G7Z A;  4BBS C;  4A3J K;  4A3L C;  4A3K K;  3GTK C;  2B63 C;  3S1M C;  1TWH K;  2BE5 A;  5IP7 C;  4A3F C;  1SFO K;  2PPB A;  3S15 C;  4A3B C;  3HOU K;  1YNN A;  3HOY C;  1I6H K;  2YU9 K;  3HOZ K;  2R7Z K;  3M4O C;  3I4N C;  4A3G C;  2JA7 K;  4QIW L;  3HOW C;  3HKZ D;  4Q5S A;  2PA8 L;  2R92 K;  3H3V L;  2E2H C;  1XPP A;  5FLM K;  4BXX C;  4BBR C;  1I6V A;  4A3I K;  4KN7 A;  3GTP C;  4XLN A;  5TMF A;  2NVT K;  3PO2 C;  5IP9 K;  1TWF K;  2PMZ D;  5IP9 C;  4A93 C;  1I50 C;  4Y52 C;  2A68 A;  4QJV A;  3S1N C;  3S16 C;  1WCM K;  4ZH4 A;  2NVY C;  3GTJ K;  3PO3 K;  3I4M C;  1BDF A;  5FJ8 K;  4XSX A;  3M3Y C;  3RZO C;  4BY7 K;  4A3E K;  4XLP A;  4AYB L;  2JA5 K;  4GZY A;  3S14 K;  1YNJ A;  2Y0S L;  2JA6 K;  2VUM C;  5IYB K;  4MQ9 A;  3GTG K;  2NVQ C;  2WB1 L;  5FLM C;  1Y1W C;  5C4X K;  3FKI K;  1R9T K;  2R93 K;  2O5I A;  1TWC C;  3HOV C;  2WAQ L;  3H0G K;  4BY1 C;  4NOI A;  5C4J C;  1HQM A;  4Y7N C;  3S1R C;  3S17 C;  2E2I K;  5IYC K;  1Y1V K;  1K83 C;  5C3E C;  1I3Q C;  4LK0 A;  3GTQ C;  1TWA C;  4A3D K;  3GTO C;  4X6A K;  3S1Q K;  3GTM K;  4A3J C;  4QIW D;  4A3K C;  4A3M K;  2PA8 D;  3K7A K;  4MEY A;  2JA8 K;  3H3V D;  5C4X C;  1TWH C;  4Q4Z A;  1SFO C;  2NVX K;  4YG2 A;  1I6H C;  3HOU C;  2YU9 C;  2R7Z C;  3HOZ C;  5M5Y K;  5D4D A;  5IYD K;  2JA7 C;  4LJZ A;  4OIP A;  3HOX K;  3S2H K;  4KMU A;  3CQZ K;  3RZD K;  2R92 C;  4LLG A;  3GTL K;  4C3H K;  5C44 K;  1TWG K;  4OIR A;  3EQL A;  2E2J K;  3S2D K;  4A3C K;  4XSZ A;  4AYB D;  5M5W K;  4A3I C;  2A6E A;  4BBS K;  4A3L K;  2Y0S D;  2NVT C;  1TWF C;  2WB1 D;  5TMC A;  4QJV B;  1IW7 A;  2B63 K;  3S1M K;  4C3J K;  1WCM C;  5IP7 K;  3GTJ C;  2WAQ D;  4A3F K;  3PO3 C;  3S15 K;  3HOY K;  4A3B K;  4G7H A;  4BY7 C;  4A3E C;  4KN4 A;  3M4O K;  2JA5 C;  3I4N K;  3S14 C;  4A3G K;  2JA6 C;  5IYB C;  4OIN A;  2A6H A;  3GTG C;  3HOW K;  4OIQ A;  3FKI C;  1R9T C;  4G7O A;  2R93 C;  2E2H K;  3H0G C;  2O5J A;  4BXX K;  4BBR K;  4A93 K;  3DXJ A;  4JK1 A;  5IYC C;  2E2I C;  1Y1V C;  3GTP K;  3PO2 K;  4A3D C;  3HKZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...