3GTKK

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtkK00
1Y1VK 3S1NC 2A6EA 2E2IC 4GZYA 1HQMA 5C3EK 4XSZA 4A3BK 2CW0A 4XLPA 2JA8C 3S1MC 4LK0A 4A3IC 3PO2K 4XSXA 4QIWL 2JA5K 5IYDK 2R93K 1I3QK 1K83C 3S16C 4X6AC 5M5WK 4A3MC 3RZDK 2NVTC 3GTMC 3GTQC 3S2DK 4MQ9A 5IYBC 5TMFA 5M3FK 3CQZC 2NVXK 2VUMK 3S1QC 2JA6K 4A3KK 3K7AK 5IP7C 2B63C 3S14K 4BBSK 1Y1WC 1TWCK 1WCMK 3GTGC 2O5JA 5C44K 3GTPC 2Y0SD 4Y52K 3I4MC 3HKZD 4MEYA 2NVYC 3GTJC 4KMUA 3GTLC 4A3LC 2R92C 3FKIK 5C4XC 4KN4A 3M3YK 3H3VD 3GTOC 3WODA 3HOZC 2E2IK 4AYBL 4OINA 1XPPA 5M5YK 1I50C 4OIOA 2JA8K 2WB1D 2Y0SL 4A3JC 3DXJA 3HKZL 4QJVB 2E2HC 4A3IK 4A3EK 3S1MK 4A3FC 4C2MK 4G7OA 5FLMC 1SMYA 3H3VL 4X6AK 1K83K 4Y7NC 3S16K 4A3MK 2NVTK 1SFOC 3GTMK 4OIRA 4LK1A 5D4DA 4BBRK 5IYBK 3CQZK 3HOXC 3RZOC 3S1QK 3EQLA 2JA7C 2YU9C 3HOYC 5IP7K 2B63K 4KN7A 1Y1WK 5IP9C 3GTGK 3PO3C 4G7HA 3GTPK 4A3CC 3I4MK 4BY7C 3GTJK 4YFXA 4A3LK 3H0GC 2R92K 5C4XK 3S2HC 5IYCC 4YFKA 5M5XK 3GTOK 3HOZK 1TWFC 1R9TC 4A93C 3S1NK 2R7ZC 1I50K 4YG2A 4Q4ZA 4A3JK 2E2HK 3M4OC 4BXXK 4A3GC 2BE5A 3GTKC 2WAQD 4A3FK 3S15K 1I3QC 4LJZA 4YFNA 1TWGC 3RZDC 5FLMK 2A69A 2PMZD 1IW7A 4Y7NK 3I4NC 4XLNA 1TWAC 5C4JC 3HOUC 3S1RC 3RZOK 5FJ8K 4ZH4A 2PA8D 4QJVA 3HOXK 2E2JC 3GTQK 3HOYK 1TWHC 2YU9K 4BY1C 2JA7K 3S14C 2WB1L 2NVQC 5IP9K 2WAQL 3PO3K 1ZYRA 4BXXC 5M3MK 1I6HC 4A3DC 2O5IA 3HOWC 4C3HK 4A3CK 2A68A 4BY7K 4C3IK 3HOVC 2NVYK 3H0GK 1YNNA 1YNJA 4MEXA 1Y1VC 4C3JK 5IYCK 3GTLK 3S17C 3S2HK 1TWFK 5C3EC 1R9TK 4A93K 3S15C 4A3BC 4OIPA 2R7ZK 2A6HA 5TMCA 4A3EC 3M4OK 4A3GK 3PO2C 2JA5C 3GTKK 5IYDC 4LLGA 1TWGK 2R93C 2PPBA 3S2DC 3I4NK 4Q5SA 4BBRC 1TWAK 5C4JK 3HOUK 3S1RK 1SFOK 2VUMC 2NVXC 2E2JK 4A3KC 2JA6C 3K7AC 1TWHK 4BY1K 4AYBD 4G7ZA 4BBSC 1TWCC 1WCMC 2NVQK 4NOIA 4JK1A 5C44C 1BDFA 1I6HK 4A3DK 4Y52C 4OIQA 3HOWK 1I6VA 2PMZL 4QIWD 3HOVK 3FKIC 3M3YC 2PA8L 3S17K
chains in the Genus database with same CATH superfamily
1JQWA 4KB2A 4GTFA 4LOWA 4XSXA 1F7VA 1SFOA 1TWHA 3S16C 2JA7A 2YU9A 1BJTA 5IYBC 5TMFA 2VUMK 3S1QC 4WJ3M 4KMAA 4A3KK 1PJ6A 4Y52K 3HKZD 4MEYA 1WOSA 1USOA 1EFWA 3GTLC 2R92C 4C3JC 4KN4A 1R9TA 5M5YK 2JA8K 1INNA 4A3JC 3HKZL 1TWGA 4QJVB 4A3IK 4C2MK 4P5BA 1J6WA 4X6AK 2NVTK 1SFOC 4BBRK 3HOXC 2JA7C 2YU9C 1PJ7A 1G51A 3N0BA 5E68A 3I4MK 4BY7C 4C3IC 2GSUA 5CHPA 4A3LK 5JFEA 3LAJA 3BP8C 4YFKA 5M5XK 3GTOK 3L4JA 1R9TC 4BLBA 1I50K 3M4OC 4BXXK 2R93A 1F93A 2WAQD 1TWGC 1IL2A 4XLNA 2GSNA 1IBAA 3QX3A 5IOQA 3T00A 4QJVA 3GTQK 3HOYK 4BY1C 1XZPB 2WB1L 5IP9K 2WAQL 3CAGA 1J6XA 1ZYRA 4BKWA 4GTBA 4A3DC 3GTOA 2A68A 1BGWA 1UV7A 2D6FC 1YNNA 1I50A 4MEXA 5IYCK 1XXAA 2R7ZK 2A6HA 4A3GK 4GTEA 3GTQA 3AD9C 2JH3A 4LLGA 3JSTA 2R93C 1J98A 2GAHC 3AQOA 4BBRC 1TWAK 2B63A 5IOTA 2E2JK 4BBSC 4GTAA 4GT9A 1I6HK 3HOWK 1I6VA 3FOEA 4QIWD 3HXAA 2PA8L 3S17K 2E2IC 4GZYA 1HQMA 4XSZA 1BS2A 3S1MC 4LK0A 2XCQA 3PO2K 4QIWL 5IYDK 1L0WA 1K83C 3S2DK 3RZDK 3GTQC 3FOFA 5M3FK 1EH1A 2P5MA 2NVXK 1YCLA 2B63C 5C44K 2Y0SD 1O25A 1IE0A 4KMUA 3FKIK 4KAWX 3H3VD 3HOZC 4KDDA 1O29A 2FQTA 4KC6A 1XZQB 2Y0SL 2E2HC 5EGEA 1WOOA 4A3EK 4KM9A 2NVXA 4G7OA 4P5AA 3H3VL 4A3MK 3GTMK 3RZOC 3CQZK 3EQLA 1V5VA 5IP7K 4FM9A 1Y1WK 3GTGK 3PO3C 4PABA 1ZBSA 3GTPK 4C3HC 4A3CC 4WJ4A 3GTJK 5C4XK 2XCRB 1DCHA 3S2HC 1O26A 4KATA 4A93C 3S1NK 1B4BA 4RMFA 4KB4A 4YG2A 2BE5A 1EK8A 4A3FK 4YFNA 3M3YC 2VUMA 3RZDC 5FLMK 2PMZD 4Y7NK 3I4NC 5C4JC 3HOUC 1XZQA 1O28A 1TWHC 1WORA 5M3MK 4BLAA 4KASA 2O5IA 1IQ0A 3L4KA 3HOVC 3H0GK 1TWFK 1O2FB 3G4CA 1VJEA 3AQPA 4A3EC 1DCPA 3GTKK 3TFHA 4WILA 3S1RK 2VUMC 4A3KC 3GSIA 4AYBD 4G7ZA 4G0UA 2NVQK 1VLOA 2FQOA 1GE9A 4GTLA 1BDFA 1C0AA 4Y52C 2XCOA 3GEHA 5TJ3A 1WSRA 1Y1VK 3S1NC 5C3EK 3GTKA 4A3BK 2CW0A 2JA8C 4AH6A 4A3IC 2JA5K 4C2MC 4X6AC 5M5WK 2NVTC 1DD5A 4DDQA 4MQ9A 2JA6K 3K7AK 2RGRA 3V4GA 3SZZA 1TWCK 1WCMK 1ISEA 1Y1VA 3I4MC 3OEPA 1J6VA 3TFIA 4A3LC 3M3YK 3GTOC 3WODA 2R7ZA 4OINA 1I50C 4OIOA 4BXXC 1XXBA 1WSVA 2PHCB 1TWAA 4ILDA 2JA6A 3S16K 3IPJA 2V6TA 3AD8C 1WCMA 4OIRA 4LK1A 5D4DA 5IYBK 2ZUEA 3S1QK 3AD7C 3HOYC 1ZVUA 2EBBA 4KN7A 5IP9C 2CFAB 3GDZA 5HL8A 4G7HA 2V6UA 3OREA 1F9NA 4YFXA 2R92K 1RU0A 5IYCC 2W7VA 1WQFA 3OPFA 4C45A 2R7ZC 1EQRA 4A3JK 4A3GC 1F7UA 2A69A 4KMDA 1IW7A 4J3NA 1HI9A 1TWAC 1O2AA 4ZH4A 4KM8A 5FJ8K 3HOXK 2E2JC 2JA7K 2YU9K 1EI6A 1I6HC 3NUHA 3FKIA 3HOWC 4BY7K 1YX2A 4C3IK 3MMLB 2NVYK 2CFAA 3S17C 1WIHA 1R9TK 3AH5A 4OIPA 4G0WA 5TMCA 3M4OK 3PO2C 1JVIA 1USMA 2GSOA 3GTMA 5IYDC 1TWGK 3CQZA 2PPBA 4KARA 3FHZA 3S2DC 4Q5SA 1O24A 1Y1WA 2NVXC 3GTGA 4BY1K 1ZQ1C 1WOPA 3A8JA 3GTPA 3S0XA 2ZFZA 2NVYA 4NOIA 5C44C 3GTJA 2GAGC 4A3DK 4OIQA 1WQGA 1X31C 2PMZL 4LR2A 1DCOA 3LPXA 4FZBA 4XCHA 3FKIC 1KQ4A 2A6EA 3BP3A 4O2DA 4XLPA 1PJ5A 5L46A 2R93K 1I3QK 4LQYA 4A3MC 3GTMC 3CQZC 3GEIA 5IP7C 3GEEA 3S14K 5IOSA 2KWAA 5EGHA 1Y1WC 1IS1A 4BBSK 3GTGC 2O5JA 5CJ9A 2RH6A 3GTPC 3H0GA 2NVYC 3GTJC 3ERED 5JVOA 1TWFA 5C4XC 3TFJA 3SZYA 1VH2A 2E2IK 4AYBL 1XPPA 3LAPA 4G0VA 4GTDA 5IORA 3S15K 1I3QA 2WB1D 3DXJA 3S1MK 4A3FC 4KMHA 5FLMC 1SMYA 1K83K 4Y7NC 4P9SA 1VGXA 3BUEA 2B63K 3N0CA 1O27A 3T02A 3N3YA 2E2IA 3H0GC 1WQHA 3HOZK 1TWFC 2JA5A 4Q4ZA 2Y3PA 3T01A 1K83A 2E2HK 3GTKC 1I3QC 4LJZA 3VA7A 3G4AA 3Q3QA 3S1RC 3RZOK 1TWCA 2PA8D 3S14C 2NVQC 1AB4A 3PO3K 4GTCA 4C3HK 4A3CK 3A8KA 1XZPA 1YNJA 4GFQA 3GTLK 1Y1VC 4C3JK 3S2HK 2E2HA 1XXCA 5C3EC 4A93K 3S15C 4A3BC 2JA5C 2P8TA 4M1XA 1ZXOA 3TTGA 3I4NK 5C4JK 3HOUK 1VRQC 1SFOK 3GIRA 2JA6C 1O2BA 1TWHK 3K7AC 1JOEA 3ADAC 1TWCC 1WCMC 3A8IA 4JK1A 3GTLA 2ZUFA 2R92A 4PAAA 3HOVK 1B4AA 2V6SA
chains in the Genus database with same CATH topology
1Y1VK 3S1NC 2A6EA 2E2IC 4GZYA 1HQMA 5C3EK 4XSZA 4A3BK 2CW0A 4XLPA 2JA8C 3S1MC 4LK0A 4A3IC 3PO2K 4XSXA 4QIWL 2JA5K 5IYDK 2R93K 1I3QK 1K83C 3S16C 4X6AC 5M5WK 4A3MC 3RZDK 2NVTC 3GTMC 3GTQC 3S2DK 4MQ9A 5IYBC 5TMFA 5M3FK 3CQZC 2NVXK 2VUMK 3S1QC 2JA6K 4A3KK 3K7AK 5IP7C 2B63C 3S14K 4BBSK 1Y1WC 1TWCK 1WCMK 3GTGC 2O5JA 5C44K 3GTPC 2Y0SD 4Y52K 3I4MC 3HKZD 4MEYA 2NVYC 3GTJC 4KMUA 3GTLC 4A3LC 2R92C 3FKIK 5C4XC 4KN4A 3M3YK 3H3VD 3GTOC 3WODA 3HOZC 2E2IK 4AYBL 4OINA 1XPPA 5M5YK 1I50C 4OIOA 2JA8K 2WB1D 2Y0SL 4A3JC 3DXJA 3HKZL 4QJVB 2E2HC 4A3IK 4A3EK 3S1MK 4A3FC 4C2MK 4G7OA 5FLMC 1SMYA 3H3VL 4X6AK 1K83K 4Y7NC 3S16K 4A3MK 2NVTK 1SFOC 3GTMK 4OIRA 4LK1A 5D4DA 4BBRK 5IYBK 3CQZK 3HOXC 3RZOC 3S1QK 3EQLA 2JA7C 2YU9C 3HOYC 5IP7K 2B63K 4KN7A 1Y1WK 5IP9C 3GTGK 3PO3C 4G7HA 3GTPK 4A3CC 3I4MK 4BY7C 3GTJK 4YFXA 4A3LK 3H0GC 2R92K 5C4XK 3S2HC 5IYCC 4YFKA 5M5XK 3GTOK 3HOZK 1TWFC 1R9TC 4A93C 3S1NK 2R7ZC 1I50K 4YG2A 4Q4ZA 4A3JK 2E2HK 3M4OC 4BXXK 4A3GC 2BE5A 3GTKC 2WAQD 4A3FK 3S15K 1I3QC 4LJZA 4YFNA 1TWGC 3RZDC 5FLMK 2A69A 2PMZD 1IW7A 4Y7NK 3I4NC 4XLNA 1TWAC 5C4JC 3HOUC 3S1RC 3RZOK 5FJ8K 4ZH4A 2PA8D 4QJVA 3HOXK 2E2JC 3GTQK 3HOYK 1TWHC 2YU9K 4BY1C 2JA7K 3S14C 2WB1L 2NVQC 5IP9K 2WAQL 3PO3K 1ZYRA 4BXXC 5M3MK 1I6HC 4A3DC 2O5IA 3HOWC 4C3HK 4A3CK 2A68A 4BY7K 4C3IK 3HOVC 2NVYK 3H0GK 1YNNA 1YNJA 4MEXA 1Y1VC 4C3JK 5IYCK 3GTLK 3S17C 3S2HK 1TWFK 5C3EC 1R9TK 4A93K 3S15C 4A3BC 4OIPA 2R7ZK 2A6HA 5TMCA 4A3EC 3M4OK 4A3GK 3PO2C 2JA5C 3GTKK 5IYDC 4LLGA 1TWGK 2R93C 2PPBA 3S2DC 3I4NK 4Q5SA 4BBRC 1TWAK 5C4JK 3HOUK 3S1RK 1SFOK 2VUMC 2NVXC 2E2JK 4A3KC 2JA6C 3K7AC 1TWHK 4BY1K 4AYBD 4G7ZA 4BBSC 1TWCC 1WCMC 2NVQK 4NOIA 4JK1A 5C44C 1BDFA 1I6HK 4A3DK 4Y52C 4OIQA 3HOWK 1I6VA 2PMZL 4QIWD 3HOVK 3FKIC 3M3YC 2PA8L 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V K;  3S1N C;  2A6E A;  2E2I C;  4GZY A;  1HQM A;  5C3E K;  4XSZ A;  4A3B K;  2CW0 A;  4XLP A;  2JA8 C;  3S1M C;  4LK0 A;  4A3I C;  3PO2 K;  4XSX A;  4QIW L;  2JA5 K;  5IYD K;  2R93 K;  1I3Q K;  1K83 C;  3S16 C;  4X6A C;  5M5W K;  4A3M C;  3RZD K;  2NVT C;  3GTM C;  3GTQ C;  3S2D K;  4MQ9 A;  5IYB C;  5TMF A;  5M3F K;  3CQZ C;  2NVX K;  2VUM K;  3S1Q C;  2JA6 K;  4A3K K;  3K7A K;  5IP7 C;  2B63 C;  3S14 K;  4BBS K;  1Y1W C;  1TWC K;  1WCM K;  3GTG C;  2O5J A;  5C44 K;  3GTP C;  2Y0S D;  4Y52 K;  3I4M C;  3HKZ D;  4MEY A;  2NVY C;  3GTJ C;  4KMU A;  3GTL C;  4A3L C;  2R92 C;  3FKI K;  5C4X C;  4KN4 A;  3M3Y K;  3H3V D;  3GTO C;  3WOD A;  3HOZ C;  2E2I K;  4AYB L;  4OIN A;  1XPP A;  5M5Y K;  1I50 C;  4OIO A;  2JA8 K;  2WB1 D;  2Y0S L;  4A3J C;  3DXJ A;  3HKZ L;  4QJV B;  2E2H C;  4A3I K;  4A3E K;  3S1M K;  4A3F C;  4C2M K;  4G7O A;  5FLM C;  1SMY A;  3H3V L;  4X6A K;  1K83 K;  4Y7N C;  3S16 K;  4A3M K;  2NVT K;  1SFO C;  3GTM K;  4OIR A;  4LK1 A;  5D4D A;  4BBR K;  5IYB K;  3CQZ K;  3HOX C;  3RZO C;  3S1Q K;  3EQL A;  2JA7 C;  2YU9 C;  3HOY C;  5IP7 K;  2B63 K;  4KN7 A;  1Y1W K;  5IP9 C;  3GTG K;  3PO3 C;  4G7H A;  3GTP K;  4A3C C;  3I4M K;  4BY7 C;  3GTJ K;  4YFX A;  4A3L K;  3H0G C;  2R92 K;  5C4X K;  3S2H C;  5IYC C;  4YFK A;  5M5X K;  3GTO K;  3HOZ K;  1TWF C;  1R9T C;  4A93 C;  3S1N K;  2R7Z C;  1I50 K;  4YG2 A;  4Q4Z A;  4A3J K;  2E2H K;  3M4O C;  4BXX K;  4A3G C;  2BE5 A;  3GTK C;  2WAQ D;  4A3F K;  3S15 K;  1I3Q C;  4LJZ A;  4YFN A;  1TWG C;  3RZD C;  5FLM K;  2A69 A;  2PMZ D;  1IW7 A;  4Y7N K;  3I4N C;  4XLN A;  1TWA C;  5C4J C;  3HOU C;  3S1R C;  3RZO K;  5FJ8 K;  4ZH4 A;  2PA8 D;  4QJV A;  3HOX K;  2E2J C;  3GTQ K;  3HOY K;  1TWH C;  2YU9 K;  4BY1 C;  2JA7 K;  3S14 C;  2WB1 L;  2NVQ C;  5IP9 K;  2WAQ L;  3PO3 K;  1ZYR A;  4BXX C;  5M3M K;  1I6H C;  4A3D C;  2O5I A;  3HOW C;  4C3H K;  4A3C K;  2A68 A;  4BY7 K;  4C3I K;  3HOV C;  2NVY K;  3H0G K;  1YNN A;  1YNJ A;  4MEX A;  1Y1V C;  4C3J K;  5IYC K;  3GTL K;  3S17 C;  3S2H K;  1TWF K;  5C3E C;  1R9T K;  4A93 K;  3S15 C;  4A3B C;  4OIP A;  2R7Z K;  2A6H A;  5TMC A;  4A3E C;  3M4O K;  4A3G K;  3PO2 C;  2JA5 C;  3GTK K;  5IYD C;  4LLG A;  1TWG K;  2R93 C;  2PPB A;  3S2D C;  3I4N K;  4Q5S A;  4BBR C;  1TWA K;  5C4J K;  3HOU K;  3S1R K;  1SFO K;  2VUM C;  2NVX C;  2E2J K;  4A3K C;  2JA6 C;  3K7A C;  1TWH K;  4BY1 K;  4AYB D;  4G7Z A;  4BBS C;  1TWC C;  1WCM C;  2NVQ K;  4NOI A;  4JK1 A;  5C44 C;  1BDF A;  1I6H K;  4A3D K;  4Y52 C;  4OIQ A;  3HOW K;  1I6V A;  2PMZ L;  4QIW D;  3HOV K;  3FKI C;  3M3Y C;  2PA8 L;  3S17 K; 
#chains in the Genus database with same CATH topology
 1JQW A;  4KB2 A;  4GTF A;  4LOW A;  4XSX A;  1F7V A;  1SFO A;  1TWH A;  3S16 C;  2JA7 A;  2YU9 A;  1BJT A;  5IYB C;  5TMF A;  2VUM K;  3S1Q C;  4WJ3 M;  4KMA A;  4A3K K;  1PJ6 A;  4Y52 K;  3HKZ D;  4MEY A;  1WOS A;  1USO A;  1EFW A;  3GTL C;  2R92 C;  4C3J C;  4KN4 A;  1R9T A;  5M5Y K;  2JA8 K;  1INN A;  4A3J C;  3HKZ L;  1TWG A;  4QJV B;  4A3I K;  4C2M K;  4P5B A;  1J6W A;  4X6A K;  2NVT K;  1SFO C;  4BBR K;  3HOX C;  2JA7 C;  2YU9 C;  1PJ7 A;  1G51 A;  3N0B A;  5E68 A;  3I4M K;  4BY7 C;  4C3I C;  2GSU A;  5CHP A;  4A3L K;  5JFE A;  3LAJ A;  3BP8 C;  4YFK A;  5M5X K;  3GTO K;  3L4J A;  1R9T C;  4BLB A;  1I50 K;  3M4O C;  4BXX K;  2R93 A;  1F93 A;  2WAQ D;  1TWG C;  1IL2 A;  4XLN A;  2GSN A;  1IBA A;  3QX3 A;  5IOQ A;  3T00 A;  4QJV A;  3GTQ K;  3HOY K;  4BY1 C;  1XZP B;  2WB1 L;  5IP9 K;  2WAQ L;  3CAG A;  1J6X A;  1ZYR A;  4BKW A;  4GTB A;  4A3D C;  3GTO A;  2A68 A;  1BGW A;  1UV7 A;  2D6F C;  1YNN A;  1I50 A;  4MEX A;  5IYC K;  1XXA A;  2R7Z K;  2A6H A;  4A3G K;  4GTE A;  3GTQ A;  3AD9 C;  2JH3 A;  4LLG A;  3JST A;  2R93 C;  1J98 A;  2GAH C;  3AQO A;  4BBR C;  1TWA K;  2B63 A;  5IOT A;  2E2J K;  4BBS C;  4GTA A;  4GT9 A;  1I6H K;  3HOW K;  1I6V A;  3FOE A;  4QIW D;  3HXA A;  2PA8 L;  3S17 K;  2E2I C;  4GZY A;  1HQM A;  4XSZ A;  1BS2 A;  3S1M C;  4LK0 A;  2XCQ A;  3PO2 K;  4QIW L;  5IYD K;  1L0W A;  1K83 C;  3S2D K;  3RZD K;  3GTQ C;  3FOF A;  5M3F K;  1EH1 A;  2P5M A;  2NVX K;  1YCL A;  2B63 C;  5C44 K;  2Y0S D;  1O25 A;  1IE0 A;  4KMU A;  3FKI K;  4KAW X;  3H3V D;  3HOZ C;  4KDD A;  1O29 A;  2FQT A;  4KC6 A;  1XZQ B;  2Y0S L;  2E2H C;  5EGE A;  1WOO A;  4A3E K;  4KM9 A;  2NVX A;  4G7O A;  4P5A A;  3H3V L;  4A3M K;  3GTM K;  3RZO C;  3CQZ K;  3EQL A;  1V5V A;  5IP7 K;  4FM9 A;  1Y1W K;  3GTG K;  3PO3 C;  4PAB A;  1ZBS A;  3GTP K;  4C3H C;  4A3C C;  4WJ4 A;  3GTJ K;  5C4X K;  2XCR B;  1DCH A;  3S2H C;  1O26 A;  4KAT A;  4A93 C;  3S1N K;  1B4B A;  4RMF A;  4KB4 A;  4YG2 A;  2BE5 A;  1EK8 A;  4A3F K;  4YFN A;  3M3Y C;  2VUM A;  3RZD C;  5FLM K;  2PMZ D;  4Y7N K;  3I4N C;  5C4J C;  3HOU C;  1XZQ A;  1O28 A;  1TWH C;  1WOR A;  5M3M K;  4BLA A;  4KAS A;  2O5I A;  1IQ0 A;  3L4K A;  3HOV C;  3H0G K;  1TWF K;  1O2F B;  3G4C A;  1VJE A;  3AQP A;  4A3E C;  1DCP A;  3GTK K;  3TFH A;  4WIL A;  3S1R K;  2VUM C;  4A3K C;  3GSI A;  4AYB D;  4G7Z A;  4G0U A;  2NVQ K;  1VLO A;  2FQO A;  1GE9 A;  4GTL A;  1BDF A;  1C0A A;  4Y52 C;  2XCO A;  3GEH A;  5TJ3 A;  1WSR A;  1Y1V K;  3S1N C;  5C3E K;  3GTK A;  4A3B K;  2CW0 A;  2JA8 C;  4AH6 A;  4A3I C;  2JA5 K;  4C2M C;  4X6A C;  5M5W K;  2NVT C;  1DD5 A;  4DDQ A;  4MQ9 A;  2JA6 K;  3K7A K;  2RGR A;  3V4G A;  3SZZ A;  1TWC K;  1WCM K;  1ISE A;  1Y1V A;  3I4M C;  3OEP A;  1J6V A;  3TFI A;  4A3L C;  3M3Y K;  3GTO C;  3WOD A;  2R7Z A;  4OIN A;  1I50 C;  4OIO A;  4BXX C;  1XXB A;  1WSV A;  2PHC B;  1TWA A;  4ILD A;  2JA6 A;  3S16 K;  3IPJ A;  2V6T A;  3AD8 C;  1WCM A;  4OIR A;  4LK1 A;  5D4D A;  5IYB K;  2ZUE A;  3S1Q K;  3AD7 C;  3HOY C;  1ZVU A;  2EBB A;  4KN7 A;  5IP9 C;  2CFA B;  3GDZ A;  5HL8 A;  4G7H A;  2V6U A;  3ORE A;  1F9N A;  4YFX A;  2R92 K;  1RU0 A;  5IYC C;  2W7V A;  1WQF A;  3OPF A;  4C45 A;  2R7Z C;  1EQR A;  4A3J K;  4A3G C;  1F7U A;  2A69 A;  4KMD A;  1IW7 A;  4J3N A;  1HI9 A;  1TWA C;  1O2A A;  4ZH4 A;  4KM8 A;  5FJ8 K;  3HOX K;  2E2J C;  2JA7 K;  2YU9 K;  1EI6 A;  1I6H C;  3NUH A;  3FKI A;  3HOW C;  4BY7 K;  1YX2 A;  4C3I K;  3MML B;  2NVY K;  2CFA A;  3S17 C;  1WIH A;  1R9T K;  3AH5 A;  4OIP A;  4G0W A;  5TMC A;  3M4O K;  3PO2 C;  1JVI A;  1USM A;  2GSO A;  3GTM A;  5IYD C;  1TWG K;  3CQZ A;  2PPB A;  4KAR A;  3FHZ A;  3S2D C;  4Q5S A;  1O24 A;  1Y1W A;  2NVX C;  3GTG A;  4BY1 K;  1ZQ1 C;  1WOP A;  3A8J A;  3GTP A;  3S0X A;  2ZFZ A;  2NVY A;  4NOI A;  5C44 C;  3GTJ A;  2GAG C;  4A3D K;  4OIQ A;  1WQG A;  1X31 C;  2PMZ L;  4LR2 A;  1DCO A;  3LPX A;  4FZB A;  4XCH A;  3FKI C;  1KQ4 A;  2A6E A;  3BP3 A;  4O2D A;  4XLP A;  1PJ5 A;  5L46 A;  2R93 K;  1I3Q K;  4LQY A;  4A3M C;  3GTM C;  3CQZ C;  3GEI A;  5IP7 C;  3GEE A;  3S14 K;  5IOS A;  2KWA A;  5EGH A;  1Y1W C;  1IS1 A;  4BBS K;  3GTG C;  2O5J A;  5CJ9 A;  2RH6 A;  3GTP C;  3H0G A;  2NVY C;  3GTJ C;  3ERE D;  5JVO A;  1TWF A;  5C4X C;  3TFJ A;  3SZY A;  1VH2 A;  2E2I K;  4AYB L;  1XPP A;  3LAP A;  4G0V A;  4GTD A;  5IOR A;  3S15 K;  1I3Q A;  2WB1 D;  3DXJ A;  3S1M K;  4A3F C;  4KMH A;  5FLM C;  1SMY A;  1K83 K;  4Y7N C;  4P9S A;  1VGX A;  3BUE A;  2B63 K;  3N0C A;  1O27 A;  3T02 A;  3N3Y A;  2E2I A;  3H0G C;  1WQH A;  3HOZ K;  1TWF C;  2JA5 A;  4Q4Z A;  2Y3P A;  3T01 A;  1K83 A;  2E2H K;  3GTK C;  1I3Q C;  4LJZ A;  3VA7 A;  3G4A A;  3Q3Q A;  3S1R C;  3RZO K;  1TWC A;  2PA8 D;  3S14 C;  2NVQ C;  1AB4 A;  3PO3 K;  4GTC A;  4C3H K;  4A3C K;  3A8K A;  1XZP A;  1YNJ A;  4GFQ A;  3GTL K;  1Y1V C;  4C3J K;  3S2H K;  2E2H A;  1XXC A;  5C3E C;  4A93 K;  3S15 C;  4A3B C;  2JA5 C;  2P8T A;  4M1X A;  1ZXO A;  3TTG A;  3I4N K;  5C4J K;  3HOU K;  1VRQ C;  1SFO K;  3GIR A;  2JA6 C;  1O2B A;  1TWH K;  3K7A C;  1JOE A;  3ADA C;  1TWC C;  1WCM C;  3A8I A;  4JK1 A;  3GTL A;  2ZUF A;  2R92 A;  4PAA A;  3HOV K;  1B4A A;  2V6S A; 
#chains in the Genus database with same CATH homology
 1Y1V K;  3S1N C;  2A6E A;  2E2I C;  4GZY A;  1HQM A;  5C3E K;  4XSZ A;  4A3B K;  2CW0 A;  4XLP A;  2JA8 C;  3S1M C;  4LK0 A;  4A3I C;  3PO2 K;  4XSX A;  4QIW L;  2JA5 K;  5IYD K;  2R93 K;  1I3Q K;  1K83 C;  3S16 C;  4X6A C;  5M5W K;  4A3M C;  3RZD K;  2NVT C;  3GTM C;  3GTQ C;  3S2D K;  4MQ9 A;  5IYB C;  5TMF A;  5M3F K;  3CQZ C;  2NVX K;  2VUM K;  3S1Q C;  2JA6 K;  4A3K K;  3K7A K;  5IP7 C;  2B63 C;  3S14 K;  4BBS K;  1Y1W C;  1TWC K;  1WCM K;  3GTG C;  2O5J A;  5C44 K;  3GTP C;  2Y0S D;  4Y52 K;  3I4M C;  3HKZ D;  4MEY A;  2NVY C;  3GTJ C;  4KMU A;  3GTL C;  4A3L C;  2R92 C;  3FKI K;  5C4X C;  4KN4 A;  3M3Y K;  3H3V D;  3GTO C;  3WOD A;  3HOZ C;  2E2I K;  4AYB L;  4OIN A;  1XPP A;  5M5Y K;  1I50 C;  4OIO A;  2JA8 K;  2WB1 D;  2Y0S L;  4A3J C;  3DXJ A;  3HKZ L;  4QJV B;  2E2H C;  4A3I K;  4A3E K;  3S1M K;  4A3F C;  4C2M K;  4G7O A;  5FLM C;  1SMY A;  3H3V L;  4X6A K;  1K83 K;  4Y7N C;  3S16 K;  4A3M K;  2NVT K;  1SFO C;  3GTM K;  4OIR A;  4LK1 A;  5D4D A;  4BBR K;  5IYB K;  3CQZ K;  3HOX C;  3RZO C;  3S1Q K;  3EQL A;  2JA7 C;  2YU9 C;  3HOY C;  5IP7 K;  2B63 K;  4KN7 A;  1Y1W K;  5IP9 C;  3GTG K;  3PO3 C;  4G7H A;  3GTP K;  4A3C C;  3I4M K;  4BY7 C;  3GTJ K;  4YFX A;  4A3L K;  3H0G C;  2R92 K;  5C4X K;  3S2H C;  5IYC C;  4YFK A;  5M5X K;  3GTO K;  3HOZ K;  1TWF C;  1R9T C;  4A93 C;  3S1N K;  2R7Z C;  1I50 K;  4YG2 A;  4Q4Z A;  4A3J K;  2E2H K;  3M4O C;  4BXX K;  4A3G C;  2BE5 A;  3GTK C;  2WAQ D;  4A3F K;  3S15 K;  1I3Q C;  4LJZ A;  4YFN A;  1TWG C;  3RZD C;  5FLM K;  2A69 A;  2PMZ D;  1IW7 A;  4Y7N K;  3I4N C;  4XLN A;  1TWA C;  5C4J C;  3HOU C;  3S1R C;  3RZO K;  5FJ8 K;  4ZH4 A;  2PA8 D;  4QJV A;  3HOX K;  2E2J C;  3GTQ K;  3HOY K;  1TWH C;  2YU9 K;  4BY1 C;  2JA7 K;  3S14 C;  2WB1 L;  2NVQ C;  5IP9 K;  2WAQ L;  3PO3 K;  1ZYR A;  4BXX C;  5M3M K;  1I6H C;  4A3D C;  2O5I A;  3HOW C;  4C3H K;  4A3C K;  2A68 A;  4BY7 K;  4C3I K;  3HOV C;  2NVY K;  3H0G K;  1YNN A;  1YNJ A;  4MEX A;  1Y1V C;  4C3J K;  5IYC K;  3GTL K;  3S17 C;  3S2H K;  1TWF K;  5C3E C;  1R9T K;  4A93 K;  3S15 C;  4A3B C;  4OIP A;  2R7Z K;  2A6H A;  5TMC A;  4A3E C;  3M4O K;  4A3G K;  3PO2 C;  2JA5 C;  3GTK K;  5IYD C;  4LLG A;  1TWG K;  2R93 C;  2PPB A;  3S2D C;  3I4N K;  4Q5S A;  4BBR C;  1TWA K;  5C4J K;  3HOU K;  3S1R K;  1SFO K;  2VUM C;  2NVX C;  2E2J K;  4A3K C;  2JA6 C;  3K7A C;  1TWH K;  4BY1 K;  4AYB D;  4G7Z A;  4BBS C;  1TWC C;  1WCM C;  2NVQ K;  4NOI A;  4JK1 A;  5C44 C;  1BDF A;  1I6H K;  4A3D K;  4Y52 C;  4OIQ A;  3HOW K;  1I6V A;  2PMZ L;  4QIW D;  3HOV K;  3FKI C;  3M3Y C;  2PA8 L;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...