5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
molecule keywords Arginine repressor
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
3D5LA 2MLKA 3DPTA 2PLYA 3VODA 4UVCA 3HRUA 2CG4A 1FBQA 5BS6A 1ON1A 1B1BA 1IXCA 2YSRA 5ERIA 1YFHA 1TBXA 3RDIA 2WWYA 1K6OA 3R6SA 4G7ZF 3DXJF 1G3TA 3BPVA 4RS8A 1IXSB 1IN4A 4QLCU 2VOPA 4KC6A 2OBPA 1R23A 1R1UA 4FT8A 4DQ2A 1XXCA 5CYVA 5HS8A 4MGRA 2HZTA 3JAMK 4L9TA 3DEUA 1G6NA 4L5JA 3MAJA 3RI4A 1ZG1A 4XLPF 1R5GA 4OIRF 3O3KA 4Y15A 3HSFA 2DPUA 4HV5A 3J80Z 1P4AA 2XKOA 4LGWA 1YYVA 4KYWA 1PDNC 1CGPA 3L2CA 1MD0A 1YW7A 1HSTA 2ZMEB 3H92A 5FLXZ 4GYGA 1Y0UA 2J5OA 1QPMA 3BJOA 1L3LA 3K1PA 4KT5C 3TDUC 1JE8A 3QRFF 1TQIA 4YFKF 4WCGA 4MQ9F 4A0ZA 1PP8F 2EJRA 1W7PA 3RIRA 4R8HA 1O3RA 3LSTA 3BJ6A 5AONA 3KEQA 4U7BA 4U0WA 3ABTA 4UV9A 3IC7A 5JFRA 2IA2A 1O3QA 3HRTA 1O3SA 4I0AA 3CTAA 2M8EA 4CHUA 4ZH4F 2XHKA 1UCRA 3DKWA 4I98B 2FNAA 4PGGA 3EYIA 2WC2A 5BMZA 1BIBA 4G6QA 2ZBKA 1H9GA 2EA2A 2DBBA 2EFOA 2VXZA 4PGHA 1RZ4A 2PMHA 3CUQB 1YIOA 4S05A 4ENNA 1X3UA 3E6BA 1KA8A 4JBAA 3RYPA 4Q48A 4G8XA 5H6QA 5LRRA 2ELHA 1TLHB 5DD4A 4A5NA 4IHTA 2HTJA 3DQVC 4KIBA 5DYMA 3CO6C 2FEZA 4ZYHA 4G7OF 3GO5A 3ROUA 4HDUA 3GUDA 1TNTA 4UUVA 1BJAA 1FYMA 3GWZA 4HA8A 3CAGA 2YR2A 1LVAA 1D5VA 3RTRA 1P2FA 5AIPA 2WV0A 3FHZA 5IT9Z 3WE2A 2K02A 4WK8F 3FXQA 5HDKA 5HLHA 3GFIA 4M72A 4ENKA 4HF2A 4S04A 1MKMA 2OQGA 2Q8KA 2DU9A 1SD6A 3BWGA 1ZYRF 2J5PA 2RGVA 1RI7A 5E20A 4EVIA 1J75A 2VT3A 2D45A 1GE9A 3VB2A 3MMLB 2P4WA 2P5VA 2JPCA 5JHUA 1DP7P 3NEUA 4WXDA 4CO8A 1LEAA 4ASNA 5L3FA 4P9UA 1FC3A 2HOEA 2YU3A 1FP2A 2A6EF 4NHJA 1U5TA 4AVPA 4KN7X 1JHFA 2G7UA 2CQKA 5L3CA 3B73A 5DUKA 1FZPB 4JQFA 1L0OC 3DPLC 2DT5A 4A5MA 3ZP5A 4YIFA 2DW4A 3FWEA 4A0YA 2JZYA 2VC1A 4ZZLA 3O2PE 6PAXA 3V8JA 4EJVA 1SFEA 4HLXA 1W7PD 1HXDA 3P7NA 3EUHA 1TW3A 3Q9SA 4Q5SF 1KU7A 1KQ8A 2W25A 1WQGA 3B02A 1T0FA 4XBFA 2V1XA 3GYHX 4NQWA 3ZMUA 2XCRB 2DLLA 2X4HA 3JTHA 5ED4A 5HLIA 4HV6A 1ISEA 1UHMA 5LEJA 2ESHA 2PN6A 3I59A 4OIOF 3HIFA 3K1MA 3ERED 2MBFA 1FP1D 2EFWA 4NB5A 1BIAA 3U2RA 5ILVA 2KJBA 5E8IA 1FLIA 2L4MA 3TO9A 2FNPA 5D5XB 1WRJA 2VT2A 2H09A 5DEQA 3WTTC 2ZFWA 3SHFA 2BBYA 4E70A 1ODDA 3OREA 3C7JA 3CLOA 3CUOA 2FMYA 4OINF 4LB5A 2LSOA 2VBXA 1WQHA 5KK1A 5ILSA 5LGTA 1V3FA 5LHIA 1TTYA 4RGXA 1R36A 3KE2A 3COAC 1O7FA 2FBKA 5CJ9A 3QPTA 4YFXF 2F2EA 3ZN0A 1ZARA 2VONA 1FSEA 3I5UA 1FOKA 5F6FA 1KQ9A 3V4GA 4ESJA 3L00A 4BAYA 3EDPA 1MDMB 5BOXA 2DTRA 2OZ6A 2HS5A 2UXXA 5L3DA 4HX7A 2ZXJA 3ML6A 4KIFA 3MZHA 5DCMB 3DV8A 2UWMA 5ICFA 3HHHA 5LHHA 2EWNA 5E8GA 4IJAA 2KJCA 2R7FA 2RGRA 3DF8A 4BH9A 2PBIA 3T8TA 1R1TA 4OIPF 1S8NA 4EGYA 3FXUA 5D5UB 3F22A 1FWZA 1LDKB 2HYGD 2FOKA 1ZLJA 1TQPA 1T39A 3LWFA 4M71A 1DDNA 1FBSA 4LFUA 1S3JA 5DV5A 3GFLA 5HLGA 2XROA 1XSDA 2HEOA 4LK0F 5J8FA 2GA1A 5HS9A 4FX0A 4LD5A 2RDPA 4LLGF 3WE3A 3F8MA 3FMQA 1R22A 1W5SA 2Z3YA 1LDDA 3I4PA 1ZG5A 3FOFA 2ZNZA 5K1YA 3LPXA 3MEXA 4AIJA 4PDKA 3LQQA 1HSJA 3S2WA 1QO0D 5FD6A 2Y0MA 4M9XA 1U5TC 2E1NA 1G4DA 1WIHA 2D1VA 4ENJA 5CVVA 2UZKA 3HUGA 2EA4A 2YX4A 3L9FA 4KAWX 3WU0A 3DFGA 5ICCA 3MWMA 4LB6B 4AWXB 1Z6TA 1FX7A 1YLFA 3FMRA 3ECOA 1Z91A 1JGSA 4A6DA 1T98A 4U7DA 3MZYA 4EJWA 2C6YA 2IA1A 1IN6A 4RGSA 5HDNA 1MZBA 4HAMA 3K9TA 1NHAA 2ZJ2A 2XUBA 5JR3A 4IXAA 3WTSC 1BI1A 4BQAA 1DUXC 2NNNA 3I54A 2Q2EA 2YX7A 3JTGA 2QQ9A 3J7AO 5ICGA 3QP6A 3IWZA 2IW5A 3GVAA 2WTEA 3C3WA 1OMIA 1XMKA 3P9CA 3WODF 3F8NA 2X0LA 5LEKA 3F21A 2KIUA 4XSZF 1UHWA 3K1NA 5TRDA 4RB2C 3FXRA 4KN4X 3KEOA 1XXAA 1LNWA 1MJAA 2W57A 2P8TA 5BPIA 2CSOA 2E7XA 5IT3A 1DPRA 2L54A 1I27A 2JSCA 3TGNA 3IWFA 2DK5A 1T38A 3CUQA 3FM3A 3E6DA 1FSHA 1J9IA 1XXBA 1HKSA 3GX4X 5LGUA 1XDSA 3E5XA 2P6TA 1EH8A 4MEYF 3QU3A 3KP6A 3WGHA 2HQNA 2ESNA 5DD8A 1KYZA 3CO7C 4KB2A 4LMYA 3W6KB 4O5VA 3G73A 2CWEA 1ZRFA 3K2ZA 2K86A 2QQBA 3KFWX 2STTA 1KQ0A 1MGTA 2OD5A 4IF4A 2EB7A 1DPUA 5CVUA 1P6RA 2F5CA 3JAMZ 1KU2A 1IZ1A 3O6BB 1QZZA 5D8LB 3WTZA 1BGWA 4A0XA 3E3VA 2MH9A 1ZGJA 1P4WA 2O0YA 2XASA 1XCVA 3L7WA 3GEZA 4L9VA 1FYLA 3KETA 3WTVC 2NAZA 5K5QA 1HW5A 4L9NA 5E1XA 2ZO4A 1U2WA 2O6GE 1USSA 5DCMA 1K78A 3ULQB 1BC8C 5FD5A 1KGSA 5E1WA 2Y75A 4Y17A 2Z99A 3D0SA 4G7HF 2OZUA 4OMYA 1EV7A 3WGIA 3RYRA 5BQTA 5D4SA 4RGRA 4I2OA 2QWWA 5J8CA 1R5HA 2CYYA 3F8FA 1GXPA 1HW2A 3GLXA 1I1GA 3EETA 2P7CB 1WI9A 4ENMA 3K69A 4FHTA 1ZG3A 3LA7A 2KKOA 3JW4A 3HYIA 2HKXA 1I6XA 1RUNA 3E97A 2VE9A 3MCZA 4CGZA 2PJPA 4I02A 3BUEA 1KYWA 3TKYA 1A04A 5E17F 3T5XA 2IJLA 4HW0A 5L3BA 2F5FA 4IPAA 4CZZA 4R1HA 4HOBA 1S7AA 1XSXA 4M74A 4RAYA 1BJTA 1IXRC 4R79A 4ZYDA 3G3ZA 4KFCA 2Q0OA 3MFKA 4G9YA 3P9IA 2OU2A 1HKTA 3ZMVA 2EFPA 1AWCA 1K78B 3VA7A 1G3WA 3KP5A 1SD5A 1WSUA 3LFKA 4XSXF 1BC7C 1F9NA 2DPDA 4L0ZB 1LDJA 1Z6RA 1W7PB 1J0RA 4EJUA 2W85A 3JSOA 4EM1A 2QBYB 4WXHA 1P92A 5JVTA 4G6DA 2PI0A 2CW0F 2HQRA 4M9ZA 1XN7A 4L9JA 3ZMDA 4KUMA 1IN8A 4G0WA 3VFZA 3Q9VA 3HRSA 1GHCA 1ZREA 1SMYF 1O57A 4XRFA 3FZVA 3KZZA 4P5OA 1E2XA 2Z9OA 3TOAA 3RKYA 5HDGA 3C1DA 1BOAA 2RV8A 5D4RA 3CUQC 2JTVA 1B4AA 1LQ1A 2MH2A 3WTWC 1IS1A 1EK8A 4MNUA 1XDUA 2PMUA 4I7HA 3IRRA 1XCBA 1B59A 1SAXA 1OKRA 3OPFA 2MA3A 1ON2A 4N0BA 2A07F 1J5YA 2L01A 4ETSA 3F6OA 2L4AA 4ZZDA 4CXFA 1WQ2A 1XGNA 3E5QA 3ZMTA 4FM9A 2OQRA 2UXNA 1STZA 2E1CA 1T6SA 5L3EA 3GFMA 4M73A 3V7RA 4BXUA 4KICA 2GAUA 1F5TA 1ZRDA 1AOYA 3J81K 3I59B 2RVCA 3DP7A 1YS6A 2P5LC 2LNBA 3T8RA 3TO7A 4G0VA 2RNJA 1U3EM 2O61A 4BHBA 3L4KA 2F5EA 3IL2A 1U8RA 2QUFA 1YS7A 1SD7A 3ZMSA 4K2EA 2LKPA 4GCVA 1YQAA 3TOBA 1FY7A 2DQLA 4KB4A 2HDCA 3QP5A 4ESBA 1IRGA 4B8XA 4KDPA 3NUHA 4EV0A 5HVQC 4BHCA 3HSEA 4HZFA 4HYEA 4MQVA 3P9KA 2M87A 3H3UA 2BEOA 2A61A 1IW7F 4BYYA 3F6VA 2AXLA 4A2UA 4U0YA 5D5VB 1K7AA 2JPBA 4J3NA 4AIHA 2KIMA 2V1DA 4UV8A 2K7LA 1VTNC 4BNCA 3BDDA 1SD4A 3RPQA 2O3FA 3GF2A 3RPUA 3GZ6A 2CFXA 4LG0A 1U5TB 1PP7U 1FYKA 3BP8A 1W4MA 5LGNA 2GWRA 5BPDA 1YG2A 2GXGA 2MD5A 2V1UA 1R00A 5IT9K 1WWXA 1OYWA 3RKWA 1LB2A 1HBXG 1B9MA 3FX3A 4G94A 5ILUA 4EQQA 4FX4A 1QZYA 1R1VA 4WX9A 3V8LA 2MLGA 5LHGA 5F64A 1D8KA 3IHUA 4LLLA 3K0LA 3VOEA 1Z9CA 1MJBA 4OU0A 4P55A 2ACJA 3GW2A 2DI3A 2VBYA 2G9WA 3WGGA 2CO5A 2VE8A 2XAFA 3R61A 4XLNF 1XMAA 1BI3A 2XAQA 2A69F 4I0BA 3ZMZA 4Q47A 1TNSA 1Z05A 4GGGA 4MTDA 3F23A 1XD7A 2ISZA 1KU9A 2FBHA 1IN7A 1ZH5A 1C0WA 2L3DA 3WU1B 4KNYA 1J7KA 1F1ZA 2XAHA 2QVOA 5K5OA 5E18F 4ESFA 1O7LA 2K4BA 4IHSA 3GZ5A 3CJNA 2NNYA 2ADUA 1ZRCA 2DO7A 2IT0A 1I5ZA 1ONVA 1QGPA 3ECHA 5K5RA 1IUYA 1ZN2A 1QNTA 2D1HA 5H6RA 2XVCA 3CDHA 2JRTA 2F5DA 3HHGA 4WXCA 2W84A 3E6CC 3BZ6A 4A6EA 2O03A 1IRFA 3WG9A 1BN5A 3V7SA 4AD9A 1REPC 4CICA 1J2XA 3PQJA 3HOSA 3QPHA 2FSWA 3LA3A 2OAZA 4DNCA 2LF7A 2LDUA 4LJZF 2FE3A 2QYOA 2ISYA 2LF8A 2W24A 4P96A 5DUIA 1XGOA 4L5IA 3IRQA 3BROA 2M1BA 1Z1DA 1G3SA 1DD5A 5FFZA 2HGCA 2XKPA 2P7VB 2YPRA 3I58A 1UB9A 4F7ZA 1JHHA 4HF0A 2ZMEA 3I71A 4HDVA 2HYFA 4YG2F 1YW9A 3R4KA 2DQRA 3F8CA 1TQMA 3U1DA 4TV7A 1BI0A 4CDGA 4UVAA 4EJTA 3NRVA 4RGUA 4PZJA 3J81Z 5DCFA 4M6XA 5CVIA 2FA5A 5A2QZ 3REOA 4UHTA 3QOPA 4M6YA 1YO5C 5FO5A 1KU3A 2RQPA 1PUEE 2L02A 1K79A 4LK1F 1GVJA 2HR3A 2CGPA 4LG0B 3KP4A 4BHPA 2HFHA 3ABUA 4RB0A 2RC4A 2STWA 4UXNA 3BY6A 2ZNYA 3KZYA 4Y13A 1B9NA 4B09A 2H6CA 2ZKZA 5FB2A 2PQ8A 2P6SA 2KRFA 2EV0A 3M1EA 2FMLA 5LLQA 1RUOA 3SQNA 1Z7UA 1YTYA 4U88A 3QU6A 4ON0A 2ZCWA 3L09A 4HQEA 5HOOA 1EH1A 1W5TA 4YIIA 5E1ZB 2QBYA 3E5UA 3WTYC 3I0TA 3FMSA 1P4XA 2VN2A 5D8KB 4MEXF 2XIGA 2P5KA 4PCQA 2A3SA 2K27A 4KA4A 2XCQA 1OYIA 5CLSA 2TDXA 2EV5A 3TDZC 3H3ZA 4L0YB 2JT1A 3KLNA 2KWAA 3M8EA 2M45A 1HW1A 2H6BA 3QX3A 1BI2A 4IVNA 3EYYA 3N4MA 2E7WA 3FOEA 1RIOH 1H0MA 2IA0A 1FPQA 4HX4A 5KVRA 2EFNA 1H9TA 2XAGA 2BV6A 4N9HA 3I53A 5JVOA 2FF4A 1FBUA 4WF2A 2H27A 3LA2A 5FGMA 5FFXA 3SZTA 2DK8A 5L3GA 1TW2A 3HRMA 2G7HA 3HOTA 2COMA 2NRAC 4I01A 1E17A 3R0JA 3HTSB 2QM3A 4IRGA 4HX8A 4LLNA 4Z2YA 1R58A 4HF1A 1OPCA 2BYVE 2PG4A 3KP2A 4RB1A 4KMFA 2V6CA 2R7DA 3V8KA 5D6EA 4A12A 4EJOA 2XCOA 3IKVA 3PFIA 2IP2A 3T1BA 1T2KA 2XGXA 2HKOA 1V4RA 3U9GA 2A6HF 4KDDA 2PFBA 1OR7A 3J80K 4U0VA 2FXAA 3ZQ7A 1O3TA 3SXYA 2IPQX 2VOOA 5CVRA 2GZWA 5FLXK 2P5MA 2HTSA 1SFXA 2PEXA 4GYIA 1EH7A 3QAHA 2ETHA 1XSVA 5AIQA 5F1RA 2DFIA 3TO6A 1ZHFA 5D6FA 4EM2A 2IRFG 2M5WA 3IKTA 3BOQA 2FRHA 4ZYGA 4UVBA 1D8JA 3E6MA 3TQNA 5CVJA 1Q1HA 2Z5UA 2RKHA 1WQFA 2FQ3A 4I09A 1J59A 2VBZA 2BE5F 2MC3A 2FBIA 4HLYA 1R7JA 1ZGAA 2Y3PA 2EK5A 3SZPA 1ZVUA 2V9VA 3LQRA 3BJAA 1ZLKA 1HKQA 3GXOA 4D0PA 5EEHA 3T0YA 5DDGA 4M9SA 4QWQA 2A68F 4EMSA 1LEBA 3EQLF 1QQIA 3RJPA 1OYYA 4MTEA 5ICEA 2QENA 5TJJA 1FT9A 1CF7B 1USTA 5A2QK 2BGCA 1BBYA 3LAJA 2O8XA 4GO1A 3WTXC 2PHCB 2XV4S 2GA2A 2A5YB 5EEGA 3C18A 2GQQA 3OOPA 1MDMA 4HQMA 4IRIA 2Y48A 1YW8A 1IN5A 1LJ9A 1XGSA 2KIFA 3F72A 3AAFA 3KLOA 2QZ8A 3OV8A 3R0AA 1JXSA 1I1SA 1AB4A 4IRHA 1BM9A 1QBJA 1SMTA 2NS0A 3NQOA 3ELKA 2FU4A 3M8FA 4G0UA 2Z33A 4Q4ZF 2XAJA 3HTUA 2OA4A 4EM0B 3M7GA 4JK1X 1S29A 1ULYA 2XRNA 2R3SA 1CF7A 4O6JA 1G3YA 2HWVA 4KIGA 2GXBA 4H0EA 1SFUA 3I64A 1HQCA 2VODA 5J6XA 1GXQA 4L18B 1IAWA 4O3MA 1XB4A 4MHGA 3F8BA 1U6GA 3WTUC 5LBQA 4KMUX 3N97A 4RB3C 2ZFZA 4OOIA 2VBWA 2M30A 3FM5A 2IVMA 2QQAA 4OIQF 1FNNA 4P9FA 3R60A 1EH6A 5LRSA 3ZN1A 3Q5FA 4CYDA 2B0LA 1S6LA 3JSPA 2V79A 3KP7A 3F3XA 3HSRA 1UFMA 4EGZA 2QLZA 2EV6A 4AIKA 1S7OA 4WWCA 4OMZA 3LAPA 3KP3A 1RNLA 4HBLA 3BPXA 4ZYEA 4GXOA 3OEPA 1B6AA 3MQ0A 1MJ9A 4RAZA 3M9AA 3SFZA 2K4JA 1WKMA 4N9IA 2EFQA 2GIVA 3FF5A 3ISPA 2AS5F 4UNOA 5H20A 2RN7A 3ZPLA 5HS7A 2VC0A 2D2WA 3KCCA 3W6JB 5D5WB 3RKXA 1XGMA 1B4BA 3L4JA 2H94A 1D3YA 1IF1A 3PQKA 3GFJA 3V7CA 2NYXA 1U78A 1ZAOA 4YFNF 2DAOA 1F4KA 3VEPA 5JI6A 4DDQA 4GFQA
chains in the Genus database with same CATH superfamily
3D5LA 2MLKA 3BR3A 4XL9A 3DPTA 2ZC2A 2PLYA 1UV7A 1H89C 3VODA 1WJEA 2WAEA 5JLXA 4UVCA 2LY9A 4DBQA 2ID6A 3HRUA 3HOUC 5IOTA 2CG4A 1FBQA 5BS6A 1QZEA 2BOLA 2R92J 4F91B 1ON1A 1B1BA 1IXCA 2YSRA 5BNGA 1UJ8A 3Q0UA 5ERIA 4C3HK 1YFHA 3AD7C 1TBXA 1KONA 3RDIA 2WWYA 1K6OA 3R6SA 3WU2C 3CJQB 2HOSA 4G7ZF 3DXJF 1G3TA 3BPVA 4KARA 3BT9A 5D4DA 4RS8A 3S17J 1IXSB 2QKMB 1IN4A 3PNYA 2FOWA 4QLCU 5IYCJ 2EIMH 4OIOA 2VOPA 4KC6A 4A3EK 2OBPA 1R23A 2P81A 1R1UA 4P5AA 3AD9C 4FT8A 4DQ2A 1XXCA 5CYVA 5HS8A 3K70D 1TWAK 4XQFA 4WJ4A 4MGRA 1SEUA 2HZTA 3JAMK 4L9TA 4XNFA 3DEUA 5F1JA 1G6NA 4L5JA 3PIPF 1SVMA 4HSTA 2K9MA 3FISA 2EBIA 1K4TA 4JX6A 2BXZA 3K10A 1LPQA 3MAJA 3B6CA 2EINH 1I3QA 2V9PA 3RI4A 3CDIA 1ZG1A 3AD8C 4V2FA 4XLPF 3GSIA 1ENHA 2E2HC 1EA3A 3CQZC 1FTZA 1R5GA 4OIRF 2L9RA 3O3KA 4Y15A 1Y1VJ 4B48A 3HSFA 1QRYA 2CQXA 4HV5A 3J80Z 2DPUA 3QYEA 1P4AA 2XKOA 3HM5A 4LGWA 2H8WA 2FQTA 1YYVA 1XG1A 4KYWA 1BJZA 3S1NJ 2FQOA 4PJ0C 2GSUA 4Y52C 4GT9A 3S1RK 2B63K 1PDNC 3W6VA 1TWHA 1OCOH 1CGPA 3L2CA 1MD0A 2WV1A 5LFAA 1YW7A 3GTPK 2JA7K 4YFKA 1HSTA 2ZMEB 3H92A 3OS0A 5FLXZ 1QA6A 4GYGA 4NDLA 4LOWA 4A3LK 2RAEA 3OYAA 2GM4A 1O2FB 2VUMK 1YCLA 2OV7A 1R9TC 1Y0UA 2J5OA 2ID3A 2V1NA 2DT7B 1QPMA 2VKVA 3BJOA 2VB6A 1L3LA 4PJLA 4A93J 2KHMA 3K1PA 4KT5C 3TDUC 3GTPC 1JE8A 2GOMA 4YFKF 1TQIA 2JK3A 3QRFF 4WCGA 3BP8C 3W2VA 4MQ9F 4NC6A 1MBGA 4A0ZA 2VL8A 3IAM2 1MSFC 1L0WA 1PP8F 3H5AA 1ZR2A 1C0AA 5C3EJ 2EJRA 1K4SA 2YU9C 2GBYA 1R71A 3GTJC 1W7PA 1I3QJ 2MD0A 1MBJA 3RIRA 4R8HA 1O3RA 2BY1A 2HPMA 3LSTA 3BJ6A 5GTHC 5AONA 3H0GJ 4FQGA 4QTRA 3HOYJ 3KEQA 1ETXA 4U7BA 1TWHK 5TJ3A 4A3JC 3KZIC 4U0WA 4GTCA 3ABTA 5E3MA 4UV9A 3IC7A 5JFRA 4MLOA 2IA2A 1JQWA 1O3QA 4A3MC 3OWTA 5FLVA 3HRTA 1O3SA 4I0AA 3CTAA 2K3PA 2M8EA 3DCFA 4BGDA 1WH7A 4CHUA 3BCAA 4ZH4F 2XHKA 1XZQB 1UCRA 2KLOA 1NG7A 2BY0A 3DKWA 2FNAA 4I98B 1X2MA 2HNHA 4N4NB 3GTKC 1OCRH 4PGGA 2ECCA 4B1RA 2M7BA 2XPUA 3HOVJ 3CCLI 3EYIA 2WC2A 5BMZA 1BIBA 4G6QA 2W82A 2ZBKA 3BLYA 1H9GA 2EA2A 2DBBA 4BDZA 2EFOA 2VXZA 4PGHA 1RZ4A 4B3XA 3K4MA 3S15C 3GTQK 4GRIA 3GTJK 1B8IB 2PMHA 3CUQB 3KX2A 1QHHD 1USOA 3FHNA 3QPSA 1YIOA 4S05A 4ENNA 4BE1A 2ME0A 1JT0A 2P0WA 1X3UA 3E6BA 3OYDA 1KA8A 4JBAA 3ASOH 3RYPA 4Q48A 4QPQA 5F0HA 3IH2A 4G8XA 5H6QA 5LRRA 4PFPA 4BJ6C 2NVTC 4A3JJ 2HVQA 2ELHA 2OF7A 1TLHB 3HEFA 5DD4A 2E2JC 2E71A 4A5NA 2R7XA 2JA5J 4AYBN 1VRQC 4HNVA 2XC7A 5J4YA 1OLTA 1D0ZA 5IPAA 2HTJA 4IHTA 1HC8A 3N0BA 3DQVC 3S8PA 4KIBA 2A6TA 5DYMA 3CO6C 4G12A 2FEZA 2JA6A 4ZYHA 3K6GA 2LOOA 1Z0XA 3GO5A 4G7OF 3BP3A 1T08B 2DA7A 2EZKA 2EILH 2LP0A 1TNTA 2OUMA 3GUDA 3ROUA 4HDUA 2JA7J 4KATA 4UUVA 1JT6A 4HEA2 1BJAA 1WGXA 5CPRB 1FYMA 2QF7A 1N25A 3GTOK 3GWZA 3DTIA 1A35A 4BY1J 4HA8A 4IQ4A 2A69A 3A0BC 1IG7A 3PJRA 3CAGA 3JRAA 2YR2A 4DJAA 3IP4B 1LVAA 3ABLH 4D5CA 3RTRA 1P2FA 1WJFA 4FASD 1D5VA 3HDDA 1IRXA 5AIPA 3I4MJ 1XMXA 2WV0A 3FHZA 5IT9Z 3BR1A 1P7IA 3WE2A 2ECBA 2K02A 4WK8F 1IJWC 3FXQA 5HDKA 1VQLI 5HLHA 3GFIA 2B9SA 3ADAC 2WAQL 3CP8A 4M72A 5FLMJ 3SDGA 4QPOA 4ENKA 2MW8A 4HF2A 1A31A 2Y2ZA 1NK3P 4S04A 1WOPA 1MKMA 2KRCA 2OQGA 2Q8KA 2DU9A 4A3EC 4A3FC 1SD6A 3BWGA 4ZDLA 4DYRA 4MEXA 3A0HC 3TBIA 1ZYRF 2J5PA 2RGVA 3OL4A 4BXFA 4E7JA 1RI7A 1K83J 5E20A 2Y0SN 5KNLA 4M3GA 4BEHA 1BR2A 1ETOA 4HNTA 2DA6A 1H8AC 1DGRM 3QODA 3G1MA 2X51A 3OYNA 4EVIA 1J75A 2VT3A 2D45A 3A01B 1GE9A 1LUJB 3VB2A 3MMLB 5EZGA 2BXYA 2P4WA 2F4IA 2E2HJ 3O8GA 2P5VA 3DBLB 2JPCA 5JHUA 4KM9A 1DP7P 3NEUA 4WXDA 4CO8A 1MMAA 3JSTA 1LFUP 1LEAA 3GTJA 4DW6A 1WCMJ 2HQ5A 2NVQJ 4ASNA 5L3FA 2V4JC 4P9UA 4PSXA 1FC3A 3GTLJ 1PUFA 2HOEA 3K4CA 1V5EA 1WSRA 3S1RC 5B66C 5M5YJ 5EF6A 2DODA 2YU3A 5C44C 1FP2A 4A3BC 2A6EF 2G0EA 4KMUA 2E1OA 4NHJA 1U5TA 4AVPA 3PNVA 4KN7X 1JHFA 4FZBA 3RQ4A 1WJ5A 3CP2A 3IH4A 1TWCC 2OPTA 2G7UA 4BY7K 4XRSA 2RNGA 2CQKA 5L3CA 3B73A 5DUKA 1X31C 1IL2A 1FZPB 1MSEC 2R7ZJ 4JQFA 3OYJA 1L0OC 2A6EA 3IPJA 2CQNA 3DPLC 1DQUA 3ZQLA 5EZHA 1BW6A 4PUSA 4AM3A 2DT5A 1UG2A 4IZZA 4UUSA 4A5MA 5M5XJ 4OAZA 1M1EB 3LNQA 2KIQA 1I6HJ 3ZP5A 4YIFA 4LK1A 3EUKL 2DW4A 3FWEA 1MW7A 4A0YA 2JZYA 3J7ZI 2VC1A 4ZZLA 3GTOA 5TMFA 4Z6YA 3O2PE 3HOZJ 1IDZA 6PAXA 3V8JA 2GSNA 4EJVA 2CUEA 1SFEA 4HLXA 1YIJI 1ZR4A 1W7PD 1HXDA 3P7NA 3EUHA 1TW3A 3CCJI 3DU6A 3F0CA 3Q9SA 4YFNA 2K9NA 1WJAA 2TCTA 4Q5SF 1KU7A 3GEIA 3ZQHA 1KQ8A 3OIQA 2W25A 1WQGA 3GZNB 3B02A 1T0FA 4XLEA 3K7AJ 1MNEA 2V1XA 4RLQA 1TWFJ 3ABMH 4XBFA 3ZR8X 3GYHX 2NVXJ 4U87A 2IAIA 2HDDA 4NQWA 3ZMUA 2XCRB 2DLLA 4IHWA 2X4HA 3JTHA 4NUBA 2NVQC 5ED4A 5HLIA 2DJNA 4HV6A 3DLLF 2QQ8A 1ISEA 4ZTFA 1Z77A 3W3CA 1UHMA 1GDTA 4C3HJ 5LEJA 3SZZA 2ESHA 3DLAA 4M1XA 1JTYA 2PN6A 3I59A 4OIOF 3GTMJ 3HIFA 3K1MA 3ERED 3A4CA 3IV5A 2QKLB 3WODA 4D7MA 3S17K 2MBFA 1YJ9I 1FP1D 2DDBA 2EFWA 4NB5A 1BIAA 1VI0A 2WAQA 3U2RA 3CESA 5ILVA 3OYMA 3GEEA 3MKZA 3JRCA 3ZXSA 3S2DC 4FCYA 2JA8J 2KJBA 5E8IA 4ZDOA 1SFOJ 1FLIA 1W1WE 2L4MA 3TO9A 4D5FA 4X1EA 2BW3B 2FNPA 3FXLA 2OTLI 5D5XB 1WRJA 2R4GA 4V19K 2VT2A 1VQMI 1N78A 2H09A 4XKWA 3CC7I 4KM8A 5DEQA 3JRIA 3WTTC 1VNDA 1WH5A 2ZFWA 3SHFA 3Q3QA 2BBYA 4QIWD 2ICWG 3AL0C 4E70A 1ODDA 3OREA 2JA5C 3DU5A 3C7JA 3HG9A 5FRMA 4WJ3M 3CLOA 3CUOA 1VQNI 3CCMI 1GUUA 4XK4A 1FMWA 1VQ7I 1TWGA 1RU0A 2FMYA 4RMNA 4OINF 3H3VD 4LB5A 2LSOA 3S1NK 2XGEA 2R7ZC 5M5XK 2GOXB 2VBXA 1WQHA 5KK1A 5ILSA 5LGTA 1V3FA 5LHIA 4MEYA 1TTYA 2L9NA 4RGXA 1QU3A 1R36A 3KE2A 3COAC 3S0XA 1YJNI 1MBHA 1I6HC 1O7FA 2R92A 1RESA 2FBKA 5CJ9A 1XS9A 3FKJA 2EZLA 3QPTA 4YFXF 2F2EA 3ZN0A 1Y1WC 1QVUA 2MABA 3MKWB 2VUMJ 3CJRB 1XZQA 1ZARA 2HQAA 3FKIA 2K9QA 4BKWA 2VONA 2F4OB 3HUGB 1FSEA 3I5UA 3QYFA 3HOXK 1PJRA 1FOKA 5F6FA 1KQ9A 4E7KA 2R7VA 2DOEA 3V4GA 3L00A 1N75A 4BAYA 4ESJA 3EDPA 1TL8A 1MDMB 5K7FA 5BOXA 5J3LA 1TWGK 2DTRA 3U1KA 2OZ6A 2HS5A 2UXXA 2YS9A 2FD5A 4AUXA 1JKQC 4JX4A 1UHSA 1WHUA 1JTXA 5L3DA 1EJ9A 2CV0A 4HX7A 2E19A 2Y9ZA 1XPXA 1EF4A 2ZXJA 3ML6A 4KIFA 3MZHA 5DCMB 3DV8A 2UWMA 2JA2A 1R4NB 1IDYA 3DBRB 3HKZD 5ICFA 4OIPA 3HHHA 5LHHA 1X4PA 2EWNA 3IH3A 1IW7A 4LR2A 2R93K 5E8GA 4IJAA 2JQ7A 3DPUA 1U9NA 5GAGJ 2PMZL 1MNMC 1AA7A 3SEQA 2KJCA 2R7FA 2RGRA 3CJTB 3UKGA 5M3FJ 3TL4X 1D1BA 1KZHA 3DF8A 4BH9A 2PBIA 3T8TA 5FLMC 2DMUA 1R1TA 2QCOA 1F36A 2F5VA 3GTGA 4OIPF 3PO3K 1S8NA 4EGYA 3NAUA 5C4XK 1ETQA 3L2VA 2CW7A 3IUOA 3WHCA 4BS9A 3FXUA 5J40A 4AVZA 4QIWN 5D5UB 3F22A 1FWZA 4NC7A 1LDKB 2HYGD 2FOKA 5CKTA 4Y7NJ 4A3FJ 1JKRC 1ZLJA 1TQPA 3BC8A 3VSKA 3LWFA 4M71A 3ZCOA 1T39A 3PO2C 1DDNA 1JGGA 1ITYA 4KN7A 1FBSA 4BY1C 1OCPA 4LFUA 3TP0A 1S3JA 5DV5A 3GFLA 4PABA 1ZTRA 5HLGA 2XROA 1XSDA 2HEOA 4LK0F 4DBRA 3BR5A 5J8FA 2GA1A 1YOVB 3I4NJ 5HS9A 2DYSH 2COBA 4FX0A 4LD5A 2WA0A 3JRGA 4GTBA 2RDPA 1TWHC 4A3JK 1SAUA 4LLGF 1VLOA 3WE3A 3N0CA 1JI8A 4WILA 3F8MA 2F4MB 2GAHC 4A3GK 3FMQA 1Y8QB 5FJ8K 4ZTJA 3AKZA 1R22A 1S9HA 1W5SA 2Z3YA 4W1UA 1LDDA 3I4PA 1ZG5A 2BY2A 3FOFA 3OYHA 2ZNZA 5K1YA 1YX3A 3LPXA 3HKZN 3MEXA 1VFCA 4AIJA 4PDKA 3G4SI 1E3HA 3LQQA 4E7ZA 3KYDB 5IP9J 2CV1A 3G2BA 1HSJA 3S2WA 2JWTA 1QO0D 5FD6A 1PUFB 2Y0MA 2NOGA 1VQ4I 3RCOA 3BCBA 2XB0X 4M9XA 1U5TC 2E1NA 1G4DA 3L2WA 2ZB9A 1WIHA 2D1VA 2KFDA 4ENJA 5CVVA 2UZKA 3HUGA 2EA4A 3G71I 1VQ8I 3GTKA 2YX4A 3L9FA 4KAWX 3WU0A 2WADA 3PL8A 3DFGA 3LSIA 5ICCA 3MWMA 4LB6B 4AWXB 1B8IA 1Z6TA 3OL3A 4IHVA 3EPZA 5C4XC 2B63C 4Y52K 1FX7A 4ZJZA 1YLFA 3LL7A 2ZXHA 3FMRA 3ECOA 5FLMK 2CUJA 5M3MK 1Z91A 1JGSA 2N8GA 4JYKA 4A6DA 4C3IK 1T98A 2Z16A 4U7DA 3MZYA 2Z2SB 4EJWA 5EEAA 2IA1A 1IN6A 4RGSA 2C6YA 1K83K 3OSFA 1J09A 2R5ZB 5HDNA 3H0DA 2CV2A 2JH3A 1MZBA 2B7EA 4HAMA 3RZDJ 1DCOA 3K9TA 1NHAA 2ZJ2A 2I5UA 3C2HA 5DS9A 2XUBA 3J7YJ 1YHQI 5JR3A 4IXAA 4GTEA 2M4KA 4XLFA 4ANJA 1V54H 4GTFA 2W48A 3WTSC 1BI1A 1W5CC 2R5YB 4BQAA 3HC7A 2BVMA 1VZ0A 4BE0A 1DUXC 2NNNA 3I54A 2Q2EA 2YX7A 3JTGA 2PA8D 4YEJA 3JCUC 4UUTA 1VQ6I 1MIJA 2OC6A 3DTEA 2KMUA 2QQ9A 3S93A 2A6HA 1Z7LA 3J7AO 1VJEA 3OYGA 1SFOA 5ICGA 4A3FK 3QP6A 2YU9K 1INNA 4YELA 4RLFA 5M5YK 3IWZA 2IW5A 2ZUFA 3GVAA 2XGDA 3BQYA 2WTEA 5C4JC 3C3WA 1OMIA 2DMNA 3S2DJ 1XMKA 3P9CA 3WODF 3F8NA 2X0LA 5LEKA 1E0EA 1PVEA 2BVLA 5C3EC 5EG0A 1K6YA 3F21A 3I4NK 2R93A 4LQYA 2KIUA 4BJTA 2WAQN 2IGOA 4XSZF 1UHWA 3K1NA 3GTMA 5TRDA 3OYBA 4RB2C 3CF5F 3FXRA 3QOEA 1R9TJ 3CD6I 4KN4X 3KEOA 4M3FA 1Y1VK 3LSJA 2LRDA 2XSDC 1XXAA 3T02A 1LNWA 1JUMA 1MJAA 2W57A 2VLAA 2BW3A 2HOAA 2P8TA 2CSOA 2E7XA 3JR9A 5BPIA 1ZGWA 1JKOC 5IT3A 4PFOA 4A3DC 1DPRA 5HNHA 2L54A 1OCZH 1ZBSA 1I27A 2JSCA 3TGNA 3IWFA 2DK5A 4O2DA 2PJRA 2KZVA 1HI9A 1T38A 1X3ZB 3H3VK 3KPHA 3CUQA 3FM3A 1RRJA 1O2AA 3E6DA 1FSHA 1J9IA 1XXBA 1HKSA 2X1CA 3GX4X 5LGUA 4RBOA 1TWFA 1Y1WK 4Q5SA 2NVXA 1XDSA 2ZXIA 2ELKA 3E5XA 1GV2A 3W2AA 2P6TA 1MNDA 4Y3OA 1EH8A 2XRLA 4MEYF 2VJJA 3HOWK 4A3MK 4BUPA 3QU3A 1XX5A 3KP6A 5C3EK 4CCJA 2M34A 3WGHA 2HQNA 1X1CA 1EI6A 1TWGC 3I9V2 1I3QK 4BLAA 2ESNA 5DD8A 4QJVA 4DOZA 1KYZA 3SJMA 3CO7C 5KHDA 4KB2A 4LMYA 3W6KB 5JHFA 2E1MC 4O5VA 3G73A 2CWEA 3S1QC 1TWCA 1ZRFA 3K2ZA 3JRBA 1HOMA 2K86A 5F0CA 2QQBA 3KFWX 2PMZD 1BDFA 1GLNA 2STTA 1KQ0A 1MGTA 2OD5A 2B63A 1BS2A 2R7ZA 1VQ9I 4IF4A 3HPHA 4XLHA 2ME6A 3HKZL 2EB7A 3OYFA 1DPUA 2BZTA 3CCYA 5CVUA 1P6RA 4FISA 2F5CA 3JAMZ 1KU2A 2V6UA 1TT0A 1IZ1A 5GADJ 2K3FA 3O6BB 2L2OA 2O5IA 1QZZA 5D8LB 3WTZA 5IP6A 3O8HA 1IQ0A 1BGWA 2FQ4A 4A0XA 3E3VA 2MH9A 1ZGJA 2LKSA 3S3MA 1P4WA 3AH5A 1P7JA 2KPMA 4DZJA 2WB1A 3PFYA 2O0YA 2XASA 1XCVA 3L7WA 3ASNH 3GEZA 1ORKA 3K2AA 3PSFA 2L7KA 1BR4A 3EUHC 1WCMC 4LIUA 4L9VA 2EZHA 3K4BA 1FYLA 3KETA 2IS1A 3WTVC 4ILDA 2HYJA 2NAZA 1T95A 1E3OC 4C2MJ 5K5QA 4BXXJ 4P5BA 1HW5A 4L9NA 5E1XA 4OINA 3G4AA 3S1MC 2ZO4A 2A05A 3VDXA 4G7HA 2RREA 1ACIA 1SFOC 3GTGC 1U2WA 3S2HK 3PO2K 2WY8Q 2O6GE 2JA8C 1U0JA 1USSA 1ERDA 3DEEA 3A8IA 5IP7C 5DCMA 1K78A 3ULQB 1R4MB 1TZLA 1BC8C 5FD5A 1KGSA 5E1WA 2Y75A 4YFXA 1O2BA 1I3AA 3BG7A 3S16C 2GAGC 4Y17A 4C2UA 5TISC 1DCPA 4I99C 4PSWA 2Z99A 3D0SA 4G7HF 2NS7A 4IOCF 2OZUA 1WJDA 4OMYA 1EV7A 3WGIA 4E7HA 2JUCA 4J01A 3RYRA 5BQTA 5D4SA 4B47A 4RGRA 3CQZK 3L2RA 4Q4ZA 1ZK8A 1AHDP 4S0HB 4I2OA 3HKZA 2QWWA 3HOXJ 2LFBA 5J8CA 4L5EA 1R5HA 3Q0WA 2CYYA 1W0TA 2V6TA 3F8FA 2DDAA 3LSKA 1LKXA 1GXPA 1HW2A 3GLXA 1JJ8C 4E7SA 1I1GA 3FK7A 3EETA 4A3LC 2V6EA 5IY5H 2P7CB 1WI9A 4ENMA 3BR0A 1UZCA 1DGWY 3K7AC 2NVXC 2R0QC 3K69A 4FHTA 1BL0A 2BHYA 1ZG3A 3LSGA 2R92K 3NARA 2R93J 3LA7A 5GPCA 2KKOA 3JW4A 1RC9A 2YU9A 4A3CJ 3HYIA 2HKXA 1I6XA 1RUNA 5FROA 3E97A 5B1BH 2VE9A 1UELB 3MCZA 3MVPA 4CGZA 2PJPA 1O26A 4A3KK 4I02A 3BUEA 1KYWA 1W36D 3DKXA 3KIOA 1A04A 3TKYA 5E17F 3T5XA 2HVRA 4X6AC 2IJLA 2XGCA 1I50A 4HW0A 5L3BA 2F5FA 2XF5A 4IPAA 3OYEA 1WZ2A 3OS2A 3K70C 2H1KA 1RR7A 4CZZA 3BG6A 3FDYA 4R1HA 2L7MP 4HOBA 1S7AA 1XSXA 4M74A 4RAYA 1BJTA 2Q2EB 4LK0A 1IXRC 4R79A 2VI6A 4ZYDA 3H3VL 3G3ZA 2NVYJ 2GIZA 4AIDA 4KFCA 3PSIA 1HLVA 3GEHA 4IL6C 2NS8A 2XPWA 4J19A 4BU2A 2NVTJ 2Q0OA 3MFKA 4G9YA 3P9IA 5JLWA 2OU2A 3RZDC 2ZMEC 3M3YK 3VYSB 1O24A 5HODA 4XM3A 1XZPA 1V55H 1HKTA 3ZMVA 3AG4H 3BZKA 1LFBA 4GZYA 1DCHA 4LG3A 3AFHA 2EFPA 2EPFA 5CQGA 3G4CA 4KN4A 3FXJA 1AWCA 3M07A 4CCKA 1K78B 3VA7A 1G3WA 3M4OC 3KP5A 1SD5A 5FJ8J 1WSUA 4IHXA 3BTIA 1HQMA 3MKYB 1SVLA 3LFKA 4XSXF 1BC7C 1O27A 1F9NA 2DPDA 2YUSA 4L0ZB 4DZPA 1LDJA 4BBSJ 2MYSA 3OIPA 1Z6RA 1W7PB 4AYBL 1J0RA 1X3WB 4EJUA 2W85A 3JSOA 3H0GC 4EM1A 2QBYB 4E7LA 1PJ5A 4WXHA 1P92A 3TP3A 3Q0VA 1SMYA 5JVTA 4G6DA 2KQRA 2PI0A 1SANA 2CW0F 2HQRA 4M9ZA 1XN7A 2XPVA 5GTIC 4L9JA 3ZMDA 4KUMA 4A93K 1IN8A 3GTQC 3OYIA 4E6KG 3FXOA 4G0WA 3VFZA 3ZQGA 3Q9VA 5JFEA 2V6SA 3M3YC 3HRSA 1GHCA 1I3QC 1ZREA 4IQJA 1SMYF 1B72B 1TWFK 1RR8C 1O57A 3S3NA 3HGGA 4XRFA 3FZVA 3KZZA 4P5OA 2R5ZA 1E2XA 2Z9OA 4Y4RA 3TOAA 3CQZA 4BACA 4LITA 3RKYA 5HDGA 1BR1A 5FKKA 2RH6A 3H0GK 3C1DA 1TWHJ 3L2QA 3A01A 1BOAA 2LH9A 2RV8A 3A03A 5D4RA 3WHBA 4DIQA 2W7NA 1LE8B 1V5FA 3CUQC 2QGUA 2JTVA 1B4AA 1JUPA 3LFUA 2E36A 1LQ1A 2MH2A 4A3CK 3WTWC 1IS1A 3VPRA 4XLNF 1EK8A 2VXDA 1DU0A 4MNUA 2CQ7A 3ABKH 1O25A 1XDUA 2PMUA 4I7HA 3IRRA 1XCBA 3GTMK 3MD2A 1B59A 4JP0A 4PJNA 1SAXA 3HOVK 3LSHA 1T8IA 1IV8A 1OKRA 2X1DA 3HOXC 3OPFA 4GDFA 2MA3A 2UUZA 1JVIA 2CFAA 1ON2A 3HBLA 1Z3XA 5IP7J 3GTQJ 4II2A 4N0BA 2A07F 3GTGJ 2R7TA 1J5YA 3PUFA 2A68A 2L01A 2R7WA 2WB1L 1ZELA 2JA8K 4ETSA 1Y1VC 2Y0SL 1ETKA 3F6OA 3DXJA 2L4AA 1S72I 4ZZDA 4OIRA 4E4HA 3S2DK 2JRMA 2NVYK 2LTPA 4CXFA 1WQ2A 3VYUB 1W0UA 3ZRGA 1XGNA 3E5QA 2DA1A 1W36C 3ZMTA 3RSNA 2O5RA 2OQRA 2UXNA 2R7OA 4FM9A 1STZA 2E1CA 1T6SA 3TMOA 2KDZA 4BBSC 5L3EA 1WOSA 5IOSA 3GFMA 4M73A 2VKHA 2LKXA 3RKQA 2R7SA 2W1OA 1O29A 3V7RA 4BXUA 3NWSA 2EIJH 1FEXA 4KICA 2GAUA 1F5TA 1A5JA 1ZRDA 2DA3A 4XIDA 3GLLA 2IS4A 1AOYA 4XN3A 3J81K 3I59B 2X1EA 4XICA 3CCVI 3A8KA 1RETA 2RVCA 1YS6A 3DP7A 5DM6F 1NG6A 5F0FA 2P5LC 2VJ5A 1ZQ1C 2M8GX 2LNBA 3T8RA 3TO7A 4G0VA 5DTDA 2EIKH 2JSPA 4ABZA 2RNJA 1OJLA 2EBBA 1U3EM 4MQ9A 3CZ6A 2QA4I 2JVGA 4HRIA 3FKIJ 3HB9A 2O61A 2E2JK 4BHBA 2Y69H 2CFAB 1Y1WJ 3L4KA 2VUMA 4BY1K 1NK2P 2F5EA 3IL2A 1MBEA 1U8RA 3CC4I 3CCSI 2QUFA 1YS7A 2CH0A 1Y39A 1SD7A 3ZMSA 1TWAC 4A69C 3AG2H 4BQQA 4K2EA 4XR6A 2IXSA 2ZJRF 1H88C 4ZDPA 2LKPA 3DBHB 2M2EA 1YQAA 4GCVA 3TOBA 3BTJA 5F04A 1FY7A 5C44J 2DQLA 2OCEA 4KB4A 3LMMA 2DXIA 3T01A 3BTCA 2HDCA 2D6FC 4I76A 1TWGJ 3QP5A 3GTLC 1ETWA 4ESBA 2HI3A 1IRGA 4B8XA 3HL2A 4KDPA 4E7IA 3NUHA 4EV0A 3S1QJ 5HVQC 4KITB 4BHCA 3CCEI 1J98A 3HSEA 4HZFA 1T33A 5EGOA 2MFZA 4HYEA 2WAQD 1D0YA 1WPKA 4MQVA 3TFHA 1MMSA 3P9KA 2M87A 3H3UA 2BEOA 1Q1VA 3HXLA 2A61A 2IGNA 3CC2I 1IW7F 2E2IK 4BYYA 3F6VA 4UB8C 2E1MB 2AXLA 2H8RA 4A2UA 1JKPC 4U0YA 5D5VB 1K7AA 1K83C 2JPBA 2UV1A 4J3NA 3PO3J 4AIHA 1WCMK 4I6ZA 3F9KA 1QPIA 2KIMA 4A3EJ 2V1DA 2VIXA 4UV8A 3GTLK 2K7LA 1VTNC 4BNCA 3EUAA 3BDDA 1SD4A 4Y7NK 2AQFA 4CUGA 3RPQA 4A3DK 2O3FA 3GF2A 4CSWA 2Y0SA 1Y6IA 3RPUA 2CFXA 3GZ6A 4KMHA 4LG0A 3H5NA 1U5TB 3VSLA 4M3DA 4C3HC 1PP7U 1FYKA 3BP8A 1W4MA 5LGNA 4DYCA 3QWLA 2R7UA 1Y8RB 3PIOF 4OAYA 2GWRA 1O28A 3I4MC 5BPDA 2PMZA 3UNGC 1YG2A 1YX2A 5DM7F 2DCEA 5IYDC 3L1PA 4XOTA 3CDLA 5K7ZA 4G7OA 2GXGA 2MD5A 2V1UA 2R7ZK 1R00A 5IT9K 1WWXA 4GFBA 2CQQA 4A3GJ 1XZPB 1OYWA 4MO7A 2W7VA 5FKOA 5F08A 2RQQA 1TWFC 3RKWA 2JA7C 2VQGA 1I50C 2ZXWH 4J00A 1LB2A 1HBXG 3HOZC 5CQEA 4M3EA 1PJ6A 1D1CA 2CJJA 3D5SC 4V2GA 1B9MA 3FX3A 4G94A 1XPPA 5ILUA 4EQQA 4FX4A 1QZYA 1FOXA 1R1VA 2E2JJ 3FKIK 4WX9A 5EDNA 3V8LA 2MLGA 5LHGA 5F64A 1D8KA 3IHUA 3QYBA 3K0LA 4LLLA 3VOEA 3K4JA 1Z9CA 1EQRA 1MJBA 4OU0A 4P55A 2ACJA 3HOWC 2DA5A 3GW2A 5LD2C 2DI3A 1F7UA 2VBYA 2G9WA 2VPLA 3J7AY 5JVGF 3VWBA 1QVTA 3WGGA 2CO5A 2VE8A 2XAFA 3R61A 4P1WA 1XMAA 4NC8A 1BI3A 2XAQA 2A69F 3I3LA 4IO9F 2DFFA 1A36A 2DOFA 4I0BA 3ZMZA 1F93A 4Q47A 1TNSA 5IOYA 1Z05A 5FKNA 4UUSB 2VASA 3H1CA 1OCTC 2VJ4A 4FE4A 2O9LA 2IGMA 4UY8I 4GGGA 2LREA 3N05A 3HOVC 4MTDA 1YE9A 3VYRB 3F23A 3JRHA 3OS1A 1XD7A 3A1YA 2HPIA 2ISZA 4D7NA 1KU9A 1U9OA 5HLTA 2FBHA 1IN7A 1ZH5A 1C0WA 2L3DA 4A3BJ 2PPBA 2X6XA 3MN2A 1WOOA 2E2IC 2KDOA 4H4KC 3WU1B 1CQTA 4KNYA 3S3OA 2FJ1A 1HDDC 1ZYRA 1J7KA 2DN0A 1F1ZA 3GTLA 2JN6A 5M5WJ 2XAHA 2LLKA 4PJJA 5EYRA 4CCNA 3OMYA 4CYCB 1YX5A 3QPLA 2WY7Q 3RZOJ 3GTJJ 2VPRA 2QVOA 5K5OA 5E18F 3ERMA 2X6OA 4C3JK 2YU9J 1VH2A 4ESFA 4A3DJ 3GCMA 1O7LA 2E2HA 2K4BA 1KQ4A 4IHSA 3GZ5A 2GXAA 4XORA 3CJNA 3CCUI 2NNYA 2ADUA 1ZRCA 2DO7A 4LIVA 2IT0A 2OCCH 1POGA 3S16K 4HNUA 1I5ZA 1BOBA 2AHQA 1ONVA 3TEDA 1OFCX 4BKXA 2K5CA 1QGPA 1GV5A 4DGWB 1K83A 3ECHA 5K5RA 1IUYA 1WJBA 1ZN2A 1QNTA 2D1HA 5H6RA 4XLCA 2GLOA 2LR8A 2XVCA 3CDHA 3ZGKA 4AH6A 3ZOBA 2JRTA 1LVKA 4AYBD 2F5DA 5FKLA 3HHGA 4WXCA 2W84A 2LC2A 3E6CC 1IGNA 3BZ6A 4A6EA 2O03A 1IRFA 3RPUD 5GAEJ 2Y0SD 3WG9A 1BN5A 2WB1D 4MFDA 2LG4A 4BY7C 2DFEA 3V7SA 1MMGA 1A6IA 4AD9A 4CICA 4BE2A 1REPC 1J2XA 2L9VA 3D1NI 2CW0A 5C4JK 3PQJA 2DOAA 3HOSA 3S32A 3IAS2 5L46A 2K40A 3QPHA 2FSWA 3LA3A 3E7LA 1GT0C 1WI3A 1DU6A 1SC7A 3RZOC 1J6WA 1ZKGA 3Q3SA 3I4MK 5E3NA 3H9GA 2OAZA 4DNCA 5EG0B 2VKDA 2LF7A 2JA7A 2LDUA 4LJZF 2FE3A 1HDPA 2QYOA 2ISYA 1EFWA 2DT6A 3SZGA 2PMZN 2LF8A 5KCMA 2W24A 2BE5A 4P96A 5DUIA 1TP4A 1XGOA 4L5IA 3IRQA 3DKYA 4CH7A 3K4KA 4KJZA 3BROA 2XDVA 2M1BA 3H9JA 1BW5A 3GDZA 4RM3A 2LMDA 4II3A 1Z1DA 1FJLA 1G3SA 1DD5A 5FFZA 3LSMA 2HGCA 2XKPA 2DA2A 1AKHB 2LVSA 2P7VB 3HXAA 2JJ7A 4BBRK 1D5YA 2YPRA 3I58A 1UB9A 4CCMA 4F7ZA 4X6AK 5IYBJ 1JHHA 4HF0A 2ZMEA 4HG2A 1QHGA 1X58A 3I71A 1YJWI 4HDVA 4A3BK 3FXMA 2D5VA 4CZCA 2HYFA 2E2HK 4AC0A 1YW9A 3R4KA 4YG2F 1USMA 1R6RA 2QSHX 5CHPA 2DQRA 2PX9A 3F8CA 1TQMA 5M5WK 1Z21A 3U1DA 4F3QA 1G51A 5FKMA 4TV7A 2IS2A 2NVQK 5C4XJ 1BI0A 3AL0B 4CDGA 5IP7K 4UVAA 4EJTA 1VQ5I 3SFIA 3NRVA 2L7FP 4RGUA 4IEJA 1WFXA 2DMTA 1IC8A 3CCQI 4PZJA 1TWAA 3J81Z 4BJ5C 2KISA 3HJEA 5DCFA 4M6XA 4KT6A 2LY2A 2QSFX 4CA0A 5J1YA 2X6YA 5CVIA 1FOYA 2FA5A 5A2QZ 4XCHA 4XLPA 4QJVB 4ZYAA 1SFKA 3REOA 4UHTA 2WB1N 4BY7J 3CF2A 4F55A 4PAAA 2W00A 3QOPA 4M6YA 1YO5C 1VF9A 1KU3A 5FO5A 2LBFB 3GTQA 5KAFC 2RQPA 3CCRI 1PUEE 3AQOA 3H0GA 2L02A 1K79A 2BY3A 4A3GC 5EGOB 1I50K 3WG7H 4LK1F 1GVJA 2HR3A 2CGPA 4LG0B 2W4SA 3KP4A 3PO2J 1MBFA 1FMVA 4BHPA 2R93C 2HFHA 4RAFA 3ABUA 1I6HK 1R49A 4RB0A 2CRGA 2LY1A 2RC4A 2STWA 2LK2A 1TT5B 3H5RA 2AQEA 3A02A 3GTPJ 4UXNA 2O8KA 5IP9K 3I4NC 2DMQA 2I10A 1YNNA 2HZDA 2L5QA 4A3LJ 4P9SA 4BLBA 1FTTA 3BY6A 2ZNYA 3KZYA 4AYBA 4C9YA 3TFIA 3QQAA 4G6TB 3KYCB 1T56A 3SEZA 4Y13A 5K7HA 3CQZJ 4M3BA 1B9NA 2IGKA 4Y7NC 4B09A 3V42A 2H6CA 2ZKZA 5FB2A 2PQ8A 2MSYA 2P6SA 4X0GA 5IOQA 2KRFA 1VGXA 3AQPA 2BHZA 2EV0A 2R7QA 4Y52J 2X9DA 1RPWA 5C44K 2NVUB 3SDBA 3M1EA 2FMLA 5LLQA 1RUOA 2K9SA 3GTKK 5M3MJ 4B4CA 1OQYA 5J1RA 1Z7UA 3SQNA 4C3IJ 5E3OA 3LSPA 1YTYA 1Y1VA 4N4OB 4U88A 3QU6A 4RAGA 5EGHA 4NBQA 4ON0A 1HA8A 1AKHA 2ZUEA 2ZCWA 3L09A 2KZGA 1IO2A 4HQEA 3HOYK 3SZYA 1OCCH 4BBRJ 4NQWB 1X19A 5HOOA 1EH1A 4HPQA 1W5TA 4YIIA 5E1ZB 2QBYA 4ZH4A 3E5UA 3WTYC 4XLNA 3S17C 1RKWA 2DJIA 3I0TA 3FMSA 2XB5A 1P4XA 2VN2A 4A3KJ 5D8KB 2E2IJ 4C2TA 3S1MJ 4C2MC 4BXXC 4MEXF 2XIGA 2P5KA 4PCQA 1J6VA 1F43A 2A3SA 2K27A 4KA4A 1YNJA 4HSRA 2XCQA 1OYIA 4QSHA 3G1LA 5CLSA 2TDXA 2EV5A 5EJCA 3BG5A 1MH4A 4RA2A 3TDZC 3H3ZA 5H2FC 4L0YB 2JT1A 4PJMA 3KLNA 5TGTA 2KWAA 4A3IK 3M8EA 3N3YA 2F48A 4KISA 1ETVA 4IHYA 1SFOK 2M45A 3AG1H 1Y0NA 3FXKA 1WVRA 1HW1A 2H6BA 4F92B 3QX3A 2NVYA 1BI2A 2WAFA 4IVNA 3EYYA 3N4MA 2NVTK 3I56I 2E7WA 3OY9A 4B44A 2WBMA 4XRSG 2DMPA 3ESWB 3JRDA 3FOEA 1RIOH 1H0MA 3M4OK 3GTOC 2IA0A 1FPQA 2DTZA 3ZQCA 3FKIC 4HX4A 1WORA 4XN0A 2E2IA 1I50J 2JA5K 5KVRA 2EFNA 1H9TA 2XAGA 2BV6A 1MMNA 4B3AA 4N9HA 3I53A 2ZFUA 2R5YA 4CCOA 5JVOA 2FF4A 1FBUA 2AO9A 4WF2A 2H27A 3LA2A 5FGMA 3CMEI 2R7RA 4D1QA 2CW8A 5FFXA 3SZTA 4BBSK 2DK8A 4RM2A 5L3GA 1TW2A 3HRMA 1E3PA 2G7HA 3HOTA 3BQZA 2COMA 2NRAC 4I01A 2QEXI 1E17A 3C2BA 3R0JA 3HTSB 1JJ6C 1DP3A 2JA6K 2QM3A 1UMQA 1D0XA 4IRGA 2CFOA 1XC5A 4IX7A 3M1CA 4HX8A 4LLNA 2CUFA 4Z2YA 1R58A 4HF1A 5TMCA 3H9QA 1OPCA 2BYVE 4DDQA 2PG4A 1ETYA 3OYCA 4KMDA 3AG3H 3KP2A 4RB1A 4KMFA 3GTMC 2V6CA 2R7DA 3V8KA 1Y56A 5D6EA 3RQIA 1YRNA 4C3JC 4A12A 2LYCA 3GTPA 4EJOA 2XCOA 2O7OA 2E60A 1EKEA 2L0KA 3IKVA 3PFIA 1FOWA 2IP2A 3T1BA 3FK6A 3FBNB 1T2KA 2E34A 1P9QC 4XLAA 3JREA 2X48A 2XGXA 2HKOA 2LD5A 1V4RA 2M9HA 2MGQA 3U9GA 2A6HF 2V9KA 4KDDA 2PFBA 1OR7A 4NOIA 2VJIA 3J80K 3S1MK 4U0VA 1WSVA 4DYQA 1G8XA 2EZIA 2FXAA 2H1LA 1X1AA 3ZQ7A 1O3TA 1OISA 5KAIC 1X1PA 4C30A 4EATA 3SXYA 1X4OA 2OTJI 1LE8A 2IPQX 2VOOA 5CVRA 2GZWA 3RZOK 5FLXK 2P5MA 2XSJC 4XSZA 2OJED 2GSOA 2HTSA 1TWAJ 3M8JA 1SFXA 2PEXA 3E0JB 4GYIA 1EH7A 1I6VA 1VQOI 4YG2A 3KEYA 3QAHA 4EEFG 2ETHA 1MH3A 2EH3A 4LOCA 1D1AA 4PK4A 4XONA 1XSVA 1N77A 1I39A 5AIQA 3TW7A 4LLGA 2ELJA 5F1RA 2DFIA 3C2GA 3OYLA 3TO6A 2IEKA 2Y30A 1ZHFA 5D6FA 4ZC3A 4F52A 2X85A 2F6CA 3TW6A 4EM2A 2NXNB 3M4OJ 2JMWA 2X6WA 1IRZA 4BQOA 2L7ZA 3X2QH 2DYRH 2M5WA 2IRFG 3D5RC 3S2HJ 3UR3C 2FUG2 4MFEA 3IKTA 2B63J 3S1RJ 3NWTA 3BOQA 2FRHA 5IYBC 4ZYGA 2QSGX 1MMDA 2XF7A 4UVBA 3S15K 3OYKA 3TTGA 5IOZA 3L2UA 1TWCJ 1D8JA 2O5JA 3CLQA 3OR1C 3E6MA 3TQNA 3A8JA 3DWLE 2PA8L 5CVJA 4JK1A 3HOZK 1Q1HA 2Z5UA 2RKHA 1G59A 3K4NA 3ZQIA 3PUBA 1X1BA 4LJZA 3BTLA 1WQFA 3OIOA 5E68A 2FQ3A 2HU9A 4I09A 1J59A 2VBZA 3MMYB 3GIRA 5IP9C 2BE5F 4RDUA 2MC3A 3LOCA 4XKVA 2E5NA 2KL4A 4ITVA 3S14C 4JOMA 3HOYC 1YI2I 1HF0A 1YITI 2FBIA 2E35A 4HLYA 2V7FA 5J1UA 4GTDA 1R7JA 1ZGAA 4MIMA 2Y3PA 3PNTA 1APLC 4C3IC 2EK5A 3SZPA 1ZVUA 2V9VA 3LQRA 5GPAA 3FBIB 4G7ZA 3HGYA 3S1QK 4W97A 3BJAA 4D9JA 2M3AA 2IBDA 5FRNA 1ZLKA 1ZQ3P 5GAHJ 4KMAA 5IORA 1HKQA 3GXOA 5E79C 3RZDK 4X6AJ 5IYBK 5HL8A 4FTHA 2V26A 2L9SA 2Y9YA 4D0PA 5EEHA 3T0YA 4FE7A 5DDGA 1NH3A 3H36A 4M9SA 3A2KA 3B6AA 2A68F 4QWQA 4BEHB 4EMSA 1LEBA 5E3LA 3EQLF 1IUFA 1QQIA 1X1DA 3RJPA 1OYYA 3OSGA 4GTLA 4MTEA 5ICEA 2QENA 2MC4A 1FT9A 5TJJA 1USTA 5A2QK 2BGCA 1CF7B 1BBYA 3LAJA 2E5ZA 2O8XA 2NOJB 5IYDK 3PM1A 4GO1A 3WTXC 2PHCB 2XV4S 1R9TA 3GMEA 2GA2A 2A5YB 2DFHA 3S1NC 5EEGA 3C18A 2GQQA 3OOPA 1MDMA 4HQMA 2KRHA 4IRIA 2Y48A 1YW8A 3OR2C 1BA5A 2JUGA 1IN5A 1LJ9A 1XGSA 5J47A 2KIFA 3F72A 3AAFA 3G1OA 1O4XA 2TRTA 3KLOA 2QZ8A 1XTAA 2HOTA 3OV8A 3R0AA 1UG0A 1FIPA 1JXSA 2M4GA 1JUSA 1I1SA 3SYTA 1AB4A 4IRHA 3M3YJ 2M0CA 1BM9A 1ZXOA 3DEWA 1HCRA 1QBJA 1SMTA 4UB6C 3FIWA 1JOEA 4YRVA 2NS0A 3NQOA 1V5VA 1R9TK 3ELKA 1MBKA 4KASA 1F7VA 2FU4A 1X2NA 3M8FA 5HNFA 3LSRA 2PJRB 3BG3A 4G0UA 3TFJA 2Z33A 1A6QA 1B72A 5B5EC 2XAJA 2KT0A 4Q4ZF 5IYCC 3ONQA 3HTUA 4F93B 2EQRA 2OA4A 3BR2A 3S15J 3S14J 4EM0B 4CYCA 3M7GA 1TWCK 4B43A 1V5GA 2K85A 4JK1X 1S29A 1ULYA 9ANTA 2Z1DA 1Z67A 2XRNA 2A5WA 2R3SA 3GTOJ 1CF7A 3CMAI 4O6JA 3ZQFA 1G3YA 3W2WA 1S7EA 2HWVA 3MZ8A 4KIGA 2GXBA 4FETA 4H0EA 1SFUA 3MKLA 1PYVA 1J6XA 3T00A 1IE0A 3I64A 1HQCA 3HOWJ 4A3MJ 2VODA 3VYTB 4AU7A 4BQNA 1GXQA 5J6XA 4BDYA 3HOUK 4XOPA 3E1SA 1U8BA 3S2HC 2VUMC 4L18B 2NVYC 4GTAA 1IAWA 4O3MA 3GTKJ 1XB4A 3ZQQA 4MHGA 3BG9A 3F8BA 4OIQA 2M0MA 2CS3A 2M7AA 3I55I 1U6GA 3WTUC 4Y33A 5LBQA 4KMUX 2HVSA 3N97A 3H35A 4RB3C 2LBFA 2XF6A 2ZFZA 3EQLA 4OOIA 2VQCA 1IV6A 2VBWA 4A3KC 1IBAA 2CUZA 4A93C 2JVHA 4OWRB 2M30A 3HZJA 3FM5A 4XRMA 5J4VA 2IVMA 5M3FK 2QQAA 4OIQF 1FNNA 4RMFA 4P9FA 5GP9A 2Q1ZB 2ZSHB 1WCMA 3R60A 1EH6A 4BBRC 4A3CC 5LRSA 2ZSIB 5IYDJ 1GVDA 4XMYA 1S5LC 5IYCK 3ZN1A 1T0FC 2JA6C 3BZCA 1SVOA 3GTGK 2DA4A 4A3IJ 1TC3C 4C3JJ 2Y31A 4NNJA 3U21A 3Q5FA 4CYDA 2CU7A 2B0LA 2VQHA 4YIRX 5B3SH 1S6LA 3JSPA 2IS6A 2V79A 3KP7A 5B1AH 4XSXA 3S16J 3G6EI 3F3XA 3HSRA 1UFMA 4CCLA 4EGZA 3PO3C 2QLZA 4QIWL 1K61A 2EV6A 4XKBA 3HPGA 3GBGA 4AIKA 1S7OA 4WWCA 2HXOA 4C2MK 4C45A 4BXXK 4OMZA 1AU7A 3LAPA 3KP3A 3CMYA 1G2HA 1RNLA 2VKEA 4HBLA 3BPXA 2HDWA 2AXTC 1R5ID 4ZYEA 4GXOA 2K9LA 1YRNB 4IOAF 1B6AA 3OEPA 3MQ0A 1MJ9A 2ZJPF 4XKCA 2ZJQF 4RAZA 3M9AA 3SFZA 2MG4A 2K4JA 1WJCA 3DTKA 2CMPA 3CMMA 1WKMA 4N9IA 2EFQA 2GIVA 2VQLA 3S14K 1Z3YA 1VQPI 2XAUA 1LFPA 1OR7C 3FF5A 3ISPA 1UAAA 5C4JJ 2AS5F 2I8DA 4UNOA 5H20A 3K4LA 2RN7A 3ZPLA 5HS7A 1FIAA 4A3IC 4JX5A 1PJ7A 2VC0A 2HXIA 2D2WA 2KP6A 3KCCA 4M6VA 3W6JB 2JA6J 5D5WB 1VQKI 2FX0A 3RKXA 1XGMA 1B4BA 3L4JA 4IKFA 2H94A 1NTCA 4BL0B 1RKTA 3P5JA 2R92C 1D3YA 1IF1A 3OOUA 3BR6A 3PQKA 3GFJA 5F27A 3V7CA 3HOUJ 2JA5A 2NYXA 5EGEA 1U78A 1ZAOA 4YFNF 2DAOA 1F4KA 3K7AK 2NVXK 1Y1WA 3VEPA 5JI6A 3KYLA 3JRFA 4GFQA
chains in the Genus database with same CATH topology
3D5LA 2MLKA 3DPTA 2PLYA 3VODA 4UVCA 3HRUA 5IOTA 2CG4A 1FBQA 5BS6A 1ON1A 1B1BA 1IXCA 2YSRA 5ERIA 1YFHA 1TBXA 3RDIA 2WWYA 1K6OA 3R6SA 4G7ZF 3DXJF 1G3TA 3BPVA 4KARA 4RS8A 1IXSB 1IN4A 4QLCU 2VOPA 4KC6A 2OBPA 1R23A 1R1UA 4FT8A 4DQ2A 1XXCA 5CYVA 5HS8A 4MGRA 2HZTA 3JAMK 4L9TA 3DEUA 1G6NA 4L5JA 3MAJA 1I3QA 3RI4A 1ZG1A 4XLPF 1R5GA 4OIRF 3O3KA 4Y15A 3HSFA 2DPUA 4HV5A 3J80Z 1P4AA 2XKOA 4LGWA 1YYVA 4KYWA 2GSUA 4GT9A 1PDNC 1TWHA 1CGPA 3L2CA 1MD0A 1YW7A 1HSTA 2ZMEB 3H92A 5FLXZ 4GYGA 1Y0UA 2J5OA 1QPMA 3BJOA 1L3LA 3K1PA 4KT5C 3TDUC 1JE8A 3QRFF 1TQIA 4YFKF 4WCGA 4MQ9F 4A0ZA 1PP8F 2EJRA 1W7PA 3RIRA 4R8HA 1O3RA 3LSTA 3BJ6A 5AONA 3KEQA 4U7BA 5TJ3A 4U0WA 4GTCA 3ABTA 4UV9A 3IC7A 5JFRA 2IA2A 1O3QA 3HRTA 1O3SA 4I0AA 3CTAA 2M8EA 4CHUA 4ZH4F 2XHKA 1UCRA 3DKWA 4I98B 2FNAA 4PGGA 3EYIA 2WC2A 5BMZA 1BIBA 4G6QA 2ZBKA 1H9GA 2EA2A 2DBBA 2EFOA 2VXZA 4PGHA 1RZ4A 2PMHA 3CUQB 1YIOA 4S05A 4ENNA 1X3UA 3E6BA 1KA8A 4JBAA 3RYPA 4Q48A 4G8XA 5H6QA 5LRRA 2ELHA 1TLHB 5DD4A 4A5NA 4IHTA 2HTJA 3N0BA 3DQVC 4KIBA 5DYMA 3CO6C 2FEZA 2JA6A 4ZYHA 4G7OF 3GO5A 3ROUA 4HDUA 4KATA 3GUDA 1TNTA 4UUVA 1BJAA 1FYMA 3GWZA 4HA8A 3CAGA 2YR2A 1LVAA 1D5VA 3RTRA 1P2FA 5AIPA 2WV0A 3FHZA 5IT9Z 3WE2A 2K02A 4WK8F 3FXQA 5HDKA 5HLHA 3GFIA 4M72A 4ENKA 4HF2A 4S04A 1MKMA 2OQGA 2Q8KA 2DU9A 1SD6A 3BWGA 1ZYRF 2J5PA 2RGVA 1RI7A 5E20A 4EVIA 1J75A 2VT3A 2D45A 1GE9A 3VB2A 3MMLB 2P4WA 2P5VA 2JPCA 5JHUA 4KM9A 1DP7P 3NEUA 4WXDA 4CO8A 1LEAA 3GTJA 4ASNA 5L3FA 4P9UA 1FC3A 2HOEA 2YU3A 1FP2A 2A6EF 4NHJA 1U5TA 4AVPA 4KN7X 1JHFA 4FZBA 2G7UA 2CQKA 5L3CA 3B73A 5DUKA 1FZPB 4JQFA 1L0OC 3DPLC 2DT5A 4A5MA 3ZP5A 4YIFA 2DW4A 3FWEA 4A0YA 2JZYA 2VC1A 4ZZLA 3GTOA 3O2PE 6PAXA 3V8JA 2GSNA 4EJVA 1SFEA 4HLXA 1W7PD 1HXDA 3P7NA 3EUHA 1TW3A 3Q9SA 4Q5SF 1KU7A 1KQ8A 2W25A 1WQGA 3B02A 1T0FA 4XBFA 2V1XA 3GYHX 4NQWA 3ZMUA 2XCRB 2DLLA 2X4HA 3JTHA 5ED4A 5HLIA 4HV6A 1ISEA 1UHMA 5LEJA 2ESHA 4M1XA 2PN6A 3I59A 4OIOF 3HIFA 3K1MA 3ERED 2MBFA 1FP1D 2EFWA 4NB5A 1BIAA 3U2RA 5ILVA 2KJBA 5E8IA 1FLIA 2L4MA 3TO9A 2FNPA 5D5XB 1WRJA 2VT2A 2H09A 4KM8A 5DEQA 3WTTC 2ZFWA 3SHFA 3Q3QA 2BBYA 4E70A 1ODDA 3OREA 3C7JA 3CLOA 3CUOA 1TWGA 2FMYA 4OINF 4LB5A 2LSOA 2VBXA 1WQHA 5KK1A 5ILSA 5LGTA 1V3FA 5LHIA 1TTYA 4RGXA 1R36A 3KE2A 3COAC 3S0XA 2R92A 1O7FA 2FBKA 5CJ9A 3QPTA 4YFXF 2F2EA 3ZN0A 1ZARA 3FKIA 4BKWA 2VONA 1FSEA 3I5UA 1FOKA 5F6FA 1KQ9A 3V4GA 4ESJA 3L00A 4BAYA 3EDPA 1MDMB 5BOXA 2DTRA 2OZ6A 2HS5A 2UXXA 5L3DA 4HX7A 2ZXJA 3ML6A 4KIFA 3MZHA 5DCMB 3DV8A 2UWMA 5ICFA 3HHHA 5LHHA 2EWNA 4LR2A 5E8GA 4IJAA 2KJCA 2R7FA 2RGRA 3DF8A 4BH9A 2PBIA 3T8TA 1R1TA 3GTGA 4OIPF 1S8NA 4EGYA 3FXUA 5D5UB 3F22A 1FWZA 1LDKB 2HYGD 2FOKA 1ZLJA 1TQPA 1T39A 3LWFA 4M71A 1DDNA 1FBSA 4LFUA 1S3JA 5DV5A 3GFLA 5HLGA 2XROA 1XSDA 2HEOA 4LK0F 5J8FA 2GA1A 5HS9A 4FX0A 4LD5A 4GTBA 2RDPA 4LLGF 3WE3A 3N0CA 3F8MA 3FMQA 1R22A 1W5SA 2Z3YA 1LDDA 3I4PA 1ZG5A 3FOFA 2ZNZA 5K1YA 3LPXA 3MEXA 4AIJA 4PDKA 3LQQA 1HSJA 3S2WA 1QO0D 5FD6A 2Y0MA 4M9XA 1U5TC 2E1NA 1G4DA 1WIHA 2D1VA 4ENJA 5CVVA 2UZKA 3HUGA 2EA4A 3GTKA 2YX4A 3L9FA 4KAWX 3WU0A 3DFGA 5ICCA 3MWMA 4LB6B 4AWXB 1Z6TA 1FX7A 1YLFA 3FMRA 3ECOA 1Z91A 1JGSA 4A6DA 1T98A 4U7DA 3MZYA 4EJWA 2C6YA 2IA1A 1IN6A 4RGSA 5HDNA 2JH3A 1MZBA 4HAMA 3K9TA 1NHAA 2ZJ2A 2XUBA 5JR3A 4IXAA 4GTEA 4GTFA 3WTSC 1BI1A 4BQAA 1DUXC 2NNNA 3I54A 2Q2EA 2YX7A 3JTGA 2QQ9A 3J7AO 1SFOA 5ICGA 3QP6A 3IWZA 2IW5A 3GVAA 2WTEA 3C3WA 1OMIA 1XMKA 3P9CA 3WODF 3F8NA 2X0LA 5LEKA 3F21A 2R93A 4LQYA 2KIUA 4XSZF 1UHWA 3K1NA 3GTMA 5TRDA 4RB2C 3FXRA 4KN4X 3KEOA 1XXAA 1LNWA 1MJAA 2W57A 2P8TA 5BPIA 2CSOA 2E7XA 5IT3A 1DPRA 2L54A 1I27A 2JSCA 3TGNA 3IWFA 2DK5A 1T38A 3CUQA 3FM3A 1O2AA 3E6DA 1FSHA 1J9IA 1XXBA 1HKSA 3GX4X 5LGUA 1TWFA 2NVXA 1XDSA 3E5XA 2P6TA 1EH8A 4MEYF 3QU3A 3KP6A 3WGHA 2HQNA 4BLAA 2ESNA 5DD8A 1KYZA 3CO7C 4KB2A 4LMYA 3W6KB 4O5VA 3G73A 2CWEA 1TWCA 1ZRFA 3K2ZA 2K86A 2QQBA 3KFWX 2STTA 1KQ0A 1MGTA 2OD5A 2B63A 2R7ZA 4IF4A 2EB7A 1DPUA 5CVUA 1P6RA 2F5CA 3JAMZ 1KU2A 1IZ1A 3O6BB 1QZZA 5D8LB 3WTZA 1BGWA 4A0XA 3E3VA 2MH9A 1ZGJA 1P4WA 3AH5A 2O0YA 2XASA 1XCVA 3L7WA 3GEZA 4L9VA 1FYLA 3KETA 3WTVC 4ILDA 2NAZA 5K5QA 4P5BA 1HW5A 4L9NA 5E1XA 3G4AA 2ZO4A 1U2WA 2O6GE 1USSA 5DCMA 1K78A 3ULQB 1BC8C 5FD5A 1KGSA 5E1WA 2Y75A 1O2BA 4Y17A 2Z99A 3D0SA 4G7HF 2OZUA 4OMYA 1EV7A 3WGIA 3RYRA 5BQTA 5D4SA 4RGRA 4I2OA 2QWWA 5J8CA 1R5HA 2CYYA 3F8FA 1GXPA 1HW2A 3GLXA 1I1GA 3EETA 2P7CB 1WI9A 4ENMA 3K69A 4FHTA 1ZG3A 3LA7A 2KKOA 3JW4A 2YU9A 3HYIA 2HKXA 1I6XA 1RUNA 3E97A 2VE9A 3MCZA 4CGZA 2PJPA 1O26A 4I02A 3BUEA 1KYWA 3TKYA 1A04A 5E17F 3T5XA 2IJLA 1I50A 4HW0A 5L3BA 2F5FA 4IPAA 4CZZA 4R1HA 4HOBA 1S7AA 1XSXA 4M74A 4RAYA 1BJTA 1IXRC 4R79A 4ZYDA 3G3ZA 4KFCA 2Q0OA 3MFKA 4G9YA 3P9IA 2OU2A 1O24A 1HKTA 3ZMVA 2EFPA 3G4CA 1AWCA 1K78B 3VA7A 1G3WA 3KP5A 1SD5A 1WSUA 3LFKA 4XSXF 1BC7C 1O27A 1F9NA 2DPDA 4L0ZB 1LDJA 1Z6RA 1W7PB 1J0RA 4EJUA 2W85A 3JSOA 4EM1A 2QBYB 4WXHA 1P92A 5JVTA 4G6DA 2PI0A 2CW0F 2HQRA 4M9ZA 1XN7A 4L9JA 3ZMDA 4KUMA 1IN8A 4G0WA 3VFZA 3Q9VA 5JFEA 3HRSA 1GHCA 1ZREA 1SMYF 1O57A 4XRFA 3FZVA 3KZZA 4P5OA 1E2XA 2Z9OA 3TOAA 3CQZA 3RKYA 5HDGA 2RH6A 3C1DA 1BOAA 2RV8A 5D4RA 3CUQC 2JTVA 1B4AA 1LQ1A 2MH2A 3WTWC 1IS1A 1EK8A 4MNUA 1O25A 1XDUA 2PMUA 4I7HA 3IRRA 1XCBA 1B59A 1SAXA 1OKRA 3OPFA 2MA3A 2CFAA 1ON2A 4N0BA 2A07F 1J5YA 2L01A 4ETSA 3F6OA 2L4AA 4ZZDA 4CXFA 1WQ2A 1XGNA 3E5QA 3ZMTA 4FM9A 2OQRA 2UXNA 1STZA 2E1CA 1T6SA 5L3EA 5IOSA 3GFMA 4M73A 1O29A 3V7RA 4BXUA 4KICA 2GAUA 1F5TA 1ZRDA 1AOYA 3J81K 3I59B 2RVCA 3DP7A 1YS6A 2P5LC 2LNBA 3T8RA 3TO7A 4G0VA 2RNJA 1U3EM 2O61A 4BHBA 3L4KA 2CFAB 2VUMA 2F5EA 3IL2A 1U8RA 2QUFA 1YS7A 1SD7A 3ZMSA 4K2EA 2LKPA 4GCVA 1YQAA 3TOBA 1FY7A 2DQLA 4KB4A 2HDCA 3QP5A 4ESBA 1IRGA 4B8XA 4KDPA 3NUHA 4EV0A 5HVQC 4BHCA 3HSEA 4HZFA 4HYEA 4MQVA 3P9KA 2M87A 3H3UA 2BEOA 2A61A 1IW7F 4BYYA 3F6VA 2AXLA 4A2UA 4U0YA 5D5VB 1K7AA 2JPBA 4J3NA 4AIHA 2KIMA 2V1DA 4UV8A 2K7LA 1VTNC 4BNCA 3BDDA 1SD4A 3RPQA 2O3FA 3GF2A 3RPUA 3GZ6A 2CFXA 4KMHA 4LG0A 1U5TB 4C3HC 1PP7U 1FYKA 3BP8A 1W4MA 5LGNA 2GWRA 1O28A 5BPDA 1YG2A 2GXGA 2MD5A 2V1UA 1R00A 5IT9K 1WWXA 1OYWA 3RKWA 1LB2A 1HBXG 1B9MA 3FX3A 4G94A 5ILUA 4EQQA 4FX4A 1QZYA 1R1VA 4WX9A 3V8LA 2MLGA 5LHGA 5F64A 1D8KA 3IHUA 4LLLA 3K0LA 3VOEA 1Z9CA 1MJBA 4OU0A 4P55A 2ACJA 3GW2A 2DI3A 2VBYA 2G9WA 3WGGA 2CO5A 2VE8A 2XAFA 3R61A 4XLNF 1XMAA 1ZBSA 1BI3A 2XAQA 2A69F 4I0BA 3ZMZA 4Q47A 1TNSA 1Z05A 4GGGA 4MTDA 3F23A 1XD7A 2ISZA 1KU9A 2FBHA 1IN7A 1ZH5A 1C0WA 2L3DA 3WU1B 4KNYA 1J7KA 1F1ZA 3GTLA 2XAHA 2QVOA 5K5OA 5E18F 4ESFA 1O7LA 2E2HA 2K4BA 1KQ4A 4IHSA 3GZ5A 3CJNA 2NNYA 2ADUA 1ZRCA 2DO7A 2IT0A 1I5ZA 1ONVA 1QGPA 1K83A 3ECHA 5K5RA 1IUYA 1ZN2A 1QNTA 2D1HA 5H6RA 2XVCA 3CDHA 2JRTA 2F5DA 3HHGA 4WXCA 2W84A 3E6CC 3BZ6A 4A6EA 2O03A 1IRFA 3WG9A 1BN5A 3V7SA 4AD9A 1REPC 4CICA 1J2XA 3PQJA 3HOSA 3QPHA 2FSWA 3LA3A 2OAZA 4DNCA 2LF7A 2JA7A 2LDUA 4LJZF 2FE3A 2QYOA 2ISYA 2LF8A 2W24A 4P96A 5DUIA 1XGOA 4L5IA 3IRQA 3BROA 2M1BA 1Z1DA 1G3SA 1DD5A 5FFZA 2HGCA 2XKPA 2P7VB 2YPRA 3I58A 1UB9A 4F7ZA 1JHHA 4HF0A 2ZMEA 3I71A 4HDVA 2HYFA 4YG2F 1YW9A 3R4KA 5CHPA 2DQRA 3F8CA 1TQMA 3U1DA 4TV7A 1BI0A 4CDGA 4UVAA 4EJTA 3NRVA 4RGUA 4PZJA 1TWAA 3J81Z 5DCFA 4M6XA 5CVIA 2FA5A 5A2QZ 3REOA 4UHTA 3QOPA 4M6YA 1YO5C 5FO5A 1KU3A 3GTQA 2RQPA 1PUEE 3AQOA 3H0GA 2L02A 1K79A 4LK1F 1GVJA 2HR3A 2CGPA 4LG0B 3KP4A 4BHPA 2HFHA 3ABUA 4RB0A 2RC4A 2STWA 4UXNA 4BLBA 3BY6A 2ZNYA 3KZYA 4Y13A 1B9NA 4B09A 2H6CA 2ZKZA 5FB2A 2PQ8A 2P6SA 5IOQA 2KRFA 3AQPA 2EV0A 3M1EA 2FMLA 5LLQA 1RUOA 3SQNA 1Z7UA 1YTYA 1Y1VA 4U88A 3QU6A 5EGHA 4ON0A 2ZCWA 3L09A 4HQEA 5HOOA 1EH1A 1W5TA 4YIIA 5E1ZB 2QBYA 3E5UA 3WTYC 3I0TA 3FMSA 1P4XA 2VN2A 5D8KB 4C2MC 4MEXF 2XIGA 2P5KA 4PCQA 2A3SA 2K27A 4KA4A 2XCQA 1OYIA 5CLSA 2TDXA 2EV5A 3TDZC 3H3ZA 4L0YB 2JT1A 3KLNA 2KWAA 3M8EA 3N3YA 2M45A 1HW1A 2H6BA 3QX3A 2NVYA 1BI2A 4IVNA 3EYYA 3N4MA 2E7WA 3FOEA 1RIOH 1H0MA 2IA0A 1FPQA 2E2IA 4HX4A 5KVRA 2EFNA 1H9TA 2XAGA 2BV6A 4N9HA 3I53A 5JVOA 2FF4A 1FBUA 4WF2A 2H27A 3LA2A 5FGMA 5FFXA 3SZTA 2DK8A 5L3GA 1TW2A 3HRMA 2G7HA 3HOTA 2COMA 2NRAC 4I01A 1E17A 3R0JA 3HTSB 2QM3A 4IRGA 4HX8A 4LLNA 4Z2YA 1R58A 4HF1A 1OPCA 2BYVE 2PG4A 4KMDA 3KP2A 4RB1A 4KMFA 2V6CA 2R7DA 3V8KA 5D6EA 4C3JC 4A12A 3GTPA 4EJOA 2XCOA 3IKVA 3PFIA 2IP2A 3T1BA 1T2KA 2XGXA 2HKOA 1V4RA 3U9GA 2A6HF 4KDDA 2PFBA 1OR7A 3J80K 4U0VA 2FXAA 3ZQ7A 1O3TA 3SXYA 2IPQX 2VOOA 5CVRA 2GZWA 5FLXK 2P5MA 2GSOA 2HTSA 1SFXA 2PEXA 4GYIA