5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
molecule keywords Arginine repressor
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
4N9IA 3R6SA 1L3LA 1SMYF 4L5JA 3AAFA 3LAJA 4ENNA 1S29A 3REOA 1O3SA 2DU9A 3N97A 1K79A 1QO0D 2PMUA 2ESNA 4HZFA 2XAFA 3DF8A 1T39A 3KP4A 1BI2A 4HDUA 4GO1A 3FXUA 3GXOA 1EH7A 1Z7UA 1Z9CA 1KQ8A 3M1EA 3ECHA 1E2XA 2VONA 1KYZA 1XCVA 3E5UA 3F21A 1RIOH 3IRRA 2F2EA 3ZMVA 3WTWC 2HYGD 2GIVA 4M72A 4P9FA 3BY6A 5J8CA 1P92A 2VT2A 2A3SA 1DD5A 2HEOA 3ZQ7A 4ZYHA 3KZZA 4OIRF 3Q9VA 2P6SA 4XBFA 1TW2A 1SD4A 2JSCA 3IWZA 5D6FA 2ZFZA 4G0WA 2ZXJA 2M30A 4U7BA 4KN4X 1U2WA 3L4KA 3B02A 3HTUA 4ZYGA 1KQ0A 3I0TA 2XGXA 1IUYA 2H09A 4G7OF 2EV6A 4GYIA 2K4JA 2M87A 2QQBA 3K69A 1YYVA 2FMLA 3WU0A 3DEUA 4WK8F 2E1NA 4A5MA 5ED4A 1USSA 4EM1A 1H9TA 4BAYA 2HGCA 1HKSA 2HYFA 2O6GE 3GWZA 3GX4X 1R23A 3TDZC 5L3EA 3V8LA 4EVIA 1T98A 4CXFA 3V8KA 2GA2A 5DCMA 5HLIA 3BJAA 5D4SA 2EFOA 4RGSA 4KDPA 1ON2A 2QVOA 2V9VA 4LG0B 2V1UA 1U8RA 4U0WA 3W6JB 3ZN0A 3HRSA 4M71A 2L3DA 3L9FA 4D0PA 1OMIA 4U88A 3TO9A 4JBAA 5K1YA 1ZRFA 1K78A 3I59B 3RDIA 5ICFA 1FY7A 2FBKA 4ENMA 1D8KA 2FMYA 3F8MA 2VBZA 1SFEA 3DP7A 2HQRA 3F6VA 2EA4A 2QQAA 1RI7A 4JQFA 2YSRA 5HDKA 2V1DA 1J7KA 1Z1DA 2CYYA 5H6QA 4KDDA 1HQCA 1KU3A 2ZMEB 2VC1A 3GFIA 3FMSA 3IL2A 3HSRA 3IKVA 3TOBA 1ON1A 4AD9A 3WU1B 3E5XA 5ICCA 2H6CA 4A0XA 1T6SA 3I58A 5CLSA 4OIOF 4ETSA 3COAC 3RKWA 4IRIA 2ZKZA 1HSTA 3RYPA 3F3XA 2RGVA 3DQVC 1ZG1A 1RNLA 2RNJA 4IVNA 5BPIA 4HA8A 5J6XA 2E7WA 1P4AA 2K02A 1W5TA 3RYRA 1B9MA 5FD6A 4KFCA 3RJPA 2XAJA 1O3TA 4I0BA 4EM2A 4A0YA 5DUKA 1XB4A 1YS7A 1TTYA 1USTA 2GXBA 1GXQA 1PDNC 2RC4A 3V7SA 5CVUA 2UXXA 1ISEA 2DT5A 2X0LA 2VE9A 4M6YA 3ZPLA 1ZN2A 4HDVA 3OREA 2VXZA 2NYXA 5AIPA 2XCQA 2PEXA 4UNOA 3ZMZA 1O7LA 3R4KA 2PQ8A 3WGIA 4A5NA 5LEJA 3LA2A 5HDNA 4HF1A 4MTDA 3EUHA 4ENJA 3CUQB 4ESBA 3WGHA 2VBXA 3KP5A 1YIOA 3LA3A 4HQEA 4RB1A 1PUEE 1SFXA 3TO7A 2M1BA 2EK5A 1FOKA 5DCMB 4KAWX 2H6BA 3T1BA 3ABTA 1B4BA 2STTA 5DUIA 3DPLC 3KEQA 4WX9A 3NQOA 2GA1A 2A5YB 2HKXA 3FMQA 4BXUA 4G6QA 1O3RA 2ADUA 1LJ9A 1Y0UA 5LEKA 4R1HA 1FYLA 1IN5A 1U3EM 5CVIA 2QUFA 2AXLA 3ZN1A 3P9CA 2EFWA 2K7LA 1IXCA 1DP7P 1U5TB 3LPXA 2FSWA 1ZG3A 2R7FA 1LDKB 2DK8A 1OPCA 4CHUA 4M9XA 1KGSA 3V7CA 3DFGA 4EV0A 3RI4A 2H94A 1J0RA 1P4XA 3ZMUA 4OIPF 1FBSA 4EM0B 1AOYA 3HYIA 4UXNA 3U2RA 5LHGA 3T8TA 2D1HA 2L54A 4U7DA 3GUDA 1C0WA 1D8JA 4Q4ZF 1Z6TA 4AWXB 3WGGA 4IHSA 1IXSB 1U5TA 4MHGA 1JE8A 2W25A 1KQ9A 3CAGA 4QLCU 3QPTA 4LFUA 3I4PA 2L4MA 3MQ0A 1KA8A 4Q5SF 5BOXA 2JPBA 1YS6A 2W84A 3RPUA 2EFPA 2NNNA 2Z3YA 3P9KA 1ZYRF 1V3FA 1YO5C 5KK1A 1FYKA 3HRTA 4AIKA 2LF7A 1P4WA 4P96A 5LHIA 2OZ6A 4L9JA 2A69F 2F5FA 1RUOA 2JTVA 3TO6A 1EH8A 4EGYA 2A61A 1R5HA 5E8GA 2QBYA 2ZCWA 4KMFA 2VOOA 2CFXA 2A07F 1ZARA 3PQKA 1W7PD 3EQLF 2KJBA 4RGRA 3ZMDA 5ILVA 3F8FA 5L3DA 1FPQA 2L4AA 1FNNA 3MCZA 4EJUA 4LB5A 2ZBKA 3WTSC 3C7JA 4WF2A 2XCOA 2IT0A 3E6BA 4HQMA 3I53A 2GZWA 4DDQA 1BI1A 2DBBA 4HLYA 4KYWA 1LDJA 3J7AO 3WTXC 2HZTA 2L02A 3K0LA 1MKMA 1JXSA 1YW7A 4YG2F 4Y13A 3JAMK 1XCBA 3DKWA 3C18A 4UV8A 1BOAA 2J5PA 4FX0A 3GZ5A 4EJOA 3L00A 1HW1A 3GFMA 4JK1X 5AONA 3F72A 5TJJA 1ZGJA 5HS8A 3Q9SA 1BI0A 3IHUA 1GHCA 3W6KB 1K6OA 4Y15A 1DUXC 2KRFA 2V1XA 1FWZA 3MWMA 3FMRA 5ICEA 3S2WA 5HOOA 5D8KB 2K4BA 2K27A 1QZYA 2UZKA 2Z5UA 1E17A 2Q8KA 1TW3A 4EMSA 2JZYA 3CO6C 1IS1A 1I1GA 1P6RA 1J59A 1R00A 4L9VA 5DD8A 3M9AA 2E7XA 4F7ZA 2QENA 4ESFA 1DPRA 2IPQX 4U0VA 4OINF 1S7OA 4HW0A 1FP2A 2BE5F 2ISZA 3K2ZA 5FGMA 3EYIA 1WIHA 1J9IA 1QGPA 3F8NA 4UHTA 3GLXA 4YFXF 3VOEA 2JPCA 4OMZA 1TNSA 1V4RA 4HX7A 1R1UA 5L3BA 2ZMEA 2ACJA 2HQNA 2P6TA 5DEQA 5F64A 1LVAA 1S8NA 4UUVA 2QLZA 2KIUA 3RKYA 1Z05A 3M7GA 1WKMA 1XGMA 1YW9A 4FX4A 3VB2A 2JRTA 5HDGA 2C6YA 2XKOA 4B09A 2QQ9A 2EWNA 2DI3A 2OBPA 3I59A 4EJVA 5F6FA 3RKXA 3M8FA 1DDNA 2G7HA 4EGZA 1IN7A 1BIAA 1BJAA 1WQ2A 2ZNYA 3F23A 2P4WA 4RB3C 2J5OA 1F5TA 2FNPA 2A6EF 2XAGA 3Q5FA 2COMA 2EFQA 2OQRA 3DXJF 4I7HA 3HRMA 2FBIA 3TDUC 4Y17A 4KIBA 3ROUA 4KB2A 1G6NA 2PMHA 4EQQA 4WXHA 3EYYA 2P7CB 4WXCA 2V79A 1TBXA 5D6EA 2L01A 3FM3A 1HBXG 2OD5A 1XXBA 3VEPA 4TV7A 5HS7A 1BGWA 3RIRA 1ODDA 2R3SA 1BJTA 4AIHA 3U1DA 1UFMA 3QP6A 5JVTA 2FRHA 2LSOA 2OQGA 2WC2A 2EB7A 3HUGA 2DPDA 4KIGA 2EV0A 2NS0A 5D5VB 3CO7C 2RV8A 1XGOA 2DPUA 2A6HF 4G8XA 2DQLA 1T38A 5CJ9A 1XSVA 3JAMZ 3GZ6A 3FOFA 2Y75A 2PN6A 4LLNA 3IKTA 4HF0A 3KEOA 4E70A 5FLXZ 1T2KA 2DO7A 4UV9A 2CW0F 4NHJA 3GF2A 3TQNA 4M9SA 2Y0MA 4KICA 1IRFA 3ECOA 3FXRA 1XGSA 2XAHA 3LAPA 2YX7A 1STZA 2P5KA 3KP7A 1XSDA 1TQPA 4P9UA 1QNTA 4KIFA 5FFZA 5D8LB 5FLXK 3VFZA 2JT1A 3KP6A 4ZYEA 5FB2A 3V7RA 2PFBA 2PBIA 4R79A 2MD5A 3HHHA 1U5TC 1G3YA 2MLGA 3TGNA 2CG4A 4BNCA 4HOBA 3HOSA 4UVCA 1LDDA 4MTEA 3E6CC 3G3ZA 1O7FA 2XCRB 5D5XB 5IT9K 3HSFA 2V6CA 2RN7A 2HTJA 1W7PA 3WTUC 4WXDA 2VE8A 1ZREA 1ZG5A 5CVRA 2XVCA 3FF5A 4YIFA 5E17F 3MMLB 4HV6A 1BIBA 5L3CA 2W85A 4I09A 3B73A 4EJTA 1EH1A 1IN4A 4R8HA 4RGXA 3BJ6A 1XN7A 1XMAA 2YPRA 3R60A 3R0JA 1AB4A 3L09A 5JVOA 5CVJA 3DPTA 2STWA 1SFUA 2DLLA 4MQVA 4BHBA 2XASA 4RAZA 4HLXA 1R22A 4YFKF 2P7VB 4OMYA 2Y48A 4ZYDA 3L4JA 1L0OC 4M9ZA 3OOPA 4O5VA 3SZPA 1J75A 1U78A 1PP8F 1P2FA 1YQAA 2DK5A 2VC0A 3LWFA 3I5UA 3LSTA 5FO5A 1QQIA 2FQ3A 4HBLA 2ZFWA 2ZNZA 3MFKA 2O0YA 5L3GA 4IHTA 2UWMA 2M5WA 1NHAA 2OU2A 2IRFG 1MJAA 3V8JA 2P5MA 1QPMA 2MH9A 1JGSA 3SZTA 1AWCA 3D5LA 1HW5A 5LRRA 1IN6A 1OYIA 2P8TA 4RAYA 1BM9A 2QM3A 1FP1D 5F1RA 2ETHA 4XSXF 1S3JA 2D45A 1BN5A 3F8BA 3FXQA 1XD7A 1MDMA 1FSHA 4KUMA 3K9TA 2Y3PA 2GWRA 2RGRA 4NQWA 2ZJ2A 3BPXA 4DNCA 3QAHA 1B1BA 3F6OA 4LG0A 2ZO4A 1ZGAA 2VT3A 1R7JA 4O6JA 1FSEA 3C3WA 2M8EA 2GQQA 2Q0OA 2NNYA 4CZZA 5HVQC 3J81Z 1RUNA 2LDUA 1H9GA 1MD0A 3ZMSA 5HLGA 1XMKA 3HIFA 5ILSA 2QBYB 4L0YB 3BZ6A 1W4MA 2XIGA 3ZMTA 3BPVA 4PZJA 4I98B 3RPQA 2YU3A 5HS9A 1R1TA 2FU4A 1HXDA 3LFKA 2HFHA 4M6XA 4ENKA 2CQKA 4HX8A 2PJPA 5JHUA 3N4MA 1I27A 2XKPA 3GW2A 3O3KA 2A68F 1J5YA 2HDCA 3KCCA 4HAMA 4XRFA 1JHFA 3L2CA 1XGNA 3HTSB 2F5CA 2Q2EA 4G9YA 5BMZA 3SFZA 1CF7A 1IF1A 5BPDA 3ML6A 2BEOA 2PI0A 1TLHB 4P5OA 3F8CA 4PCQA 1F9NA 4CICA 4HX4A 1FX7A 1ZRCA 3BWGA 4UVAA 1Z91A 2XV4S 4G0UA 3VA7A 1D3YA 5ICGA 4LMYA 5EEGA 1YW8A 5EEHA 1LNWA 1I1SA 2G9WA 4KA4A 1H0MA 3GFJA 2LF8A 4WCGA 3KZYA 3QOPA 4KNYA 4BH9A 3FOEA 1GXPA 1UHWA 1BC7C 5KVRA 1YTYA 2DTRA 1O3QA 1XSXA 2VOPA 3HSEA 2XUBA 3VODA 2HR3A 1Z6RA 5DYMA 4I02A 1OYWA 1F4KA 4H0EA 3BJOA 1GE9A 2FXAA 2YR2A 2EA2A 4MQ9F 2IW5A 5K5QA 1G4DA 1SD6A 3TOAA 2DFIA 2Z9OA 5J8FA 4GGGA 2KJCA 3BDDA 1FLIA 3WODF 2F5EA 3QRFF 1WQFA 2IP2A 2MA3A 5DDGA 1S6LA 5BQTA 3WTVC 1REPC 2B0LA 3WE2A 5HLHA 2D2WA 2IA0A 4AVPA 3BP8A 4XLPF 4GXOA 3I54A 4ON0A 4KB4A 5CYVA 3CLOA 2GAUA 1MJBA 4G6DA 1ZHFA 2FF4A 1TNTA 2ESHA 4KN7X 1R5GA 2FOKA 4OU0A 3IWFA 1YG2A 3KP2A 2TDXA 1IZ1A 3T0YA 2WTEA 2FBHA 3G73A 3EETA 2KIFA 1KU2A 4L9TA 1ULYA 3P7NA 4OOIA 3I71A 1YLFA 1XDUA 3QU6A 2RVCA 1G3WA 2KIMA 4UVBA 1MZBA 3H92A 3GO5A 3FZVA 1KU9A 3CDHA 4A6DA 2P5VA 3E5QA 3K1MA 2QYOA 2O3FA 4G7HF 3LQQA 3QU3A 5D5WB 4L9NA 4LK0F 4G94A 3T8RA 1B6AA 2LKPA 2EV5A 2BBYA 1Q1HA 4PGGA 5E1ZB 4S05A 3I64A 4ZZDA 3OPFA 1HKQA 5JFRA 3V4GA 5LBQA 1T0FA 3J80Z 2CGPA 4G0VA 1CF7B 1WRJA 3SXYA 3KLOA 2F5DA 3FM5A 2RDPA 3KE2A 2HS5A 3HHGA 2QWWA 2O8XA 4BQAA 3GVAA 4FM9A 3FX3A 1HSJA 3L7WA 1I5ZA 2RKHA 4N0BA 1YFHA 3LA7A 4LB6B 2QZ8A 3CTAA 2IVMA 4AIJA 1HKTA 2E1CA 5E18F 4IF4A 5E1XA 4A12A 3MZHA 3ELKA 3HRUA 1ZVUA 2BV6A 4PGHA 4PDKA 1BC8C 3PFIA 4LK1F 3P9IA 1IN8A 2PLYA 3LQRA 4MEYF 1ZH5A 5K5OA 3WTTC 5D5UB 2OZUA 4BYYA 3HOTA 5DCFA 2VBWA 2IA1A 4YIIA 2IJLA 4RS8A 5LGTA 3CUQC 2XAQA 1MJ9A 2O61A 5D4RA 2D1VA 2MC3A 3WTZA 5E8IA 3JSPA 2KKOA 1BI3A 2AS5F 5LGNA 3D0SA 1IXRC 3E6MA 1WSUA 5IT3A 2UXNA 3ULQB 2IA2A 4MGRA 1UHMA 4RB2C 1FBUA 4ZZLA 2DAOA 1MDMB 1FZPB 1GVJA 5LGUA 3CJNA 4XSZF 3JTHA 2BYVE 1J2XA 2OAZA 4O3MA 1UB9A 2PHCB 1SD7A 4Q48A 2W57A 2FE3A 4HV5A 4FHTA 5ILUA 2OA4A 3O2PE 1SAXA 4IXAA 3PQJA 1EK8A 4L5IA 2MBFA 4MEXF 2CWEA 1ZRDA 2EJRA 3J80K 5H20A 4RGUA 3R0AA 3IRQA 2DQRA 1OYYA 5CVVA 4CO8A 1LEAA 2MH2A 1QZZA 3QX3A 2HTSA 4ESJA 5LRSA 4RB0A 4I01A 1XXCA 3BUEA 2LNBA 4FT8A 1CGPA 4QWQA 4GFQA 5TRDA 3BROA 4L0ZB 4Q47A 3GEZA 4WWCA 2FEZA 5A2QZ 4DQ2A 2EFNA 4M74A 5JI6A 1TQMA 4MNUA 5FFXA 3SHFA 3QP5A 2CSOA 3KETA 3MAJA 1B59A 1O57A 3EDPA 2ISYA 4YFNF 5K5RA 2K86A 3GYHX 3TKYA 3T5XA 4KC6A 3K1NA 3WE3A 1ZAOA 3JTGA 1WQHA 1G3SA 2O03A 5AIQA 3FHZA 3KP3A 2XRNA 1IAWA 4GYGA 3H3ZA 4S04A 4B8XA 4G7ZF 2WV0A 2PG4A 3H3UA 4J3NA 1W7PB 2DW4A 3KFWX 3E97A 1EH6A 3O6BB 3ISPA 3IC7A 2HOEA 1B9NA 4OIQF 4BHCA 5E1WA 3NEUA 3E3VA 5LLQA 2BGCA 2ELHA 1FBQA 4CGZA 3ERED 2CO5A 1WQGA 1G3TA 5H6RA 2FNAA 4M73A 1XXAA 4CDGA 1KYWA 2P5LC 1W5SA 1B4AA 2FA5A 3ZP5A 5JR3A 4LLGF 3WTYC 1R36A 2XHKA 2X4HA 3KLNA 4LJZF 4CYDA 3MEXA 4LD5A 1HW2A 2WWYA 1XDSA 4A2UA 2VN2A 2XROA 1VTNC 5E20A 3JW4A 5BS6A 1ZLKA 1MGTA 1FYMA 4ASNA 2W24A 1FT9A 1U6GA 1IRGA 1A04A 2GXGA 1I6XA 3K1PA 3CUOA 1DPUA 1K7AA 2RQPA 4L18B 2KWAA 4HF2A 3C1DA 2G7UA 3MZYA 2Z99A 3WG9A 1SMTA 3BOQA 4U0YA 1F1ZA 2NRAC 4EJWA 4KMUX 2HKOA 4IJAA 5LHHA 3OEPA 1UCRA 1QBJA 1WWXA 2VODA 2H27A 2VBYA 1OR7A 4KT5C 4IPAA 5DD4A 4P55A 1TQIA 3ABUA 1PP7U 3FWEA 3SQNA 2M45A 1IW7F 2Z33A 5L3FA 1K78B 4A0ZA 2MLKA 3RTRA 1WI9A 3NRVA 4XLNF 5FD5A 5IT9Z 1LB2A 1LEBA 1EV7A 3M8EA 4HYEA 2R7DA 3QPHA 3R61A 4A6EA 4LGWA 4Z2YA 1D5VA 4ZH4F 3OV8A 2YX4A 4I0AA 3NUHA 5ERIA 1JHHA 1FC3A 1ZLJA 2HWVA 2NAZA 3JSOA 3J81K 1RZ4A 4K2EA 1S7AA 3F22A 4I2OA 3GFLA 4NB5A 1SD5A 1KU7A 5A2QK 3CUQA 5DV5A 1R1VA 4GCVA 1LQ1A 4IRGA 1OKRA 3E6DA 1ONVA 4IRHA 4N9HA 3U9GA 1R58A 1BBYA 4BHPA 3DV8A 6PAXA 1X3UA 4LLLA
chains in the Genus database with same CATH superfamily
4N9IA 2K40A 3H1CA 5M5WK 3R6SA 3CP2A 2O5IA 3S2DC 1L3LA 1A31A 2R4GA 3AFHA 1SMYF 3HM5A 4L5JA 3H9GA 3AAFA 3LAJA 1FJLA 3JCUC 1LUJB 4ENNA 1S29A 3WODA 3REOA 2NXNB 4C3JC 2GBYA 1O3SA 1SVLA 2DU9A 3N97A 2R92A 1K79A 1WOOA 1VQ5I 1QO0D 4E6KG 2PMUA 2ESNA 4HZFA 2XAFA 4MIMA 2JA5A 3O8HA 3DF8A 1T39A 3KP4A 3GTKC 1BI2A 4HDUA 4U87A 1S9HA 2LC2A 2ZC2A 4GO1A 4KATA 3TFJA 1TWAK 2LG4A 1WJCA 3FXUA 3GXOA 3HOUJ 3HOYC 4MQ9A 1EH7A 3ASOH 1Z7UA 1Z9CA 1KQ8A 3M1EA 3ECHA 4BXXC 1E2XA 2FOWA 4M3EA 4NC6A 2VONA 4HNVA 1KYZA 3AQPA 1XCVA 1GUUA 3E5UA 3F21A 1XPXA 1Z0XA 4PUSA 2EZIA 4BY7K 1RIOH 5IP7K 1Y39A 4W1UA 1A35A 3GTPK 3IRRA 2E2JJ 2CW7A 2F2EA 3PUBA 1T0FC 3ZMVA 1QU3A 5EDNA 3Q0VA 2DYSH 3OYIA 2NVYC 3WTWC 1YJ9I 3H35A 2W82A 2XPWA 5IOSA 1K6YA 2HYGD 2JA8K 2WV1A 3FK6A 2GIVA 1RU0A 1ZXOA 5DM7F 1QHGA 4M72A 4P9FA 2IS2A 1IG7A 3OYKA 2LLKA 1TWCJ 3W2WA 4E7IA 1LKXA 3BY6A 5J8CA 2R7ZK 2VUMK 1P92A 2VT2A 2V9PA 2Z2SB 2A3SA 4E4HA 3W3CA 1DD5A 2HEOA 1OQYA 4E7ZA 3ZQ7A 2L9RA 3PO3J 4YFKA 4ZYHA 1WCMC 3KZZA 4Z6YA 4CCLA 1Y56A 4OIRF 2LY9A 3G1MA 3Q9VA 4XSZA 2P6SA 4XBFA 5EGHA 1NG7A 3RSNA 1TW2A 1SD4A 1VQ8I 4A3DK 2JSCA 3IWZA 1YJWI 5D6FA 3J7YJ 2HOSA 5JHFA 2ZFZA 4G0WA 2ZXJA 4BE0A 2F4OB 3S16C 2M30A 1SVMA 4U7BA 3HUGB 2KDZA 4A3KK 4KN4X 1U2WA 3L4KA 4HG2A 3B02A 3HTUA 2JK3A 4ZYGA 1KQ0A 3I0TA 1QVUA 2XGXA 3CJQB 2OJED 2X9DA 2K3PA 1IUYA 2H09A 4C2TA 4G7OF 2EV6A 2RQQA 2DA6A 4GYIA 4BBSJ 2K4JA 2M87A 2QQBA 2DFHA 3K69A 1YYVA 3HOWK 2FMLA 4N4OB 4XLFA 2A68A 4A93K 3FIWA 3PFYA 3C2BA 3WU0A 3DEUA 3S3OA 4WK8F 3ZQIA 2NVYK 2E1NA 4A5MA 3SDBA 5ED4A 1USSA 3LSMA 1RC9A 4EATA 4EM1A 1H9TA 2E71A 2YS9A 1JJ8C 4LR2A 1X1CA 4BAYA 2VJ5A 2HGCA 1HKSA 5C44J 2HYFA 1RR8C 1MBGA 1CQTA 4XR6A 2O6GE 4IQJA 3GWZA 1R9TJ 2L7KA 2I5UA 3HG9A 5IP6A 3GX4X 1H89C 1LE8B 3E7LA 1MSEC 3DTEA 1R23A 1MMGA 1XS9A 4D5FA 3DU5A 3TDZC 1BW5A 5L3EA 4ABZA 4QPOA 3V8LA 4AYBN 1EFWA 4XLEA 2K9QA 4EVIA 4M3FA 2ELJA 1T98A 4CXFA 3V8KA 1V54H 2GA2A 4ZYAA 1EA3A 1A6QA 5DCMA 1EI6A 3DCFA 2DXIA 4UB8C 5HLIA 1ZK8A 1HOMA 3BJAA 5D4SA 2A6HA 3AKZA 2R7OA 2MC4A 4FQGA 4KMAA 2EFOA 4OWRB 1QHHD 4RGSA 2E1MB 4J00A 4G7OA 2W7VA 4KDPA 1ON2A 2QVOA 2V9VA 5GP9A 1SFOJ 4OIRA 3MVPA 2DCEA 4LG0B 2V1UA 4Y52C 3W6JB 4U0WA 3ZRGA 3ZN0A 1U8RA 3BQYA 4FE7A 3WHCA 1RETA 2QQ8A 3A8IA 3QOEA 4NUBA 3HRSA 2HDWA 3MMYB 4M71A 4GT9A 2L3DA 3L9FA 4D0PA 1OMIA 1D5YA 1VH2A 5IYCK 4U88A 3TO9A 1FEXA 4JBAA 4BJ5C 1WJDA 5K1YA 1ZRFA 2KHMA 1K78A 3I59B 2VPRA 4II2A 3RDIA 3VDXA 4RM3A 5ICFA 1FY7A 2R92C 2FBKA 4ENMA 1R6RA 1D8KA 2FMYA 3F8MA 2OF7A 2VBZA 2E1MC 1SFEA 1WJ5A 3DP7A 2HQRA 3F6VA 3CCLI 4A3CJ 3CCVI 5GTIC 2EA4A 1MMDA 2QQAA 5K7ZA 1RI7A 2NVTJ 4QIWD 2VI6A 5F27A 3CC7I 4XKCA 4JQFA 2YSRA 3OIOA 1JT0A 1PJ5A 5HDKA 1I50A 2V1DA 4UUSB 4BE1A 1J7KA 5B1AH 1Z1DA 4RDUA 5FLVA 2CYYA 5H6QA 5IP9K 3DU6A 4KDDA 2HPIA 3I4NJ 1HQCA 3FKIK 1KU3A 2ZMEB 2VC1A 2NVXA 5C4JJ 4XOTA 3GFIA 3FMSA 1ACIA 3IL2A 3HSRA 4G12A 4OAYA 3IKVA 3TOBA 1VF9A 1ON1A 5FRMA 3H0GK 4AD9A 1R71A 1TWGJ 2Z1DA 2W1OA 3S15J 2JMWA 3WU1B 1J98A 2E2HK 3E5XA 4XONA 5ICCA 3GBGA 2H6CA 4A0XA 1T6SA 3I58A 5CLSA 4ZTJA 4OIOF 5TMFA 4C30A 4ETSA 3COAC 3RKWA 2QCOA 5JVGF 4IZZA 4IRIA 4YG2A 5L46A 3CJRB 1KQ4A 2ZKZA 1HSTA 1BDFA 1USMA 2Y0SA 3K6GA 2CJJA 3RYPA 3S2DK 3F3XA 2RGVA 3DQVC 4LOCA 1ZG1A 3GTOC 1ETWA 1RNLA 4Q4ZA 1D0XA 3HOVK 1D1AA 3M3YC 1Y1VC 2RNJA 4IVNA 1SFOA 2H8RA 5K7FA 3CJTB 5BPIA 1Y8RB 1INNA 4HA8A 4LIUA 2MG4A 4DYCA 1JTXA 5J6XA 1MBKA 2E7WA 1P4AA 2K02A 1W5TA 1IE0A 3RYRA 4D5CA 1B9MA 5FD6A 4KFCA 4B1RA 3RJPA 2XAJA 1MW7A 1O3TA 3RZDK 3IH3A 1HDPA 4I0BA 4EM2A 4B43A 3L2WA 3BZKA 4A0YA 5DUKA 1XB4A 1YS7A 1TTYA 2A5WA 1USTA 1PUFA 2GXBA 1GXQA 1PDNC 1X58A 3CCUI 2RC4A 3S1MC 3V7SA 5CVUA 4A3GK 1DU0A 2UXXA 1ISEA 2DT5A 2X0LA 1W36C 2VQHA 1VQ9I 2VE9A 4M6YA 3GEIA 1ZN2A 3ZPLA 2A69A 4A93C 4HDVA 3G4CA 3OREA 1VQ7I 3BG7A 2VXZA 2NYXA 3HOZK 3GDZA 2R7VA 5AIPA 3MKZA 2XCQA 2PEXA 3VYTB 1HLVA 2A6TA 1O2BA 2R7WA 5IYDJ 4UNOA 3ZMZA 4AYBD 1O7LA 3BP3A 4F3QA 1YE9A 2KT0A 3S17J 5FLMK 3BG5A 3PO2K 3R4KA 4FCYA 3HPHA 2CUFA 2PQ8A 1ZELA 3HOVC 3WGIA 2VUMC 5M5XK 4A5NA 2XF6A 5JFEA 5LEJA 1LFPA 4D1QA 1IGNA 3LA2A 2W7NA 4FZBA 5HDNA 4HF1A 1SAUA 1RKTA 4MTDA 1NG6A 2FQOA 3EUHA 2WAFA 5FKLA 4ENJA 3KYDB 3VYSB 2BXZA 4MFDA 3CUQB 1DCHA 5EGEA 4ESBA 3WGHA 1E3OC 3G4AA 1DGRM 3UKGA 1VQ6I 2VBXA 3KP5A 2XC7A 4BEHB 3JRDA 1O28A 2BE5A 4C3IC 1YIOA 3LA3A 4HQEA 3P5JA 5B5EC 2LD5A 2R7ZC 2RREA 1O24A 2Y9YA 4RB1A 1PUEE 1SFXA 3TO7A 4BXFA 2M1BA 3DEWA 2EK5A 1FOKA 3KIOA 5DCMB 1EQRA 1XZQA 4KAWX 1O25A 1MBJA 2H6BA 3T1BA 1QRYA 2CH0A 3ABTA 4DW6A 5IY5H 2HOTA 1B4BA 2STTA 1IW7A 2R92K 5B1BH 5DUIA 3DPLC 4II3A 3KEQA 4WX9A 3GZNB 3I3LA 2KFDA 2GA1A 3NQOA 3A4CA 2R7XA 2A5YB 2KRHA 2HKXA 1MH3A 3FMQA 4BXUA 4G6QA 1NK3P 3JRFA 3FK7A 2ADUA 1LJ9A 1Y0UA 5LEKA 1O3RA 4R1HA 1FYLA 1R5ID 1IN5A 1ERDA 3PO2J 1U3EM 1TWFK 4PJLA 5CVIA 4BJ6C 3A8JA 2QUFA 2E60A 3HOWC 3ABKH 1I3QK 5C44C 2AXLA 3HC7A 3ZN1A 2ZMEC 4C2MJ 2VASA 3P9CA 2JA5K 2OV7A 3SZGA 3J7ZI 2V6TA 2EFWA 3H3VK 3S15C 2K7LA 5CHPA 1IXCA 3LSGA 1TWGC 2OUMA 1DP7P 1U5TB 5J1RA 2R7UA 3LPXA 2XB5A 1HA8A 2FSWA 1ZG3A 2JVHA 1Y8QB 2R7FA 1LDKB 2DK8A 1OPCA 2VUMJ 4LK0A 4CHUA 4P1WA 4M9XA 1KGSA 3CC2I 1J6VA 3V7CA 3DFGA 2W48A 4EV0A 4ZH4A 3S17C 2ZXWH 3IH2A 1O29A 2IXSA 3GTMK 3RI4A 2H94A 2NOGA 3HJEA 2XGEA 1J0RA 5BNGA 1P4XA 4RA2A 3ZMUA 4OIPF 1FBSA 4EM0B 4O2DA 4M3GA 1AOYA 3HYIA 4UXNA 3U2RA 1SC7A 5CQGA 4A3LK 5LHGA 3CQZA 3T8TA 2D1HA 2L54A 2XPVA 4U7DA 3GUDA 1C0WA 1D8JA 1K4SA 3CMMA 4Q4ZF 2DOAA 1Z6TA 1OCOH 4AWXB 1P7JA 1RESA 3WGGA 4IHSA 2MW8A 1X1PA 4FE4A 1IXSB 1U5TA 3GTJK 4MHGA 3JREA 1JE8A 3KPHA 3IV5A 2W25A 3OOUA 1KQ9A 3CAGA 1X1AA 4QLCU 3QPTA 2WB1L 4LFUA 3I4PA 2L4MA 2LRDA 3MQ0A 1KA8A 3AL0B 2JA5C 3DLAA 4Q5SF 3GMEA 2JPBA 5BOXA 2DA2A 1YS6A 2W84A 5F1JA 3PJRA 5IOQA 3RPUA 2EFPA 2NNNA 1IO2A 4Y7NJ 2Z3YA 3P9KA 3OIQA 2JA7J 3L2QA 1ZYRF 1V3FA 3HXAA 4HSRA 3GTQA 1YO5C 5KK1A 3LSHA 3MKYB 3HRTA 1FYKA 3K4MA 2EPFA 4AIKA 4IHYA 2LF7A 1P4WA 4BLAA 4P96A 5LHIA 1X19A 2OZ6A 4L9JA 1ZYRA 3HOZC 2GM4A 2A69F 1PJ6A 4XCHA 4BY1K 1E3PA 2NVUB 5KNLA 2F5FA 1RUOA 2X1EA 3U21A 2JTVA 3TO6A 1EH8A 4BQNA 4EGYA 1UG0A 2EZLA 1JKQC 3FKIC 2A61A 3TW7A 1R5HA 5E8GA 2QBYA 3S1NJ 2EQRA 2ZCWA 4KMFA 2E35A 2VOOA 2LKXA 2CFXA 1G2HA 2A07F 1DP3A 3H5NA 3RPUD 1ZARA 3OYAA 3TFIA 2OPTA 3WHBA 4RMFA 2PMZD 4DYQA 1B72B 4BLBA 5B3SH 3PQKA 1POGA 3GTGK 1W7PD 3TMOA 3EQLF 2KJBA 4RGRA 2JA6J 3ZMDA 5ILVA 3BZCA 3F8FA 4MEYA 3AG1H 5L3DA 1FPQA 4UB6C 1FOXA 2HQAA 1USOA 2MABA 2L4AA 1FNNA 2WBMA 3MCZA 4EJUA 4LB5A 2ZBKA 3WTSC 3C7JA 3CF2A 4WF2A 2XCOA 3S1QC 4ITVA 2IT0A 2DFFA 2QF7A 5GPCA 1AKHB 3E6BA 4HQMA 3I53A 2GZWA 1V5VA 2GLOA 4DDQA 1BI1A 2DBBA 3QPLA 4HLYA 1LDJA 4KYWA 3J7AO 3EPZA 3OYDA 3WTXC 1R9TK 2HZTA 2L02A 3GEHA 3K0LA 1MKMA 1JXSA 1FMWA 1YW7A 1TWCA 2JA7K 4A3CC 1WVRA 4YG2F 3OYGA 4Y13A 3JAMK 3QQAA 1XCBA 3DKWA 4P5AA 3C18A 1MSFC 2HXOA 3G2BA 2DA4A 1BOAA 4UV8A 2J5PA 5M3FJ 4FX0A 2LP0A 3GZ5A 4EJOA 2HYJA 1AA7A 3L00A 1HW1A 2VKHA 3GTQC 2HQ5A 1M1EB 3GFMA 4JK1X 2O8KA 1W0UA 4A3GJ 3BTLA 3K70C 3PNTA 5AONA 5GAHJ 3H0GA 3F72A 5TJJA 1ZGJA 3SEQA 2OC6A 5HS8A 1IDYA 1SFKA 3BR5A 3Q9SA 1IRZA 1I6VA 1BI0A 3IHUA 1GHCA 3N0CA 5C3EK 3W6KB 1K6OA 4Y15A 1DUXC 5E79C 2HNHA 3BCAA 2KRFA 3SZZA 2V1XA 5IP7C 3BLYA 1FWZA 2XB0X 2M8GX 2BW3B 3MWMA 3FMRA 5ICEA 3S2WA 2EBBA 2XGDA 5HOOA 5D8KB 2R93J 3WU2C 2K4BA 2K27A 1QZYA 2UZKA 2Z5UA 1E17A 4B48A 1D1CA 2L0KA 2Q8KA 4A3FJ 3CD6I 4DOZA 4C2MC 2FX0A 4Y33A 3S14J 1TW3A 4EMSA 5EG0A 2JZYA 3CO6C 1DGWY 1IS1A 4XRMA 1HCRA 3HOWJ 1I1GA 1P6RA 3I9V2 3JSTA 1J59A 1R00A 4L9VA 2KDOA 2VJIA 3M9AA 4KT6A 2E7XA 5DD8A 4F7ZA 4YFXA 2QENA 4ESFA 3GTJJ 1Y1WA 4IHXA 2DA7A 1R9TC 4C3JK 1DPRA 1YI2I 2IPQX 4U0VA 1HDDC 3S14K 4OINF 3H5AA 1S7OA 2KL4A 1JUMA 4HW0A 1FP2A 1T33A 4RM2A 2BE5F 2ISZA 3K2ZA 2JA6C 4KMUA 5FGMA 3EYIA 1VQMI 5FKKA 5EG0B 1R49A 4AUXA 1WIHA 3HOYK 1J9IA 9ANTA 1QGPA 5IP7J 3F8NA 2VJJA 3M1CA 4UHTA 1TWGA 2GSOA 3GLXA 3QODA 4ZTFA 4IEJA 4YFXF 2WA0A 4XIDA 3FDYA 4ZC3A 3VOEA 4B44A 1JKRC 2JPCA 5TGTA 2L9SA 4OMZA 4M3BA 1TNSA 1V4RA 4HX7A 1R1UA 5L3BA 2ZMEA 1A6IA 3I55I 3LSJA 2ACJA 2HPMA 2HQNA 2KQRA 4ZDLA 2P6TA 5DEQA 1YX5A 1TWFC 5IOTA 4BY7C 4CUGA 1WJBA 3JRCA 4A3JK 5F64A 4V2FA 1LVAA 1S8NA 4Y3OA 2OTLI 4UUVA 2GOMA 2QLZA 3GCMA 2KIUA 4A3FK 4BE2A 3RKYA 1Z7LA 4HEA2 1Z05A 2F6CA 2CS3A 3M7GA 4DIQA 2ZUFA 1WKMA 5EZHA 1XGMA 1YW9A 2JJ7A 4FETA 4NC8A 4UUSA 4FX4A 4A3BK 2EZHA 2X1DA 4BY7J 3VB2A 2I8DA 2JRTA 3A0HC 5HDGA 3PSIA 2C6YA 2XKOA 4B09A 2I10A 3S8PA 4XN3A 2QQ9A 2ZXIA 1HC8A 2EWNA 2BZTA 2DI3A 3BR1A 2OBPA 5C3EJ 3B6AA 3I59A 4EJVA 3LNQA 5IYDC 3T00A 5F6FA 4MFEA 3RKXA 2FD5A 4CH7A 5M5WJ 3M8FA 1DDNA 2G7HA 4EGZA 3OYMA 1IN7A 1BIAA 1BJAA 1TWAJ 4I76A 2ZSHB 1WQ2A 4XN0A 2ZNYA 2HDDA 2XDVA 3BTCA 1FMVA 3F23A 2P4WA 3IAS2 5J3LA 4XKVA 1G51A 3TBIA 4RB3C 4A3KC 3GTGC 2J5OA 1NK2P 2WAQA 1F5TA 5FLMJ 2FNPA 3S17K 4C2UA 2A6EF 3K2AA 5IYBJ 1W1WE 4E7KA 1TT5B 3JR9A 2XAGA 2QGUA 3Q5FA 4DZPA 4IHWA 2COMA 2EFQA 3CMEI 2OQRA 4KN4A 4QIWN 3DXJF 4I7HA 4ANJA 3HRMA 2LMDA 3IH4A 4N4NB 5IYBK 3HEFA 2FBIA 3TDUC 1BS2A 4Y17A 1N78A 1YOVB 2VXDA 4WJ4A 4KIBA 3AD9C 2YUSA 2LKSA 3ROUA 2DN0A 3TP0A 3L1PA 5B66C 2D6FC 4BU2A 4I6ZA 3GEEA 2A05A 4KB2A 1ZQ3P 2CW0A 3CCYA 3L2UA 1G6NA 2PMHA 4C9YA 4EQQA 2Z16A 2JVGA 4WXHA 3EYYA 2P7CB 4WXCA 4QPQA 4JX4A 2V79A 1IJWC 2VL8A 1TBXA 3KYCB 5D6EA 2L01A 3FM3A 1HBXG 2OD5A 1XXBA 4LK1A 2M9HA 3VEPA 5J1YA 4F92B 1VQNI 4TV7A 5HS7A 1BGWA 3RIRA 2CUZA 3H0GC 1VQ4I 1X4OA 2ZXHA 4A3MK 1ODDA 2R3SA 3ZQHA 4AIHA 1BJTA 2TCTA 3U1DA 3PIOF 1UFMA 3QP6A 5C4JC 5DTDA 4BY1C 5JVTA 2FRHA 2LSOA 2OQGA 2WC2A 4E7SA 4PJNA 4C3HJ 4IHVA 2DOFA 2EB7A 3HUGA 2E5NA 3RZDJ 2A6EA 3GTMJ 3D5SC 2DPDA 3A1YA 1OCCH 3CCEI 1YRNB 3FXJA 3GTOK 3HGGA 2VB6A 2CV0A 2OCCH 3H9QA 2BY3A 2Y9ZA 4KIGA 3TL4X 3CQZK 2EV0A 2NS0A 5D5VB 4HRIA 4J19A 4V2GA 2RV8A 3FXKA 3CO7C 1XGOA 1A36A 1YRNA 1Y1WC 4BKXA 3I4NK 4PJ0C 2DPUA 4AH6A 1GDTA 2A6HF 4G8XA 3OYEA 3H36A 2DQLA 1T38A 2V6EA 5CJ9A 3LSPA 5KCMA 1XSVA 3JAMZ 3GZ6A 3FOFA 2Y75A 3OS0A 2B7EA 2PN6A 2LK2A 4D7NA 3IKTA 4LLNA 2LOOA 4HF0A 1KONA 3DTIA 4PJJA 2E2HJ 3KEOA 1Z77A 2CFOA 5GAEJ 4CCKA 1K83C 3SDGA 4E70A 5FLXZ 1T2KA 2DO7A 4A3CK 1JKOC 1DQUA 4UV9A 2CW0F 4NHJA 3GF2A 3TQNA 4M9SA 2Y0MA 3BC8A 4KICA 1IRFA 3C2HA 3GTQK 3ECOA 3RQIA 3FXRA 1WSRA 1XGSA 3M07A 2XAHA 3K4NA 3LAPA 2JA5J 4GDFA 4C2MK 4A3BC 5IYCJ 2DA1A 4NBQA 2YX7A 2Y31A 2E2IK 1STZA 4MEXA 2P5KA 2V1NA 3KP7A 1XSDA 1TQPA 2CQXA 4P9UA 3DKYA 1JT6A 1QNTA 2IGMA 2Y2ZA 4KIFA 3DLLF 1ZGWA 5FFZA 5D8LB 4GTAA 3GTLA 3L2RA 5FLXK 2AQEA 3VFZA 1W0TA 2EZKA 2JT1A 2KP6A 2ZJQF 3KP6A 3J7AY 2BW3A 4BS9A 3TEDA 5IOYA 4ZYEA 2R5YB 2JQ7A 1Y1VK 5FB2A 2EH3A 2CUEA 3V7RA 1OLTA 2W00A 2PFBA 2JH3A 2PBIA 3S14C 4R79A 4AVZA 2IGNA 2MD5A 3HHHA 1U5TC 2ZFUA 1G3YA 2MLGA 3TGNA 2CG4A 4BNCA 4A3DC 3S2HK 4HOBA 4C3IK 3HOSA 4UVCA 1LDDA 3AD7C 4MTEA 3ZXSA 3E6CC 1T56A 1ZKGA 3G3ZA 3ABLH 1O7FA 1BR4A 4CCNA 5E3NA 3L2VA 3PNVA 4XLAA 4M3DA 3G1LA 1WJFA 2QKLB 1MNMC 2XCRB 5JLWA 5D5XB 5IT9K 3HSFA 1SFOK 1N75A 3DPUA 3DTKA 1P9QC 2V6CA 1WGXA 2RN7A 2HTJA 1W7PA 1WSVA 1VQOI 3WTUC 4WXDA 5GAGJ 4A3JC 2DDBA 2LY1A 2VE8A 2JSPA 3OYHA 1ZREA 1YNJA 1ZG5A 5CVRA 2XVCA 3FF5A 2M34A 4YIFA 5E17F 3N05A 2CU7A 3S1MJ 3E1SA 3MMLB 2R7ZA 5H2FC 4HV6A 5K7HA 3GTLJ 1F43A 4Y7NK 1BIBA 4F91B 3OSFA 5L3CA 3CCJI 4FISA 1TL8A 2W85A 4I09A 2E34A 2HVQA 3B73A 2M0MA 4EJTA 2NVQJ 1ETYA 1EH1A 1I3QC 1IN4A 3ONQA 4R8HA 4A3BJ 1XX5A 4RGXA 5IYDK 3BJ6A 1XN7A 1XMAA 2WB1A 4HPQA 5F0FA 4BY1J 2R5YA 2NVYJ 4A3DJ 2YPRA 3E0JB 3HKZN 3R60A 3R0JA 1AB4A 2ME0A 3L09A 3AG3H 2LYCA 5JVOA 3CC4I 1K4TA 2JN6A 3RCOA 5CVJA 3DPTA 2STWA 3S2HC 1VFCA 1SFUA 2DLLA 4MQVA 1MIJA 4BHBA 5E3OA 4A3MC 1ETQA 3CQZJ 2XASA 4RAZA 5F04A 3TW6A 1JUPA 4HLXA 1U8BA 3ZCOA 5M3MK 1K83J 1R22A 3N0BA 1MMNA 4YFKF 2P7VB 2YU9A 4XK4A 3JRIA 3JRAA 4OMYA 2Y48A 3K4CA 3PUFA 4ZYDA 3L4JA 1L0OC 4M9ZA 2JA8J 3OOPA 3IP4B 2F48A 2Q1ZB 3M4OC 4E7JA 4O5VA 1WOSA 1WORA 4PFOA 3EQLA 3I4MJ 3OS2A 2ZJRF 2LR8A 3SZPA 2VKEA 5EYRA 2LREA 1J75A 1U78A 4P9SA 4DBQA 3CQZC 1PP8F 1LFUP 1JOEA 1P2FA 4A3MJ 2RNGA 1YQAA 2DK5A 2VC0A 3LWFA 1LFBA 1G8XA 3I5UA 3OR2C 2YU9J 4AYBL 3G71I 3LSTA 5FO5A 1QQIA 4KASA 5F0CA 2FQ3A 4HBLA 2ZFWA 2ZNZA 3MFKA 4Y7NC 3EUHC 2O0YA 3I56I 3HOVJ 5L3GA 1Y1WK 3I4NC 3BG9A 4IHTA 4W97A 2L9NA 2X1CA 2UWMA 1ZQ1C 2XF7A 2M5WA 1NHAA 2OU2A 2IRFG 1MJAA 3V8JA 3RZDC 2VUMA 2P5MA 1AHDP 5IYBC 5HODA 2XSDC 2HVSA 5KAFC 2XRLA 5TMCA 1QPMA 2NVTC 2MH9A 1FOWA 2E5ZA 2CV2A 1JGSA 1MBHA 3SZTA 1AWCA 3DBLB 1P7IA 2EBIA 3D5LA 1UELB 1HW5A 1WFXA 5LRRA 2R93K 1IN6A 3ESWB 4GTDA 3FXLA 1OYIA 2P8TA 2VJ4A 4RAYA 1BM9A 2QM3A 1N77A 1FP1D 5F1RA 2YU9K 2ETHA 3OYJA 1V5GA 4XSXF 1S3JA 1WZ2A 1Q1VA 2D45A 1BN5A 2GIZA 4KN7A 4CYCB 3F8BA 5C4JK 3FXQA 4G7HA 2CQNA 1XD7A 3NAUA 1OCTC 4BDZA 4XQFA 1F7UA 1MDMA 3T02A 1YIJI 1FSHA 5GPAA 4KUMA 2GOXB 3K9TA 2Y3PA 4A3LC 2GWRA 2LVSA 2RGRA 2QA4I 4Y52J 2AQFA 1R4MB 2L7MP 2E19A 3FKJA 1ZTRA 2VIXA 3GTLK 4NQWA 2DTZA 4NNJA 2RH6A 1BL0A 2KPMA 4G7ZA 2ZJ2A 3HKZA 4CCMA 3BPXA 4DNCA 1SMYA 4IO9F 2R92J 3A03A 1J6XA 2R5ZB 2DMNA 3ZQGA 3QAHA 4BJTA 1B1BA 3CZ6A 1BR2A 1FIAA 3FISA 3F6OA 4LG0A 2ZO4A 1ZGAA 3QYFA 3ZR8X 2VT3A 1R7JA 4O6JA 4RBOA 3OR1C 1FSEA 4A3EJ 3C3WA 2G0EA 4V19K 2M8EA 2GQQA 2Q0OA 3HZJA 4J01A 3ZGKA 2NNYA 2NVYA 2EIJH 1XZPB 4A3IC 4CZZA 3S1RJ 1VJEA 5HVQC 3J81Z 1RUNA 4XOPA 2LDUA 5EZGA 1H9GA 1MD0A 3ZMSA 5HLGA 3HOXJ 1GV2A 1XMKA 1QPIA 3PSFA 3S1MK 3HIFA 3JRHA 5ILSA 1BR1A 3HGYA 3QYBA 3S2HJ 2QBYB 1LE8A 4L0YB 3BZ6A 1XZPA 1W4MA 2XIGA 1V55H 1TWAC 3ZMTA 2R5ZA 3BPVA 4PZJA 4I98B 3RPQA 3S3NA 2LH9A 1ZBSA 2YU3A 5M5YJ 5HS9A 1R1TA 1OISA 2FU4A 1HXDA 3LFKA 1JJ6C 5C3EC 2ZSIB 1MNDA 5M5XJ 2HFHA 4X1EA 2MSYA 4XLPA 3GTKA 1XC5A 4M6XA 4DYRA 1JTYA 3GTLC 4ENKA 1T95A 2CQKA 2M7AA 3RZOJ 4XNFA 1J6WA 4HX8A 2PA8L 2PJPA 5JHUA 5C44K 2E2IJ 3N4MA 3K70D 1I27A 2FJ1A 5GTHC 2XKPA 3GW2A 3O3KA 2A68F 1C0AA 1QZEA 1J5YA 3LOCA 3SFIA 2HDCA 3KCCA 4HSTA 4HAMA 2BY2A 4XRFA 1JHFA 3L2CA 1XGNA 5J4VA 1WCMJ 3PO3K 3X2QH 1IDZA 3HTSB 2F5VA 2F5CA 2PMZN 2Q2EA 3LSKA 4G9YA 3S32A 5BMZA 3SFZA 1CF7A 1U0JA 4S0HB 1IF1A 2PMZL 5BPDA 1FTTA 3N3YA 4AM3A 3ML6A 4CYCA 1I50K 2BEOA 1MNEA 2PI0A 3BG3A 1TLHB 4P5OA 3F8CA 2DMUA 4PCQA 4GTBA 4F55A 2R7TA 1F9NA 2JWTA 3HDDA 4BBRC 4A3IK 1I39A 2ECBA 4CICA 4HX4A 4XRSG 1FX7A 3GTMC 1I3AA 1ZRCA 1SFOC 3BWGA 2FQ4A 5J40A 3GIRA 3H0DA 4UVAA 4JX6A 1Z91A 2XV4S 5KHDA 2CFAB 4E7LA 2BHYA 3VA7A 4G0UA 1D3YA 5ICGA 4LMYA 5EEGA 1YW8A 5EEHA 1LNWA 2NOJB 1I1SA 2G9WA 2NS8A 2VPLA 2BVMA 4KA4A 4PAAA 1H0MA 3GFJA 3TFHA 3RZOC 2LF8A 4BXXK 4WCGA 3CCQI 3KZYA 1GV5A 3QOPA 3GLLA 4KNYA 4ZJZA 1TWCK 4BH9A 4BDYA 4B3XA 3FOEA 2P81A 1GXPA 1ZR2A 1UHWA 3VYRB 1BC7C 5KVRA 1YTYA 1IQ0A 2DTRA 1O3QA 4AC0A 1XSXA 1KZHA 1GT0C 5EEAA 3F0CA 1HQMA 2VOPA 3OWTA 2EIKH 2VKVA 5M3FK 4A3FC 4IX7A 4C45A 2PMZA 2Y30A 3GTKJ 3HSEA 2XUBA 3VODA 2PJRA 1AU7A 2NVXC 2HR3A 3K4BA 3OMYA 3S15K 2R93C 1Z6RA 5DYMA 2O7OA 4I02A 1OYWA 1F4KA 4H0EA 4GZYA 5E3LA 3BJOA 1GE9A 3CMAI 4BBSC 2FXAA 2JUCA 4LOWA 3S1RC 4XLHA 3S1NC 1I50C 2YR2A 2EA2A 4OIQA 5TJ3A 4MQ9F 1RPWA 2COBA 1L0WA 4RLQA 4PJMA 2IW5A 5K5QA 1XTAA 4UUTA 1DU6A 4GTFA 5IP9J 3K10A 3MKWB 4X6AJ 1G4DA 1SD6A 3TOAA 5M5YK 1ORKA 1X1BA 1IRXA 3ADAC 3ZQFA 2DFIA 4C3HK 3HBLA 1MMSA 2E36A 1XZQB 2Z9OA 4DJAA 2JA6K 1TZLA 4MO7A 3HXLA 5J8FA 4GGGA 2KJCA 3BDDA 3K4JA 1FLIA 3WODF 2F5EA 3QRFF 1K83A 1IL2A 1WQFA 1XMXA 2IP2A 3KX2A 3RZOK 2MA3A 5DDGA 2M3AA 2DA3A 1YX3A 2IAIA 1S6LA 1U9OA 1R4NB 2CQ7A 5BQTA 3AH5A 3WTVC 1REPC 2B0LA 3WE2A 5HLHA 1B8IB 4BKWA 1X2NA 1WCMA 2KRCA 4BEHA 1X31C 2D2WA 2IA0A 1RKWA 4AVPA 3HB9A 3OS1A 2X6XA 4H4KC 4CCOA 1TWAA 3BP8A 4XLPF 3S1QK 1IC8A 2O9LA 3LFUA 3I54A 4GXOA 2K85A 4ON0A 3SYTA 1K61A 3K7AK 3LL7A 4KB4A 5CYVA 3CLOA 2GAUA 1N25A 1ETKA 1MJBA 4G6DA 2QSGX 1E0EA 3MN2A 4LLGA 2DT6A 2V6SA 1EF4A 1ZHFA 2KZGA 2BHZA 1AKHA 3OL3A 2FF4A 4AIDA 3HL2A 1TNTA 2ESHA 4RAGA 1A5JA 2ZUEA 4KN7X 3GTGA 4PSWA 1R5GA 2FOKA 3PL8A 1UAAA 3BCBA 4OU0A 3NARA 2DJNA 1YG2A 3IWFA 3GTPA 1ITYA 2GSUA 1B8IA 1B72A 3KP2A 2TDXA 1X3WB 3K7AJ 1SVOA 4RAFA 3OYLA 2X6OA 3MD2A 4L5EA 1IZ1A 3T0YA 5IP9C 3S1QJ 2WAQL 2R7QA 2WTEA 1TWHA 1VQKI 2FBHA 3G73A 2MFZA 4YRVA 5FJ8K 1Z3YA 4Y4RA 2R7RA 2ELKA 3EETA 3JRGA 3HOZJ 4FTHA 2KIFA 2QSHX 3RQ4A 1D1BA 1KU2A 3UNGC 4L9TA 1YJNI 1ULYA 3P7NA 4OOIA 1RR7A 2YU9C 4KJZA 3F9KA 3I71A 1YLFA 1XDUA 1MH4A 5EGOA 3QU6A 4BGDA 2RVCA 1WHUA 1G3WA 2GAHC 2KIMA 1IV8A 1WJEA 3K4LA 1WJAA 2JRMA 3BR2A 4UVBA 4FASD 4XM3A 1MZBA 3H92A 3CDLA 3TTGA 3GO5A 2JA8C 3FZVA 4DZJA 3PIPF 2ID6A 1KU9A 3CDHA 4A6DA 4IOAF 4JK1A 1VRQC 2P5VA 4LITA 3VSKA 2V6UA 3K7AC 2IGKA 2DMPA 3E5QA 5F0HA 1TWFA 1XG1A 4BBRK 1LVKA 3K1MA 3DBHB 1I3QA 2QYOA 3HKZL 2O3FA 4QIWL 3CCRI 1W5CC 4XMYA 1WOPA 2WAQN 4G7HF 1J09A 2DDAA 4XLCA 3LQQA 3CCMI 4A3KJ 3QU3A 5D5WB 4L9NA 1I6HC 4LK0F 4X0GA 2WAQD 2JA7C 2FQTA 2UUZA 4G94A 1SEUA 1X1DA 1O27A 1DCOA 3T8RA 4KARA 3GTKK 1B6AA 2LKPA 3RKQA 4BACA 5IORA 2EV5A 2BBYA 1GVDA 1X2MA 3K4KA 2NVQC 3OIPA 1Q1HA 4PGGA 1F7VA 2QSFX 1T08B 5E1ZB 4S05A 2IS1A 2DMQA 2R7ZJ 4I99C 3FXOA 3I64A 2PX9A 3QYEA 4ZDPA 4ZZDA 3OPFA 5M3MJ 4GTEA 4B47A 3BTJA 1HKQA 1VZ0A 3V4GA 5JFRA 1T0FA 1MBFA 5LBQA 1TWHJ 4A3GC 4JYKA 3FBIB 3J80Z 2MGQA 2CUJA 1NH3A 1QA6A 2M4KA 2CGPA 3LMMA 3S3MA 2CRGA 4G0VA 3BQZA 1CF7B 3UR3C 2LFBA 2Q2EB 1WRJA 3BR6A 3SXYA 3KLOA 3HKZD 2E2IC 2F5DA 4PK4A 1MBEA 4XRSA 3FM5A 2RDPA 1TWFJ 3KE2A 5J4YA 2HS5A 2F4IA 3HHGA 3PO2C 2QWWA 4E7HA 2O8XA 3OY9A 2GSNA 4BQAA 2K9LA 3GVAA 1O2AA 4BBRJ 4FM9A 4QSHA 3FX3A 1I50J 3A01A 1ETOA 3M3YK 4D7MA 3D1NI 1HSJA 3L7WA 2LY2A 1I5ZA 2RKHA 4N0BA 1YFHA 3HOUK 3LA7A 4LB6B 1I6HK 2QZ8A 3CTAA 4CSWA 3EUKL 3GTJA 2X6WA 2IVMA 2JUGA 1IV6A 5FRNA 4PSXA 4AIJA 2CMPA 2DJIA 1HKTA 2E1CA 3CLQA 5E18F 4IF4A 4KISA 1VLOA 5E1XA 5IPAA 2E2JC 4A12A 3MZHA 5EGOB 3ELKA 5D4DA 3S16K 3HRUA 1ZVUA 2BV6A 2V4JC 2KISA 4PGHA 1YITI 4PDKA 1BC8C 1IBAA 5HLTA 3CP8A 3PFIA 4LK1F 4KM8A 2Y0SD 3A0BC 3P9IA 5IYCC 1IN8A 4CA0A 5F08A 2PLYA 4P5BA 2JA6A 2XAUA 3LQRA 4MEYF 5CQEA 1ZH5A 5K5OA 3WTTC 5J1UA 1Y0NA 2WAEA 5D5UB 2OZUA 4BYYA 2CW8A 3HOTA 2IBDA 5DCFA 2VBWA 2IA1A 4YIIA 2IJLA 4RS8A 2NVXK 1Y1VJ 5LGTA 3CUQC 4F52A 1YCLA 2XAQA 1MJ9A 1OCPA 2O61A 5D4RA 4QTRA 1UG2A 2L7FP 3C2GA 2D1VA 2MC3A 2B63C 3WTZA 5E8IA 3JSPA 3S1NK 2KKOA 1BI3A 2AS5F 1LPQA 3BT9A 5LGNA 3D0SA 2H1KA 2DMTA 4A3EK 2DODA 1IXRC 3E6MA 1VNDA 1WSUA 5IT3A 3ZQCA 3Q0UA 4C3IJ 2UXNA 3ULQB 4UY8I 1GLNA 2IA2A 2TRTA 1ZR4A 1JVIA 4XL9A 3GTQJ 4MGRA 1UHMA 4RB2C 2OTJI 3OYBA 1FBUA 4ZZLA 1BA5A 5C4XK 4LG3A 2DAOA 3B6CA 1MDMB 2IS4A 1FZPB 1GVJA 2VQLA 4BBSK 3VSLA 5LGUA 4DGWB 3CJNA 4XSZF 3JTHA 3DXJA 2BYVE 1J2XA 3DKXA 1S5LC 2VLAA 2K9SA 2OAZA 4O3MA 4OINA 1OCRH 2ZJPF 4Y52K 1UB9A 2PHCB 1SD7A 4EEFG 2IS6A 1VQPI 4Q48A 2W57A 5E68A 3M4OK 2DA5A 2FE3A 4HV5A 4FHTA 5ILUA 1O4XA 2OA4A 3O2PE 3KZIC 1SAXA 4IXAA 1F93A 3IAM2 3PQJA 1EK8A 1OCZH 4PFPA 3Q3QA 3SZYA 4L5IA 4C3HC 2MBFA 2PPBA 4D9JA 4MEXF 2CWEA 1JQWA 2XSJC 1ZRDA 2EJRA 3J80K 5H20A 1PUFB 2H1LA 4KMHA 1U9NA 3GSIA 3ABMH 4RGUA 3R0AA 1I6HJ 3IRQA 4IOCF 2ME6A 4RLFA 2DQRA 4XORA 2F4MB 1OYYA 5CVVA 1TWHK 4MLOA 3W6VA 4CO8A 4CCJA 2BVLA 1LEAA 3HOXC 1ETVA 2X6YA 2HZDA 3FBNB 3BTIA 2MH2A 4GFBA 1QZZA 1JGGA 3QX3A 2HTSA 4F93B 2L9VA 4ESJA 2B63A 1OR7C 5LRSA 1S7EA 2QEXI 5J47A 4A3EC 1UHSA 2RAEA 4RB0A 2L5QA 2X85A 1OFCX 2E1OA 4I01A 1XXCA 3BUEA 2LNBA 4OAZA 3BG6A 3CF5F 4FT8A 1CGPA 3ERMA 4QWQA 4GFQA 5TRDA 3BROA 3A02A 4L0ZB 2DFEA 2HXIA 4LQYA 2M2EA 4DBRA 4Q47A 3GTPJ 1ENHA 3D5RC 3GEZA 3QWLA 1Y6IA 4WWCA 3QPSA 2ZB9A 2FEZA 2V7FA 1HI9A 5LFAA 3W2AA 4ILDA 5A2QZ 4Q5SA 3ZQQA 2BY0A 4DQ2A 1YNNA 4KM9A 3GTOJ 2EFNA 4M74A 5JI6A 1TQMA 2E2HC 4MNUA 5FFXA 3I4MC 3SHFA 3QP5A 4A3LJ 4YELA 2CSOA 2GXAA 3M4OJ 3KETA 3MAJA 4GTLA 3H5RA 1B59A 1O57A 3EDPA 2ISYA 1I3QJ 2LTPA 2N8GA 2X51A 4LIVA 3ZQLA 1O26A 4YFNF 5K5RA 5HL8A 2WADA 2K86A 3GYHX 1JUSA 5FLMC 3TKYA 2L7ZA 3CDIA 3T5XA 1IUFA 3K1NA 3WE3A 3JRBA 3SJMA 1ZAOA 4KC6A 3JTGA 2CFAA 1Y1WJ 1WQHA 5CPRB 4YIRX 5HNHA 3DWLE 1G3SA 5DM6F 2UV1A 1APLC 4IQ4A 5C4XJ 2O03A 5AIQA 3W2VA 3FHZA 1V5FA 2HI3A 3DEEA 4WILA 3KP3A 1SANA 2B9SA 4HNUA 2XRNA 1IAWA 4GYGA 3H3ZA 2HOAA 1BW6A 4S04A 2HVRA 4B8XA 4G7ZF 3VWBA 2ECCA 1UJ8A 2WV0A 2PG4A 3CMYA 5GADJ 2VQCA 1W36D 2NS7A 2E2IA 3H3UA 2NVQK 4J3NA 2EINH 2WY7Q 1W7PB 2DW4A 3KFWX 3E97A 1EH6A 2AO9A 1D0YA 3T01A 3O6BB 3ISPA 1K83K 1V5EA 4PABA 3IC7A 2HOEA 3G4SI 1B9NA 4OIQF 4BHCA 4XKBA 2AHQA 5E1WA 3Q3SA 5FROA 3NEUA 2BOLA 1XPPA 3GTPC 4A93J 3E3VA 5LLQA 2BGCA 2ELHA 1FBQA 5JLXA 4BQOA 2O5RA 3M8JA 1TC3C 5FJ8J 4CGZA 3LSIA 2EIMH 4XSXA 3ERED 1UMQA 2CO5A 3Q0WA 4X6AC 1WQGA 3G6EI 3V42A 1E3HA 3FXMA 2EILH 1OJLA 1G3TA 2LBFA 5H6RA 2CQQA 2CV1A 1WI3A 1R9TA 2MD0A 2Y69H 2FNAA 4M73A 1XXAA 4CDGA 3BP8C 1KYWA 2JA7A 1BOBA 2P5LC 3S93A 1W5SA 1B4AA 2FA5A 1NTCA 3ZP5A 2VKDA 1QVTA 5JR3A 1PYVA 4LLGF 5E3MA 3IPJA 2KLOA 2LBFB 3OYNA 2W4SA 1R36A 2XHKA 5CKTA 2X4HA 3KLNA 4LJZF 3WTYC 4CYDA 5FKMA 3M3YJ 4CZCA 4NOIA 3MEXA 4LD5A 1HW2A 2WWYA 1VGXA 2GAGC 1XDSA 4RMNA 1HF0A 4A2UA 2D5VA 4XICA 2VN2A 4A69C 2PJRB 3IUOA 2XROA 4ZDOA 1VTNC 5E20A 3JW4A 5FKNA 5BS6A 3A01B 3HOYJ 3HOUC 1WPKA 4XLNA 4NQWB 3S16J 3S0XA 1ZLKA 4M1XA 1MGTA 1FYMA 2QKMB 1X4PA 4IL6C 5FKOA 3AD8C 4ASNA 3NWTA 2W24A 1FTZA 2R0QC 2BXYA 1FT9A 2JA2A 1U6GA 4IKFA 4BQQA 1IRGA 1A04A 4NC7A 1H88C 2GXGA 2WB1D 1D0ZA 1I6XA 2E2JK 2KMUA 3K1PA 2MYSA 2IEKA 3CUOA 4A3JJ 3OL4A 1DPUA 1K7AA 3TP3A 5KAIC 4X6AK 1TWHC 2RQPA 4C3JJ 4JX5A 1MMAA 5IOZA 4L18B 1FOYA 1TWCC 2KWAA 2E2HA 1WH7A 4HF2A 3S2DJ 3C1DA 2G7UA 3MZYA 2B63J 3GTOA 4OIOA 3OYCA 3AG2H 2Z99A 3WG9A 2L2OA 1SMTA 3BOQA 2R7SA 2OCEA 4G6TB 3WG7H 1F1ZA 4EJWA 4KITB 4U0YA 2NRAC 4KMUX 1Z21A 2HKOA 4IJAA 3AQOA 2H8WA 5LHHA 3H9JA 3OEPA 1UCRA 1WH5A 2XPUA 2M0CA 3LSRA 1QBJA 1WWXA 1O2FB 1DCPA 5C4XC 2VODA 1TT0A 4GRIA 2FUG2 4BL0B 2H27A 2V9KA 1TWGK 3H0GJ 2P0WA 3MKLA 2PA8D 2B63K 4GTCA 3NWSA 4HNTA 2VBYA 3ASNH 1OR7A 2M4GA 4KT5C 4IPAA 1EJ9A 3I4MK 4BXXJ 5DD4A 3H3VD 4YEJA 4P55A 1TQIA 2HU9A 3ABUA 1PP7U 2ICWG 4OIPA 3GTMA 3FWEA 1YX2A 3SQNA 4WJ3M 2M45A 1WCMK 1IW7F 2DYRH 5L3FA 2Z33A 1K78B 4A0ZA 3O8GA 3PNYA 1YHQI 2ID3A 2VQGA 2MLKA 3RTRA 3ZOBA 4M6VA 1WI9A 2K9MA 2KIQA 3NRVA 4XLNF 5FD5A 1S72I 5IT9Z 1LB2A 1Z3XA 2Y0SL 1LEBA 1EV7A 2X48A 3VPRA 3M8EA 4HYEA 4YFNA 1G59A 2R7DA 3QPHA 4A3IJ 3R61A 1PVEA 2O5JA 1X3ZB 3G1OA 4A6EA 4B4CA 4LGWA 1Z67A 4NDLA 4Z2YA 3GTJC 3BR0A 2K9NA 3FKIJ 1D5VA 4B3AA 4ZH4F 1ETXA 3OV8A 1F36A 2YX4A 2Y0SN 1VQLI 2XGCA 4I0AA 3NUHA 5ERIA 4BUPA 4LJZA 1JHHA 1FC3A 1ZLJA 2HWVA 2R93A 2K5CA 1T8IA 2NAZA 5LD2C 3KEYA 3U1KA 2XF5A 2NVTK 1Y1VA 1PJ7A 3CCSI 3GTGJ 3JSOA 3MZ8A 3J81K 3A8KA 3PM1A 1RZ4A 3H3VL 3HOXK 4K2EA 3A2KA 2KZVA 2WY8Q 1S7AA 2BY1A 1UV7A 4QJVA 2M7BA 1JKPC 2IGOA 2NVXJ 4KMDA 2WB1N 1EKEA 3S1RK 1VI0A 2DT7B 3F22A 3AG4H 4XKWA 4I2OA 3GFLA 4NB5A 3KYLA 1SD5A 1BJZA 5EJCA 1KU7A 5A2QK 3CUQA 3HPGA 5HNFA 1H8AC 2AXTC 1FIPA 4AU7A 3CESA 1PJRA 5DV5A 3VYUB 1R1VA 2DOEA 4JOMA 3OSGA 4GCVA 1LQ1A 5EF6A 1RRJA 3SEZA 4IRGA 1OKRA 3E6DA 1ONVA 4IRHA 4N9HA 3U9GA 3DBRB 1R58A 2V26A 3EUAA 1BBYA 1UZCA 3OYFA 3FKIA 4BHPA 5DS9A 3DV8A 1TP4A 3FHNA 6PAXA 4QJVB 1X3UA 4JP0A 4AYBA 5TISC 3PO3C 3AL0C 1JI8A 2K3FA 4LLLA 3BR3A
chains in the Genus database with same CATH topology
4N9IA 3R6SA 1L3LA 1SMYF 4L5JA 3AAFA 3LAJA 4ENNA 1S29A 3REOA 4C3JC 1O3SA 2DU9A 3N97A 2R92A 1K79A 1QO0D 2PMUA 2ESNA 4HZFA 2XAFA 2JA5A 3DF8A 1T39A 3KP4A 1BI2A 4HDUA 4GO1A 4KATA 3FXUA 3GXOA 1EH7A 1Z7UA 1Z9CA 1KQ8A 3M1EA 3ECHA 1E2XA 2VONA 1KYZA 3AQPA 1XCVA 3E5UA 3F21A 1RIOH 3IRRA 2F2EA 3ZMVA 3WTWC 5IOSA 2HYGD 2GIVA 1ZXOA 4M72A 4P9FA 3BY6A 5J8CA 1P92A 2VT2A 2A3SA 1DD5A 2HEOA 3ZQ7A 4ZYHA 3KZZA 4OIRF 3Q9VA 2P6SA 4XBFA 5EGHA 1TW2A 1SD4A 2JSCA 3IWZA 5D6FA 2ZFZA 4G0WA 2ZXJA 2M30A 4U7BA 4KN4X 1U2WA 3L4KA 3B02A 3HTUA 4ZYGA 1KQ0A 3I0TA 2XGXA 1IUYA 2H09A 4G7OF 2EV6A 4GYIA 2K4JA 2M87A 2QQBA 3K69A 1YYVA 2FMLA 3WU0A 3DEUA 4WK8F 2E1NA 4A5MA 5ED4A 1USSA 4EM1A 1H9TA 4LR2A 4BAYA 2HGCA 1HKSA 2R7ZA 2HYFA 2O6GE 3GWZA 3GX4X 1R23A 3TDZC 5L3EA 3V8LA 4EVIA 1T98A 4CXFA 3V8KA 2GA2A 5DCMA 5HLIA 3BJAA 5D4SA 4KMAA 2EFOA 4RGSA 4KDPA 1ON2A 2QVOA 2V9VA 4LG0B 2V1UA 1U8RA 4U0WA 3W6JB 3ZN0A 3HRSA 4GT9A 4M71A 2L3DA 3L9FA 4D0PA 1OMIA 4U88A 3TO9A 4JBAA 5K1YA 1ZRFA 1K78A 3I59B 3RDIA 5ICFA 1FY7A 2FBKA 4ENMA 1D8KA 2FMYA 3F8MA 2VBZA 1SFEA 3DP7A 2HQRA 3F6VA 2EA4A 2QQAA 1RI7A 4JQFA 2YSRA 1I50A 5HDKA 2V1DA 1J7KA 1Z1DA 2CYYA 5H6QA 4KDDA 1HQCA 1KU3A 2ZMEB 2VC1A 2NVXA 3GFIA 3FMSA 3IL2A 3HSRA 3IKVA 3TOBA 1ON1A 4AD9A 3WU1B 3E5XA 5ICCA 2H6CA 4A0XA 1T6SA 3I58A 5CLSA 4OIOF 4ETSA 3COAC 3RKWA 4IRIA 1KQ4A 2ZKZA 1HSTA 3RYPA 3F3XA 2RGVA 3DQVC 1ZG1A 1RNLA 2RNJA 4IVNA 1SFOA 5BPIA 4HA8A 5J6XA 2E7WA 1P4AA 2K02A 1W5TA 3RYRA 1B9MA 5FD6A 4KFCA 3RJPA 2XAJA 1O3TA 4I0BA 4EM2A 4A0YA 5DUKA 1XB4A 1YS7A 1TTYA 1USTA 2GXBA 1GXQA 1PDNC 2RC4A 3V7SA 5CVUA 2UXXA 1ISEA 2DT5A 2X0LA 2VE9A 4M6YA 3ZPLA 1ZN2A 4HDVA 3G4CA 3OREA 2VXZA 2NYXA 5AIPA 2XCQA 2PEXA 1O2BA 4UNOA 3ZMZA 1O7LA 3R4KA 2PQ8A 3WGIA 4A5NA 5JFEA 5LEJA 3LA2A 4FZBA 5HDNA 4HF1A 4MTDA 3EUHA 4ENJA 3CUQB 5EGEA 4ESBA 3WGHA 3G4AA 2VBXA 3KP5A 1O28A 4C3IC 1YIOA 3LA3A 4HQEA 1O24A 4RB1A 1PUEE 1SFXA 3TO7A 2M1BA 2EK5A 1FOKA 5DCMB 4KAWX 1O25A 2H6BA 3T1BA 3ABTA 1B4BA 2STTA 5DUIA 3DPLC 3KEQA 4WX9A 3NQOA 2GA1A 2A5YB 2HKXA 3FMQA 4BXUA 4G6QA 1O3RA 2ADUA 1LJ9A 1Y0UA 5LEKA 4R1HA 1FYLA 1IN5A 1U3EM 5CVIA 2QUFA 2AXLA 3ZN1A 3P9CA 2EFWA 2K7LA 5CHPA 1IXCA 1DP7P 1U5TB 3LPXA 2FSWA 1ZG3A 2R7FA 1LDKB 2DK8A 1OPCA 4CHUA 4M9XA 1KGSA 3V7CA 3DFGA 4EV0A 1O29A 3RI4A 2H94A 1J0RA 1P4XA 3ZMUA 4OIPF 1FBSA 4EM0B 1AOYA 3HYIA 4UXNA 3U2RA 5LHGA 3CQZA 3T8TA 2D1HA 2L54A 4U7DA 3GUDA 1C0WA 1D8JA 4Q4ZF 1Z6TA 4AWXB 3WGGA 4IHSA 1IXSB 1U5TA 4MHGA 1JE8A 2W25A 1KQ9A 3CAGA 4QLCU 3QPTA 4LFUA 3I4PA 2L4MA 3MQ0A 1KA8A 4Q5SF 5BOXA 2JPBA 1YS6A 2W84A 5IOQA 3RPUA 2EFPA 2NNNA 2Z3YA 3P9KA 1ZYRF 1V3FA 3GTQA 1YO5C 5KK1A 1FYKA 3HRTA 4AIKA 2LF7A 1P4WA 4BLAA 4P96A 5LHIA 2OZ6A 4L9JA 2A69F 2F5FA 1RUOA 2JTVA 3TO6A 1EH8A 4EGYA 2A61A 1R5HA 5E8GA 2QBYA 2ZCWA 4KMFA 2VOOA 2CFXA 2A07F 1ZARA 4BLBA 3PQKA 1W7PD 3EQLF 2KJBA 4RGRA 3ZMDA 5ILVA 3F8FA 5L3DA 1FPQA 2L4AA 1FNNA 3MCZA 4EJUA 4LB5A 2ZBKA 3WTSC 3C7JA 4WF2A 2XCOA 2IT0A 3E6BA 4HQMA 3I53A 2GZWA 4DDQA 1BI1A 2DBBA 4HLYA 4KYWA 1LDJA 3J7AO 3WTXC 2HZTA 2L02A 3K0LA 1MKMA 1JXSA 1TWCA 1YW7A 4YG2F 4Y13A 3JAMK 1XCBA 3DKWA 4P5AA 3C18A 4UV8A 1BOAA 2J5PA 4FX0A 3GZ5A 4EJOA 3L00A 1HW1A 3GFMA 4JK1X 5AONA 3H0GA 3F72A 5TJJA 1ZGJA 5HS8A 3Q9SA 1BI0A 3IHUA 1GHCA 3N0CA 3W6KB 1K6OA 4Y15A 1DUXC 2KRFA 2V1XA 1FWZA 3MWMA 3FMRA 5ICEA 3S2WA 5HOOA 5D8KB 2K4BA 2K27A 1QZYA 2UZKA 2Z5UA 1E17A 2Q8KA 4C2MC 1TW3A 4EMSA 2JZYA 3CO6C 1IS1A 1I1GA 1P6RA 1J59A 1R00A 4L9VA 5DD8A 3M9AA 2E7XA 4F7ZA 2QENA 4ESFA 1Y1WA 1DPRA 2IPQX 4U0VA 4OINF 1S7OA 4HW0A 1FP2A 2BE5F 2ISZA 3K2ZA 5FGMA 3EYIA 1WIHA 1J9IA 1QGPA 3F8NA 4UHTA 1TWGA 2GSOA 3GLXA 4YFXF 3VOEA 2JPCA 4OMZA 1TNSA 1V4RA 4HX7A 1R1UA 5L3BA 2ZMEA 2ACJA 2HQNA 2P6TA 5DEQA 5IOTA 5F64A 1LVAA 1S8NA 4UUVA 2QLZA 2KIUA 3RKYA 1Z05A 3M7GA 1WKMA 1XGMA 1YW9A 4FX4A 3VB2A 2JRTA 5HDGA 2C6YA 2XKOA 4B09A 2QQ9A 2EWNA 2DI3A 2OBPA 3I59A 4EJVA 5F6FA 3RKXA 3M8FA 1DDNA 2G7HA 4EGZA 1IN7A 1BIAA 1BJAA 1WQ2A 2ZNYA 3F23A 2P4WA 4RB3C 2J5OA 1F5TA 2FNPA 2A6EF 2XAGA 3Q5FA 2COMA 2EFQA 2OQRA 3DXJF 4I7HA 3HRMA 2FBIA 3TDUC 4Y17A 4KIBA 3ROUA 4KB2A 1G6NA 2PMHA 4EQQA 4WXHA 3EYYA 2P7CB 4WXCA 2V79A 1TBXA 5D6EA 2L01A 3FM3A 1HBXG 2OD5A 1XXBA 3VEPA 4TV7A 5HS7A 1BGWA 3RIRA 1ODDA 2R3SA 1BJTA 4AIHA 3U1DA 1UFMA 3QP6A 5JVTA 2FRHA 2LSOA 2OQGA 2WC2A 2EB7A 3HUGA 2DPDA 4KIGA 2EV0A 2NS0A 5D5VB 3CO7C 2RV8A 1XGOA 2DPUA 2A6HF 4G8XA 2DQLA 1T38A 5CJ9A 1XSVA 3JAMZ 3GZ6A 3FOFA 2Y75A 2PN6A 4LLNA 3IKTA 4HF0A 3KEOA 4E70A 5FLXZ 1T2KA 2DO7A 4UV9A 2CW0F 4NHJA 3GF2A 3TQNA 4M9SA 2Y0MA 4KICA 1IRFA 3ECOA 3FXRA 1XGSA 2XAHA 3LAPA 2YX7A 1STZA 2P5KA 3KP7A 1XSDA 1TQPA 4P9UA 1QNTA 4GTAA 4KIFA 5FFZA 5D8LB 3GTLA 5FLXK 3VFZA 2JT1A 3KP6A 4ZYEA 5FB2A 3V7RA 2PFBA 2JH3A 2PBIA 4R79A 2MD5A 3HHHA 1U5TC 1G3YA 2MLGA 3TGNA 2CG4A 4BNCA 4HOBA 3HOSA 4UVCA 1LDDA 4MTEA 3E6CC 3G3ZA 1O7FA 2XCRB 5D5XB 5IT9K 3HSFA 2V6CA 2RN7A 2HTJA 1W7PA 3WTUC 4WXDA 2VE8A 1ZREA 1ZG5A 5CVRA 2XVCA 3FF5A 4YIFA 5E17F 3MMLB 4HV6A 1BIBA 5L3CA 2W85A 4I09A 3B73A 4EJTA 1EH1A 1IN4A 4R8HA 4RGXA 3BJ6A 1XN7A 1XMAA 2YPRA 3R60A 3R0JA 1AB4A 3L09A 5JVOA 5CVJA 3DPTA 2STWA 1SFUA 2DLLA 4MQVA 4BHBA 2XASA 4RAZA 4HLXA 1R22A 3N0BA 4YFKF 2P7VB 2YU9A 4OMYA 2Y48A 4ZYDA 3L4JA 1L0OC 4M9ZA 3OOPA 4O5VA 3SZPA 1J75A 1U78A 1PP8F 1P2FA 1YQAA 2DK5A 2VC0A 3LWFA 3I5UA 3LSTA 5FO5A 1QQIA 4KASA 2FQ3A 4HBLA 2ZFWA 2ZNZA 3MFKA 2O0YA 5L3GA 4IHTA 2UWMA 2M5WA 1NHAA 2OU2A 2IRFG 1MJAA 3V8JA 2VUMA 2P5MA 1QPMA 2MH9A 1JGSA 3SZTA 1AWCA 3D5LA 1HW5A 5LRRA 1IN6A 4GTDA 1OYIA 2P8TA 4RAYA 1BM9A 2QM3A 1FP1D 5F1RA 2ETHA 4XSXF 1S3JA 2D45A 1BN5A 3F8BA 3FXQA 1XD7A 1MDMA 1FSHA 4KUMA 3K9TA 2Y3PA 2GWRA 2RGRA 4NQWA 2RH6A 2ZJ2A 3BPXA 4DNCA 3QAHA 1B1BA 3F6OA 4LG0A 2ZO4A 1ZGAA 2VT3A 1R7JA 4O6JA 1FSEA 3C3WA 2M8EA 2GQQA 2Q0OA 2NNYA 2NVYA 4CZZA 5HVQC 3J81Z 1RUNA 2LDUA 1H9GA 1MD0A 3ZMSA 5HLGA 1XMKA 3HIFA 5ILSA 2QBYB 4L0YB 3BZ6A 1W4MA 2XIGA 3ZMTA 3BPVA 4PZJA 4I98B 3RPQA 1ZBSA 2YU3A 5HS9A 1R1TA 2FU4A 1HXDA 3LFKA 2HFHA 3GTKA 4M6XA 4ENKA 2CQKA 4HX8A 2PJPA 5JHUA 3N4MA 1I27A 2XKPA 3GW2A 3O3KA 2A68F 1J5YA 2HDCA 3KCCA 4HAMA 4XRFA 1JHFA 3L2CA 1XGNA 3HTSB 2F5CA 2Q2EA 4G9YA 5BMZA 3SFZA 1CF7A 1IF1A 5BPDA 3N3YA 3ML6A 2BEOA 4GTBA 2PI0A 1TLHB 4P5OA 3F8CA 4PCQA 1F9NA 4CICA 4HX4A 1FX7A 1ZRCA 3BWGA 4UVAA 2CFAB 1Z91A 2XV4S 4G0UA 3VA7A 1D3YA 5ICGA 4LMYA 5EEGA 1YW8A 5EEHA 1LNWA 1I1SA 2G9WA 4KA4A 1H0MA 3GFJA 2LF8A 4WCGA 3KZYA 3QOPA 4KNYA 4BH9A 3FOEA 1GXPA 1UHWA 1BC7C 5KVRA 1YTYA 2DTRA 1O3QA 1XSXA 2VOPA 3HSEA 2XUBA 3VODA 2HR3A 1Z6RA 5DYMA 4I02A 1OYWA 1F4KA 4H0EA 3BJOA 1GE9A 2FXAA 2YR2A 2EA2A 5TJ3A 4MQ9F 2IW5A 5K5QA 4GTFA 1G4DA 1SD6A 3TOAA 2DFIA 2Z9OA 5J8FA 4GGGA 2KJCA 3BDDA 1FLIA 3WODF 2F5EA 3QRFF 1K83A 1WQFA 2IP2A 2MA3A 5DDGA 1S6LA 5BQTA 3AH5A 3WTVC 1REPC 2B0LA 3WE2A 5HLHA 4BKWA 1WCMA 2D2WA 2IA0A 4AVPA 1TWAA 3BP8A 4XLPF 4GXOA 3I54A 4ON0A 4KB4A 5CYVA 3CLOA 2GAUA 1MJBA 4G6DA 1ZHFA 2FF4A 1TNTA 2ESHA 4KN7X 3GTGA 1R5GA 2FOKA 4OU0A 3IWFA 1YG2A 3GTPA 2GSUA 3KP2A 2TDXA 1IZ1A 3T0YA 2WTEA 1TWHA 2FBHA 3G73A 3EETA 2KIFA 1KU2A 4L9TA 1ULYA 3P7NA 4OOIA 3I71A 1YLFA 1XDUA 3QU6A 2RVCA 1G3WA 2KIMA 4UVBA 1MZBA 3H92A 3GO5A 3FZVA 1KU9A 3CDHA 4A6DA 2P5VA 3E5QA 1TWFA 3K1MA 1I3QA 2QYOA 2O3FA 4G7HF 3LQQA 3QU3A 5D5WB 4L9NA 4LK0F 4G94A 1O27A 3T8RA 4KARA 1B6AA 2LKPA 5IORA 2EV5A 2BBYA 1Q1HA 4PGGA 5E1ZB 4S05A 3I64A 4ZZDA 3OPFA 4GTEA 1HKQA 5JFRA 3V4GA 5LBQA 1T0FA 3J80Z 2CGPA 4G0VA 1CF7B 1WRJA 3SXYA 3KLOA 2F5DA 3FM5A 2RDPA 3KE2A 2HS5A 3HHGA 2QWWA 2O8XA 2GSNA 4BQAA 3GVAA 1O2AA 4FM9A 3FX3A 1HSJA 3L7WA 1I5ZA 2RKHA 4N0BA 1YFHA 3LA7A 4LB6B 2QZ8A 3CTAA 3GTJA 2IVMA 4AIJA 1HKTA 2E1CA 5E18F 4IF4A 5E1XA 4A12A 3MZHA 3ELKA 3HRUA 1ZVUA 2BV6A 4PGHA 4PDKA 1BC8C 3PFIA 4LK1F 4KM8A 3P9IA 1IN8A 2PLYA 4P5BA 2JA6A 3LQRA 4MEYF 1ZH5A 5K5OA 3WTTC 5D5UB 2OZUA 4BYYA 3HOTA 5DCFA 2VBWA 2IA1A 4YIIA 2IJLA 4RS8A 5LGTA 3CUQC 2XAQA 1MJ9A 2O61A 5D4RA 2D1VA 2MC3A 3WTZA 5E8IA 3JSPA 2KKOA 1BI3A 2AS5F 5LGNA 3D0SA 1IXRC 3E6MA 1WSUA 5IT3A 2UXNA 3ULQB 2IA2A 4MGRA 1UHMA 4RB2C 1FBUA 4ZZLA 2DAOA 1MDMB 1FZPB 1GVJA 5LGUA 3CJNA 4XSZF 3JTHA 2BYVE 1J2XA 2OAZA 4O3MA 1UB9A 2PHCB 1SD7A 4Q48A 2W57A 2FE3A 4HV5A 4FHTA 5ILUA 2OA4A 3O2PE 1SAXA 4IXAA 3Q3QA 3PQJA 1EK8A 4C3HC 4L5IA 2MBFA 4MEXF 2CWEA 1ZRDA 2EJRA 3J80K 5H20A 4KMHA 4RGUA 3R0AA 3IRQA 2DQRA 1OYYA 5CVVA 4CO8A 1LEAA 2MH2A 1QZZA 3QX3A 2HTSA 4ESJA 2B63A 5LRSA 4RB0A 4I01A 1XXCA 3BUEA 2LNBA 4FT8A 1CGPA 4QWQA 4GFQA 5TRDA 3BROA 4L0ZB