5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
1PP8F 3QPHA 1IN8A 3HRSA 1EH8A 4MNUA 1S7AA 5DCFA 3JTGA 4FX4A 1DUXC 4K2EA 3SFZA 1ZLJA 4HQEA 3GFJA 3KP7A 4I0BA 1BI2A 3TO7A 2HYFA 1SD7A 1WSUA 2VOPA 4O5VA 2XASA 2A69F 4YIFA 3ISPA 1IN7A 2HQRA 1I6XA 2ZO4A 4I7HA 2R3SA 3GWZA 2IA2A 2JZYA 2YR2A 3EDPA 2AXLA 1ZG3A 4A6EA 4ETSA 1ZHFA 4Q47A 1IRFA 4A2UA 4AWXB 5D8LB 1MD0A 1YO5C 5FLXZ 1LB2A 4HYEA 2DQLA 2LSOA 2FOKA 4ZZLA 1ZVUA 3EYIA 4I01A 3WTZA 3KE2A 2YX4A 1EH6A 5J8FA 4A12A 1MZBA 2O0YA 1B9NA 3K1MA 3QP6A 5BMZA 4ZYHA 4PCQA 5ICGA 2ESNA 2F5EA 4KT5C 2OQRA 1K78A 1XN7A 3PFIA 3HYIA 4GFQA 2EV5A 4KA4A 4ZYGA 1IN6A 4ZZDA 4ENNA 1R1VA 2LF8A 3K2ZA 2QM3A 1GXPA 1FC3A 3KCCA 4ENJA 3ZMVA 3AAFA 1XCBA 5L3EA 2A68F 3L00A 4UV9A 3ZMZA 4HLYA 2ESHA 2QBYB 1OYIA 2OA4A 1F5TA 2KIUA 5CVVA 3F8MA 4I0AA 3V7SA 1C0WA 1WIHA 3LAPA 4LLNA 1CF7B 2JPBA 3JW4A 4KDDA 2OU2A 3WU0A 2K4BA 1T2KA 5E1WA 1XGSA 5ICEA 4OMZA 1YS7A 1G4DA 5DD8A 3KP3A 3GO5A 1QZZA 2H94A 4G6DA 1D5VA 2V9VA 1U3EM 4RS8A 2EV0A 1OYWA 1ODDA 3LQRA 1KU7A 4HDVA 2FA5A 4P9FA 4EM1A 2XCRB 5LHHA 2ETHA 1S7OA 3CAGA 4UV8A 2XCOA 2Z3YA 3PQJA 4M6XA 4CXFA 4R79A 4CYDA 1OR7A 5FLXK 5K5OA 4XRFA 4KC6A 4RGXA 1WQGA 1FSEA 2V1DA 3BPXA 2Q0OA 5DUIA 3FOEA 3ZMSA 4O3MA 3TQNA 1OYYA 1HSJA 2C6YA 2WC2A 3RYRA 3DKWA 3NQOA 3E3VA 1T38A 4R8HA 4ON0A 3KP2A 2HTSA 1DPRA 3ZMUA 1QQIA 1K78B 5CYVA 1OKRA 4LLGF 1MJBA 1XDSA 3ULQB 3HOSA 1TLHB 5HDKA 3WGIA 4GCVA 5E18F 2D1VA 1VTNC 5L3BA 2RKHA 1FYLA 1BJAA 2HS5A 1EH1A 4L9TA 1P4WA 5AIPA 2Y75A 1YS6A 3BUEA 1O7LA 2ZJ2A 2P6SA 2V79A 2Y48A 1BOAA 3REOA 1REPC 2XAJA 4EM0B 1YFHA 3E5UA 2OAZA 1O3QA 2NNNA 3RPQA 3BWGA 2A6HF 5CVRA 2FRHA 1OMIA 2ZNYA 3WTTC 1GVJA 1IW7F 5E8IA 5HS8A 4HF1A 2CYYA 4RGUA 3LA7A 4BQAA 1R36A 1BI0A 4KFCA 4UNOA 5L3FA 3TO6A 5LGNA 5D4RA 4OU0A 3IWZA 1ON1A 1B59A 1KU3A 3I0TA 4RB2C 1WI9A 2F5FA 4NHJA 1FYMA 2PJPA 2HR3A 3RJPA 3WG9A 4MTDA 1S29A 2XUBA 1LEAA 2MC3A 3SHFA 3IKTA 1R00A 4M6YA 3VODA 3HOTA 1V4RA 2PG4A 2H27A 4EVIA 5JHUA 4AD9A 3GEZA 1PUEE 2WTEA 4KIFA 3T0YA 4P55A 1SFEA 1XD7A 2BBYA 1FPQA 2FF4A 2EB7A 4LB6B 1QO0D 1HW1A 2K7LA 4A5MA 1I1GA 5KK1A 3HRMA 2FMYA 1LQ1A 3RI4A 2Y3PA 2YU3A 5E1XA 1FNNA 4WK8F 2KJBA 5A2QZ 5F6FA 3GUDA 4Q5SF 2VE9A 4G9YA 2QVOA 4F7ZA 1JHFA 2L4AA 3NUHA 4WX9A 3FOFA 1IN4A 2QWWA 3BJ6A 1IUYA 5ICCA 3LFKA 3NRVA 3I58A 5D8KB 4LB5A 2IT0A 1KU2A 2P8TA 1IXRC 5EEHA 1P92A 3C3WA 5D5VB 2DLLA 2RDPA 4AIHA 5K5QA 4LLLA 2DPDA 2DW4A 5KVRA 3VOEA 1SMYF 2QYOA 1FP1D 1J2XA 1CGPA 2RGVA 1BIAA 4N9IA 5LHIA 3ABUA 4OOIA 1SMTA 3BJAA 1O3TA 4CICA 1HXDA 3LAJA 3LA3A 3MEXA 2OZUA 3F8NA 3OPFA 1R1TA 1WQFA 5LEJA 1ISEA 2KJCA 2GZWA 1P4XA 1HW2A 3TOAA 1BI1A 3T8TA 1W4MA 2LF7A 1YW7A 4ZYEA 3RKXA 2DU9A 2XCQA 1LEBA 3SZTA 2ZBKA 5DYMA 2IA1A 5A2QK 4Z2YA 3F3XA 5J8CA 3FZVA 3WE3A 2QQBA 4ZYDA 1YYVA 5LRRA 3HTSB 4P96A 4KMUX 5DCMB 1ZRDA 2EFNA 3CO7C 1KYZA 3VFZA 4IF4A 3I5UA 3E6BA 1ON2A 3DQVC 4GYGA 4KNYA 4UUVA 4MHGA 2GA2A 5D5UB 1G3WA 2LNBA 3TGNA 2PLYA 2CSOA 1WQHA 2ZFWA 2STWA 2BGCA 2NYXA 2ELHA 5FD6A 2OBPA 2QQAA 3GFIA 5JR3A 1UHWA 3J81Z 2QBYA 3RKYA 2IA0A 5HLHA 3IKVA 2FMLA 1FZPB 1R58A 1FT9A 1CF7A 2AS5F 2DK8A 1WWXA 2CFXA 1YTYA 3RDIA 2IJLA 2EFQA 4ENMA 3MFKA 3HIFA 4XBFA 1PDNC 3H92A 5CVIA 3GVAA 2ZCWA 2HYGD 1BBYA 2VOOA 1HW5A 3VB2A 4I09A 5LGTA 5H6RA 3KLOA 3ECHA 4XSZF 4BXUA 4U0VA 3V8KA 1SFUA 3IC7A 3HSRA 2PBIA 4KMFA 2JPCA 4IJAA 1DP7P 2F2EA 2ADUA 5K5RA 2K4JA 2HFHA 3M8FA 4QLCU 3GX4X 1LVAA 4J3NA 2OD5A 4ZH4F 1U5TC 2FQ3A 4OIPF 3L4JA 1KU9A 4BHPA 3MMLB 4HLXA 1K6OA 2H6CA 1QBJA 5D5WB 4GXOA 2DK5A 4QWQA 5E8GA 2UZKA 1JXSA 2P5VA 3CJNA 4FM9A 3P7NA 2YPRA 4BYYA 1J5YA 2VXZA 3CUQC 4KAWX 3VA7A 1QGPA 3EYYA 1Z91A 3ZQ7A 2HEOA 3J81K 2VBWA 1STZA 2Q8KA 1FX7A 3E6DA 1RZ4A 1B4AA 1SAXA 2QUFA 3HSEA 1FWZA 2VT3A 3DV8A 4IRIA 1RNLA 1U5TA 2IPQX 4CGZA 1RUNA 4MTEA 1KQ8A 5HLGA 5BOXA 3WTYC 1XXAA 1XSVA 4AVPA 3LPXA 2HQNA 3QOPA 1RIOH 2DO7A 3E6CC 4KDPA 4G7OF 4G94A 5HDNA 1GHCA 3E97A 4KYWA 2IVMA 2D2WA 1F9NA 3F6VA 1ONVA 4IHSA 3MAJA 2OZ6A 3CUQA 1RI7A 4EM2A 3IL2A 4CDGA 4EJVA 5BQTA 3MZYA 3JSOA 2TDXA 5JVOA 3OREA 2CO5A 1V3FA 3CUOA 1AWCA 4HX4A 3IRQA 5HLIA 2DPUA 3U1DA 1U8RA 1L3LA 1FBQA 3L9FA 3I53A 1L0OC 5CVJA 3P9IA 1I27A 2BE5F 1O3RA 1ZGJA 1GE9A 2FBIA 3O2PE 3RPUA 3WTXC 3RYPA 5E17F 2L4MA 3LQQA 2H6BA 5L3DA 4OIOF 2O61A 4LMYA 4MEXF 3EUHA 2GQQA 2ZKZA 3LSTA 1XMAA 3M7GA 3ZMDA 2FBKA 1IS1A 3G3ZA 1KA8A 5LRSA 4OINF 4EGZA 4L5JA 3KZYA 2KIFA 3FMRA 3TO9A 2XRNA 1HQCA 1LNWA 2VBYA 1UHMA 4WWCA 3M9AA 3FM5A 3P9CA 2K86A 2HKOA 4KB4A 1XGOA 5LGUA 1FY7A 2YSRA 3FWEA 1FBSA 1U78A 3R0JA 4N9HA 4DQ2A 2BV6A 1YW9A 1U5TB 3QRFF 1KQ0A 2JTVA 4RB0A 4OIQF 2GXBA 2P7VB 2UXXA 5JI6A 2D1HA 4KN4X 2HWVA 3BOQA 3IHUA 3O3KA 3SZPA 3FMQA 3CUQB 3C7JA 1ZAOA 3D5LA 1EV7A 2KWAA 2M45A 4XLNF 4MGRA 3MZHA 3TDZC 1R7JA 1XB4A 2ZXJA 1TQMA 3I54A 4OIRF 3I64A 3U2RA 2DFIA 4MEYF 3OEPA 3K0LA 4HV6A 3TKYA 4CO8A 5TRDA 2P5MA 2B0LA 3FX3A 2W84A 1IXCA 3F6OA 2DQRA 1KGSA 4A0XA 2F5DA 2W85A 1S8NA 4ESFA 4PGGA 4O6JA 2MH2A 4UXNA 1BM9A 4CHUA 2NNYA 1IAWA 1ZREA 2XGXA 4R1HA 3ELKA 1R1UA 4ASNA 2DTRA 1BJTA 1B6AA 4XLPF 2FU4A 2NRAC 1E2XA 2HKXA 2JRTA 3R0AA 2FNAA 5IT3A 2JT1A 3CDHA 3FMSA 3V7RA 2G7UA 3E6MA 5DCMA 4HW0A 1IRGA 2XV4S 2ZNZA 3ZN1A 1ZG5A 5HOOA 1JE8A 1AOYA 2A61A 5HVQC 3ECOA 5FD5A 5HDGA 2MA3A 3ML6A 2BYVE 1S6LA 1PP7U 2W24A 4GGGA 2XAHA 2VODA 1HKSA 1IF1A 1U6GA 2VT2A 2RV8A 5LLQA 4HX7A 1K7AA 3BROA 2DI3A 2GWRA 4U7DA 2VC1A 3R61A 3C18A 1XMKA 1MDMA 4ENKA 4RB1A 3V8LA 3R60A 4YIIA 3GF2A 4HBLA 4UVCA 5E20A 5DUKA 2MD5A 1OPCA 1XSXA 1YG2A 1Z1DA 3CLOA 1D3YA 1TQPA 2STTA 4IVNA 1A04A 4RGSA 5CJ9A 1XGNA 3HUGA 1W5TA 4IPAA 3U9GA 2OQGA 4EJTA 2IP2A 3C1DA 1XSDA 5ERIA 5IT9K 2D45A 2EA2A 4LG0B 3ROUA 2FBHA 2EV6A 1JHHA 4FT8A 3M1EA 1H9TA 4HZFA 2O8XA 2MBFA 2FEZA 2PN6A 3GFMA 4B09A 2DBBA 4YFKF 1SD6A 2A6EF 4N0BA 3Q9VA 2CWEA 1BN5A 3F21A 1ZRFA 3COAC 2MLKA 1B9MA 4LK1F 2Q2EA 3GFLA 5ED4A 5LEKA 2L3DA 2EJRA 2EFPA 2VN2A 1G3TA 4GYIA 4PZJA 4XSXF 4DDQA 3FHZA 3VEPA 4U7BA 4BAYA 3W6JB 3CTAA 3L7WA 1TTYA 3T5XA 4UVBA 2PQ8A 1Z7UA 3B73A 1R23A 2CGPA 3BJOA 2GAUA 4H0EA 3F8CA 2ZMEA 4MQ9F 1F1ZA 1I1SA 2P4WA 3KZZA 3BY6A 3SQNA 6PAXA 1RUOA 1D8KA 4HV5A 1DD5A 2M8EA 2WWYA 1MDMB 4FHTA 5FO5A 1B4BA 1XCVA 1R5GA 3WTSC 1QPMA 1QNTA 5FFXA 1R5HA 4M9XA 3SXYA 3QP5A 4L9VA 4Y17A 4HAMA 4AIJA 5FB2A 3G73A 1IZ1A 5EEGA 5DD4A 1ULYA 5K1YA 3F8BA 5JVTA 2H09A 3DF8A 5D5XB 3JSPA 2M1BA 5ILVA 1LDJA 1UCRA 3Q5FA 3HRUA 3HTUA 4KB2A 2J5PA 3F8FA 5TJJA 3CO6C 2WV0A 1EH7A 4FX0A 3KEQA 4YG2F 2K27A 4M71A 3ZN0A 2HOEA 5LHGA 4L9JA 1ZARA 1USSA 4G8XA 4BHBA 1Z6TA 5D6FA 1Z9CA 2M5WA 2O3FA 2XAQA 3OOPA 3ABTA 2QENA 3WTVC 2FXAA 3I59A 4P5OA 1J9IA 1J7KA 2QQ9A 3DP7A 1J0RA 3DPTA 2FSWA 1W5SA 3JAMK 3NEUA 5CLSA 1X3UA 3H3UA 2X4HA 3K1NA 1TBXA 4CZZA 3TOBA 3QAHA 2O03A 2ZMEB 3OV8A 1P2FA 3KP4A 5F64A 3PQKA 5ILUA 1E17A 4A6DA 1T0FA 2Y0MA 4D0PA 2E7XA 4RB3C 5ICFA 2MH9A 3IRRA 5BPIA 3WTUC 3GYHX 3GZ5A 5L3GA 3KP6A 3KEOA 5H20A 4U0WA 1ZN2A 4Q4ZF 1YIOA 2EFOA 4RAZA 4ESJA 4WCGA 3DXJF 3V7CA 1MKMA 1I5ZA 1XXBA 4HOBA 4L9NA 5BS6A 3HSFA 5D6EA 1HBXG 5JFRA 3FF5A 4M74A 4M73A 3Q9SA 2FNPA 3FXRA 2Z5UA 2ZFZA 3F72A 2KKOA 2UWMA 1ZG1A 4ESBA 1AB4A 1ZRCA 4P9UA 3ZP5A 2XVCA 2W57A 2O6GE 4Y15A 3QU3A 1LDKB 4HF2A 4KUMA 5AIQA 2IRFG 1FP2A 3LA2A 4YFXF 2P5LC 4Y13A 4WXCA 4G7ZF 4KIBA 1J59A 1J75A 2GXGA 1JGSA 3I59B 3L4KA 4MQVA 1MJAA 1Z6RA 4EJOA 2V1XA 4JQFA 1Y0UA 2E7WA 4UHTA 2LKPA 3WU1B 2KIMA 2NAZA 1BC7C 3W6KB 2PHCB 3L2CA 3MWMA 3WE2A 1G6NA 2Z33A 3V8JA 4HDUA 2RC4A 5L3CA 1MJ9A 3BZ6A 2HDCA 2X0LA 3RTRA 1IN5A 1ZGAA 4NQWA 3WODF 3J80Z 2XAGA 5HS7A 2A07F 1DDNA 2A5YB 1WQ2A 4M72A 4IHTA 3KP5A 4TV7A 1XXCA 3HHGA 3FXQA 1HSTA 1YQAA 1KQ9A 3BDDA 4I02A 1WKMA 3DEUA 2EK5A 3LWFA 4EGYA 4LK0F 2LDUA 3H3ZA 3DPLC 1FYKA 4BNCA 2PMUA 2G9WA 1H9GA 1S3JA 5E1ZB 1T98A 2P5KA 3K69A 3HRTA 4JBAA 1TNSA 5HS9A 2M87A 3K9TA 2KRFA 1O57A 4HA8A 5DEQA 1WRJA 2GA1A 5AONA 1UB9A 4EQQA 2W25A 4DNCA 3GLXA 3E5QA 2UXNA 3GW2A 5DV5A 4LG0A 5IT9Z 2IW5A 4U88A 1O3SA 2CG4A 2NS0A 2G7HA 2J5OA 2P6TA 3GXOA 1SD5A 4G0WA 4S05A 3F23A 2MLGA 3BPVA 4G0UA 2BEOA 2Z9OA 1W7PD 2QLZA 1D8JA 3EQLF 3QU6A 3M8EA 3ZPLA 4RGRA 3L09A 2RVCA 3GZ6A 4KICA 2GIVA 1FLIA 3MCZA 3I71A 2L02A 4BHCA 4JK1X 1P4AA 1KYWA 2F5CA 1Q1HA 3BP8A 1ZYRF 1R22A 1HKQA 2VE8A 3KETA 2ISYA 2QZ8A 1K79A 2EA4A 3B02A 2PEXA 5D4SA 1P6RA 4WF2A 1EK8A 4IRHA 3D0SA 2ISZA 3ERED 3J80K 3P9KA 4PDKA 3E5XA 5J6XA 1UFMA 1BGWA 4LFUA 4M9SA 1G3YA 2XROA 3N97A 3IWFA 2PMHA 4RAYA 3RIRA 4E70A 3R4KA 1HKTA 2CQKA 1W7PA 4A0ZA 4YFNF 1FOKA 2HZTA 2HTJA 3I4PA 3KLNA 2CW0F 3T8RA 2R7FA 5H6QA 2VC0A 3R6SA 1SFXA 1IXSB 1FBUA 1DPUA 1NHAA 4UVAA 3N4MA 2COMA 3HHHA 3ZMTA 1XDUA 5F1RA 2PFBA 2R7DA 4NB5A 1QZYA 4B8XA 4HX8A 1BIBA 3WGHA 1SD4A 4A5NA 3K1PA 5LBQA 1T6SA 3V4GA 2XHKA 4OMYA 2XIGA 1TNTA 2DAOA 4WXDA 5FFZA 2VONA 2DT5A 2RQPA 2L01A 2XAFA 1BI3A 3WGGA 2VBZA 2HGCA 4LD5A 1T39A 2L54A 3MQ0A 4WXHA 3J7AO 3JTHA 2Z99A 4L0YB 2EFWA 4I2OA 4G0VA 4S04A 1Z05A 2V1UA 3T1BA 4G7HF 2YX7A 1FSHA 2JSCA 3S2WA 1LJ9A 4A0YA 4GO1A 4EMSA 3WTWC 4L5IA 4PGHA 3TDUC 3DFGA 1U2WA 3FXUA 4KIGA 5DDGA 3F22A 3EETA 3FM3A 1H0MA 4LGWA 2K02A 1GXQA 5ILSA 4AIKA 2V6CA 3JAMZ 2A3SA 2PI0A 1TW2A 4EV0A 1F4KA 2VBXA 3QX3A 2E1CA 1TW3A 1W7PB 5FGMA 1O7FA 4L18B 2XKPA 4LJZF 2ACJA 1YLFA 1ZLKA 4M9ZA 1LDDA 1B1BA 2P7CB 2RN7A 5CVUA 4IXAA 1XGMA 4KN7X 4IRGA 4Q48A 2XKOA 3O6BB 1USTA 3RKWA 4HF0A 4HQMA 1G3SA 3KFWX 2M30A 5BPDA 4EJUA 2RNJA 2E1NA 1MGTA 4L0ZB 3QPTA 1TQIA 4U0YA 4BH9A 1ZH5A 2RGRA 4G6QA 4I98B 2EWNA 1BC8C 1YW8A 4EJWA 2FE3A
chains in the Genus database with same CATH superfamily
5J40A 3FKIK 1R4NB 5EJCA 1PP8F 3QPHA 1VQMI 1IN8A 3HRSA 3QPLA 4DBRA 1EH8A 4MNUA 1DCOA 3SEZA 4G7ZA 1S7AA 1TWGJ 5DCFA 3UNGC 5GAHJ 3CC4I 3V42A 2IGNA 3S1NK 3K4BA 3JTGA 2BVLA 4FX4A 1VFCA 1DUXC 1UZCA 4K2EA 4KISA 3SFZA 3TW6A 1ZLJA 4CSWA 3H1CA 4HQEA 3OYNA 3GFJA 2F48A 1IE0A 3KP7A 3S2DJ 4I0BA 1BI2A 1F43A 2LMDA 3DWLE 5IYCJ 3TO7A 2YU9J 2R7TA 4QSHA 1TWFK 3L2WA 2HYFA 1O26A 2GSNA 1SD7A 1WSUA 2QSGX 2VOPA 4O5VA 2XASA 4FISA 2E1OA 2A69F 1EKEA 4JX5A 4YIFA 3K4LA 2XRLA 4KARA 3ISPA 2HXIA 1IN7A 3TFJA 3MKYB 2HQRA 5EZGA 1Y39A 1I6XA 2UV1A 2ZO4A 2M9HA 4DIQA 4I7HA 2R3SA 3GWZA 1XZPA 2IA2A 3HXAA 2JZYA 2YR2A 3EDPA 3HEFA 2WY7Q 2AXLA 3E1SA 1ZG3A 4A6EA 3G1OA 3M07A 1R9TA 4ETSA 2CS3A 2LYCA 1LKXA 2DMUA 1ZHFA 4Q47A 1IRFA 4A2UA 4AWXB 5D8LB 1MD0A 1YO5C 2DOAA 3ZQGA 1SFOJ 3WODA 2CFOA 1O28A 3BZCA 5FLXZ 2E5NA 3ERMA 1LB2A 1BR1A 3NWTA 4XICA 4HYEA 2DQLA 2LSOA 2FOKA 4IQ4A 4CCJA 1T8IA 3X2QH 4BLAA 1BW5A 1QRYA 4ZZLA 1ZVUA 1HOMA 3EYIA 1TWGK 2QEXI 4I01A 4A3KJ 5JFEA 3WTZA 4XCHA 1MBFA 4BXXC 3KE2A 2NS8A 1EH6A 2YX4A 5J8FA 1AKHA 3S15C 4A12A 1MZBA 2O0YA 1B9NA 3K1MA 3QP6A 5FKKA 5BMZA 2GSOA 4GTEA 1TWAJ 3ZR8X 2JRMA 4ZYHA 4BKWA 4PCQA 4PAAA 5C3EJ 5ICGA 2LC2A 2ESNA 2F5EA 3S2DK 4LK0A 3HOWJ 2JA7A 4KT5C 5IYCK 4XL9A 2OQRA 3LSKA 4P1WA 1WGXA 1K78A 1XN7A 4DGWB 2YU9K 3S1QK 3PFIA 3BT9A 3HYIA 1UELB 4ZJZA 4GFQA 2EV5A 4RAGA 4KA4A 3BG7A 3BCBA 5CQGA 2WY8Q 4ZYGA 2UUZA 4II3A 5J3LA 2H1KA 2R7UA 2HVRA 2RREA 3FKIC 1FTTA 1IN6A 1PJ7A 4LQYA 3A2KA 4ZZDA 4ENNA 1R1VA 2LF8A 3K2ZA 2QM3A 5HNHA 1GXPA 1FC3A 3KCCA 3A0BC 2HQ5A 5KAFC 4ENJA 1ITYA 4MLOA 2GLOA 5K7ZA 3ZMVA 3AAFA 2JQ7A 3ZQFA 4M6VA 1XCBA 4OAZA 5L3EA 2A68F 3L00A 4UV9A 3ZMZA 2E2IJ 5M3FK 3DKXA 1SFOK 4HLYA 3FBNB 2ESHA 3W3CA 2QBYB 4BDZA 1OYIA 4QPOA 3TBIA 3OYJA 4GDFA 2OA4A 5EDNA 2CRGA 1F5TA 2EILH 2KIUA 5KHDA 3HOZJ 5CVVA 4C2MC 3F8MA 4I0AA 1O24A 2DFHA 3V7SA 1C0WA 2EINH 3WHCA 1WIHA 3LAPA 4LLNA 3BQYA 5IORA 3H36A 2E1MC 3D5SC 2E34A 1CF7B 4FZBA 2JPBA 3JW4A 5IOYA 3TEDA 3ZQCA 1VZ0A 4KDDA 2OU2A 3SJMA 4F93B 3QYEA 3WU0A 2K4BA 1X1DA 5LD2C 2JA6J 1TWAK 2LR8A 1BA5A 3EQLA 1XPXA 5C3EK 2Y0SL 1HDDC 2MG4A 3GTOJ 1T2KA 5E1WA 1XGSA 3HG9A 2WAQD 5ICEA 2R92J 4OMZA 1YS7A 1G4DA 1X58A 1VQ7I 5DD8A 3HGGA 3KP3A 3GO5A 1QZZA 2H94A 4G6DA 1D5VA 2V9VA 4G12A 1U3EM 4RS8A 2EV0A 4NDLA 4DJAA 1OYWA 2OUMA 1F36A 2DJNA 2KZGA 2XF6A 1ODDA 3LQRA 1WVRA 2JJ7A 2LTPA 4IHXA 3M3YC 2RAEA 4HDVA 1KU7A 1I50J 2FA5A 4P9FA 2R7VA 4EM1A 3OS2A 1TWGC 4E7LA 2CV1A 4KMAA 2XCRB 5LHHA 2ETHA 1S7OA 3GCMA 3CAGA 5C4JJ 4UV8A 2VJ4A 4X6AJ 2FOWA 2XCOA 5L46A 2E2IK 4PK4A 2WV1A 2Z3YA 1BJZA 3PQJA 5IP7J 4M6XA 2W00A 4CXFA 4R79A 3GTMJ 4Y52K 1LFPA 3PJRA 4FQGA 1B72A 4CYDA 1OR7A 5FLXK 5K5OA 3HOZK 4PSXA 3HL2A 4CCLA 4XRFA 4C3IJ 5B5EC 3S2DC 4KC6A 2V1NA 4RGXA 5IYCC 2YU9C 1Z67A 3S1QC 2HOTA 1WQGA 1IRXA 1FSEA 4B3XA 3QWLA 2XF5A 4CZCA 3CCYA 2M3AA 4F91B 3BTIA 2V1DA 2FUG2 2Q0OA 3BPXA 2DFEA 5DUIA 1DP3A 5F0CA 4YFNA 2JA5A 3DKYA 3FOEA 3CCMI 2EQRA 3ZMSA 4O3MA 2WAQA 3TQNA 4KASA 3GTOK 2CW0A 2R92K 2NXNB 1OYYA 4HSTA 2FJ1A 1HSJA 9ANTA 2DDBA 2C6YA 2CUFA 2WC2A 1I3QC 3RYRA 3DKWA 2D5VA 3NQOA 3E3VA 3ZCOA 1T38A 3H9GA 4R8HA 3KP2A 4ON0A 3JRBA 2HTSA 1DPRA 4BBRC 3ZMUA 1QQIA 1K78B 4A3FJ 5CYVA 1QPIA 1OKRA 4LLGF 4V2FA 1MJBA 2WA0A 4A3GJ 3OR2C 2DT7B 4A3DJ 1W5CC 1XDSA 3L2RA 3ULQB 1I50K 3HOSA 1S7EA 1TLHB 5HDKA 3WGIA 5F1JA 5E3OA 1X4OA 4GCVA 4CCNA 5E18F 2D1VA 4ZTFA 2NS7A 1VTNC 2ID6A 1IRZA 5GP9A 1O2FB 4X6AK 4XR6A 4IL6C 5L3BA 5IP7K 3G4CA 3HKZN 3SDBA 2RKHA 3OWTA 4X1EA 3DLLF 2XAUA 1FYLA 3GTMK 4B44A 1BJAA 2HS5A 1EH1A 4L9TA 3BG3A 1P4WA 5AIPA 1RU0A 5C3EC 2Y75A 3IUOA 3GLLA 4C3IK 1BDFA 1YS6A 3BUEA 1WJFA 1O7LA 2ZJ2A 1RRJA 2P6SA 2V4JC 2IS4A 4I6ZA 2V79A 2Y48A 4BQQA 1BOAA 3MKLA 3REOA 1REPC 3AH5A 2NVQJ 2XAJA 1EJ9A 4BJ6C 1VQ6I 4EM0B 2NOGA 1BS2A 3ADAC 1W36C 3H0GC 4V2GA 1H88C 1YFHA 3E5UA 2OAZA 1I6HJ 3AQPA 1O3QA 2NNNA 3RPQA 3BWGA 2A6HF 2Y9YA 1I3QA 4C3HC 1WJBA 2E2IC 1OCRH 4PFOA 3CP8A 4A3EJ 2R93J 5CVRA 4Y52C 3KYCB 2BHZA 3S1MK 2FRHA 1I39A 3BZKA 1HA8A 4A3FK 2DFFA 1S5LC 4D5CA 3HOZC 2R5YB 1OMIA 2ZNYA 4G7HA 3CCSI 3T02A 3WTTC 1GVJA 1QHHD 1IW7F 2NVXJ 1OCZH 4A3DK 5E8IA 1T08B 1R4MB 5HS8A 4HF1A 3KEYA 1FOYA 1LUJB 2H1LA 2CYYA 1DQUA 3LA7A 4RGUA 5J47A 4BQAA 3FKJA 4I76A 1VQOI 1ORKA 1Y1VJ 2Y0SD 3MZ8A 1SEUA 2FQOA 1OCPA 1R36A 1BI0A 4KFCA 4UNOA 2L7ZA 3PIOF 5L3FA 3TO6A 1EQRA 2Q1ZB 1POGA 1UAAA 1IG7A 5LGNA 2IBDA 2VUMJ 2KLOA 3HXLA 5D4RA 4XLHA 2GOXB 4OU0A 3IWZA 1ON1A 1B59A 1KU3A 4BL0B 3M4OC 5M5XJ 3I0TA 2VXDA 2ZXHA 4RB2C 1PYVA 1D0XA 2NVQK 1WI9A 2JMWA 2F5FA 4NHJA 4AIDA 1G51A 1FYMA 4F55A 2PJPA 2L9SA 2HR3A 2EIKH 3RJPA 3G4AA 3WG9A 2E1MB 4MTDA 2XDVA 1IO2A 1S29A 1WOOA 2XUBA 1LEAA 1I50C 2X1CA 2Y31A 4KITB 4W1UA 2MC3A 3SHFA 3H0GA 4XQFA 4N4NB 1R00A 3IKTA 1IDZA 4YELA 4M6YA 4LJZA 3VODA 3Q3SA 3HOTA 4M1XA 2TRTA 1ZQ3P 1HC8A 1V4RA 5IP7C 1USOA 4A3EK 2PG4A 3GTMC 3K2AA 2H27A 3CESA 4EVIA 5JHUA 1K4TA 4IX7A 4AD9A 5EGHA 3GEZA 4C3IC 1ZTRA 1PUEE 2BY1A 3I55I 2WTEA 4DZJA 4KIFA 1MW7A 1LE8A 4H4KC 3VSKA 1EF4A 4P9SA 2KZVA 2VPRA 5J1UA 3KPHA 3T0YA 4P55A 2Y0SA 1SFEA 1XD7A 2BBYA 4RAFA 1FPQA 2FF4A 2EB7A 2VB6A 2HPIA 4LB6B 1Y1VK 1QO0D 1FMVA 1HW1A 2K7LA 4A5MA 1I1GA 5KK1A 3HRMA 2FMYA 3Q0VA 1LQ1A 2JK3A 3RI4A 1RETA 2Y3PA 2YU3A 5E1XA 1JJ8C 1FNNA 2LREA 4WK8F 2KJBA 5A2QZ 2VUMK 2K3FA 5F6FA 3TP0A 4BLBA 2X48A 4MO7A 3GUDA 4BY1C 4Q5SF 2IXSA 2VE9A 4M3DA 4G9YA 5M5XK 2QVOA 4E7SA 4E7HA 1FJLA 1UMQA 1RESA 4F7ZA 1MBGA 2E35A 5JHFA 4CA0A 1JHFA 3S1MC 3PO3J 2XF7A 4A3FC 2BXZA 2L4AA 3NUHA 4WX9A 1OCOH 2JA8J 3ONQA 3FOFA 1IN4A 1YX2A 2F4OB 2QWWA 3BJ6A 3CC7I 1IUYA 5ICCA 3PUFA 3LFKA 3NRVA 2ZSIB 3I58A 3LSPA 5D8KB 5JVGF 3A02A 2OJED 1MIJA 4F92B 1J6XA 4QPQA 4KMUA 4LB5A 1AU7A 2IT0A 4BBSC 1H8AC 4XM3A 5C4XJ 3GBGA 2BVMA 1KU2A 2P8TA 2Z2SB 4S0HB 1IXRC 2PJRA 2G0EA 5EEHA 1WH7A 2IGKA 2E60A 1P92A 1O2AA 1IV6A 4KM9A 2A69A 3C3WA 5D5VB 2I10A 2DLLA 5J4YA 3VYSB 4GTAA 2DMTA 2RDPA 1W0UA 4AIHA 5K5QA 4LLLA 1TT5B 2QA4I 5H2FC 2DPDA 2DW4A 5KVRA 1VQ5I 3VOEA 1SMYF 3S8PA 5C44J 1QVTA 1FP1D 2QYOA 2R4GA 2JA7J 4IOCF 3OYFA 3GTKC 1TWCJ 2L7KA 3FDYA 4C2TA 3N0CA 3L2QA 1J2XA 4NBQA 5M5WJ 2RGVA 1CGPA 1BIAA 1GV5A 3N0BA 4JX4A 2P0WA 3K4NA 4N9IA 3PO3K 2OCEA 5LHIA 3ABUA 5JLXA 4OOIA 3OYGA 2JA8K 1SMTA 3BJAA 1O3TA 1I3AA 4BY7J 4CICA 3F0CA 3LSHA 1HXDA 3LAJA 3LA3A 1K61A 2PMZD 1F93A 1TWHJ 3MEXA 2OZUA 3F8NA 4NC6A 4XKVA 3SZGA 1Y1VC 1R1TA 3OPFA 3DBRB 3T01A 1WQFA 1SVLA 4OAYA 5FJ8J 5LEJA 1ISEA 4A3JJ 2KJCA 2GZWA 5IP9J 3TFHA 3ZQLA 1P4XA 2KPMA 1HW2A 3TOAA 5C4XK 1BI1A 1IV8A 3T8TA 1W4MA 4A3CJ 2KT0A 2LF7A 3GEHA 1YW7A 2A05A 4ZYEA 2XGEA 3JSTA 1K83A 1ETWA 3RKXA 2DU9A 4AYBN 2XCQA 2D6FC 3GMEA 2YUSA 5IYDJ 1SANA 3J7YJ 1YJNI 1LEBA 4ILDA 1VH2A 4RMFA 3SZTA 4B48A 2ZBKA 2EZLA 1MBHA 5DYMA 3A0HC 3N05A 4BE1A 3QPSA 3CJTB 4D7NA 2DJIA 3AG3H 2IA1A 5A2QK 1WI3A 4Z2YA 5C44K 4XKWA 1G59A 3F3XA 2NVTC 1JI8A 1VQNI 1WCMJ 5J8CA 3FZVA 3WE3A 2QQBA 4HRIA 4ZYDA 3HOXJ 1TWCK 2A68A 1YYVA 1JQWA 3GTKA 5LRRA 3PNVA 5M5WK 3HTSB 4P96A 4KMUX 5DCMB 1ZRDA 4E4HA 2EFNA 3CO7C 4RA2A 1KYZA 3VFZA 4IF4A 3I5UA 5B66C 3E6BA 1ON2A 3DQVC 4D7MA 4GYGA 2HU9A 4CCOA 4KNYA 4BY7K 4UUVA 2KFDA 3OYDA 2PMZA 4MHGA 2GA2A 5D5UB 1TWHK 1GVDA 5F08A 2NVYA 1G3WA 1U0JA 2JVGA 5FJ8K 3CCEI 2LNBA 3TGNA 4A3JK 2PLYA 3TFIA 5IP9K 2HI3A 2CSOA 1WQHA 2L0KA 2ZFWA 2Y69H 4YRVA 1ZGWA 2STWA 2BGCA 1HQMA 3GTPC 1VQKI 2NYXA 4A3CK 2ELHA 2M0CA 5FD6A 2OBPA 2QQAA 1MMGA 3GFIA 5JR3A 1UHWA 3O8GA 3J81Z 2QBYA 2EZIA 3RKYA 2IA0A 5HLHA 3IKVA 2HDDA 5F27A 2FMLA 1D1BA 4XRMA 2PJRB 5IYDK 3SYTA 3LOCA 3OL3A 1FZPB 1R58A 2F6CA 2JA5J 3ZQIA 2JA8C 4DYRA 1BOBA 1FT9A 2HDWA 2LRDA 5GTHC 1CF7A 2AS5F 2DK8A 1WWXA 3PIPF 2CFXA 1YTYA 3RDIA 2IJLA 1ZXOA 5KAIC 1WCMK 2EFQA 4ENMA 1RKWA 4RBOA 3MFKA 3ASOH 3HIFA 4XBFA 1PDNC 3H92A 5CVIA 1VNDA 1X2NA 3GVAA 3HM5A 2ZCWA 5FRMA 2HYGD 2VKVA 3JRAA 3S3MA 3K4CA 1BBYA 2X6YA 3HUGB 5C4XC 4BDYA 4AU7A 2IAIA 3RZOC 2VOOA 1N75A 1HW5A 2M7AA 3NWSA 2GAGC 4YEJA 3VB2A 4I09A 2LG4A 5LGTA 1ETYA 1Y8QB 5H6RA 1Y1WJ 1UHSA 3H5AA 3KLOA 2CFAB 5HL8A 3K7AK 3ECHA 4XSZF 3I4MK 3GTPA 1KZHA 3CCUI 1WFXA 3LMMA 4BXUA 2ME0A 4U0VA 2H8RA 4AYBD 2M7BA 1T0FC 3V8KA 1SFUA 3IC7A 1ZQ1C 3HSRA 1MBJA 3BP3A 1A6QA 2PBIA 4A93K 3FBIB 1YNNA 1UG0A 2MC4A 2VI6A 2JPCA 3KX2A 4IJAA 1DP7P 1ETVA 2F2EA 5GPAA 4KMFA 2ADUA 5GTIC 4MFEA 5K5RA 4LLGA 2K4JA 1OLTA 2HFHA 2HNHA 1XC5A 3M8FA 2VJJA 4QLCU 1LVAA 2CUZA 1V54H 3GX4X 2OD5A 4J3NA 4ZH4F 1U5TC 5B1AH 1MSFC 2FQ3A 4ABZA 4OIPF 3L4JA 3S17J 4AC0A 1KU9A 4BHPA 2Q2EB 4XNFA 5EGOA 2JUGA 3MMLB 4BUPA 2QKMB 1U8BA 4HLXA 1HCRA 1NH3A 4A3JC 2FX0A 1K6OA 2H6CA 3BR3A 4QIWN 1VQPI 3LSJA 1QBJA 2M4GA 5D5WB 4GXOA 1PJ5A 2DK5A 2MSYA 4QWQA 5E8GA 1QA6A 2UZKA 2KHMA 2VKEA 1JXSA 2O5JA 2P5VA 3CJNA 3EUAA 2R7ZJ 1D0YA 1JKOC 4FM9A 3P7NA 4M3BA 2YPRA 1TL8A 4BYYA 1J5YA 1J6WA 3DU5A 4OIQA 5DTDA 2VXZA 3CUQC 1PUFB 2CMPA 4KAWX 1Y1WK 3VA7A 1QZEA 1WJAA 2ZJPF 1QGPA 3EYYA 3GTLJ 1Z91A 3ZQ7A 2A6HA 2HEOA 3S1NC 1Y0NA 3J81K 2VBWA 1STZA 3JCUC 2Q8KA 4ZTJA 1FX7A 3E6DA 2ZSHB 5DS9A 1RZ4A 2K3PA 5EZHA 1B4AA 4XLEA 2QUFA 2CUJA 3HSEA 1SAXA 1IW7A 4A3CC 1FWZA 1N25A 2VT3A 3S32A 3DV8A 3GTGJ 4IRIA 4PJNA 1RNLA 2KMUA 1U5TA 3F9KA 2I5UA 2IPQX 5J1YA 4CGZA 3KYLA 4JX6A 1TWFC 4A3KK 3GTJJ 1RUNA 4MTEA 1KQ8A 5HLGA 5BOXA 4CCMA 3WTYC 1XXAA 1XSVA 2ZUEA 3FK6A 4GTDA 3K7AC 2E19A 4AVPA 3LPXA 2HQNA 3I4MC 3OL4A 3QOPA 1RIOH 2DO7A 3RPUD 3E6CC 5M5YJ 4KDPA 2IS1A 4G7OF 4C2MJ 4G94A 3C2BA 1K4SA 2V6EA 5HDNA 2R7ZK 1GHCA 4C9YA 3HOWK 1NTCA 3E97A 4KYWA 2IVMA 2D2WA 4A93C 1J98A 3DCFA 1F9NA 1OQYA 3EUHC 2R5YA 3F6VA 1ONVA 4IHSA 4IHVA 1WPKA 3M8JA 3MAJA 2OZ6A 1U9OA 3CUQA 5IP6A 2QSHX 2VQHA 1RI7A 3GEIA 4EM2A 3IL2A 1DU0A 4A3LJ 1T56A 4CDGA 4EJVA 5BQTA 3MZYA 4PABA 3FKIA 3B6AA 4C45A 3GTLK 3IH2A 3JSOA 5KCMA 2TDXA 4I99C 5JVOA 3K4KA 2QSFX 3OREA 2CO5A 5TISC 1LVKA 4KN4A 1LPQA 1V3FA 2R7XA 5E3MA 3CUOA 1AWCA 4HX4A 1GDTA 3IRQA 2MFZA 2IS2A 5HLIA 2HOAA 2COBA 3NARA 4B3AA 2DPUA 1WORA 3U1DA 1YCLA 3CQZJ 1U8RA 3GTGK 1L3LA 1FBQA 2XGCA 3CC2I 3L9FA 1OCCH 5K7HA 3I53A 1FIPA 3QYBA 1L0OC 5CVJA 4PJMA 4LOWA 3P9IA 3A1YA 1RR8C 1I27A 1P9QC 2BE5F 4Y7NJ 1TWFA 2XSJC 3GTJK 1U9NA 2E71A 1O3RA 1Y1WC 1A35A 2M34A 3BR5A 1QHGA 1FMWA 1ZGJA 1YJWI 4QIWD 1IL2A 1GE9A 2FBIA 3O2PE 3RPUA 3HGYA 4RLFA 5EGOB 2X85A 2JA6K 3WTXC 3RYPA 3WHBA 4Q5SA 2KIQA 4C2MK 2X51A 3I4NJ 5E17F 2L4MA 2ZUFA 3LQQA 1WZ2A 2H6BA 5L3DA 4OIOF 3B6CA 3S2HJ 3HKZL 4PUSA 2O61A 1EA3A 1FOXA 3RSNA 4LMYA 4MEXF 1XPPA 2ECCA 3EUHA 2GQQA 2ZKZA 3A8JA 4A3IJ 3QQAA 1DCPA 1WJCA 1BL0A 1SFOC 2L9VA 3K4JA 3LSTA 1XMAA 5B3SH 3CJRB 2A6TA 3VYUB 3M7GA 3ZMDA 2FBKA 1IS1A 3G3ZA 1KA8A 4OINF 5LRSA 3BG5A 4EGZA 4L5JA 4II2A 3KZYA 2KIFA 3FMRA 3TO9A 2XRNA 1HQCA 1LNWA 2VBYA 4A3KC 1UHMA 4BACA 1TWGA 4IKFA 4WWCA 2HVSA 3M9AA 5C4JK 1WH5A 1IQ0A 1Z21A 5E79C 3FM5A 2XC7A 3P9CA 2K86A 2HKOA 3ZQQA 1E3PA 2XPUA 1TWAC 4KB4A 1V55H 1XGOA 5LGUA 3CQZK 4B4CA 3FXJA 1FY7A 2YSRA 2LY1A 2E2HJ 2V26A 3H9JA 2R7ZC 4XLFA 3HOWC 3FWEA 2PPBA 1FBSA 2WB1N 3IV5A 1U78A 4JP0A 3CDIA 3R0JA 4N9HA 4E6KG 4Y7NK 2YU9A 2CU7A 4DQ2A 3GSIA 2BV6A 1YW9A 3K10A 1J09A 1DGWY 4GZYA 1U5TB 3QRFF 1KQ0A 3GTQJ 2JTVA 4RB0A 4OIQF 1PVEA 3I3LA 1YITI 2GXBA 4PJLA 2DOEA 5CPRB 2P7VB 3GTLC 1LFBA 1VQ9I 1SMYA 2UXXA 1X19A 5JI6A 3OYHA 2KP6A 4C3JJ 3S2HK 2D1HA 4MFDA 4XONA 3OY9A 2X6WA 2I8DA 4KN4X 1W36D 4LIUA 2HWVA 2LH9A 2X1EA 3BOQA 3Q3QA 4A3IK 3IHUA 1SFOA 4ZC3A 3O3KA 3AL0B 4AH6A 5GADJ 3GTGC 5IOZA 5HODA 2HOSA 4A3GK 2KL4A 3FMQA 3SZPA 5J4VA 3CUQB 1JT6A 1ZAOA 3C7JA 3BP8C 2QQ8A 3UKGA 2HYJA 3D5LA 4BJTA 1MNEA 1EV7A 4LG3A 2KWAA 3CMYA 2B63J 2M45A 4XLNF 4D9JA 4MGRA 3SFIA 2JA6C 3OOUA 3MZHA 3TDZC 1R7JA 1XB4A 2ZXJA 1TQMA 1IC8A 1TWAA 2PMZL 3I54A 4OIRF 3I64A 3U2RA 3VSLA 4BEHB 4BE0A 3S3OA 2E2HK 2DFIA 3GTOC 4MEYF 4EATA 2R92C 3OEPA 3K0LA 4HV6A 3TKYA 3OIQA 4CO8A 4NUBA 4P5AA 2B7EA 1ZBSA 2NVYJ 2RNGA 5TRDA 2P5MA 2B0LA 3BR6A 3FX3A 3GTQK 2DA6A 2W84A 4QJVA 3IP4B 1IXCA 2F4IA 4DBQA 3F6OA 1VQLI 2DQRA 1SVMA 3WU2C 3OYMA 1KGSA 1MMSA 4A0XA 4FTHA 3GDZA 2F5DA 1DU6A 2W85A 1I6HK 2VQCA 1B8IB 2MW8A 1V5VA 1JTYA 1S8NA 2CW7A 4NC7A 3JRGA 5C4JC 4ESFA 2QCOA 4PGGA 4X6AC 4O6JA 2MH2A 5IPAA 2BY2A 4UXNA 1BM9A 4CHUA 2NNYA 3PO2J 2E2IA 4D5FA 1YRNA 2R93K 1IAWA 1ZREA 4AM3A 3CQZC 2EBIA 2XGXA 4R1HA 3ELKA 2ICWG 1ETKA 2NVXK 1R1UA 4ASNA 2DTRA 1BJTA 1B6AA 3OYCA 3BR2A 4XLPF 4PJJA 3Q0WA 4Y7NC 4HPQA 2FU4A 2NRAC 1E2XA 2HKXA 2JRTA 1Z7LA 1R5ID 5GPCA 2B63K 4NOIA 2XSDC 3R0AA 2FNAA 4BKXA 5IT3A 3HKZD 2JT1A 1O4XA 1YX3A 1WOSA 1Y6IA 3OS0A 3CDHA 3BG6A 2B9SA 3FMSA 1XG1A 3V7RA 3HOUJ 2G7UA 2QKLB 3E6MA 3GTOA 5DCMA 1Y8RB 4XLAA 4HW0A 1IRGA 2R92A 2WB1D 5IYBJ 2XV4S 2E2JJ 2ZNZA 3ZN1A 2JSPA 5FROA 1ZG5A 2LK2A 5HOOA 1JE8A 3S14J 1AOYA 4NQWB 2FQ4A 3CMAI 2A61A 5HVQC 1EI6A 5IOSA 1X4PA 3ECOA 5FD5A 5HDGA 2MA3A 3ML6A 2BYVE 3CCQI 1S6LA 2EIMH 4HEA2 4RDUA 1PP7U 2W24A 4GGGA 4A3GC 2XAHA 2JH3A 4A3DC 2VODA 1E0EA 2V6TA 1HKSA 1IF1A 1U6GA 2LLKA 2VT2A 2DMNA 2EPFA 1I50A 1IGNA 3DEEA 2RV8A 2YS9A 1MBEA 2ZB9A 4CH7A 5LLQA 1MMDA 4HX7A 1K7AA 3BROA 1R9TJ 2DI3A 2GWRA 1J6VA 4U7DA 2VC1A 3R61A 2X6OA 2JN6A 3GZNB 3AD8C 3C18A 3MKWB 1CQTA 1Q1VA 1ZK8A 1XMKA 1MDMA 4ENKA 3GTMA 2E2HC 4RB1A 4KMDA 2Z16A 3V8LA 2V9KA 3J7ZI 3ZXSA 2Y30A 3S0XA 3R60A 4YIIA 2NVQC 4IHWA 3GF2A 4HBLA 4UVCA 5E20A 3HKZA 1MNMC 3ZGKA 1GUUA 3GTQC 5DUKA 4GT9A 2MD5A 1OPCA 1XSXA 3WG7H 4XSZA 2GXAA 1YG2A 1Z1DA 5EYRA 3CLOA 1D3YA 5DM6F 2IGOA 1TQPA 1X1PA 4IVNA 2STTA 3HOUK 1A04A 4RGSA 5CJ9A 1I6HC 5IYBK 3SZYA 2DDAA 1XGNA 3MVPA 3LNQA 2E2JK 2M0MA 3HUGA 1W5TA 4IPAA 3U9GA 4IHYA 3LSIA 1O25A 2OQGA 4EJTA 3S14K 2IP2A 3OIOA 4A3EC 3H3VK 3C1DA 1XSDA 2X1DA 5ERIA 2R93C 5IT9K 2R7SA 3OMYA 2D45A 4ZH4A 2EA2A 4LG0B 4AYBL 3ROUA 2FBHA 2EV6A 4UB6C 4OIPA 2NVXC 3BR1A 1ETOA 3L2UA 2JUCA 1JHHA 1RC9A 4FT8A 1JUSA 3TW7A 3M1EA 3T00A 1H9TA 4QJVB 2CFAA 4A3BJ 1T95A 3K4MA 4HZFA 2GAHC 5GAGJ 1R9TK 2O8XA 2CH0A 4M3EA 4A3MJ 1P7IA 2B63C 2ZMEC 2VKHA 4G6TB 3OYEA 3BTCA 2MBFA 2FEZA 2PN6A 3AG1H 3GFMA 2MABA 2ZJRF 2AQEA 2E36A 3HPHA 3QYFA 3G1MA 4B09A 2VUMC 2DBBA 4YFKF 1SD6A 2A6EF 4E7KA 4N0BA 4V19K 3Q9VA 2R0QC 1YRNB 2CWEA 1BN5A 1XMXA 2JVHA 3S16J 3F21A 1ZRFA 2MYSA 3COAC 4J00A 1TT0A 1P7JA 3OYAA 3W2VA 5BNGA 2MLKA 1B9MA 4BXXJ 5TJ3A 4LK1F 3L2VA 2R5ZA 4GFBA 3RQIA 2Q2EA 4ITVA 1ZR2A 3CMMA 1JTXA 2QGUA 3GFLA 3S15J 5ED4A 5LEKA 5E3NA 2L3DA 2EJRA 2EFPA 1WHUA 2VN2A 1G3TA 4IO9F 2RH6A 2EZKA 1AHDP 3ABLH 1TZLA 2M8GX 3H5NA 4XKCA 4GYIA 4PZJA 2JA7K 4XSXF 2CQXA 4DDQA 3FHZA 3AD9C 3VEPA 3A01A 4GTFA 4XMYA 4U7BA 4BAYA 3W6JB 3CTAA 1ETXA 3L7WA 4XK4A 1TTYA 3T5XA 4UVBA 2PQ8A 3KZIC 3H0DA 3LL7A 1Z7UA 3B73A 1R23A 2LFBA 1WOPA 2L7FP 1ERDA 1PUFA 2CGPA 3E0JB 3BJOA 4A3BK 1G2HA 2GAUA 2W7NA 4H0EA 4A3MK 4QTRA 3F8CA 4ZDLA 2ID3A 1Y1VA 2ZMEA 4MQ9F 2V6UA 2EIJH 1F1ZA 2V9PA 2EZHA 1X2MA 1LFUP 3AD7C 1I1SA 1YI2I 2P4WA 4G7OA 3KZZA 3BY6A 2DMPA 3SQNA 6PAXA 3CF5F 3CJQB 1RUOA 1DGRM 1FEXA 2CV2A 1D8KA 4HV5A 1WSRA 4WILA 2VUMA 1DD5A 2M8EA 2WWYA 4W97A 5IYBC 1X1AA 1RR7A 1T33A 1MDMB 3HOYJ 2E2JC 3S16K 4FHTA 3DEWA 5FO5A 5FKNA 1NK2P 3H5RA 3PM1A 1B4BA 4D1QA 4FASD 1R71A 1XCVA 1R5GA 3BLYA 3J7AY 3WTSC 3PO3C 1QPMA 1QNTA 2DYRH 2OV7A 4PJ0C 1R5HA 5FFXA 3G71I 3LSGA 3S15K 4M9XA 3SXYA 3QP5A 4FE7A 4IEJA 1R6RA 3G4SI 2BOLA 1DCHA 4LR2A 1I6VA 4L9VA 3FIWA 3TL4X 1R9TC 4Y17A 4HAMA 1JKPC 3HOXK 3A4CA 4AIJA 5FB2A 3G73A 2A5WA 3VYRB 2AO9A 3VPRA 1IZ1A 5EEGA 4CYCA 2PA8L 3LFUA 3MMYB 3HJEA 2OCCH 3RKQA 2OC6A 5DD4A 1FTZA 1ULYA 3HZJA 5F0FA 5K1YA 3F8BA 2BE5A 5JVTA 2H09A 1PJRA 5B1BH 1K6YA 4ZDOA 4YFXA 2Y2ZA 1XTAA 4UUSA 3M3YJ 1VF9A 1JVIA 3DF8A 2CJJA 5D5XB 3JSPA 2M1BA 1OFCX 4P5BA 2K40A 3VWBA 3H9QA 5ILVA 1LDJA 1UCRA 5JLWA 2N8GA 3Q5FA 3HRUA 3HTUA 2VL8A 4JYKA 2J5PA 2XPWA 4KB2A 4KJZA 4DZPA 3TTGA 4OIOA 3K70C 3F8FA 5TJJA 3CO6C 4MIMA 5C44C 4MEXA 2WV0A 4QIWL 1EH7A 1UV7A 3HOYK 4FX0A 3W6VA 2JA7C 3HB9A 3K70D 2WAQN 4KATA 1TWCC 3KEQA 4GTLA 4Y3OA 1S72I 4YG2F 2K27A 4M71A 4FETA 2GBYA 3S1QJ 2VQLA 3ZN0A 4OINA 2R7OA 4FE4A 2CQ7A 2HOEA 4Z6YA 1ENHA 5LHGA 2JA5K 4L9JA 4XIDA 4C30A 1ZARA 1USSA 3BR0A 4G8XA 2HXOA 3PFYA 4BHBA 4BY7C 4GTCA 1OJLA 1Z6TA 2F4MB 2BZTA 2BY0A 5D6FA 4A3BC 3CCVI 1Z9CA 2M5WA 1TWHC 3ZRGA 5EF6A 4A3MC 2R5ZB 2O3FA 2XAQA 3OOPA 3ABTA 2QENA 3U1KA 3WTVC 4WJ4A 2FXAA 3CP2A 3I59A 3CMEI 4A69C 4P5OA 1J9IA 2TCTA 5IP9C 1I3QJ 1J7KA 2ZXWH 3O8HA 5M3FJ 2QQ9A 1VGXA 3JRFA 2VKDA 1J0RA 3DP7A 3DPTA 3ZOBA 4BBRJ 3IPJA 2FSWA 1W5SA 3JAMK 1XZQB 3A01B 1F7UA 1INNA 4XRSG 4Y4RA 3NEUA 5CLSA 3AL0C 3M3YK 3S16C 1X3UA 3P5JA 5TMCA 3H3UA 1JUPA 4Y33A 2X4HA 5IYDC 1FOWA 3K1NA 4RM3A 3U21A 1ETQA 1TBXA 3CD6I 4CZZA 2W48A 3TOBA 3QAHA 1UG2A 2O03A 2ZMEB 3PUBA 2LBFB 4EEFG 3OV8A 4KT6A 4HNTA 1P2FA 3KP4A 5F64A 3PQKA 4AYBA 4BXFA 3DBLB 5ILUA 1E17A 1WCMC 5D4DA 1FIAA 2AQFA 3GIRA 3MN2A 4A6DA 5EG0B 1T0FA 2ZFUA 3HOXC 2Y0MA 4IQJA 1TWCA 4D0PA 5KNLA 2K85A 2HZDA 1EFWA 5GAEJ 2LOOA 2X9DA 3TMOA 2E7XA 4RB3C 5ICFA 2MH9A 3DTIA 3IRRA 4ZDPA 2NVUB 5BPIA 4HG2A 3WTUC 3GYHX 3GZ5A 5L3GA 2GSUA 1YX5A 1PJ6A 1C0AA 3KP6A 2K9QA 3NAUA 3BG9A 3KEOA 5H20A 3PL8A 4DW6A 3S17K 4U0WA 1APLC 3H0GJ 1TWHA 1ZN2A 4XLNA 1VLOA 4Q4ZF 1YIOA 2EFOA 3PNYA 1I3QK 1JKQC 4RAZA 4OIRA 4C3HJ 4WCGA 4ESJA 3DXJF 3V7CA 5J1RA 2EBBA 4MEYA 2KQRA 3KIOA 2VIXA 1MKMA 4Y52J 4BBRK 1I5ZA 1XXBA 1MH4A 1OR7C 4HOBA 1KONA 4L9NA 1D5YA 3HOYC 5BS6A 3HSFA 4CYCB 1V5EA 5D6EA 3IH4A 1HBXG 3OIPA 3HPGA 1H89C 5JFRA 4E7IA 3FF5A 2E5ZA 2JA5C 4M74A 4UUSB 4M73A 3Q9SA 2O8KA 1MH3A 3AKZA 2FNPA 4KMHA 2ELKA 1YHQI 5EGEA 3FXKA 2M4KA 3FXRA 3CLQA 3BC8A 2Z5UA 4XLCA 2PA8D 1Y56A 3FHNA 2VPLA 1WCMA 2ZFZA 3F72A 2KKOA 2UWMA 1ZG1A 2X6XA 4ESBA 1AB4A 4BEHA 1VI0A 3M4OJ 3S93A 5DM7F 1D0ZA 1ZRCA 3LSMA 2BXYA 4P9UA 1X3WB 2XVCA 4BQNA 2P81A 2W57A 3L1PA 3ZP5A 3ASNH 2O6GE 4XLPA 3GEEA 3VYTB 1X31C 4Y15A 3QU3A 1A31A 1LDKB 3DPUA 1ZYRA 3DBHB 4HF2A 2K5CA 4KUMA 1QVUA 1MMNA 3H0GK 3CDLA 5AIQA 2IRFG 2CUEA 1FP2A 3LA2A 3UR3C 4YFXF 2P5LC 3A8IA 4Y13A 2O9LA 4WXCA 2Y0SN 2BW3A 1GLNA 1XZPB 4M3GA 4G7ZF 5CQEA 1NK3P 2XPVA 4KIBA 4C3HK 4BE2A 1J59A 2GXGA 1J75A 1B8IA 1BR2A 1JGSA 2FQTA 3SEQA 5M5YK 4O2DA 3JRCA 2LP0A 3I59B 3L4KA 1IDYA 1X3ZB 2VLAA 1UJ8A 4MQVA 1MJAA 1Z6RA 1MNDA 3IAM2 2ZXIA 3OYBA 3JRIA 4C2UA 3H35A 4EJOA 1BR4A 2LKSA 2V1XA 1F7VA 4JQFA 1Y0UA 4BU2A 2E7WA 4UHTA 2CV0A 2LKPA 2V6SA 3WU1B 2KIMA 2NAZA 2WADA 1BC7C 2WB1L 4A3LK 3W6KB 2OTLI 3PSIA 2ECBA 3MWMA 3L2CA 5FLVA 3W2WA 3WE2A 2PHCB 1TC3C 2DYSH 3A03A 2VASA 3EPZA 1G6NA 3S17C 2Z33A 3V8JA 3CCLI 3S1RJ 1AKHB 4F52A 4J01A 4HDUA 4BY1J 2RC4A 5L3CA 3AFHA 1MJ9A 3M4OK 3AG2H 2CQQA 2IGMA 3BZ6A 1HLVA 5IOTA 2LKXA 4M3FA 1WSVA 4UUTA 2HDCA 1ZR4A 2K9LA 1D1AA 2X0LA 1A6IA 2Y9ZA 3RTRA 3S1MJ 1NG7A 4KM8A 1IN5A 1ZGAA 1RKTA 4NQWA 3WODF 1Z3XA 3J80Z 3RQ4A 1SC7A 2XAGA 1R49A 4JK1A 5HS7A 2L2OA 2A07F 1DDNA 2A5YB 2JA2A 2HPMA 3SZZA 1HF0A 1WQ2A 4M72A 4IHTA 3KP5A 4TV7A 5FKOA 1XXCA 3I9V2 2GIZA 4JOMA 1ZKGA 3CCJI 3HHGA 3FXQA 5E68A 1Y1WA 1HSTA 1YQAA 4CCKA 1KQ9A 5F0HA 3KYDB 2HVQA 1A36A 3BDDA 2VJIA 1XS9A 4I02A 1WKMA 4BBSJ 3I4NK 3DEUA 2OF7A 1SVOA 3ESWB 2EK5A 3LWFA 1GT0C 3BQZA 1K83J 4EGYA 4XOTA 1XX5A 2ME6A 3RCOA 2XB0X 4F3QA 4LK0F 3HDDA 2DTZA 2LDUA 3H3ZA 3DPLC 1X1BA 3FXOA 2R7RA 3RZDJ 1FYKA 1A5JA 4BNCA 2PMUA 2G9WA 1H9GA 2DA3A 1S3JA 5E1ZB 2OTJI 1T98A 4J19A 4GRIA 1M1EB 2L9NA 2P5KA 3S1RK 3E7LA 3K69A 4OWRB 1JJ6C 4U87A 2L7MP 3HRTA 4JBAA 4AVZA 3GTJC 4BY1K 3G6EI 3HOVJ 1TNSA 3FISA 5HS9A 2M87A 3K9TA 3GTKJ 1YNJA 2AXTC 2KRFA 1O57A 4YFKA 4HA8A 2A6EA 2ELJA 3MD2A 5DEQA 1WRJA 2GA1A 5AONA 3BTJA 1UB9A 4EQQA 2W25A 4DNCA 3GLXA 3G1LA 2R7ZA 3E5QA 5EEAA 4NNJA 2UXNA 3I56I 1AA7A 3GW2A 5DV5A 1YOVB 2V7FA 4LG0A 5IY5H 1O27A 2LD5A 4LK1A 5IT9Z 2DA4A 2IW5A 4U88A 1O3SA 1IBAA 2LY9A 2DMQA 2CG4A 3VDXA 4A3LC 2NS0A 4XKBA 2G7HA 2J5OA 2P6TA 3GXOA 1SD5A 4G0WA 4S05A 5IOQA 3F23A 5E3LA 2MLGA 3BPVA 4G0UA 3GTLA 4BBSK 2LY2A 2BEOA 2BW3B 2Z9OA 4XSXA 2DA2A 4C3JK 1W7PD 3SDGA 1SAUA 1K83K 2QLZA 2R7WA 1D8JA 1VJEA 3EQLF 3QU6A 3M8EA 2XGDA 3PNTA 1B72B 3ZPLA 1GV2A 4RGRA 3L09A 3RZDK 3S3NA 2RVCA 4CUGA 3GZ6A 1Z3YA 2VJ5A 1RPWA 2O5RA 2JWTA 4KICA 2MGQA 3CF2A 2W1OA 2GIVA 3GTGA 1FLIA 3G2BA 4XRSA 3MCZA 3I71A 2L02A 2EH3A 4B47A 4BHCA 2AHQA 2K9NA 4JK1X 4RMNA 1P4AA 4HNVA 5FLMJ 2M2EA 1KYWA 2F5CA 4HSRA 1Q1HA 4MQ9A 3BP8A 1ZYRF 3D5RC 3HOVK 2PMZN 3GTJA 2NVTJ 1R22A 1HKQA 2DN0A 2VE8A 4ANJA 2ISYA 2QZ8A 2Z1DA 3KETA 2W7VA 3GTKK 1K79A 2EA4A 3B02A 2PEXA 2JA6A 2KRHA 5D4SA 1P6RA 4WF2A 1EK8A 4IRHA 3I4NC 5FKMA 2BY3A 4IOAF 3D0SA 2ISZA 3S2HC 3ERED 2QF7A 3J80K 1Z77A 3P9KA 4PDKA 5HLTA 3E5XA 1UFMA 4RLQA 5J6XA 1BGWA 4LFUA 4M9SA 1G3YA 2XROA 4A3IC 3N97A 2NVYK 3OSGA 2OPTA 3IWFA 1JT0A 2DA7A 2PMHA 4UB8C 4RAYA 3RIRA 4E70A 2IEKA 2H8WA 2BHYA 2K9SA 3R4KA 2PX9A 2CQKA 1W7PA 4A0ZA 1HKTA 4YFNF 3GTPJ 3S1RC 1E3OC 1FOKA 4BGDA 3D1NI 2HZTA 1SFKA 2HTJA 3QOEA 4YIRX 3H3VL 3FK7A 3I4PA 3KLNA 3M1CA 1IJWC 2HQAA 3MKZA 2CW0F 3T8RA 3PO2K 2R7FA 1O29A 5H6QA 2VC0A 3R6SA 1SFXA 1IXSB 1FBUA 1DPUA 4B1RA 1NHAA 3CQZA 4UVAA 4XN3A 4E7ZA 2DOFA 1Z0XA 1VRQC 3N4MA 2COMA 3HHHA 3ZMTA 4DYCA 3N3YA 5FLMK 1XDUA 5F1RA 1V5FA 2PFBA 1YJ9I 1W0TA 2CW8A 3HC7A 1MMAA 2R7DA 2NVTK 1MSEC 4ZYAA 1OISA 1QZYA 4NB5A 4B8XA 4HX8A 2DODA 1BIBA 3WGHA 2O5IA 1SD4A 2DA1A 1ZELA 4A5NA 4E7JA 2WAFA 3K1PA 2ZC2A 5FKLA 5LBQA 1S9HA 1T6SA 2FD5A 3V4GA 4C3JC 2WB1A 2KDZA 1K83C 3OYKA 1VQ4I 4YG2A 3RZOJ 5CHPA 1W1WE 4PFPA 2XHKA 4OMYA 2XIGA 1TNTA 2DAOA 2KDOA 4NC8A 3RZDC 4KN7A 4WXDA 3CZ6A 1OCTC 5FFZA 5TGTA 2VONA 4DOZA 2DT5A 3AG4H 4BJ5C 2RQPA 2L01A 1KQ4A 2XAFA 1BI3A 1WJ5A 3WGGA 4L5EA 2RQQA 1L0WA 3W2AA 2LVSA 2GOMA 3GTPK 3DU6A 2VBZA 2HGCA 3HOVC 4LD5A 2MD0A 2L54A 1T39A 3MQ0A 4WJ3M 1E3HA 4WXHA 2ZJQF 2L9RA 3J7AO 3JTHA 3ABKH 4PSWA 2Z99A 4L0YB 2EFWA 3BCAA 4I2OA 4G0VA 4S04A 1Z05A 2VQGA 2E2HA 5K7FA 2DCEA 2V1UA 4RM2A 3K6GA 3JREA 4XOPA 1O2BA 3T1BA 4G7HF 2R7QA 2YX7A 1FSHA 3C2GA 2JSCA 3LSRA 2NVYC 3S2WA 1LJ9A 4A0YA 3JR9A 4GO1A 2K9MA 1N78A 3DLAA 3OYLA 3GTQA 4EMSA 3WTWC 3ABMH 3TP3A 4L5IA 4PGHA 3TDUC 3DFGA 2GM4A 1X1CA 4X0GA 1U2WA 3FXUA 3IH3A 3OR1C 4KIGA 2W82A 3CCRI 5DDGA 3F22A 2KISA 4N4OB 3ZQHA 4HNUA 5M3MJ 3RZOK 3EETA 3FM3A 4LIVA 4LITA 4GTBA 5TMFA 4BS9A 1H0MA 2L5QA 3JRDA 1TP4A 1IUFA 4LGWA 3DTKA 1XZQA 3PO2C 2K02A 3A8KA 1LE8B 4LOCA 3HBLA 1GXQA 5ILSA 2R93A 4AIKA 1YE9A 2V6CA 1YIJI 4IZZA 3FXMA 4BQOA 3FXLA 3JAMZ 2A3SA 5LFAA 2PI0A 1TW2A 3OS1A 5FLMC 2NVXA 4EV0A 3FKIJ 2WBMA 2DT6A 4Q4ZA 1JGGA 1WJEA 3OYIA 1F4KA 5CKTA 2VBXA 3QX3A 1N77A 2E1CA 2B63A 2WAEA 1TW3A 2NOJB 1JOEA 3S1NJ 1W7PB 2LBFA 3DXJA 5HNFA 2XB5A 5FGMA 1O7FA 4L18B 2XKPA 4LJZF 2ACJA 2F5VA 1YLFA 3EUKL 2DA5A 1ZLKA 5EG0A 3HOUC 4M9ZA 3BTLA 1LDDA 1MBKA 4FCYA 1B1BA 2CQNA 2IS6A 1BW6A 2P7CB 2RN7A 1HI9A 3DTEA 1ACIA 5CVUA 4IXAA 3S14C 1JUMA 1XGMA 2W4SA 4KN7X 1TWFJ 5FRNA 4IRGA 4DYQA 3AQOA 4Q48A 1HDPA 1V5GA 4BXXK 2XKOA 3H3VD 1D1CA 3O6BB 1USTA 2O7OA 3RKWA 4HF0A 4HQMA 3OSFA 4XORA 1G3SA 3K7AJ 3KFWX 2KRCA 1WJDA 3C2HA 2M30A 3IAS2 4XN0A 4B43A 5BPDA 3I4MJ 3QODA 5M3MK 4EJUA 2RNJA 2E1NA 1MGTA 4L0ZB 3QPTA 1TQIA 4U0YA 4BH9A 3Q0UA 1ZH5A 2RGRA 4G6QA 3JRHA 4I98B 4A93J 2EWNA 2DXIA 1JKRC 1USMA 3PSFA 4UY8I 1G8XA 4AUXA 1BC8C 1YW8A 1NG6A 5F04A 4EJWA 1VQ8I 1QU3A 2WAQL 2FE3A
chains in the Genus database with same CATH topology
1PP8F 3QPHA 1IN8A 3HRSA 1EH8A 4MNUA 1S7AA 5DCFA 3JTGA 4FX4A 1DUXC 4K2EA 3SFZA 1ZLJA 4HQEA 3GFJA 3KP7A 4I0BA 1BI2A 3TO7A 1O26A 2HYFA 2GSNA 1SD7A 1WSUA 2VOPA 4O5VA 2XASA 2A69F 4YIFA 4KARA 3ISPA 1IN7A 2HQRA 1I6XA 2ZO4A 4I7HA 2R3SA 3GWZA 2IA2A 2JZYA 2YR2A 3EDPA 2AXLA 1ZG3A 4A6EA 1R9TA 4ETSA 1ZHFA 4Q47A 1IRFA 4A2UA 4AWXB 5D8LB 1MD0A 1YO5C 1O28A 5FLXZ 1LB2A 4HYEA 2DQLA 2LSOA 2FOKA 4BLAA 4ZZLA 1ZVUA 3EYIA 4I01A 5JFEA 3WTZA 3KE2A 2YX4A 1EH6A 5J8FA 4A12A 1MZBA 2O0YA 1B9NA 3K1MA 3QP6A 5BMZA 2GSOA 4GTEA 4ZYHA 4BKWA 4PCQA 5ICGA 2ESNA 2F5EA 2JA7A 4KT5C 2OQRA 1K78A 1XN7A 3PFIA 3HYIA 4GFQA 2EV5A 4KA4A 4ZYGA 4LQYA 1IN6A 4ZZDA 4ENNA 1R1VA 2LF8A 3K2ZA 2QM3A 1GXPA 1FC3A 3KCCA 4ENJA 3ZMVA 3AAFA 1XCBA 5L3EA 2A68F 3L00A 4UV9A 3ZMZA 4HLYA 2ESHA 2QBYB 1OYIA 2OA4A 1F5TA 2KIUA 5CVVA 3F8MA 4I0AA 1O24A 3V7SA 1C0WA 1WIHA 3LAPA 4LLNA 5IORA 1CF7B 4FZBA 2JPBA 3JW4A 4KDDA 2OU2A 3WU0A 2K4BA 1T2KA 5E1WA 1XGSA 5ICEA 4OMZA 1YS7A 1G4DA 5DD8A 3KP3A 3GO5A 1QZZA 2H94A 4G6DA 1D5VA 2V9VA 1U3EM 4RS8A 2EV0A 1OYWA 1ODDA 3LQRA 1KU7A 4HDVA 2FA5A 4P9FA 4EM1A 4KMAA 2XCRB 5LHHA 2ETHA 1S7OA 3CAGA 4UV8A 2XCOA 2Z3YA 3PQJA 4M6XA 4CXFA 4R79A 4CYDA 1OR7A 5FLXK 5K5OA 4XRFA 4KC6A 4RGXA 1WQGA 1FSEA 2V1DA 3BPXA 2Q0OA 2JA5A 5DUIA 3FOEA 3ZMSA 4O3MA 3TQNA 4KASA 1OYYA 1HSJA 2C6YA 2WC2A 3RYRA 3DKWA 3NQOA 3E3VA 1T38A 4R8HA 4ON0A 3KP2A 2HTSA 1DPRA 3ZMUA 1QQIA 1K78B 5CYVA 1OKRA 4LLGF 1MJBA 1XDSA 3ULQB 3HOSA 1TLHB 5HDKA 3WGIA 4GCVA 5E18F 2D1VA 1VTNC 5L3BA 3G4CA 2RKHA 1FYLA 1BJAA 2HS5A 1EH1A 4L9TA 1P4WA 5AIPA 2Y75A 1YS6A 3BUEA 1O7LA 2ZJ2A 2P6SA 2V79A 2Y48A 1BOAA 3REOA 1REPC 3AH5A 2XAJA 4EM0B 1YFHA 3E5UA 2OAZA 3AQPA 1O3QA 2NNNA 3RPQA 3BWGA 2A6HF 1I3QA 4C3HC 5CVRA 2FRHA 1OMIA 2ZNYA 3WTTC 1GVJA 1IW7F 5E8IA 5HS8A 4HF1A 2CYYA 4RGUA 3LA7A 4BQAA 1R36A 1BI0A 4KFCA 4UNOA 5L3FA 3TO6A 5LGNA 5D4RA 4OU0A 3IWZA 1ON1A 1B59A 1KU3A 3I0TA 4RB2C 1WI9A 2F5FA 4NHJA 1FYMA 2PJPA 2HR3A 3RJPA 3G4AA 3WG9A 4MTDA 1S29A 2XUBA 1LEAA 2MC3A 3SHFA 3H0GA 3IKTA 1R00A 4M6YA 3VODA 3HOTA 4M1XA 1V4RA 2PG4A 2H27A 4EVIA 5JHUA 5EGHA 4AD9A 3GEZA 4C3IC 1PUEE 2WTEA 4KIFA 3T0YA 4P55A 1SFEA 1XD7A 2BBYA 1FPQA 2FF4A 2EB7A 4LB6B 1QO0D 1HW1A 2K7LA 4A5MA 1I1GA 5KK1A 3HRMA 2FMYA 1LQ1A 3RI4A 2Y3PA 2YU3A 5E1XA 1FNNA 4WK8F 2KJBA 5A2QZ 5F6FA 4BLBA 3GUDA 4Q5SF 2VE9A 4G9YA 2QVOA 4F7ZA 1JHFA 2L4AA 3NUHA 4WX9A 3FOFA 1IN4A 2QWWA 3BJ6A 1IUYA 5ICCA 3LFKA 3NRVA 3I58A 5D8KB 4LB5A 2IT0A 1KU2A 2P8TA 1IXRC 5EEHA 1P92A 1O2AA 4KM9A 3C3WA 5D5VB 2DLLA 4GTAA 2RDPA 4AIHA 5K5QA 4LLLA 2DPDA 2DW4A 5KVRA 3VOEA 1SMYF 2QYOA 1FP1D 1J2XA 1CGPA 2RGVA 1BIAA 3N0BA 4N9IA 5LHIA 3ABUA 4OOIA 1SMTA 3BJAA 1O3TA 4CICA 1HXDA 3LAJA 3LA3A 3MEXA 2OZUA 3F8NA 3OPFA 1R1TA 1WQFA 5LEJA 1ISEA 2KJCA 2GZWA 1P4XA 1HW2A 3TOAA 1BI1A 3T8TA 1W4MA 2LF7A 1YW7A 4ZYEA 1K83A 3RKXA 2DU9A 2XCQA 1LEBA 4ILDA 3SZTA 2ZBKA 5DYMA 2IA1A 5A2QK 4Z2YA 3F3XA 5J8CA 3FZVA 3WE3A 2QQBA 4ZYDA 1YYVA 3GTKA 5LRRA 3HTSB 4P96A 4KMUX 5DCMB 1ZRDA 2EFNA 3CO7C 1KYZA 3VFZA 4IF4A 3I5UA 3E6BA 1ON2A 3DQVC 4GYGA 4KNYA 4UUVA 4MHGA 2GA2A 5D5UB 2NVYA 1G3WA 2LNBA 3TGNA 2PLYA 2CSOA 1WQHA 2ZFWA 2STWA 2BGCA 2NYXA 2ELHA 5FD6A 2OBPA 2QQAA 3GFIA 5JR3A 1UHWA 3J81Z 2QBYA 3RKYA 2IA0A 5HLHA 3IKVA 2FMLA 1FZPB 1R58A 1FT9A 1CF7A 2AS5F 2DK8A 1WWXA 2CFXA 1YTYA 3RDIA 2IJLA 1ZXOA 2EFQA 4ENMA 3MFKA 3HIFA 4XBFA 1PDNC 3H92A 5CVIA 3GVAA 2ZCWA 2HYGD 1BBYA 2VOOA 1HW5A 3VB2A 4I09A 5LGTA 5H6RA 3KLOA 2CFAB 3ECHA 4XSZF 3GTPA 4BXUA 4U0VA 3V8KA 1SFUA 3IC7A 3HSRA 2PBIA 4KMFA 2JPCA 4IJAA 1DP7P 2F2EA 2ADUA 5K5RA 2K4JA 2HFHA 3M8FA 4QLCU 3GX4X 1LVAA 4J3NA 2OD5A 4ZH4F 1U5TC 2FQ3A 4OIPF 3L4JA 1KU9A 4BHPA 3MMLB 4HLXA 1K6OA 2H6CA 1QBJA 5D5WB 4GXOA 2DK5A 4QWQA 5E8GA 2UZKA 1JXSA 2P5VA 3CJNA 4FM9A 3P7NA 2YPRA 4BYYA 1J5YA 2VXZA 3CUQC 4KAWX 3VA7A 1QGPA 3EYYA 1Z91A 3ZQ7A 2HEOA 3J81K 2VBWA 1STZA 2Q8KA 1FX7A 3E6DA 1RZ4A 1B4AA 1SAXA 2QUFA 3HSEA 1FWZA 2VT3A 3DV8A 4IRIA 1RNLA 1U5TA 2IPQX 4CGZA 1RUNA 4MTEA 1KQ8A 5HLGA 5BOXA 3WTYC 1XXAA 1XSVA 4GTDA 4AVPA 3LPXA 2HQNA 3QOPA 1RIOH 2DO7A 3E6CC 4KDPA 4G7OF 4G94A 5HDNA 1GHCA 3E97A 4KYWA 2IVMA 2D2WA 1F9NA 3F6VA 1ONVA 4IHSA 3MAJA 2OZ6A 3CUQA 1RI7A 4EM2A 3IL2A 4CDGA 4EJVA 5BQTA 3MZYA 3FKIA 3JSOA 2TDXA 5JVOA 3OREA 2CO5A 1V3FA 3CUOA 1AWCA 4HX4A 3IRQA 5HLIA 2DPUA 3U1DA 1U8RA 1L3LA 1FBQA 3L9FA 3I53A 1L0OC 5CVJA 3P9IA 1I27A 2BE5F 1TWFA 1O3RA 1ZGJA 1GE9A 2FBIA 3O2PE 3RPUA 3WTXC 3RYPA 5E17F 2L4MA 3LQQA 2H6BA 5L3DA 4OIOF 2O61A 4LMYA 4MEXF 3EUHA 2GQQA 2ZKZA 3LSTA 1XMAA 3M7GA 3ZMDA 2FBKA 1IS1A 3G3ZA 1KA8A 5LRSA 4OINF 4EGZA 4L5JA 3KZYA 2KIFA 3FMRA 3TO9A 2XRNA 1HQCA 1LNWA 2VBYA 1UHMA 1TWGA 4WWCA 3M9AA 3FM5A 3P9CA 2K86A 2HKOA 4KB4A 1XGOA 5LGUA 1FY7A 2YSRA 3FWEA 1FBSA 1U78A 2YU9A 3R0JA 4N9HA 4DQ2A 2BV6A 1YW9A 1U5TB 3QRFF 1KQ0A 2JTVA 4RB0A 4OIQF 2GXBA 2P7VB 2UXXA 5JI6A 2D1HA 4KN4X 2HWVA 3BOQA 3Q3QA 3IHUA 1SFOA 3O3KA 3SZPA 3FMQA 3CUQB 3C7JA 1ZAOA 3D5LA 1EV7A 2KWAA 2M45A 4XLNF 4MGRA 3MZHA 3TDZC 1R7JA 1XB4A 2ZXJA 1TQMA 1TWAA 4C2MC 3I54A 4OIRF 3I64A 3U2RA 2DFIA 4MEYF 3OEPA 3K0LA 4HV6A 3TKYA 4CO8A 4P5AA 1ZBSA 5TRDA 2P5MA 2B0LA 3FX3A 2W84A 1IXCA 3F6OA 2DQRA 1KGSA 4A0XA 2F5DA 2W85A 1S8NA 4ESFA 4PGGA 4O6JA 2MH2A 4UXNA 1BM9A 4CHUA 2NNYA 2E2IA 1IAWA 1ZREA 2XGXA 4R1HA 3ELKA 1R1UA 4ASNA 2DTRA 1BJTA 1B6AA 4XLPF 2FU4A 2NRAC 1E2XA 2HKXA 2JRTA 3R0AA 2FNAA 5IT3A 2JT1A 3CDHA 3FMSA 3V7RA 2G7UA 3E6MA 3GTOA 5DCMA 4HW0A 1IRGA 2R92A 2XV4S 2ZNZA 3ZN1A 1ZG5A 5HOOA 1JE8A 1AOYA 5IOSA 2A61A 5HVQC 3ECOA 5FD5A 5HDGA 2MA3A 3ML6A 2BYVE 1S6LA 1PP7U 2W24A 4GGGA 2XAHA 2JH3A 2VODA 1HKSA 1IF1A 1U6GA 2VT2A 1I50A 2RV8A 5LLQA 4HX7A 1K7AA 3BROA 2DI3A 2GWRA 4U7DA 2VC1A 3R61A 3C18A 1XMKA 1MDMA 4ENKA 3GTMA 4RB1A 4KMDA 3V8LA 3S0XA 3R60A 4YIIA 3GF2A 4HBLA 4UVCA 5E20A 5DUKA 4GT9A 2MD5A 1OPCA 1XSXA 1YG2A 1Z1DA 3CLOA 1D3YA 1TQPA 2STTA 4IVNA 1A04A 4RGSA 5CJ9A 1XGNA 3HUGA 1W5TA 4IPAA 3U9GA 1O25A 2OQGA 4EJTA 2IP2A 3C1DA 1XSDA 5ERIA 5IT9K 2D45A 2EA2A 4LG0B 3ROUA 2FBHA 2EV6A 1JHHA 4FT8A 3M1EA 1H9TA 2CFAA 4HZFA 2O8XA 2MBFA 2FEZA 2PN6A 3GFMA 4B09A 2DBBA 4YFKF 1SD6A 2A6EF 4N0BA 3Q9VA 2CWEA 1BN5A 3F21A 1ZRFA 3COAC 2MLKA 1B9MA 5TJ3A 4LK1F 2Q2EA 3GFLA 5ED4A 5LEKA 2L3DA 2EJRA 2EFPA 2VN2A 1G3TA 2RH6A 4GYIA 4PZJA 4XSXF 4DDQA 3FHZA 3VEPA 4GTFA 4U7BA 4BAYA 3W6JB 3CTAA 3L7WA 1TTYA 3T5XA 4UVBA 2PQ8A 1Z7UA 3B73A 1R23A 2CGPA 3BJOA 2GAUA 4H0EA 3F8CA 1Y1VA 2ZMEA 4MQ9F 1F1ZA 1I1SA 2P4WA 3KZZA 3BY6A 3SQNA 6PAXA 1RUOA 1D8KA 4HV5A 2VUMA 1DD5A 2M8EA 2WWYA 1MDMB 4FHTA 5FO5A 1B4BA 1XCVA 1R5GA 3WTSC 1QPMA 1QNTA 5FFXA 1R5HA 4M9XA 3SXYA 3QP5A 4LR2A 4L9VA 4Y17A 4HAMA 4AIJA 5FB2A 3G73A 1IZ1A 5EEGA 5DD4A 1ULYA 5K1YA 3F8BA 5JVTA 2H09A 3DF8A 5D5XB 3JSPA 2M1BA 4P5BA 5ILVA 1LDJA 1UCRA 3Q5FA 3HRUA 3HTUA 4KB2A 2J5PA 3F8FA 5TJJA 3CO6C 2WV0A 1EH7A 4FX0A 4KATA 3KEQA 4GTLA 4YG2F 2K27A 4M71A 3ZN0A 2HOEA 5LHGA 4L9JA 1ZARA 1USSA 4G8XA 4BHBA 4GTCA 1Z6TA 5D6FA 1Z9CA 2M5WA 2O3FA 2XAQA 3OOPA 3ABTA 2QENA 3WTVC 2FXAA 3I59A 4P5OA 1J9IA 1J7KA 2QQ9A 3DP7A 1J0RA 3DPTA 2FSWA 1W5SA 3JAMK 3NEUA 5CLSA 1X3UA 3H3UA 2X4HA 3K1NA 1TBXA 4CZZA 3TOBA 3QAHA 2O03A 2ZMEB 3OV8A 1P2FA 3KP4A 5F64A 3PQKA 5ILUA 1E17A 4A6DA 1T0FA 2Y0MA 1TWCA 4D0PA 2E7XA 4RB3C 5ICFA 2MH9A 3IRRA 5BPIA 3WTUC 3GYHX 3GZ5A 5L3GA 2GSUA 3KP6A 3KEOA 5H20A 4U0WA 1TWHA 1ZN2A 4Q4ZF 1YIOA 2EFOA 4RAZA 4ESJA 4WCGA 3DXJF 3V7CA 1MKMA 1I5ZA 1XXBA 4HOBA 4L9NA 5BS6A 3HSFA 5D6EA 1HBXG 5JFRA 3FF5A 4M74A 4M73A 3Q9SA 2FNPA 4KMHA 5EGEA 3FXRA 2Z5UA 2ZFZA 1WCMA 3F72A 2KKOA 2UWMA 1ZG1A 4ESBA 1AB4A 1ZRCA 4P9UA 3ZP5A 2XVCA 2W57A 2O6GE 4Y15A 3QU3A 1LDKB 4HF2A 4KUMA 5AIQA 2IRFG 1FP2A 3LA2A 4YFXF 2P5LC 4Y13A 4WXCA 4G7ZF 4KIBA 1J59A 1J75A 2GXGA 1JGSA 3I59B 3L4KA 4MQVA 1MJAA 1Z6RA 4EJOA 2V1XA 4JQFA 1Y0UA 2E7WA 4UHTA 2LKPA 3WU1B 2KIMA 2NAZA 1BC7C 3W6KB 2PHCB 3L2CA 3MWMA 3N0CA 3WE2A 1G6NA 2Z33A 3V8JA 4HDUA 2RC4A 5L3CA 1MJ9A 3BZ6A 5IOTA 2HDCA 2X0LA 3RTRA 4KM8A 1IN5A 1ZGAA 4NQWA 3WODF 3J80Z 2XAGA 5HS7A 2A07F 1DDNA 2A5YB 1WQ2A 4M72A 4IHTA 3KP5A 4TV7A 1XXCA 3HHGA 3FXQA 1Y1WA 1HSTA 1YQAA 1KQ9A 3BDDA 4I02A 1WKMA 3DEUA 2EK5A 3LWFA 4EGYA 4LK0F 2LDUA 3H3ZA 3DPLC 1FYKA 4BNCA 2PMUA 2G9WA 1H9GA 1S3JA 5E1ZB 1T98A 2P5KA 3K69A 3HRTA 4JBAA 1TNSA 5HS9A 2M87A 3K9TA 2KRFA 1O57A 4HA8A 5DEQA 1WRJA 2GA1A 5AONA 1UB9A 4EQQA 2W25A 4DNCA 3GLXA 2R7ZA 3E5QA 2UXNA 3GW2A 5DV5A 4LG0A 1O27A 5IT9Z 2IW5A 4U88A 1O3SA 2CG4A 2NS0A 2G7HA 2J5OA 2P6TA 3GXOA 1SD5A 4G0WA 4S05A 5IOQA 3F23A 2MLGA