5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
b'GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
2EFPA 2HWVA 3WTWC 2VBZA 5ICEA 2QM3A 1KU9A 2HZTA 3F72A 1SD6A 4WF2A 1PUEE 4KFCA 1YO5C 1XGSA 1XCBA 1HKSA 3GVAA 2VE9A 1O3QA 4Q47A 1J75A 3BJAA 3ZPLA 4GYGA 2A07F 3FXRA 2XAFA 3R4KA 1RIOH 3KP5A 3MAJA 1KGSA 3KLOA 3VODA 1WRJA 3WTUC 1T2KA 5DD4A 1K78B 2O3FA 1DDNA 1BN5A 1BIBA 3RTRA 2VONA 4H0EA 4RB2C 1MKMA 2LSOA 2R7DA 4KC6A 1H9TA 1DPRA 4KN7X 1WWXA 3V8JA 3MZHA 3ZMVA 2L3DA 2FMYA 4CDGA 1UHMA 5KVRA 3F8MA 3R6SA 4DQ2A 1T6SA 2Q8KA 1BI2A 2M1BA 3HSRA 4L0ZB 2BEOA 1FZPB 2EFNA 1D8KA 3C18A 3GEZA 4B09A 4LD5A 2HKXA 5IT3A 4G0UA 3FOFA 2HYGD 4GFQA 2IA0A 2NAZA 4BYYA 1S6LA 1I1GA 3EQLF 2MH2A 5IT9K 3E97A 3MMLB 3I0TA 3HRMA 5E1ZB 4EJVA 2LF8A 3DF8A 2L4AA 2ZMEB 1XDUA 1U5TC 4ON0A 3I58A 3E3VA 4CGZA 2W57A 3KP3A 1XN7A 3G3ZA 4G9YA 4PGHA 1P4XA 4EQQA 3CTAA 3FOEA 1S7OA 4UV8A 3H3UA 5F6FA 2VXZA 2J5OA 1ON2A 1HQCA 2K02A 1G6NA 1IRFA 1GXPA 4IHSA 1XGMA 4OMYA 3KP6A 3WTYC 4P9FA 1LNWA 4BNCA 2QQBA 1E2XA 1OYWA 2P7VB 3B02A 4G6DA 1D5VA 2VBWA 4UVCA 1HBXG 5LGTA 3WTTC 2B0LA 4UXNA 2F5CA 4WXHA 3T8RA 1IRGA 3BUEA 1QNTA 2YSRA 3OV8A 4ZYHA 3CJNA 2V1XA 4HX8A 2FA5A 4EV0A 4LLNA 2ZXJA 5LRSA 1TQMA 3RPUA 5EEGA 1PDNC 1USTA 3ISPA 2E7WA 3M9AA 6PAXA 2OD5A 2EB7A 3I64A 2ISZA 4JK1X 2GQQA 3DXJF 2HFHA 2FBHA 1UCRA 1BC8C 2EJRA 2DI3A 1EH8A 3EYIA 4MQ9F 1Z91A 2OQRA 2VC0A 3RPQA 1GHCA 1Z6TA 4KDDA 4FX4A 2Z9OA 2O6GE 1D3YA 2VN2A 4LB6B 2IA1A 3V7RA 3MWMA 2XKOA 1A04A 4IXAA 1J0RA 1I5ZA 3TO6A 2M5WA 3ZMUA 4HA8A 3L2CA 4P96A 5D6EA 4I01A 4Z2YA 4RAYA 5ILSA 2EFOA 3BPVA 2OZ6A 3TKYA 1QZZA 4Q4ZF 1U78A 1WQGA 2NRAC 3I59B 2BE5F 1TW3A 1LVAA 2PMUA 1JE8A 2XUBA 5K5QA 4WK8F 3OPFA 2QQ9A 1B4BA 2CYYA 1J9IA 4RGRA 2XAJA 2HTJA 2M30A 2X0LA 1SD7A 2WV0A 1V3FA 1ON1A 1ISEA 4XLPF 2G7UA 2L4MA 1FPQA 3BY6A 1FC3A 4HYEA 1O3RA 2STTA 2D1HA 3ABTA 1Z9CA 3M1EA 3D0SA 1ULYA 1MD0A 2EV0A 5BS6A 2Q0OA 5K1YA 3L09A 2Y75A 4G7ZF 1U5TB 5L3BA 5D4RA 4FT8A 2RGRA 2DT5A 3K9TA 1EV7A 2UZKA 2A3SA 2NYXA 2JPBA 1B4AA 4HQMA 2KIFA 2CQKA 3VFZA 3O6BB 2HS5A 2H6BA 1REPC 1IW7F 1RZ4A 1ZARA 1UB9A 2ZNYA 1SMTA 3FWEA 2MBFA 1HKTA 2FXAA 2Y48A 4ESJA 1P4WA 1ZRCA 4OINF 2YPRA 1IN5A 4NHJA 4JBAA 2P7CB 3N4MA 3ULQB 3Q5FA 1U6GA 4UNOA 2HDCA 3WU0A 2LNBA 4M6XA 3WG9A 4A2UA 3BWGA 4BHBA 2PBIA 1LEAA 3JAMZ 5K5RA 1YYVA 3FX3A 3F6OA 5ILUA 3F23A 4HAMA 3HIFA 1MJ9A 3WGGA 2IVMA 3IC7A 2PHCB 3WTXC 1EH6A 5ILVA 4KNYA 5JVOA 1OYIA 4HLYA 3NQOA 3V7CA 3HTUA 1YLFA 5CVJA 2QBYB 1KU7A 1BBYA 4A0ZA 4G7OF 3KEQA 4R8HA 3GFJA 4DDQA 2UXXA 2HEOA 3LA7A 4Q5SF 4UHTA 3RYPA 1O3SA 4A0YA 3LFKA 5TJJA 5ERIA 4FX0A 1AWCA 4RB3C 3BOQA 2G7HA 1MJBA 1SD4A 4LK1F 1HXDA 2LF7A 4I09A 5AONA 2DQLA 1JGSA 3CUOA 4IRIA 5D5WB 4CYDA 4I7HA 1R58A 1XCVA 5FFZA 1IS1A 2XASA 1G3WA 4GYIA 2K4JA 5DUKA 4RGUA 2MLKA 3RJPA 2W85A 4CO8A 5E18F 1ONVA 3HHHA 2XV4S 4IF4A 4M72A 5E8IA 2ESHA 2ZCWA 1Q1HA 4KT5C 1R1UA 4M9ZA 4QWQA 3H3ZA 4U88A 4KMUX 4WXCA 3TGNA 1B59A 3ZMDA 3DQVC 1R23A 2ZFZA 3P9IA 4U0YA 2CG4A 3O2PE 4OIRF 3TQNA 1R5GA 2XAGA 1LEBA 5BPDA 2EA2A 2HGCA 1FWZA 1P6RA 4O6JA 2F5EA 2GIVA 3I59A 3N97A 3R0JA 3I4PA 2XCRB 4DNCA 5ICFA 1ZLKA 2GZWA 2FBIA 1ZAOA 2EV6A 3BP8A 3RDIA 4PGGA 2EA4A 2XIGA 3T8TA 2ZNZA 1MDMB 1SMYF 4LG0A 3HTSB 3HOSA 4B8XA 4HV5A 2ZKZA 2COMA 4KIBA 3NRVA 3ELKA 2ACJA 3FXQA 3VEPA 3KLNA 5FB2A 4A6EA 1BGWA 3SZTA 3TDZC 4EJOA 3IKTA 4AVPA 3FM3A 5HLGA 1IXCA 3IRQA 2FBKA 5DD8A 5JR3A 2WTEA 3L7WA 4UVAA 3TOBA 3GFMA 1ZGJA 2CWEA 1J5YA 2QQAA 5AIQA 5E1XA 4HLXA 4U7BA 3LQQA 2GXGA 4OIOF 4KA4A 3QU6A 1FOKA 2IW5A 3GZ6A 2VOOA 4U0WA 1YG2A 4MQVA 4QLCU 1TBXA 1MJAA 3LA2A 3W6KB 3P7NA 1T39A 2RKHA 1I27A 1TTYA 4MEXF 3F8NA 1IF1A 5E20A 5ICGA 1I1SA 2JZYA 5J6XA 2BGCA 4L5JA 2KRFA 5HS9A 2XHKA 1IN4A 1TNTA 3KP4A 1O3TA 2MH9A 4KICA 4EJUA 1O7FA 1XSDA 1ZYRF 1FBSA 2XRNA 1WQHA 2PFBA 1TQPA 3RI4A 1KA8A 2FMLA 2RDPA 3S2WA 3I71A 4KB2A 5BOXA 3GX4X 1B6AA 2GAUA 3EETA 4I98B 5DCMA 3ROUA 2J5PA 1ZREA 4WWCA 4P5OA 4BHPA 5LEJA 1HKQA 1Y0UA 3P9KA 4OIPF 2QWWA 4AD9A 4L18B 4M73A 2ELHA 2NNNA 4S04A 3CUQB 3T0YA 1XSVA 1H9GA 2KJBA 3LAPA 1W7PD 3GF2A 2FF4A 2PMHA 3C7JA 4Y15A 2QENA 2YX7A 3RKXA 1R1VA 3GFLA 5JVTA 5LHIA 2Q2EA 4RAZA 3ZN1A 2HYFA 4U7DA 2D2WA 5HOOA 1V4RA 2QUFA 2QVOA 2BBYA 3EYYA 2V9VA 4PDKA 1XB4A 4I02A 2OAZA 4BQAA 3K69A 3LSTA 4RB1A 1FYKA 1W7PB 2P6SA 3R60A 4PZJA 5D4SA 1C0WA 4XSXF 2R3SA 2XROA 4OOIA 1FSHA 2GWRA 2G9WA 1G4DA 1QZYA 2IA2A 4AIHA 4YFNF 4IRHA 1XMAA 2MA3A 2CO5A 5D5XB 2JTVA 1AB4A 2F5FA 2WWYA 2MD5A 5L3FA 1HW1A 1WI9A 4KIFA 2VOPA 5JI6A 5D5VB 4KMFA 1BOAA 2V1DA 3OREA 1J7KA 3J80K 4YFKF 3F21A 3SFZA 2P8TA 3K1PA 2R7FA 5D8KB 4LLLA 1IZ1A 1RI7A 1FLIA 5HLHA 1S29A 3ML6A 5H6QA 2XCQA 3OEPA 3K0LA 3GUDA 4EMSA 1SFUA 3CDHA 3J81K 2JT1A 1IAWA 3QPTA 3MCZA 2JSCA 4L9NA 3FHZA 5DUIA 1KYZA 1CF7B 4N9IA 3GFIA 4R79A 4ASNA 1R22A 1BI0A 2GA1A 1R00A 5CJ9A 2JRTA 4KUMA 4N9HA 4HZFA 3WTVC 2IPQX 3L4JA 1B9MA 1P2FA 3CLOA 2EV5A 5FGMA 2K27A 4LMYA 1K78A 4MTEA 4D0PA 1XD7A 4OIQF 3L9FA 2VODA 3DFGA 5FO5A 2PQ8A 3ZMZA 3ERED 3C3WA 2OU2A 2O61A 2AXLA 3K1NA 3KE2A 2F5DA 3GO5A 5BPIA 4BXUA 1XDSA 2LDUA 2UXNA 2HKOA 4IJAA 3JSPA 3IHUA 4S05A 5F64A 4XLNF 3QRFF 1B1BA 3DKWA 5LRRA 4RGSA 3HSFA 4IVNA 1F1ZA 4O3MA 4XSZF 1L0OC 5DDGA 5L3CA 3O3KA 3HOTA 4EGYA 5CYVA 4Y17A 4KDPA 1S7AA 3E5XA 2O8XA 2HR3A 2ZJ2A 1SFXA 1Z05A 4LB5A 3QU3A 2PJPA 5IT9Z 2ZMEA 3C1DA 4KYWA 3BJ6A 3E5UA 4YFXF 3IWFA 3J7AO 1L3LA 5DV5A 2K7LA 4KB4A 2QLZA 2DPDA 3M8FA 2FNPA 2GXBA 1ZHFA 3K2ZA 3M8EA 2IJLA 1BI3A 2NNYA 4HDVA 4L0YB 1EH7A 1F9NA 3V7SA 4A5NA 4GO1A 1F4KA 1KU2A 1R5HA 1HW2A 1R7JA 3E6MA 5CVUA 1FX7A 5LEKA 3WU1B 1MGTA 1HSJA 2F2EA 4IPAA 4MHGA 3QP5A 4G8XA 1YW7A 3CUQA 1JHFA 5AIPA 4ZZDA 1ZG5A 1BJTA 1TNSA 3QPHA 4O5VA 2E1CA 2GA2A 4EM2A 5BQTA 4FM9A 4L9JA 2P5KA 2W24A 1P4AA 3SZPA 4ZYEA 5CVRA 5CVIA 3PFIA 3DP7A 4EJWA 4ENNA 2HQNA 3V8KA 1HW5A 4M9XA 3WGHA 4R1HA 1EH1A 4HF0A 2XCOA 3E6DA 5LLQA 1O57A 2FEZA 5FFXA 2H27A 3KFWX 5H20A 2A6HF 3W6JB 2FU4A 1YS7A 2DQRA 2XVCA 2VE8A 2K4BA 2Z99A 3M7GA 2VT2A 2BYVE 5A2QK 4ENJA 1ZVUA 5HS7A 3CAGA 3FF5A 3ZP5A 1LQ1A 4EM0B 3SXYA 3PQKA 4NB5A 3BPXA 1K7AA 1XSXA 3KP2A 1PP8F 1SD5A 2VBYA 3SHFA 4WXDA 3VOEA 1FY7A 1K79A 3ECHA 3MZYA 4HX7A 2BV6A 1BI1A 1IN7A 3MEXA 3LA3A 1FYLA 3VB2A 4ZYGA 3QP6A 3T1BA 3B73A 4HF1A 1G3YA 3KZZA 3ZMSA 4IRGA 4LK0F 3J80Z 3KCCA 5HS8A 4Q48A 2ADUA 2H94A 3R0AA 1PP7U 2FNAA 2FRHA 5HLIA 4M74A 1K6OA 1TQIA 2D1VA 5FLXK 2MLGA 1ZG3A 2Z33A 4LGWA 1DPUA 2LKPA 1YW8A 4UV9A 1CGPA 5ED4A 4BAYA 3IL2A 2EWNA 1FNNA 1WSUA 4G0WA 4MGRA 3COAC 3KP7A 3F3XA 1WQFA 3RYRA 3HHGA 5D8LB 1D8JA 1QO0D 3GLXA 3FM5A 2PLYA 1ZGAA 3F8FA 3KZYA 1Z7UA 2M45A 3NEUA 1YFHA 1USSA 1U5TA 2DU9A 4YIIA 1LDJA 2YR2A 4ZYDA 1QBJA 2DW4A 1TW2A 3GW2A 1IXRC 4TV7A 2P5MA 4HQEA 3GZ5A 3RIRA 4HV6A 3QAHA 4JQFA 1ZN2A 3IWZA 4ZZLA 5E8GA 1WIHA 1YW9A 2L01A 1T98A 1SAXA 4ENMA 4RB0A 4XBFA 4HBLA 4A5MA 2PN6A 2MC3A 3WE2A 4LLGF 1YIOA 4HX4A 1FSEA 1W4MA 2A6EF 4ZH4F 4J3NA 1OPCA 2W84A 1STZA 5D6FA 4M9SA 4MEYF 4GCVA 1RUOA 2IT0A 2M87A 1LB2A 1ZH5A 1TLHB 2HOEA 2WC2A 4IHTA 1F5TA 3U1DA 4UVBA 2Y3PA 4G0VA 5HDKA 4I0BA 3FMQA 4ENKA 3ZN0A 2RQPA 3JAMK 4Y13A 4ETSA 1XGNA 5F1RA 2KKOA 3TOAA 2QBYA 1T0FA 3TO7A 3WE3A 2PEXA 3E5QA 1IN6A 4AIKA 3LAJA 1QGPA 1ODDA 1U8RA 2FOKA 2V6CA 1OYYA 2Z3YA 2KIUA 3TDUC 4KN4X 1GE9A 4MTDA 1ZG1A 2VBXA 2X4HA 3QX3A 4CZZA 1LDKB 2IP2A 2EFQA 2CW0F 2DO7A 1S3JA 3LPXA 4YIFA 3REOA 4U0VA 2XAQA 4CHUA 3CO7C 5HDGA 3HRSA 3PQJA 1UHWA 1X3UA 2RV8A 3ECOA 3WGIA 3P9CA 3OOPA 2O0YA 5A2QZ 5LGUA 2P6TA 4WCGA 1P92A 1J2XA 2KIMA 5J8CA 2C6YA 1KYWA 5BMZA 3K1MA 1R36A 5LHGA 2STWA 1G3TA 1GVJA 3QOPA 3R61A 3GWZA 2A68F 4EGZA 3IKVA 3NUHA 2UWMA 1BC7C 1DD5A 2A5YB 3BJOA 4M71A 2ISYA 3IRRA 5LBQA 2CGPA 3KEOA 1XXAA 5HVQC 3L4KA 4GXOA 3FMRA 4I0AA 3L00A 4G6QA 3RKWA 4LFUA 5LGNA 5JFRA 3U2RA 2D45A 1Z1DA 1R1TA 5D5UB 1AOYA 3DPTA 1XMKA 4OU0A 2DPUA 5DEQA 4NQWA 2E7XA 4YG2F 1MZBA 2DFIA 5L3DA 1LJ9A 4N0BA 1FT9A 3AAFA 5FLXZ 4EJTA 1IXSB 2QYOA 2L54A 3H92A 5J8FA 3E6CC 3GYHX 2OZUA 2W25A 4A12A 1BM9A 2ZFWA 3G73A 1GXQA 1MDMA 1LDDA 2XGXA 4EVIA 1BJAA 4M6YA 1QPMA 2Z5UA 3HRTA 1ZRDA 4RGXA 2L02A 1YTYA 4CXFA 3F6VA 5CVVA 5TRDA 1QQIA 2P5VA 1S8NA 4EM1A 2ZBKA 4I2OA 3V4GA 2KWAA 4LG0B 4WX9A 3E6BA 3I54A 2IRFG 3TO9A 2O03A 5ICCA 1EK8A 3HYIA 2RVCA 4RS8A 4KIGA 4ESFA 5K5OA 1H0MA 2CFXA 2A61A 4HW0A 3SQNA 2NS0A 1FP2A 1G3SA 3BZ6A 4G94A 1Z6RA 4P9UA 2RGVA 3HRUA 1JXSA 1FBQA 1HSTA 2H6CA 2VC1A 1FP1D 2RN7A 2E1NA 1U3EM 2YX4A 3JW4A 3T5XA 3F8BA 4ESBA 5JHUA 4HDUA 4BHCA 3Q9VA 1UFMA 3CO6C 4BH9A 1IN8A 3BROA 1RUNA 2FSWA 3ZMTA 2K86A 3ABUA 1J59A 1SFEA 2JPCA 1U2WA 1JHHA 2DLLA 5FD6A 2OBPA 3D5LA 2PI0A 3LWFA 4XRFA 4A6DA 3JTHA 3F8CA 4P55A 1OR7A 4KAWX 1KU3A 3ZQ7A 2P5LC 1I6XA 2RC4A 1IUYA 3WTZA 4AIJA 2PG4A 1W5TA 3WODF 2OA4A 1XGOA 1BIAA 4L5IA 2AS5F 1E17A 4CICA 5DCMB 2ZO4A 5LHHA 4K2EA 2P4WA 1YQAA 1KQ8A 3BDDA 2YU3A 3MFKA 2EK5A 2DBBA 4GGGA 2V79A 2Y0MA 5L3EA 5EEHA 3HSEA 5E1WA 2RNJA 1YS6A 3DV8A 1OMIA 1WQ2A 2XKPA 1NHAA 4F7ZA 3DEUA 2DK8A 2HQRA 1FYMA 2XAHA 4PCQA 2DAOA 2TDXA 3LQRA 1W7PA 2DK5A 1DP7P 2ETHA 1KQ9A 2FQ3A 4L9VA 2KJCA 1XXBA 3RKYA 1FBUA 2EFWA 2CSOA 5FD5A 3HUGA 3Q9SA 2FE3A 1KQ0A 3GXOA 4A0XA 1W5SA 3CUQC 1VTNC 3I5UA 2DTRA 3KETA 3FZVA 4L9TA 3I53A 4FHTA 1B9NA 3EDPA 5DYMA 3VA7A 2HTSA 4LJZF 1DUXC 5E17F 1RNLA 4UUVA 1T38A 2OQGA 3JSOA 5L3GA 1ZRFA 3MQ0A 5HDNA 1O7LA 1OKRA 3FXUA 4HOBA 4G7HF 2V1UA 5DCFA 3U9GA 3V8LA 5H6RA 5KK1A 5CLSA 2QZ8A 3FMSA 3DPLC 4E70A 1ZLJA 3WTSC 2M8EA 4AWXB 3F22A 2VT3A 2ESNA 3J81Z 1XXCA 2A69F 3JTGA 4HF2A 1CF7A 1WKMA 2H09A 3EUHA 4OMZA 4MNUA
chains in the Genus database with same CATH superfamily
1Z77A 2R7VA 2EFPA 3O8HA 2F4MB 4XR6A 2HWVA 3WTWC 2QSGX 2VBZA 1QA6A 3L2VA 4FISA 5ICEA 2DMNA 2QM3A 1W36C 1BS2A 4HG2A 1KU9A 3GTPA 3J7YJ 4BQOA 2HZTA 3F72A 3OL3A 4BQQA 1SD6A 4WF2A 1PUEE 4KFCA 1YO5C 3GTLC 5HNFA 1K83J 3RZDJ 1XGSA 1XCBA 2DA5A 5HODA 1WSRA 1HKSA 3GVAA 3RQIA 2VE9A 4LG3A 4RAGA 1DGRM 1O3QA 4WJ4A 3VWBA 1WOOA 4YFKA 2JA8K 2JA7J 4Q47A 3S2HJ 2AQEA 2QA4I 1J75A 1VRQC 4Y33A 3BJAA 3ZPLA 4XM3A 5FJ8K 4A3DJ 4GYGA 1E3PA 4X0GA 2A07F 1K83A 3GTQK 3FXRA 2XAFA 3R4KA 1VFCA 1RIOH 4IQ4A 1JKQC 1WJBA 1HCRA 3KP5A 5IYBK 4NNJA 1A36A 1DQUA 4HRIA 4A3MJ 3MAJA 1KGSA 3BLYA 3KLOA 3VODA 1WRJA 3WTUC 1Y8RB 3OS0A 5GAGJ 1T2KA 5DD4A 2OC6A 4XLCA 1K78B 2O3FA 2R7OA 1BN5A 2QKLB 2WA0A 3OS1A 1IC8A 1DDNA 1ZR4A 3DTIA 5FRNA 1BIBA 5F08A 2HXOA 3RTRA 1I3QJ 2EILH 1BL0A 3G2BA 4H0EA 2VONA 4A3CK 4RB2C 2JUCA 1INNA 5IY5H 4PAAA 1CF7B 1MKMA 2R7DA 2LSOA 1MW7A 2LBFA 1I3AA 1H9TA 4KC6A 3S32A 2LY9A 1DPRA 1O29A 4KN7X 1WWXA 3V8JA 1TWHJ 1H89C 3MZHA 1I3QA 3ZMVA 1FIAA 2DOEA 3TP0A 2L3DA 3TW7A 2FMYA 3S2DK 4CDGA 1GV2A 1UHMA 1O4XA 5KVRA 1ZTRA 3F8MA 2V1NA 2DMPA 5EYRA 4BXXK 2A5WA 3R6SA 4DQ2A 1T6SA 2Q8KA 1BI2A 5J4YA 2M1BA 3HSRA 1N75A 4L0ZB 2BEOA 1TWHA 1JKRC 1FZPB 2EFNA 1D8KA 3C18A 3GEZA 4B09A 3S14J 4LD5A 2HKXA 3SZZA 5IT3A 4G0UA 3DEEA 4OIQA 3FOFA 2HYGD 4GFQA 3PM1A 1DU6A 2FQ4A 2IA0A 4NC8A 2NAZA 3CP2A 4BYYA 1S6LA 1XS9A 1I1GA 1YRNA 3MMYB 2NS7A 3HL2A 1JT6A 3S93A 1OFCX 4KN4A 4DBQA 3KYDB 5F04A 5E79C 3EQLF 2MH2A 5GP9A 3RZDC 5IT9K 2MSYA 4DYCA 3E97A 4BXFA 3FDYA 3MMLB 3I0TA 3UKGA 5TISC 2WAQD 3HRMA 3LSMA 5E1ZB 2VUMA 1WPKA 4EJVA 4KATA 2JA7C 2LF8A 3DF8A 1D1AA 3G4SI 2L4AA 2LP0A 3ASOH 3S2HC 5IP7K 2O5RA 1XDUA 2ZMEB 1U5TC 4ON0A 1VQLI 4BGDA 3I58A 4A3DC 2JA6K 3K10A 3E3VA 1MH3A 4CGZA 4XLNA 2W57A 3KP3A 5JLXA 1Y1WA 3TEDA 1DCHA 3DU6A 4XN0A 5C3EJ 4PFPA 3GBGA 1XN7A 3G3ZA 4G9YA 4PGHA 4A3MC 1P4XA 1FOYA 4XSZA 4EQQA 1I50C 1O24A 1I6HC 1VNDA 3CTAA 3RZOK 3S1NK 2VPRA 3FOEA 1S7OA 4UV8A 3H3UA 5F6FA 5J3LA 2VXZA 2HXIA 1QHGA 2J5OA 4GTFA 1ON2A 3HOUK 1HQCA 1X2MA 2K02A 5CKTA 2R7WA 3DCFA 1G6NA 1R4MB 3CLQA 1IRFA 2DA4A 3FIWA 2E2HJ 1ETVA 1GXPA 4IHSA 1XGMA 4OMYA 3KP6A 3WTYC 3S1RJ 4CZCA 3A2KA 2YUSA 4P9FA 2NVQJ 1LNWA 1Q1VA 4BNCA 4YFXA 1XPPA 1RKWA 2QQBA 1E2XA 1NH3A 1OYWA 4PJJA 2P7VB 3B02A 4LOCA 4G6DA 1LE8B 1D5VA 2VBWA 4UVCA 2XB5A 1HBXG 5LGTA 1J98A 4ZJZA 3WTTC 3DEWA 5EG0A 5JFEA 2XB0X 3FKJA 5B5EC 2B0LA 3G6EI 2QQ8A 1SVLA 3GTMC 5M3FK 2XSDC 3S14C 1HDPA 2X6WA 3DWLE 4I99C 4UXNA 3KYLA 1FTTA 1TT5B 1XMXA 2F5CA 4WXHA 3VYRB 3T00A 2JJ7A 2RREA 3T8RA 1IRGA 4C3HK 3BUEA 2V6SA 1W36D 1QNTA 3AG2H 4XRSA 2YSRA 3PSIA 3OV8A 3WODA 4ZYHA 4DGWB 3CJNA 2V1XA 2DDBA 4HX8A 2NVTJ 5J1YA 2FA5A 4EV0A 1TWGK 2W7VA 1MNDA 3G4CA 3M07A 1R4NB 2YU9J 3HOVJ 1HQMA 1GDTA 4LLNA 1TWFK 3H0GK 4B47A 2ZXJA 1OCZH 1ZK8A 5LRSA 1TQMA 3RPUA 5EEGA 1YNJA 2WBMA 4C3JC 1PDNC 1YE9A 2I5UA 5EGOA 3CMMA 1USTA 4E7HA 3G4AA 3ISPA 5IP6A 2E7WA 3I4NK 2YU9A 3M9AA 2LG4A 6PAXA 2OD5A 2EB7A 2VQGA 2NVXJ 2E34A 5C3EC 4C2MJ 3I64A 2ISZA 4JK1X 2GQQA 3DXJF 3RSNA 3H9JA 2Y30A 1T0FC 3A4CA 5DTDA 2HFHA 4QIWL 4QJVB 2VI6A 4CH7A 3HOXJ 3C2HA 4MIMA 4FTHA 2FBHA 3AG1H 1UCRA 5GADJ 1BC8C 3NAUA 2EJRA 2DI3A 4LIUA 1EH8A 2KIQA 3EYIA 4MQ9F 1Z91A 2OQRA 3A0BC 3LSHA 2VC0A 1V55H 3S1MJ 2NS8A 3RPQA 1GHCA 4A3GJ 1Z6TA 2DODA 4KDDA 1R71A 4FX4A 2E2HC 2Z9OA 2IEKA 4DBRA 2IGKA 1GT0C 1HF0A 2O6GE 1D3YA 3S1RC 2VN2A 2NVQC 3GTOK 2L0KA 3K2AA 4LB6B 3TP3A 1JUMA 2IA1A 2WB1D 1P9QC 1ZGWA 4IHVA 2GXAA 3V7RA 2OCCH 1R9TK 3ZOBA 3VPRA 3MWMA 3H0DA 4ZC3A 3BT9A 2XKOA 1A04A 2MD0A 3H1CA 2ID6A 4IXAA 3GTPK 1J0RA 2XGCA 3A8IA 3A01A 4RMFA 3KPHA 3OYNA 4HPQA 3M4OC 1I5ZA 3TO6A 1DCPA 2M5WA 4G12A 3OYFA 3CESA 3MKLA 1USOA 3DU5A 3H5RA 3ZMUA 4XNFA 4PJMA 4PSWA 4GTDA 4HA8A 3HC7A 3L2CA 2LMDA 2W4SA 4P96A 3FKIC 2Y0SA 5D6EA 1YOVB 4I01A 4Z2YA 3LNQA 3S16K 4RAYA 5ILSA 1YX2A 1ORKA 4GFBA 2X9DA 4D7MA 2HQ5A 2EFOA 3BPVA 2ZSHB 4HNTA 2OZ6A 4DZJA 3HOVC 3TKYA 3T02A 5EGHA 2BVLA 1JVIA 1QZZA 4Q4ZF 1U78A 4UUTA 4ZDOA 5K7ZA 1SVMA 1WQGA 2NRAC 2R0QC 3IUOA 1UG2A 3I59B 2V6UA 2BE5F 2K85A 1TW3A 2HOAA 1LVAA 1JQWA 2PMUA 2R4GA 1JE8A 2XUBA 2NVXC 5K5QA 4C2MC 2E2IA 1GV5A 4LK0A 1D1BA 4WK8F 4BU2A 5FKLA 3OPFA 2QQ9A 1B8IB 2IGOA 2DTZA 4AYBN 2B7EA 1IV6A 4GT9A 1B4BA 2CYYA 4XORA 4UB6C 1J9IA 3AG4H 4RGRA 1V5EA 4A3FC 2XAJA 2HTJA 2JA8J 2M30A 3BC8A 4QIWD 2X0LA 1SD7A 3QOEA 3S1MC 2WV0A 1V3FA 1ON1A 5FJ8J 2L7MP 1ISEA 1RETA 4A3BK 3GTQJ 4XLPF 2G7UA 2L4MA 2B63C 2JH3A 2JA5A 1ZR2A 2V6EA 1FPQA 3BY6A 3BR3A 1TWHK 1X58A 1FC3A 2DXIA 2HI3A 3P5JA 4HYEA 1O3RA 2CQNA 2D1HA 2STTA 5IYBJ 3ABTA 2CJJA 4AUXA 4CA0A 1OCOH 2M3AA 1Z9CA 1YCLA 3M1EA 1RKTA 3D0SA 1ULYA 4E7SA 2K9SA 1IV8A 1MD0A 2EV0A 2EZKA 2GBYA 5BS6A 2Q0OA 5K1YA 3WU2C 3L09A 4C2TA 2Y75A 4G7ZF 1D0YA 3TFHA 1U5TB 3BTJA 5L3BA 4PUSA 5D4RA 4FT8A 2LR8A 1R5ID 2LKSA 2PX9A 4XL9A 3W2WA 2DT5A 1UAAA 2RGRA 1IBAA 3K9TA 1NG7A 2QGUA 4HSTA 1E3OC 1EV7A 2UZKA 1WGXA 1ETYA 4A3CJ 2A3SA 4DYQA 2NYXA 1BDFA 3BR0A 2VUMK 1PJRA 2JPBA 1B4AA 3OOUA 1S9HA 2CQKA 2KIFA 3O6BB 4HQMA 1MMGA 3FBIB 3OR1C 2BVMA 3S3MA 1EI6A 2HS5A 3S2DJ 2H6BA 5B1AH 1REPC 2EINH 1IW7F 3C2BA 4GTCA 1UJ8A 1RR8C 4BXXJ 1RZ4A 1Y1WK 1ZARA 1UB9A 2ZNYA 1SMTA 3FWEA 3BCBA 2F4OB 2MBFA 1HKTA 3IPJA 2FXAA 3ERMA 3MKZA 2Y48A 5FKNA 4ESJA 4ZYAA 1S72I 2HQAA 1P4WA 1ZRCA 3HB9A 1XZQB 2PPBA 3F9KA 4OINF 2YPRA 4CYCB 3I55I 1ZXOA 2JSPA 1IN5A 1X4OA 5D4DA 5J1UA 2V26A 3GTGC 1Z67A 3L2UA 1TWCK 4NHJA 2KP6A 5IOSA 3BQZA 4JBAA 4BS9A 3S3OA 2P7CB 3N4MA 3ZQFA 3ULQB 2XGDA 3K4MA 1U6GA 3Q5FA 4UNOA 4PSXA 2HDCA 5E3OA 2VJ5A 4F3QA 3WU0A 3K4JA 1VQMI 2LNBA 4M6XA 2XF5A 2ID3A 2KISA 3WG9A 4A2UA 2GIZA 3BWGA 2PBIA 4BHBA 2JA8C 2HZDA 5EF6A 5IP7J 1LEAA 3JAMZ 4V2FA 2JA6J 1E0EA 3L2WA 2JVHA 2UUZA 1N78A 3GTQC 5K5RA 1YYVA 3FX3A 3F6OA 5EZGA 4RLQA 5ILUA 3F23A 5C4JK 5IYBC 3VSKA 4HAMA 3SJMA 2L2OA 4G6TB 3S8PA 4CCNA 4BLBA 2CQXA 3HIFA 3VYSB 2JA6A 1MJ9A 4LLGA 3WGGA 3RZOJ 2IVMA 3IC7A 3S1NJ 2VKVA 2PHCB 2A6EA 3DLLF 3Q0WA 3WTXC 1VJEA 1EH6A 5ILVA 1YJNI 3ONQA 4KNYA 2DYRH 5JVOA 2DN0A 1OYIA 2HU9A 4P1WA 3M3YK 5KNLA 1W1WE 3HOUJ 1LE8A 4BJ6C 3BR6A 4HLYA 1SFKA 3NQOA 3V7CA 3ADAC 4A3CC 3HTUA 1YLFA 4MEYA 5CVJA 1BGWA 3EQLA 2QBYB 4ILDA 5K7FA 1KU7A 1BBYA 2ZXWH 4A3LK 1OISA 4KMHA 4CCLA 1V54H 4I6ZA 3HGGA 4A0ZA 1MBHA 4JYKA 4G7OF 3S2DC 3B6AA 3KEQA 3GFJA 4R8HA 5M5WK 4DDQA 3SDGA 4BXXC 2UXXA 2HEOA 3N3YA 2X85A 3PUFA 3LA7A 2XRLA 4Q5SF 2DDAA 2K5CA 4UHTA 3BQYA 2RAEA 3RYPA 1G8XA 1OR7C 5M3FJ 1O3SA 4A0YA 2WY8Q 3LFKA 3BP3A 2L7FP 2R92A 5TJJA 4JX4A 5ERIA 3X2QH 3JRGA 4FX0A 2GSOA 1HLVA 5L46A 1AWCA 2R7RA 5IYCC 4AU7A 4E7IA 2PMZD 4C3HJ 4RB3C 3BOQA 4FE7A 3K4BA 1OQYA 2G7HA 1MJBA 3HOXK 2KPMA 4AYBD 1SD4A 3BG7A 1HXDA 4LK1F 1TWGJ 2LF7A 4I09A 3OYDA 5AONA 4N4OB 2DQLA 4BY1K 1JGSA 3CUOA 4IRIA 5D5WB 2LYCA 1TWFJ 3H0GJ 3KIOA 4CYDA 4I7HA 1R58A 4A3GK 1XCVA 1XTAA 2XDVA 5IP7C 5FFZA 3SEQA 3ABLH 1IS1A 1O2AA 1TWGA 3I4NJ 2XASA 1G3WA 2R5YA 4GYIA 5EEAA 2K4JA 1X31C 1TWFA 5DUKA 3O8GA 4RGUA 2MLKA 3H9GA 5HLTA 3DTEA 2W85A 3RJPA 4CO8A 5E18F 1ONVA 3HHHA 2XV4S 4IF4A 4UY8I 4M72A 5E8IA 3W2AA 3RZOC 3S1NC 2CW0A 5DM6F 2ESHA 2ZCWA 1Q1HA 4KT5C 2EH3A 1R1UA 1WVRA 3SFIA 4M9ZA 2JQ7A 4QWQA 3EUAA 3HOUC 3H3ZA 4XOTA 3Q0UA 2VIXA 1AKHA 4U88A 3K6GA 3OYEA 3FXJA 4H4KC 3CCJI 4KMUX 4WXCA 3TGNA 5IOZA 4S0HB 4KM8A 1B59A 4PJLA 4IL6C 3GTOJ 2IGMA 1VQNI 2N8GA 3ZMDA 3DQVC 3LMMA 1T8IA 1R23A 3OY9A 2ZFZA 2R5ZB 3P9IA 3GTJK 1D1CA 1DGWY 4RA2A 1R9TJ 4U0YA 2CG4A 2Y9ZA 1XZPA 3O2PE 2E2IK 4OIRF 1A5JA 3GTPJ 3HGYA 3TQNA 3K70C 2M7BA 4X1EA 1R5GA 1RC9A 2XAGA 2A68A 1LEBA 5BPDA 2M4KA 3K7AK 2EA2A 2X6XA 4KN7A 1R9TA 2HGCA 2BY3A 1U0JA 4BEHA 4PJNA 1FWZA 4NQWB 4B44A 1V5VA 2NVYK 1P6RA 4C3IK 4O6JA 2F5EA 4E7KA 4C3HC 4BY7K 5CQEA 2GIVA 5M5XJ 4HSRA 3LSPA 3I59A 1WOSA 1LPQA 3N97A 3R0JA 3S16J 1X2NA 3G1OA 3I4PA 4DNCA 4F55A 5ICFA 2ECCA 1F93A 2XCRB 2JA5K 2DFHA 3CCEI 4JX5A 1TWGC 1ZLKA 1LFUP 4ANJA 2ELJA 2GZWA 2MW8A 1TWFC 2FBIA 3H0GC 1ZAOA 2EV6A 3BP8A 3RDIA 5IOYA 2K3PA 1X1CA 4PGGA 2EA4A 2XIGA 1W5CC 2ZNZA 3T8TA 1MDMB 3HOYK 1SMYF 4LG0A 3HTSB 3HOSA 4B8XA 1VQPI 1FTZA 2E36A 4HV5A 1NTCA 2KQRA 2ZKZA 2COMA 1J6XA 3DTKA 3I4NC 4KIBA 3NRVA 3MVPA 4XN3A 3ZQIA 3ELKA 1NK3P 1POGA 3OIPA 1O25A 2ACJA 1WSVA 3FXQA 3VEPA 3KLNA 3G71I 4YG2A 3HEFA 3AFHA 5FB2A 4A6EA 1D0XA 2JA2A 3SZTA 3TDZC 3JCUC 3LSGA 4EJOA 4HNUA 4AVPA 3IKTA 1JGGA 3FM3A 5HLGA 3VYTB 1Y56A 1IXCA 3IRQA 3AL0C 2DMUA 3A02A 2AO9A 2BW3B 2FBKA 2M0CA 4NOIA 2DA7A 5DD8A 5JR3A 2WTEA 3SZYA 3ZQCA 3L7WA 2DA2A 2BY0A 3PIPF 2A05A 4UVAA 3ESWB 4C30A 4A3BJ 3TOBA 1WHUA 1PJ5A 3GFMA 1ZGJA 5E3MA 2CWEA 1J5YA 2QQAA 4JOMA 5AIQA 5E1XA 4A3KK 1M1EB 4HLXA 4U7BA 3GTOC 4IQJA 1WCMA 3LQQA 2WB1N 2L9NA 2GXGA 2ZC2A 3EUHC 3H3VK 4OIOF 4KA4A 3QU6A 1FOKA 1WFXA 2LKXA 3W2VA 2IW5A 3A8JA 3GZ6A 2VOOA 4U0WA 1YG2A 3FK7A 4ZTFA 4MQVA 4QLCU 1TBXA 2K40A 3DBRB 1VGXA 5IP9K 3GTPC 5C44K 5GAHJ 1MJAA 1WJ5A 1T95A 3LA2A 3PSFA 2D5VA 1F7VA 3QWLA 4FASD 3W6KB 2OTJI 2E35A 3K4NA 3P7NA 3VSLA 1T39A 2DOFA 2VUMJ 2RKHA 1I27A 1TTYA 2E1MC 4MEXF 3F8NA 3LSIA 3RQ4A 1BR2A 5E20A 4RBOA 1IF1A 3CD6I 3AH5A 5ICGA 1I1SA 3S16C 1K83C 3UNGC 2JZYA 5J6XA 3JRAA 1Y1WJ 2BGCA 3BG3A 4L5JA 2KRFA 5HS9A 2XHKA 3QQAA 1IN4A 1TNTA 3KP4A 1O3TA 4KITB 2MH9A 1Y6IA 4KICA 4XKBA 4V19K 4EJUA 1U9OA 1O7FA 1XSDA 2QEXI 1ZYRF 4CCOA 1FBSA 2DA1A 1MMSA 4RM3A 2XRNA 1WQHA 2PFBA 1TQPA 4OAZA 3CCSI 3RI4A 1TWCJ 1KA8A 2FMLA 2HVSA 2RDPA 4B43A 3S2WA 2XC7A 3I71A 4KB2A 3MKWB 5BOXA 3GX4X 3HOWK 3HKZL 4YIRX 1B6AA 2GAUA 2ZSIB 3BTCA 3EETA 4I98B 5DCMA 3ROUA 3J7ZI 1TWCA 2LOOA 2J5PA 3JRCA 1ZREA 4QIWN 4WWCA 5HL8A 4P5OA 3Q0VA 2L9VA 4DIQA 1I3QC 4BHPA 5LEJA 1Y1VK 2R7TA 1HKQA 4IKFA 2R93K 1MMDA 1Y0UA 3FXLA 3P9KA 3QYFA 3GZNB 4KJZA 4OIPF 4A3BC 3CQZA 4JK1A 2QWWA 4AD9A 4FCYA 4M73A 4L18B 3OIOA 1TWHC 2TCTA 2KL4A 5C4JJ 2ELHA 2NNNA 1JI8A 1Z0XA 4Y52K 2K9QA 4S04A 3CC2I 2ELKA 3CUQB 3T0YA 2LTPA 2XAUA 2R92K 1XSVA 1H9GA 1OJLA 2KJBA 3LAPA 2OTLI 2CH0A 1PUFB 1W7PD 3GF2A 1AU7A 2FF4A 2PMHA 3C7JA 3M8JA 3E1SA 1VLOA 3H9QA 4BE1A 4Y15A 3CCYA 2QENA 4JX6A 1VZ0A 2YX7A 2VQLA 3RKXA 3M3YJ 3K4CA 1FJLA 1R1VA 3GFLA 3TFIA 4KM9A 5JVTA 1B72B 3U1KA 1X1DA 3SEZA 5LHIA 2Q2EA 2NOGA 2LVSA 4RAZA 4B3AA 2K9MA 3OYIA 4A3LJ 3ZN1A 4BBRK 2HYFA 2VUMC 1YX5A 1UMQA 2YS9A 4U7DA 1MNEA 2D2WA 5F27A 2LREA 5HOOA 1V4RA 2QUFA 2RNGA 2QVOA 5M5WJ 4CCMA 3GIRA 2BBYA 1Y1WC 2E60A 3EYYA 2V9VA 4PDKA 1JTYA 3CDLA 1XB4A 4I02A 2VLAA 2ZXIA 2NOJB 4E4HA 2OAZA 2MGQA 3FXMA 5FLVA 3DKYA 1XX5A 1WORA 4BQAA 5EGEA 3K69A 3ZQGA 2HVRA 3K4KA 3U21A 3IH4A 3LSTA 1UG0A 1OCTC 4RB1A 1FYKA 1W7PB 2ZJQF 1TWCC 3A8KA 2P6SA 3R60A 1SFOA 4PZJA 5D4SA 4XQFA 4BJ5C 4BQNA 1F36A 2G0EA 1C0WA 2A6TA 1BW5A 4XSXF 2R3SA 2CUJA 2XROA 1YJ9I 3HUGB 4OOIA 4IOCF 4BY1J 1FSHA 2E2JK 3IH3A 2GWRA 1UELB 2G9WA 1WZ2A 2Y9YA 2VJ4A 1G4DA 1QZYA 2IA2A 3PJRA 4AIHA 3H35A 1MBGA 4M6VA 4XOPA 4YFNF 3CCUI 3S17K 4IRHA 2ZXHA 1PVEA 2MG4A 5TGTA 1XMAA 2MA3A 4E6KG 1P7JA 1X1AA 2CO5A 3L2QA 5D5XB 2JTVA 4BE2A 1AB4A 2F5FA 2WWYA 5C4JC 2MD5A 5L3FA 1HW1A 2LFBA 2ME6A 2XPWA 1Y0NA 4UUSB 4AYBA 2L9SA 2FQTA 3OS2A 1WI9A 4KIFA 2VOPA 5JI6A 3LSKA 5D5VB 2KDOA 5J4VA 1HOMA 4KMFA 1BOAA 2V1DA 5KCMA 3OREA 1J7KA 3JRHA 4M3GA 1NK2P 3J80K 1LUJB 2MC4A 1QZEA 3OL4A 4DJAA 3Q3QA 2KRHA 4YFKF 4P5BA 3F21A 2CW7A 2HPIA 3SFZA 3BZCA 4FE4A 2FX0A 2P8TA 3AD8C 2L7ZA 3K1PA 2EIMH 2R7FA 2WV1A 5D8KB 4LLLA 2PJRB 1WOPA 1IZ1A 1RI7A 1OCCH 2CFAA 3HPHA 5M5XK 1FLIA 1D0ZA 4A3LC 5HLHA 1S29A 3C2GA 4GRIA 1G2HA 2NVTC 2H8RA 3ML6A 5H6QA 2XCQA 3AL0B 3OEPA 3K0LA 5IPAA 3GUDA 4EMSA 3OSGA 3CDHA 1SFUA 3OYKA 3J81K 3GTJJ 1SAUA 2JT1A 1U8BA 2OPTA 1U9NA 2YU9C 1IAWA 3QPTA 3MCZA 3M1CA 2JSCA 4LJZA 2EQRA 4ITVA 2E2IJ 2IS2A 4L9NA 3FHZA 5DUIA 2DT7B 1AHDP 3BR1A 2WADA 2FOWA 1KYZA 1IDYA 1MH4A 2COBA 2WY7Q 3QPLA 4N9IA 4R79A 3K7AJ 3GFIA 5JVGF 3GTJA 3I4MK 2JN6A 3QYEA 2PMZN 4ASNA 4C3IJ 2NVYJ 2CV2A 4BY7J 1R22A 1BI0A 4NC7A 4G7HA 2GOXB 1F7UA 2GA1A 3HOXC 1R00A 5CJ9A 2JRTA 4KUMA 4N9HA 2JA5J 2CRGA 4QTRA 2KHMA 4HZFA 3WTVC 4Y4RA 2NVYA 2IPQX 3L4JA 1B9MA 1P2FA 3CLOA 4IEJA 5KAIC 4BY1C 2EV5A 5FGMA 2B9SA 5KAFC 1WCMK 2K27A 4NBQA 2W1OA 4LMYA 4X6AK 3QPSA 4A3GC 2Z16A 1K78A 2EZLA 3B6CA 3HOYJ 4MTEA 4D0PA 1IRZA 1XD7A 4OIQF 3L9FA 2VODA 3HOZK 1K61A 3DFGA 2E1MB 5FO5A 1XPXA 4BJTA 2PQ8A 4XLFA 3ZMZA 4AIDA 1D5YA 2A69A 3ERED 1SVOA 3C3WA 2OU2A 1T08B 4BDZA 4E7ZA 3CMEI 2O61A 2ZFUA 2AXLA 3K1NA 2GAGC 3BG5A 2CS3A 3KE2A 2O8KA 5TJ3A 2F5DA 3GO5A 5BPIA 4XKVA 4BXUA 1XDSA 2VJJA 2OCEA 2LDUA 2VKDA 2QSFX 4PJ0C 1P7IA 2UXNA 1EFWA 2HKOA 1RR7A 4GTBA 2V9KA 1IL2A 2DCEA 1VQKI 4IJAA 3JSPA 3ZCOA 3IHUA 2W00A 4S05A 5F64A 4XLNF 5FROA 3QRFF 2H1KA 1B1BA 2DA3A 3DKWA 1Y39A 5LRRA 4RGSA 3RCOA 5GPCA 3HXAA 2EBBA 3HSFA 4A3KJ 3TBIA 2LBFB 5DM7F 5B1BH 4IVNA 1F1ZA 5LD2C 5F1JA 4O3MA 4XSZF 1L0OC 1VQ9I 4CCKA 4HEA2 3ZGKA 3GTJC 5DDGA 5L3CA 3LSRA 2HDWA 2W48A 2Z2SB 3O3KA 3HOTA 4AVZA 1V5GA 4EGYA 5DS9A 2E2IC 1FOWA 3OYGA 5IP9J 3OYMA 5C44J 5CYVA 4XCHA 1OCRH 4Y17A 4KDPA 1S7AA 3E5XA 4W1UA 3GTKJ 2O8XA 1CQTA 2HR3A 3K7AC 2Q1ZB 2ZJ2A 1SFXA 4D5FA 3ZQLA 3ZRGA 1Z05A 4LB5A 3QU3A 2PJPA 5IT9Z 3A0HC 2ZMEA 3C1DA 4BY7C 4KYWA 3BJ6A 3E5UA 1TL8A 1V5FA 3GTKA 2KT0A 4YFXF 3IWFA 2P81A 3J7AO 4C3JK 1L3LA 5DV5A 1ITYA 1YRNB 2JA5C 3CQZK 3BCAA 2BZTA 1TWAA 1W0TA 2K7LA 4KB4A 2QLZA 4HNVA 2CUEA 2DPDA 1BW6A 2FNPA 3M8FA 1RU0A 3CZ6A 3HBLA 1ZHFA 2GXBA 3K2ZA 3M8EA 2IJLA 3HOYC 1BI3A 2NNYA 4HDVA 4L0YB 4A3JK 2QKMB 1E3HA 1EH7A 1F9NA 4KMDA 3V7SA 4D7NA 4A5NA 1GLNA 1O2FB 3BTIA 2HOTA 4GO1A 2AHQA 4BLAA 4Z6YA 4F93B 4EEFG 1O2BA 1F4KA 1KU2A 1R5HA 2Y69H 3MKYB 1HW2A 1R7JA 3E6MA 5CVUA 1FX7A 3ABMH 2HVQA 4C9YA 4D1QA 2Y0SL 5LEKA 3I9V2 3WU1B 1J6VA 4RM2A 1MGTA 3HOWJ 3HZJA 1HSJA 1JJ6C 2F2EA 2K3FA 4IPAA 1WH5A 3QP5A 2WAQA 4MHGA 1J6WA 3GEIA 2O5IA 4G8XA 1YW7A 2R7ZA 2F48A 3CUQA 4GDFA 1JHFA 3NWTA 1Y1VJ 5AIPA 4ZZDA 3NARA 1ZG5A 1PUFA 1K4TA 2R93J 1TNSA 3CCQI 2IS6A 1BJTA 3QPHA 1JOEA 4GTEA 1IO2A 4O5VA 4B4CA 4YELA 2E1CA 2GA2A 4EM2A 2FQOA 4CSWA 2P0WA 5BQTA 1Y1VA 1OCPA 4A3KC 4FM9A 4L9JA 4Y52J 2P5KA 2W24A 4XMYA 2X1CA 3RPUD 1YHQI 3M4OK 2R93A 1QU3A 1P4AA 3SZPA 4ZYEA 2R92J 5CVRA 2DMQA 5CVIA 3PFIA 3DP7A 4EJWA 3SDBA 4ENNA 2HQNA 3PNTA 5K7HA 5FKOA 3BZKA 3V8KA 1SFOK 1HW5A 4M9XA 2X48A 3WGHA 2HDDA 1F43A 3FKIK 3EUKL 4R1HA 5C44C 4KMUA 2DMTA 3SYTA 1A31A 1EH1A 4HF0A 2XCOA 3E6DA 5LLQA 1IE0A 1O57A 2FEZA 1X19A 3J7AY 1USMA 2O7OA 2VKEA 5FFXA 4BBRJ 2AQFA 3KFWX 2H27A 2VPLA 5H20A 4NUBA 2F6CA 1HI9A 3IP4B 2A6HF 3W6JB 2FU4A 5M3MJ 4E7LA 1UHSA 2MABA 1YS7A 2DQRA 1VQ6I 2XVCA 3HJEA 2VE8A 2K4BA 2M9HA 3TFJA 2Z99A 3M7GA 2VT2A 2BYVE 4UB8C 5A2QK 2ZUFA 1VQOI 4ENJA 1ZVUA 4QJVA 5C4XK 2KZGA 3HM5A 5HS7A 1MMNA 3CAGA 3FF5A 2JA6C 1ZQ3P 1GUUA 3ZP5A 1LQ1A 2TRTA 4EM0B 4LR2A 2X6OA 3BR2A 3BR5A 3SXYA 1OLTA 3PQKA 3GTLJ 2IS4A 5EGOB 2BXZA 3BPXA 4NB5A 2GSUA 1K7AA 1VH2A 4A3FK 4A3IK 1XSXA 3KP2A 2M8GX 2BOLA 1PP8F 1SD5A 2V6TA 2VBYA 3SHFA 4E7JA 4WXDA 3VOEA 1I39A 2L9RA 2RH6A 4KARA 3GTLA 1FY7A 2CFOA 3PUBA 1K79A 3ECHA 3F0CA 3MZYA 3PL8A 3OYJA 4IHWA 2B63K 3HOWC 4HX7A 4XK4A 2BV6A 1BI1A 1IN7A 1G51A 1R6RA 2E2JJ 3MEXA 3LA3A 1FYLA 3VB2A 4ZYGA 1Y1VC 3PNYA 1FMWA 3QP6A 3KYCB 3T1BA 3IV5A 3E0JB 3B73A 3TMOA 4HF1A 2EPFA 3IH2A 3OR2C 3AQPA 3S17J 2BHZA 5IORA 1G3YA 2OV7A 3KZZA 3H3VL 3ZMSA 4IRGA 4I76A 3W3CA 3FBNB 4J01A 4LK0F 3J80Z 4Y52C 4KISA 4Y7NK 3KCCA 2R92C 5HS8A 2O9LA 4Q48A 2I8DA 2ADUA 3CMYA 5GPAA 4IX7A 3I56I 2H94A 3TTGA 3R0AA 1PP7U 2FNAA 2FRHA 5HLIA 2OUMA 4M74A 3DXJA 4M3EA 3N05A 1APLC 4BBSK 2K9LA 1K6OA 2CMPA 1QPIA 2DYSH 3A01B 1DU0A 4A3EK 4ZDPA 2IXSA 5M5YK 1TQIA 2D1VA 4MQ9A 1MNMC 5FLXK 2MLGA 2Y31A 4BBRC 1ZG3A 2LC2A 4QPQA 2Z33A 4BKXA 2WB1A 4LGWA 1DPUA 2LKPA 1YW8A 2FJ1A 4UV9A 1ACIA 1CGPA 5ED4A 3CCRI 4LQYA 4BAYA 3LFUA 1PJ7A 1QHHD 3IAM2 3IL2A 3S15K 2EWNA 1O26A 1FNNA 1WSUA 1B8IA 4G0WA 3CCVI 4L5EA 2XF6A 4MGRA 3COAC 3GTGK 3WG7H 3KP7A 3F3XA 2QSHX 1YIJI 2WAQL 1WQFA 3RYRA 3I4MJ 1RESA 3D1NI 3HHGA 5D8LB 1IRXA 5GTIC 1D8JA 1QO0D 2DJIA 3GLXA 4M3DA 1VQ4I 3FM5A 4V2GA 3L1PA 5FRMA 2PLYA 1ZGAA 3CMAI 1WJFA 4LIVA 4A93K 3D5RC 2HNHA 5IOTA 3F8FA 2E19A 3KZYA 1Z7UA 2CV0A 1FMVA 2M45A 3NEUA 3E7LA 1ZELA 1YFHA 2M2EA 2E2JC 4XLAA 1WCMJ 1USSA 2JA7A 4X6AJ 1U5TA 4NDLA 1R49A 2DU9A 2V4JC 3HKZN 1JUSA 1I50J 1LDJA 4YIIA 3HOZJ 1I6HJ 1UZCA 1VF9A 2VQHA 2FUG2 4C2UA 3S17C 4C45A 3K4LA 2YR2A 4XLEA 4ZYDA 4Q4ZA 1QBJA 2LY1A 1MMAA 2DW4A 2X51A 3CJRB 1ETWA 2PA8L 2BE5A 1FIPA 1I50A 1TW2A 3A03A 3ASNH 3GW2A 2LLKA 2QCOA 1IXRC 3OWTA 1R9TC 3H3VD 5TMFA 4TV7A 2P5MA 4HQEA 1S5LC 3GZ5A 3RIRA 2VXDA 4HV6A 1S7EA 3QAHA 3GTKK 4JQFA 1ZN2A 1MBFA 2IGNA 3IWZA 4ZZLA 1YI2I 5E8GA 1WIHA 2MFZA 1YW9A 2VASA 1TWAK 1IDZA 1C0AA 3OYCA 4RLFA 2L01A 3G1MA 1T98A 1ETOA 3DBLB 5JHFA 2IBDA 3TW6A 1SAXA 3BP8C 1Z7LA 4ENMA 3OMYA 4RB0A 4XBFA 1XZQA 3N0CA 4HBLA 4A5MA 2PN6A 5J40A 4CYCA 3GTMJ 2VJIA 4XLPA 2MC3A 3GCMA 3BTLA 4LLGF 3WE2A 4P9SA 1YIOA 4HX4A 1FSEA 1TZLA 1W4MA 1W0UA 1JJ8C 3FISA 2A6EF 1EQRA 5IYCK 4ZH4F 4J3NA 2AXTC 2CUFA 1YNNA 3GTMA 1OPCA 2W84A 1STZA 2F4IA 4G7ZA 3PO3K 3I4MC 5D6FA 4M9SA 4MEYF 4GCVA 1RUOA 2IT0A 2L7KA 2M87A 2O5JA 2KFDA 1LB2A 2R7ZK 1ZH5A 2EBIA 1TLHB 2HOEA 2WC2A 2X1EA 3OYAA 1N77A 1PJ6A 2JMWA 5J47A 3AD7C 5CHPA 3ZQHA 4IHTA 1QVUA 3U1DA 4UVBA 1F5TA 4C3JJ 4DYRA 2Y3PA 4G0VA 4XLHA 2CQQA 3CQZJ 5HDKA 4I0BA 4MFDA 3FMQA 4ENKA 3ZN0A 2RQPA 1WCMC 1JKPC 1JUPA 1IGNA 1IW7A 3JAMK 4X6AC 4Y13A 4A3JJ 1ETQA 3HOZC 3QODA 1XGNA 4ETSA 2GSNA 1T56A 2E71A 5F1RA 2KKOA 4OWRB 1MBKA 5EZHA 3TOAA 5IYDK 2F5VA 2ZJRF 3CDIA 1TT0A 3CCLI 1WJCA 1MBEA 2QBYA 1T0FA 3TO7A 4PFOA 1FOXA 4OINA 3WE3A 2PEXA 4B48A 3GEHA 3E5QA 2WB1L 2ECBA 2KMUA 5FLMK 4II3A 3PO2K 3K70D 2PA8D 1IN6A 3S1QK 4AIKA 1X3ZB 3LAJA 1QGPA 1ODDA 2GLOA 1U8RA 2X6YA 2FOKA 2V6CA 4DZPA 1OYYA 3OYLA 3GSIA 2Z3YA 2ME0A 2E2HA 3GLLA 2KIUA 4KASA 3TDUC 4KN4X 2X1DA 1GE9A 4MTDA 2CUZA 5M3MK 1ZG1A 5GAEJ 2VBXA 3M4OJ 2D6FC 2X4HA 3QX3A 4CZZA 1LDKB 2IP2A 1UV7A 2EFQA 2CW0F 5CPRB 2DO7A 2VB6A 3KX2A 1S3JA 2KZVA 3LPXA 4YIFA 3REOA 4U0VA 2DFFA 1SFOJ 3FKIJ 4XIDA 2XAQA 4CHUA 3CO7C 1GVDA 2BY1A 3HRSA 5HDGA 3PQJA 1UHWA 2M34A 3MN2A 3GTLK 1X3UA 3LL7A 2RV8A 4P5AA 3ECOA 3WGIA 1K6YA 3P9CA 2ZB9A 1BR1A 5F0HA 4BL0B 1ERDA 3OOPA 3MZ8A 1BJZA 2O0YA 3FKIA 5A2QZ 4W97A 5LGUA 4KT6A 2KDZA 4JP0A 3WHCA 2P6TA 4WCGA 1P92A 2EZHA 1J2XA 2KIMA 1SEUA 2RQQA 3CQZC 5J8CA 2C6YA 1I6VA 1KYWA 2XPUA 4IO9F 5BMZA 1Y8QB 3K1MA 1R36A 4IHXA 5LHGA 1SANA 1G3TA 2STWA 5C4XJ 1GVJA 4G7OA 3QOPA 3R61A 3GWZA 3QYBA 3HKZD 1EKEA 4A3JC 2A68F 4EGZA 3IKVA 1LFPA 3NUHA 2PMZA 2UWMA 1BC7C 4Q5SA 2E5NA 2NVXA 1DCOA 9ANTA 2A5YB 3BJOA 4M71A 4A3FJ 2ISYA 4A3IJ 1DD5A 1Z21A 5J1RA 3IRRA 2R5YB 4ABZA 4GTLA 1IUFA 2XPVA 5LBQA 2CGPA 3KEOA 1XXAA 5GTHC 2B63J 4YFNA 4M1XA 3LSJA 2E5ZA 5HVQC 1YX3A 3CF5F 1MSFC 3L4KA 3M3YC 4D5CA 4GXOA 2R5ZA 3FMRA 1O28A 4LITA 4O2DA 1PYVA 3L00A 4I0AA 2A6HA 4G6QA 3HDDA 3RKWA 4LFUA 4LK1A 3FK6A 3GMEA 5LGNA 2CU7A 5JFRA 2VQCA 2B63A 1AKHB 4GZYA 4II2A 3U2RA 1JT0A 1ETXA 2D45A 1Z1DA 1R1TA 5D5UB 1AOYA 3DPTA 1X1PA 5TMCA 1XMKA 4YEJA 4OU0A 1XC5A 2DPUA 2JUGA 4NQWA 5DEQA 2E7XA 4Y7NJ 1A6QA 1MZBA 1BOBA 2Y2ZA 3KZIC 4YG2F 3JSTA 2DFIA 4RAFA 2V7FA 5L3DA 1LJ9A 4N0BA 1HA8A 1SFOC 1FT9A 3AAFA 3BG9A 5FLXZ 4EJTA 1IXSB 2QYOA 4BBSJ 1XZPB 3ZQQA 1JTXA 2L54A 4KMAA 3H92A 5J8FA 3E6CC 3UR3C 3GYHX 1K83K 2OZUA 1KQ4A 3RZDK 1VQ7I 2W25A 4A3EJ 2KRCA 4A12A 1BM9A 2ZFWA 5M5YJ 1GXQA 3G73A 1MDMA 4BEHB 1LDDA 2XGXA 4EVIA 1BJAA 2WAEA 2JA7K 3S2HK 4CCJA 4M6YA 4XKCA 2HOSA 2ICWG 3I3LA 3Q3SA 1QPMA 4A3DK 2Z5UA 2GOMA 1H88C 3HRTA 1ZRDA 4RGXA 1IG7A 2L02A 1BR4A 4F52A 1YTYA 3S15J 4CXFA 5KHDA 3GTGJ 4A3MK 5C4XC 3F6VA 5CVVA 5TRDA 1QQIA 1I50K 4DW6A 2P5VA 1S8NA 4EM1A 4GTAA 2R7QA 3L2RA 1I6HK 4B1RA 2ZBKA 2BW3A 4I2OA 5E68A 4IOAF 3V4GA 3CCMI 2KWAA 4LG0B 4WX9A 1VI0A 4OIRA 2CQ7A 1VQ5I 3GTGA 3E6BA 2CW8A 4A3IC 3I54A 1MIJA 1A35A 2IRFG 3CC4I 2OJED 3TO9A 4AH6A 2LD5A 1I3QK 5E3LA 2O03A 5ICCA 4EATA 1EK8A 1DP3A 4A93J 5F0CA 3HYIA 3VYUB 5B66C 3JREA 2RVCA 4RS8A 4KIGA 4ESFA 1Z3XA 2DJNA 5K5OA 1WJEA 1H0MA 2VL8A 2ZJPF 2Y0SN 2CFXA 1JKOC 2A61A 4HW0A 3SQNA 2NS0A 2DT6A 1FP2A 1G3SA 3BZ6A 2EZIA 3CJQB 4G94A 1Z6RA 4P9UA 3GTQA 2RGVA 3HRUA 1O27A 1EA3A 5H2FC 4BE0A 1JXSA 1FBQA 1LKXA 1HSTA 2H6CA 2VC1A 3GTMK 1FP1D 2RN7A 2E1NA 2VKHA 2H1LA 1U3EM 2R7UA 3ZXSA 1SMYA 3AQOA 3S14K 2E1OA 2YX4A 1HDDC 3JW4A 4Y7NC 5LFAA 4BKWA 1EF4A 3H5NA 3T5XA 4OAYA 1Z3YA 3FXKA 3F8BA 4A69C 2JWTA 4MFEA 2H8WA 3G1LA 4ESBA 3RKQA 3GEEA 2FD5A 5JHUA 5BNGA 4BBSC 3WHBA 4HDUA 1KONA 2KLOA 4BHCA 3Q9VA 3PFYA 1ETKA 4PK4A 1UFMA 1TWAJ 3AKZA 2NVYC 4C3IC 4A3EC 3CO6C 3EPZA 4BH9A 2NVUB 1X1BA 5HNHA 1IN8A 3BROA 1RUNA 2FSWA 2V9PA 4M3BA 3ZMTA 2I10A 2K86A 2PMZL 3S0XA 3ABUA 1J59A 1SFEA 2JPCA 1U2WA 4PABA 1JHHA 2DLLA 5FD6A 2OBPA 3D5LA 4AYBL 2PI0A 3DPUA 3LWFA 4XRFA 5JLWA 3S15C 5IYCJ 5C3EK 4A6DA 3FXOA 3JTHA 1RRJA 3F8CA 4P55A 1OR7A 4KAWX 1ZQ1C 4OIOA 4RDUA 2DA6A 4ZTJA 3CJTB 1KU3A 3A1YA 4XONA 3ZQ7A 2P5LC 4QPOA 3PO3J 3NWSA 1I6XA 3FHNA 1QRYA 1XG1A 1NG6A 2RC4A 4IZZA 1IUYA 3T01A 2R7ZJ 3WTZA 4XRMA 4AIJA 2PG4A 1W5TA 3WODF 2R7XA 2OA4A 5B3SH 2L5QA 2BY2A 1XGOA 3SZGA 4A93C 2E2HK 2LH9A 1BIAA 2JRMA 3BG6A 1VQ8I 3S1RK 2DFEA 4M3FA 3LOCA 4L5IA 2AS5F 4MEXA 2NVQK 1E17A 4CICA 1L0WA 4ZDLA 5DCMB 2ZO4A 4FETA 3OYHA 5LHHA 3CF2A 4XKWA 5EDNA 4RMNA 2W7NA 4K2EA 1T33A 2M0MA 2P4WA 1YQAA 3PIOF 1KQ8A 1WJDA 4ZH4A 3BDDA 3OYBA 1AA7A 2YU3A 4MO7A 1B72A 3MFKA 2EIKH 2EK5A 2JVGA 2DBBA 5IYDJ 4GGGA 3N0BA 1ZYRA 2V79A 1IQ0A 1IJWC 2Y0MA 5L3EA 5EEHA 1G59A 1ZBSA 2M7AA 2UV1A 3AD9C 4LOWA 3S3NA 4AM3A 3HSEA 1BA5A 2ZMEC 5E1WA 2RNJA 1YS6A 5EG0B 3DV8A 5FKMA 3VDXA 5FLMJ 5IP9C 1OMIA 4J00A 3PO2J 1WQ2A 2XF7A 4QSHA 3S1QJ 3GTKC 2XKPA 3H36A 4N4NB 1NHAA 4F7ZA 3DEUA 4IHYA 1TC3C 3GDZA 2NXNB 1FEXA 2R7SA 2NVTK 2DK8A 3ZR8X 2HQRA 1FYMA 1TWAC 5IOQA 2XAHA 2YU9K 2K9NA 4PCQA 3HOVK 4F92B 2DAOA 2Q2EB 3DBHB 1TP4A 4U87A 3KEYA 2TDXA 2XGEA 2BHYA 4DOZA 3LQRA 1K4SA 2M4GA 3V42A 1W7PA 2DK5A 3JRFA 3VFZA 1DP7P 4OIPA 2ETHA 3JRDA 1ENHA 3CP8A 1KQ9A 2FQ3A 3IAS2 2NVXK 4J19A 2GM4A 2IAIA 4L9VA 4C2MK 2KJCA 1XXBA 4BDYA 3RKYA 1FBUA 2EFWA 3ABKH 2CSOA 5F0FA 1EJ9A 2JK3A 5FD5A 3HUGA 3PO3C 3DLAA 3Q9SA 2OF7A 1LVKA 2FE3A 3MD2A 2LK2A 1QVTA 1HC8A 2MYSA 1KQ0A 3GXOA 2R7ZC 4FQGA 4A0XA 1W5SA 2WAQN 3CUQC 3I5UA 1VTNC 4CUGA 1A6IA 2DTRA 3KETA 3JRIA 3S1MK 3FZVA 4L9TA 1X4PA 2EIJH 5E3NA 1WH7A 3JR9A 4WILA 2Z1DA 1J09A 3I53A 4FHTA 4F91B 1B9NA 4D9JA 2QF7A 5FKKA 3EDPA 5DYMA 3VA7A 2HTSA 4MLOA 4UUSA 4XICA 1MSEC 4LJZF 3H0GA 2Y0SD 1DUXC 5E17F 1RNLA 3AG3H 2CV1A 4UUVA 1T38A 2R93C 1WJAA 4FZBA 2OQGA 1ZKGA 4AC0A 3JSOA 4BACA 1RPWA 3HPGA 5L3GA 1ZRFA 3MQ0A 5HDNA 4BUPA 3DKXA 1O7LA 4B3XA 3W6VA 1OKRA 5IYDC 1WI3A 2HPMA 3FXUA 4HOBA 3HXLA 3OIQA 4XRSG 4G7HF 2PJRA 2ZUEA 2V1UA 1YITI 1YJWI 2W82A 3D5SC 5DCFA 3PNVA 3OSFA 4Y3OA 5EJCA 4NC6A 4YRVA 4WJ3M 3U9GA 1KZHA 3V8LA 1N25A 1SC7A 5H6RA 5KK1A 5CLSA 3CC7I 2QZ8A 1X3WB 3FMSA 5FLMC 5CQGA 3DPLC 2HYJA 4E70A 3PO2C 3H5AA 3S1QC 1ZLJA 2IS1A 3WTSC 3HKZA 2M8EA 4AWXB 1MBJA 3F22A 1H8AC 4XSXA 2VT3A 3TL4X 2ESNA 3J81Z 2BXYA 1XXCA 1LFBA 2A69F 2WAFA 3JTGA 4HF2A 2GAHC 3JRBA 1CF7A 3HG9A 2CFAB 2XSJC 1WKMA 3GTOA 2LRDA 2H09A 2DOAA 3EUHA 4OMZA 2LY2A 4MNUA
chains in the Genus database with same CATH topology
2EFPA 2HWVA 3WTWC 2VBZA 5ICEA 2QM3A 1KU9A 3GTPA 2HZTA 3F72A 1SD6A 4WF2A 1PUEE 4KFCA 1YO5C 1XGSA 1XCBA 1HKSA 3GVAA 2VE9A 1O3QA 4Q47A 1J75A 3BJAA 3ZPLA 4GYGA 2A07F 1K83A 3FXRA 2XAFA 3R4KA 1RIOH 3KP5A 3MAJA 1KGSA 3KLOA 3VODA 1WRJA 3WTUC 1T2KA 5DD4A 1K78B 2O3FA 1DDNA 1BN5A 1BIBA 3RTRA 2VONA 4H0EA 4RB2C 1MKMA 2LSOA 2R7DA 4KC6A 1H9TA 1DPRA 1O29A 4KN7X 1WWXA 3V8JA 3MZHA 1I3QA 3ZMVA 2L3DA 2FMYA 4CDGA 1UHMA 5KVRA 3F8MA 3R6SA 4DQ2A 1T6SA 2Q8KA 1BI2A 2M1BA 3HSRA 4L0ZB 2BEOA 1TWHA 1FZPB 2EFNA 1D8KA 3C18A 3GEZA 4B09A 4LD5A 2HKXA 5IT3A 4G0UA 3FOFA 2HYGD 4GFQA 2IA0A 2NAZA 4BYYA 1S6LA 1I1GA 3EQLF 2MH2A 5IT9K 3E97A 3MMLB 3I0TA 3HRMA 5E1ZB 2VUMA 4EJVA 4KATA 2LF8A 3DF8A 2L4AA 2ZMEB 1XDUA 1U5TC 4ON0A 3I58A 3E3VA 4CGZA 2W57A 3KP3A 1Y1WA 1XN7A 3G3ZA 4G9YA 4PGHA 1P4XA 4EQQA 1O24A 3CTAA 3FOEA 1S7OA 4UV8A 3H3UA 5F6FA 2VXZA 2J5OA 4GTFA 1ON2A 1HQCA 2K02A 1G6NA 1IRFA 1GXPA 4IHSA 1XGMA 4OMYA 3KP6A 3WTYC 4P9FA 1LNWA 4BNCA 2QQBA 1E2XA 1OYWA 2P7VB 3B02A 4G6DA 1D5VA 2VBWA 4UVCA 1HBXG 5LGTA 3WTTC 5JFEA 2B0LA 4UXNA 2F5CA 4WXHA 3T8RA 1IRGA 3BUEA 1QNTA 2YSRA 3OV8A 4ZYHA 3CJNA 2V1XA 4HX8A 2FA5A 4EV0A 3G4CA 4LLNA 2ZXJA 5LRSA 1TQMA 3RPUA 5EEGA 4C3JC 1PDNC 3G4AA 1USTA 3ISPA 2E7WA 2YU9A 3M9AA 6PAXA 2OD5A 2EB7A 3I64A 2ISZA 4JK1X 2GQQA 3DXJF 2HFHA 2FBHA 1UCRA 1BC8C 2EJRA 2DI3A 1EH8A 3EYIA 4MQ9F 1Z91A 2OQRA 2VC0A 3RPQA 1GHCA 1Z6TA 4KDDA 4FX4A 2Z9OA 2O6GE 1D3YA 2VN2A 4LB6B 2IA1A 3V7RA 3MWMA 2XKOA 1A04A 4IXAA 1J0RA 1I5ZA 3TO6A 2M5WA 3ZMUA 4GTDA 4HA8A 3L2CA 4P96A 5D6EA 4I01A 4Z2YA 4RAYA 5ILSA 2EFOA 3BPVA 2OZ6A 3TKYA 5EGHA 1QZZA 4Q4ZF 1U78A 1WQGA 2NRAC 3I59B 2BE5F 1TW3A 1LVAA 2PMUA 1JE8A 2XUBA 5K5QA 4C2MC 2E2IA 4WK8F 3OPFA 2QQ9A 4GT9A 1B4BA 2CYYA 1J9IA 4RGRA 2XAJA 2HTJA 2M30A 2X0LA 1SD7A 2WV0A 1V3FA 1ON1A 1ISEA 4XLPF 2G7UA 2L4MA 2JA5A 2JH3A 1FPQA 3BY6A 1FC3A 4HYEA 1O3RA 2STTA 2D1HA 3ABTA 1Z9CA 3M1EA 3D0SA 1ULYA 1MD0A 2EV0A 5BS6A 2Q0OA 5K1YA 3L09A 2Y75A 4G7ZF 1U5TB 5L3BA 5D4RA 4FT8A 2RGRA 2DT5A 3K9TA 1EV7A 2UZKA 2A3SA 2NYXA 2JPBA 1B4AA 4HQMA 2KIFA 2CQKA 3VFZA 3O6BB 2HS5A 2H6BA 1REPC 1IW7F 4GTCA 1RZ4A 1ZARA 1UB9A 2ZNYA 1SMTA 3FWEA 2MBFA 1HKTA 2FXAA 2Y48A 4ESJA 1P4WA 1ZRCA 4OINF 2YPRA 1ZXOA 1IN5A 4NHJA 5IOSA 4JBAA 2P7CB 3N4MA 3ULQB 3Q5FA 1U6GA 4UNOA 2HDCA 3WU0A 2LNBA 4M6XA 3WG9A 4A2UA 3BWGA 4BHBA 2PBIA 1LEAA 3JAMZ 5K5RA 1YYVA 3FX3A 3F6OA 5ILUA 3F23A 4HAMA 4BLBA 2JA6A 3HIFA 1MJ9A 3WGGA 2IVMA 3IC7A 2PHCB 3WTXC 1EH6A 5ILVA 4KNYA 5JVOA 1OYIA 4HLYA 3NQOA 3V7CA 3HTUA 1YLFA 5CVJA 2QBYB 4ILDA 1KU7A 1BBYA 4KMHA 4A0ZA 4G7OF 3KEQA 4R8HA 3GFJA 4DDQA 2UXXA 2HEOA 3N3YA 3LA7A 4Q5SF 4UHTA 3RYPA 1O3SA 4A0YA 3LFKA 2R92A 5TJJA 5ERIA 4FX0A 2GSOA 1AWCA 4RB3C 3BOQA 2G7HA 1MJBA 1SD4A 4LK1F 1HXDA 2LF7A 4I09A 5AONA 2DQLA 1JGSA 3CUOA 4IRIA 5D5WB 4CYDA 4I7HA 1R58A 1XCVA 5FFZA 1IS1A 1O2AA 1TWGA 2XASA 1G3WA 4GYIA 1TWFA 2K4JA 5DUKA 4RGUA 2MLKA 3RJPA 2W85A 4CO8A 5E18F 1ONVA 3HHHA 2XV4S 4IF4A 4M72A 5E8IA 2ESHA 2ZCWA 1Q1HA 4KT5C 1R1UA 4M9ZA 4QWQA 3H3ZA 4U88A 4KMUX 4WXCA 3TGNA 4KM8A 1B59A 3ZMDA 3DQVC 1R23A 2ZFZA 3P9IA 4U0YA 2CG4A 3O2PE 4OIRF 3TQNA 1R5GA 2XAGA 1LEBA 5BPDA 2EA2A 1R9TA 2HGCA 1FWZA 1P6RA 4O6JA 2F5EA 4C3HC 2GIVA 3I59A 3N97A 3R0JA 3I4PA 2XCRB 4DNCA 5ICFA 1ZLKA 2GZWA 2FBIA 1ZAOA 2EV6A 3BP8A 3RDIA 4PGGA 2EA4A 2XIGA 3T8TA 2ZNZA 1MDMB 1SMYF 4LG0A 3HTSB 3HOSA 4B8XA 4HV5A 2ZKZA 2COMA 4KIBA 3NRVA 3ELKA 1O25A 2ACJA 3FXQA 3VEPA 3KLNA 5FB2A 4A6EA 1BGWA 3SZTA 3TDZC 4EJOA 3IKTA 4AVPA 3FM3A 5HLGA 1IXCA 3IRQA 2FBKA 5DD8A 5JR3A 2WTEA 3L7WA 4UVAA 3TOBA 3GFMA 1ZGJA 2CWEA 1J5YA 2QQAA 5AIQA 5E1XA 4HLXA 4U7BA 1WCMA 3LQQA 2GXGA 4OIOF 4KA4A 3QU6A 1FOKA 2IW5A 3GZ6A 2VOOA 4U0WA 1YG2A 4MQVA 4QLCU 1TBXA 1MJAA 3LA2A 3W6KB 3P7NA 1T39A 2RKHA 1I27A 1TTYA 4MEXF 3F8NA 1IF1A 5E20A 3AH5A 5ICGA 1I1SA 2JZYA 5J6XA 2BGCA 4L5JA 2KRFA 5HS9A 2XHKA 1IN4A 1TNTA 3KP4A 1O3TA 2MH9A 4KICA 4EJUA 1O7FA 1XSDA 1ZYRF 1FBSA 2XRNA 1WQHA 2PFBA 1TQPA 3RI4A 1KA8A 2FMLA 2RDPA 3S2WA 3I71A 4KB2A 5BOXA 3GX4X 1B6AA 2GAUA 3EETA 4I98B 5DCMA 3ROUA 1TWCA 2J5PA 1ZREA 4WWCA 4P5OA 4BHPA 5LEJA 1HKQA 1Y0UA 3P9KA 4OIPF 3CQZA 2QWWA 4AD9A 4L18B 4M73A 2ELHA 2NNNA 4S04A 3CUQB 3T0YA 1XSVA 1H9GA 2KJBA 3LAPA 1W7PD 3GF2A 2FF4A 2PMHA 3C7JA 4Y15A 2QENA 2YX7A 3RKXA 1R1VA 3GFLA 4KM9A 5JVTA 5LHIA 2Q2EA 4RAZA 3ZN1A 2HYFA 4U7DA 2D2WA 5HOOA 1V4RA 2QUFA 2QVOA 2BBYA 3EYYA 2V9VA 4PDKA 1XB4A 4I02A 2OAZA 5EGEA 4BQAA 3K69A 3LSTA 4RB1A 1FYKA 1W7PB 2P6SA 3R60A 1SFOA 4PZJA 5D4SA 1C0WA 4XSXF 2R3SA 2XROA 4OOIA 1FSHA 2GWRA 2G9WA 1G4DA 1QZYA 2IA2A 4AIHA 4YFNF 4IRHA 1XMAA 2MA3A 2CO5A 5D5XB 2JTVA 1AB4A 2F5FA 2WWYA 2MD5A 5L3FA 1HW1A 1WI9A 4KIFA 2VOPA 5JI6A 5D5VB 4KMFA 1BOAA 2V1DA 3OREA 1J7KA 3J80K 3Q3QA 4YFKF 4P5BA 3F21A 3SFZA 2P8TA 3K1PA 2R7FA 5D8KB 4LLLA 1IZ1A 1RI7A 2CFAA 1FLIA 5HLHA 1S29A 3ML6A 5H6QA 2XCQA 3OEPA 3K0LA 3GUDA 4EMSA 1SFUA 3CDHA 3J81K 2JT1A 1IAWA 3QPTA 3MCZA 2JSCA 4L9NA 3FHZA 5DUIA 1KYZA 1CF7B 4N9IA 3GFIA 3GTJA 4R79A 4ASNA 1R22A 1BI0A 2GA1A 1R00A 5CJ9A 2JRTA 4KUMA 4N9HA 4HZFA 3WTVC 2NVYA 2IPQX 3L4JA 1B9MA 1P2FA 3CLOA 2EV5A 5FGMA 2K27A 4LMYA 1K78A 4MTEA 4D0PA 1XD7A 4OIQF 3L9FA 2VODA 3DFGA 5FO5A 2PQ8A 3ZMZA 3ERED 3C3WA 2OU2A 2O61A 2AXLA 3K1NA 3KE2A 5TJ3A 2F5DA 3GO5A 5BPIA 4BXUA 1XDSA 2LDUA 2UXNA 2HKOA 4GTBA 4IJAA 3JSPA 3IHUA 4S05A 5F64A 4XLNF 3QRFF 1B1BA 3DKWA 5LRRA 4RGSA 3HSFA 4IVNA 1F1ZA 4O3MA 4XSZF 1L0OC 5DDGA 5L3CA 3O3KA 3HOTA 4EGYA 5CYVA 4Y17A 4KDPA 1S7AA 3E5XA 2O8XA 2HR3A 2ZJ2A 1SFXA 1Z05A 4LB5A 3QU3A 2PJPA 5IT9Z 2ZMEA 3C1DA 4KYWA 3BJ6A 3E5UA 3GTKA 4YFXF 3IWFA 3J7AO 1L3LA 5DV5A 1TWAA 2K7LA 4KB4A 2QLZA 2DPDA 3M8FA 2FNPA 2GXBA 1ZHFA 3K2ZA 3M8EA 2IJLA 1BI3A 2NNYA 4HDVA 4L0YB 1EH7A 1F9NA 4KMDA 3V7SA 4A5NA 4GO1A 4BLAA 1O2BA 1F4KA 1KU2A 1R5HA 1HW2A 1R7JA 3E6MA 5CVUA 1FX7A 5LEKA 3WU1B 1MGTA 1HSJA 2F2EA 4IPAA 4MHGA 3QP5A 4G8XA 1YW7A 2R7ZA 3CUQA 1JHFA 5AIPA 4ZZDA 1ZG5A 1BJTA 1TNSA 3QPHA 4GTEA 4O5VA 2E1CA 2GA2A 4EM2A 5BQTA 1Y1VA 4FM9A 4L9JA 2P5KA 2W24A 2R93A 1P4AA 3SZPA 4ZYEA 5CVRA 5CVIA 3PFIA 3DP7A 4EJWA 4ENNA 2HQNA 3V8KA 1HW5A 4M9XA 3WGHA 4R1HA 1EH1A 4HF0A 2XCOA 3E6DA 5LLQA 1O57A 2FEZA 5FFXA 2H27A 3KFWX 5H20A 2A6HF 3W6JB 2FU4A 1YS7A 2DQRA 2XVCA 2VE8A 2K4BA 2Z99A 3M7GA 2VT2A 2BYVE 5A2QK 4ENJA 1ZVUA 5HS7A 3CAGA 3FF5A 3ZP5A 1LQ1A 4EM0B 4LR2A 3SXYA 3PQKA 4NB5A 3BPXA 2GSUA 1K7AA 1XSXA 3KP2A 1PP8F 1SD5A 2VBYA 3SHFA 4WXDA 3VOEA 2RH6A 4KARA 3GTLA 1FY7A 1K79A 3ECHA 3MZYA 4HX7A 2BV6A 1BI1A 1IN7A 3MEXA 3LA3A 1FYLA 3VB2A 4ZYGA 3QP6A 3T1BA 3B73A 4HF1A 3AQPA 5IORA 1G3YA 3KZZA 3ZMSA 4IRGA 4LK0F 3J80Z 3KCCA 5HS8A 4Q48A 2ADUA 2H94A 3R0AA 1PP7U 2FNAA 2FRHA 5HLIA 4M74A 1K6OA 1TQIA 2D1VA 5FLXK 2MLGA 1ZG3A 2Z33A 4LGWA 1DPUA 2LKPA 1YW8A 4UV9A 1CGPA 5ED4A 4LQYA 4BAYA 3IL2A 2EWNA 1O26A 1FNNA 1WSUA 4G0WA 4MGRA 3COAC 3KP7A 3F3XA 1WQFA 3RYRA 3HHGA 5D8LB 1D8JA 1QO0D 3GLXA 3FM5A 2PLYA 1ZGAA 5IOTA 3F8FA 3KZYA 1Z7UA 2M45A 3NEUA 1YFHA 1USSA 2JA7A 1U5TA 2DU9A 4YIIA 1LDJA 2YR2A 4ZYDA 1QBJA 2DW4A 1I50A 1TW2A 3GW2A 1IXRC 4TV7A 2P5MA 4HQEA 3GZ5A 3RIRA 4HV6A 3QAHA 4JQFA 1ZN2A 3IWZA 4ZZLA 5E8GA 1WIHA 1YW9A 2L01A 1T98A 1SAXA 4ENMA 4RB0A 4XBFA 3N0CA 4HBLA 4A5MA 2PN6A 2MC3A 3WE2A 4LLGF 1YIOA 4HX4A 1FSEA 1W4MA 2A6EF 4ZH4F 4J3NA 3GTMA 1OPCA 2W84A 1STZA 5D6FA 4M9SA 4MEYF 4GCVA 1RUOA 2IT0A 2M87A 1LB2A 1ZH5A 1TLHB 2HOEA 2WC2A 5CHPA 4IHTA 1F5TA 3U1DA 4UVBA 2Y3PA 4G0VA 5HDKA 4I0BA 3FMQA 4ENKA 3ZN0A 2RQPA 3JAMK 4Y13A 4ETSA 1XGNA 2GSNA 5F1RA 2KKOA 3TOAA 2QBYA 1T0FA 3TO7A 3WE3A 2PEXA 3E5QA 1IN6A 4AIKA 3LAJA 1QGPA 1ODDA 1U8RA 2FOKA 2V6CA 1OYYA 2Z3YA 2E2HA 2KIUA 4KASA 3TDUC 4KN4X 1GE9A 4MTDA 1ZG1A 2VBXA 2X4HA 3QX3A 4CZZA 1LDKB 2IP2A 2EFQA 2CW0F 2DO7A 1S3JA 3LPXA 4YIFA 3REOA 4U0VA 2XAQA 4CHUA 3CO7C 5HDGA 3HRSA 3PQJA 1UHWA 1X3UA 2RV8A 4P5AA 3ECOA 3WGIA 3P9CA 3OOPA 2O0YA 3FKIA 5A2QZ 5LGUA 2P6TA 4WCGA 1P92A 1J2XA 2KIMA 5J8CA 2C6YA 1KYWA 5BMZA 3K1MA 1R36A 5LHGA 2STWA 1G3TA 1GVJA 3QOPA 3R61A 3GWZA 2A68F 4EGZA 3IKVA 3NUHA 2UWMA 1BC7C 2NVXA 1DD5A 2A5YB 3BJOA 4M71A 2ISYA 3IRRA 4GTLA 5LBQA 2CGPA 3KEOA 1XXAA 4M1XA 5HVQC 3L4KA 4GXOA 3FMRA 1O28A 4I0AA 3L00A 4G6QA 3RKWA 4LFUA 5LGNA 5JFRA 2B63A 3U2RA 2D45A 1Z1DA 1R1TA 5D5UB 1AOYA 3DPTA 1XMKA 4OU0A 2DPUA 5DEQA 4NQWA 2E7XA 4YG2F 1MZBA 2DFIA 5L3DA 1LJ9A 4N0BA 1FT9A 3AAFA 5FLXZ 4EJTA 1IXSB 2QYOA 4KMAA 2L54A 3H92A 5J8FA 3E6CC 3GYHX 1KQ4A 2OZUA 2W25A 4A12A 1BM9A 2ZFWA 3G73A 1GXQA 1MDMA 1LDDA 2XGXA 4EVIA 1BJAA 4M6YA 1QPMA