5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
5J8CA 3ML6A 2R7DA 4BAYA 4MTDA 3WTYC 3MMLB 2F5EA 1OMIA 2EWNA 1YQAA 1DUXC 4WWCA 2ESNA 4KT5C 3PFIA 5IT9K 4RB2C 2IA1A 1HXDA 5LGNA 4YFXF 1ZVUA 1I6XA 1B9NA 3J81Z 3K1PA 1R58A 3MEXA 1Z1DA 4U88A 1OYIA 5LRSA 1R00A 1EH6A 3REOA 3MZHA 2KIFA 2M87A 1WQHA 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 1MZBA 2DU9A 4GO1A 3WE3A 4KIBA 1W5SA 4I7HA 5ICGA 4GFQA 2X0LA 2K7LA 4I02A 2R7FA 2GA2A 3I0TA 3HOSA 1YS6A 4Z2YA 1U5TB 4KIGA 5J6XA 1H0MA 4KMFA 1H9GA 4ON0A 2K27A 3TOBA 1I27A 4CHUA 3RI4A 2PI0A 2ZO4A 4K2EA 1IRFA 1U5TA 2IW5A 1KGSA 2FSWA 3WODF 3W6JB 2C6YA 3ELKA 2Z33A 2F2EA 1BI3A 5L3CA 4UV9A 3VA7A 1S8NA 4DNCA 3V8LA 4UUVA 4EJUA 3ZMTA 4G0UA 2XAHA 5JFRA 1W4MA 5LHGA 3RPUA 3EYYA 1KU9A 2CWEA 2ZNYA 3BWGA 2MBFA 5DDGA 2OBPA 1RZ4A 1EH8A 5TJJA 3LA3A 5L3FA 1QQIA 1IXSB 2H94A 1P92A 1LDDA 2V9VA 2XVCA 4RB0A 3I54A 4L9VA 1C0WA 2IJLA 3L00A 1FBQA 3DEUA 4LGWA 1B4AA 4LJZF 4U0YA 4KB4A 5BPIA 4BHBA 2KWAA 1XMKA 2QYOA 3F8CA 1XB4A 2QBYB 3DKWA 2P5KA 3IRRA 2CQKA 1RIOH 4FHTA 1E17A 1GHCA 4I0AA 3FOEA 3E97A 2QBYA 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 5FD5A 2O03A 2UXXA 2VONA 4HV5A 3SFZA 4KB2A 1FBSA 1ZG5A 1J5YA 3ZQ7A 2MA3A 2WWYA 3E6CC 3BUEA 4UHTA 1USSA 2KKOA 5A2QZ 1O3RA 5E1XA 4PGGA 3QAHA 1WQFA 1WWXA 2IRFG 5LEKA 3E6MA 3T0YA 4LG0B 5FFXA 1KU2A 3BPVA 3VEPA 2F5DA 2HTJA 3E3VA 3LQRA 2ZNZA 4GGGA 3FMQA 5CVRA 5D4SA 4LG0A 1I1GA 3ROUA 3EETA 3W6KB 1BJAA 1P4WA 1S7AA 3K69A 1UHMA 2TDXA 1UCRA 3KEQA 3PQJA 3OOPA 5ILVA 4EGYA 1JHHA 4MGRA 1BC7C 2FRHA 1IN6A 1B6AA 3ERED 3ISPA 1EH1A 2EFOA 4RAYA 3ZN0A 2NNYA 4QWQA 2BYVE 3WTVC 4CXFA 2O8XA 3D5LA 2JPCA 4HDVA 2W85A 1UB9A 1FSHA 2QWWA 5KK1A 3GO5A 3M8FA 3GLXA 2RGVA 4XSZF 5FLXK 4JBAA 1YW9A 4G6DA 3KP3A 3GFJA 3BJ6A 3LA2A 2P8TA 2K86A 3U9GA 4A6EA 3WU0A 3H3UA 1KYZA 2JSCA 3VFZA 3GW2A 5H20A 5D5UB 2XUBA 2VT2A 6PAXA 4A2UA 3D0SA 2EJRA 1SFEA 1MD0A 2AXLA 3T8TA 4P9FA 4B09A 1HW2A 5D5XB 1QNTA 4F7ZA 4G0WA 4JK1X 1J75A 4U0VA 1H9TA 3VOEA 1G6NA 3V7SA 2XROA 1BN5A 4RS8A 1FYLA 4KFCA 3WU1B 1FSEA 1U8RA 3FWEA 3K1NA 3J80Z 3DFGA 4YIIA 2M1BA 3HSRA 5CVIA 2ESHA 3Q9SA 1I1SA 4LB5A 1HSTA 2PFBA 3KP7A 3LPXA 4AWXB 1T98A 4LLGF 2GZWA 4P5OA 2LSOA 4G7ZF 1BOAA 1YW8A 1IN8A 1HKTA 2ZBKA 2HDCA 3R6SA 2FBIA 2VBXA 2DPDA 5L3GA 2QM3A 2RGRA 5FGMA 2VOOA 2Y75A 4Y13A 1HW1A 2PMHA 1PUEE 4L18B 5LGUA 1BIAA 4ENKA 3IRQA 5ICEA 4FT8A 4ESFA 4YFNF 3OEPA 4ESBA 3RPQA 1ZRFA 4YG2F 1TNTA 1D8KA 1V4RA 3R60A 1QZYA 3WE2A 2O0YA 2XASA 4HV6A 3M7GA 3PQKA 1G3YA 5E1WA 3C7JA 2ZFZA 3DPTA 1ZN2A 3SXYA 1ZREA 3MZYA 4HQMA 5H6QA 1S6LA 2HWVA 3L7WA 4OIPF 3IL2A 4A5NA 3AAFA 1HKSA 2WC2A 3CUOA 3F8MA 1WQ2A 2DK8A 2QUFA 3F72A 3LWFA 1SFXA 4ETSA 2R3SA 1E2XA 1DPUA 3U1DA 2G9WA 1ZLJA 3F6OA 4G8XA 2IT0A 4U0WA 5J8FA 1TLHB 1D5VA 2ELHA 3E5XA 3FXRA 5HOOA 4ENJA 1U5TC 2CG4A 2W25A 3LSTA 3MWMA 5HS7A 3OREA 1V3FA 4KA4A 1BI1A 4NHJA 2H6CA 2Y0MA 3ABUA 1YYVA 2VBZA 1ZH5A 2XCQA 3KP4A 4ZYHA 1B59A 1IXCA 3P7NA 4UVAA 1TQIA 2FU4A 2V6CA 4HX8A 1ONVA 1LEBA 1STZA 1FZPB 4ZZDA 5FD6A 4LB6B 4I0BA 4M9ZA 4OOIA 3HSFA 1D8JA 2Q8KA 2HQNA 4Y15A 4A0ZA 1AB4A 4HW0A 4HDUA 2LF7A 1LVAA 2OZUA 5D5WB 2ADUA 2KIUA 1WQGA 4XLNF 4Q48A 1QZZA 2Z3YA 2FBHA 2PJPA 3DQVC 4RGRA 4A12A 5D5VB 3OPFA 2XHKA 4YIFA 4NQWA 5D4RA 2O6GE 5K1YA 4LLLA 4BYYA 1IF1A 2HYFA 4I2OA 1U6GA 3BJAA 2XKOA 2FMYA 3O2PE 5L3DA 4MTEA 2G7UA 4M74A 1QPMA 4HYEA 4HQEA 3R0JA 2RKHA 1Z6TA 2EA2A 4AIHA 2P5LC 2O61A 1Z9CA 4MNUA 4DDQA 2F5CA 3IC7A 2MLGA 3F8BA 2E1NA 2XCRB 1OPCA 2BV6A 3KETA 2XGXA 1R1VA 1R23A 3FM3A 3IWZA 4G6QA 2ZFWA 2LNBA 2ZCWA 4LK1F 4A5MA 4R79A 2FNAA 2A3SA 2D1HA 1O3QA 1O7FA 1JXSA 4NB5A 4KIFA 2HFHA 3E6DA 2W24A 3ECOA 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 1O7LA 2KJBA 2MD5A 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4WK8F 4BH9A 4ENNA 4MQ9F 4UNOA 5A2QK 4JQFA 3I53A 2A69F 4EJTA 3U2RA 4OIQF 2O3FA 1SMYF 3EDPA 3I59B 4ZYGA 3GF2A 4AD9A 2GA1A 1FPQA 4HX7A 5ERIA 5TRDA 1CF7B 4IHSA 4I09A 1MJBA 2NAZA 3I59A 2V1DA 4UVCA 1CF7A 5KVRA 2RNJA 2WTEA 4MEYF 3M1EA 5IT9Z 3WGHA 1SD6A 4E70A 2XAGA 2P6SA 5HLIA 3FMRA 1U78A 3R0AA 3IHUA 1LDKB 3DP7A 5DYMA 2VC0A 1XGOA 4GXOA 3TO6A 4PCQA 2Z9OA 1BBYA 1ZG3A 2EV6A 1R5GA 3FOFA 2GAUA 4RB1A 4HLXA 4IHTA 5DEQA 4KMUX 4RGXA 4TV7A 2Z99A 3SZTA 4KN4X 4OU0A 2D2WA 4L5IA 1G3TA 2L3DA 2PLYA 4MQVA 4XSXF 5D8KB 4BHCA 2YPRA 2DQLA 2A68F 2J5PA 2EV5A 4HLYA 2M8EA 3G3ZA 2FA5A 3I64A 1R1TA 4EM1A 3DF8A 2OAZA 1T39A 3S2WA 5AONA 2FNPA 1WIHA 3GWZA 1LEAA 3CO6C 1AOYA 2KRFA 5F64A 3TDZC 2AS5F 4L9NA 1WI9A 3O3KA 3HTSB 4OIRF 3HRSA 3QRFF 2H09A 4WF2A 4Q5SF 2MC3A 5DCMB 2ETHA 3GVAA 1LQ1A 2FMLA 5HLGA 1IZ1A 4UXNA 1Q1HA 2DTRA 5ILUA 3F3XA 3HHHA 4OMZA 5DCMA 3FHZA 1TBXA 1MGTA 4S04A 5JVTA 2P5VA 5CVVA 4PZJA 1HW5A 1B1BA 3JAMK 1BC8C 3BROA 4OMYA 1Z91A 2A61A 4N0BA 5ED4A 2HYGD 1RUNA 5EEGA 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 2LDUA 3BPXA 2VODA 3COAC 4BHPA 4A0XA 1ODDA 1IW7F 4D0PA 4LMYA 1WRJA 4KUMA 4Q47A 1T6SA 2L4MA 2A5YB 3NQOA 4RAZA 4A6DA 1IN7A 4U7DA 1F1ZA 2E1CA 2JTVA 1BGWA 1KYWA 2IA2A 4EGZA 2Z5UA 4WCGA 5K5RA 4LD5A 3CTAA 2V79A 3N4MA 1YTYA 1R22A 3R61A 3F23A 1YO5C 5DD4A 5EEHA 4M9SA 1ZLKA 4EJOA 3K1MA 2VC1A 2HOEA 1PP7U 5JVOA 3CJNA 2YSRA 2QLZA 3ZMVA 4HOBA 1LDJA 4WXHA 3FF5A 3SQNA 1U2WA 5HS9A 4GCVA 5L3BA 5DUKA 1IAWA 3EUHA 3EQLF 1OR7A 5BQTA 2X4HA 2XIGA 1KU7A 1ZAOA 4FM9A 1HKQA 1XN7A 4M9XA 3FZVA 3FXQA 5HLHA 2GQQA 2W84A 1SD4A 3ECHA 3GFMA 4AIKA 4HX4A 3C3WA 3CLOA 2K4JA 3HSEA 1S3JA 1ZYRF 4O5VA 5ICCA 4EQQA 4L0ZB 5JHUA 1DD5A 3HRMA 1FT9A 3GXOA 3F6VA 1ZARA 4G7OF 4CDGA 1ZG1A 1WKMA 1EH7A 4PDKA 2EK5A 5FLXZ 1RI7A 1HBXG 5HDKA 2DO7A 5CJ9A 1YLFA 3JSOA 2CFXA 1F4KA 1USTA 2ZJ2A 3KEOA 4KYWA 2Q0OA 3WTSC 4ZYEA 4R1HA 1K6OA 3T8RA 2BEOA 5JR3A 3V8KA 2W57A 2HTSA 1J7KA 2ZMEB 2OA4A 2GXGA 4CICA 3C18A 2Y3PA 3KP6A 2K4BA 2FXAA 4BXUA 4IPAA 2OQGA 2E7WA 4EM2A 3CO7C 1F5TA 3ZMZA 3R4KA 1R7JA 2PMUA 2KJCA 2ZMEA 4EM0B 4KNYA 3J81K 4ZZLA 5CLSA 2D1VA 1ZGAA 1ON1A 2MH9A 1BIBA 4AIJA 4KDPA 1IRGA 2DK5A 3RIRA 1FNNA 1DP7P 3MFKA 1XCBA 2PBIA 2CO5A 5AIQA 4HF1A 1W7PA 4IRHA 1FP2A 2VE9A 5BMZA 1YS7A 1P6RA 5CVUA 3ZMSA 2EV0A 1GVJA 1BI0A 1QO0D 3RKWA 3JTHA 1KQ9A 4ZH4F 3KFWX 4N9HA 1FYKA 3V4GA 5E17F 2DI3A 2MH2A 2OD5A 5CVJA 1REPC 2Y48A 3GX4X 1CGPA 2YX4A 4P9UA 1FYMA 2XAFA 3I4PA 1T0FA 4ASNA 2OQRA 2FOKA 1P2FA 2FE3A 3KZYA 2JRTA 5LEJA 3ZN1A 2P4WA 3ABTA 5FFZA 3E5UA 1IS1A 1IXRC 3KP5A 1XMAA 4HAMA 1LB2A 2P5MA 1XSVA 2K02A 1J9IA 1KU3A 1TTYA 2UXNA 2DW4A 3P9CA 1K7AA 5LHIA 3IKTA 2WV0A 4FX4A 2VT3A 3RKYA 1XXCA 2A6EF 3T5XA 5HDGA 1BJTA 3QX3A 4OIOF 4A0YA 1SD5A 3KP2A 2LKPA 2XAQA 3HOTA 3L4JA 1K79A 3QU6A 3V8JA 3DXJF 1VTNC 3L4KA 2DT5A 3WTUC 1YIOA 5BOXA 1L3LA 5LLQA 5D6EA 4PGHA 1W7PD 2EB7A 4CYDA 2VE8A 4G9YA 3NRVA 5D8LB 4CGZA 1S29A 5F1RA 4EVIA 2B0LA 3CUQB 4R8HA 4IVNA 2RQPA 3LQQA 3T1BA 3BDDA 3HYIA 3JSPA 3BOQA 4I98B 1HQCA 2EFQA 3QOPA 2EFWA 2HEOA 2DFIA 5F6FA 1JHFA 1FOKA 3I5UA 4XLPF 3Q5FA 1W5TA 2STTA 1G3SA 4GYGA 4G7HF 3ZPLA 1XGMA 4IXAA 2YR2A 3L2CA 3JTGA 1OKRA 3GUDA 1B4BA 1P4XA 2VOPA 2ZXJA 3OV8A 1L0OC 4RGSA 3H92A 2ZKZA 5E8IA 3HRUA 5K5QA 3BY6A 1KQ8A 4GYIA 1U3EM 2NS0A 4M72A 2DPUA 2UZKA 1MDMB 2A6HF 3QP5A 1XGNA 3GFIA 1FBUA 1K78B 3I58A 4BQAA 2CGPA 2FEZA 5ILSA 3J7AO 2D45A 3HIFA 1MDMA 3TKYA 2IA0A 2P7VB 2EA4A 2IVMA 4FX0A 2LF8A 1K78A 2HR3A 4HF2A 2L4AA 2DBBA 2M30A 3F21A 1HSJA 4IRIA 3HHGA 3GYHX 1NHAA 2PQ8A 4HZFA 4QLCU 1OYWA 2E7XA 1SMTA 3B02A 5FB2A 3TQNA 4KDDA 4Y17A 1XXBA 5HVQC 2XV4S 1Z7UA 3IWFA 5E8GA 4KC6A 1MKMA 4WXDA 2RC4A 1T38A 3MCZA 2RVCA 3RKXA 5LGTA 3G73A 3WTWC 1XDUA 2H6BA 2DQRA 4I01A 2XRNA 2NNNA 1R36A 1IN5A 1ZHFA 3QPTA 2NYXA 1ULYA 4ZYDA 1XCVA 4EMSA 1KQ0A 4L9JA 2EFPA 4U7BA 4KAWX 3CAGA 4HBLA 3I71A 1J59A 2H27A 1QBJA 3E5QA 2IPQX 2EFNA 1D3YA 1EV7A 2QZ8A 2P6TA 5DV5A 5DD8A 3RDIA 3J80K 4LFUA 3K0LA 1Z6RA 2DLLA 2PHCB 2HKXA 2HZTA 2J5OA 2FF4A 3B73A 2XAJA 3KCCA 3HTUA 1KA8A 1P4AA 2ACJA 1XGSA 1Z05A 4RB3C 1ON2A 2V1UA 2RDPA 3QU3A 2JT1A 2A07F 2HKOA 3WTTC 3WG9A 2QENA 4YFKF 4XRFA 3ZMDA 1X3UA 1LNWA 2F5FA 3Q9VA 1T2KA 4EJWA 2BGCA 4ESJA 2GWRA 1WSUA 3LFKA 1J2XA 1FLIA 1O3SA 1A04A 5DCFA 4CO8A 4O3MA 3SZPA 4MEXF 2P7CB 3LAPA 3NUHA 2YU3A 2DAOA 3BJOA 3RTRA 1DDNA 4HA8A 3HUGA 3WGGA 3P9IA 1XSDA 4L9TA 2L01A 3FMSA 5K5OA 2PG4A 3WGIA 3ZMUA 1BM9A 3VODA 1IN4A 2ISZA 2COMA 1QGPA 2HQRA 2JZYA 1FY7A 3ULQB 2BE5F 3MAJA 1O3TA 5LHHA 3GZ5A 4G0VA 5HDNA 2G7HA 3F22A 1YG2A 4KN7X 3L9FA 1UHWA 1ISEA 5E18F 3MQ0A 4HF0A 2OZ6A 2PEXA 1LJ9A 3CDHA 1MJAA 1YFHA 4IF4A 4UVBA 4CZZA 2VN2A 2STWA 4L0YB 1XDSA 4S05A 1BI2A 3TO7A 4J3NA 2RV8A 4WX9A 5E1ZB 4IRGA 3F8NA 1EK8A 3L09A 4G94A 2CSOA 1GXPA 2PN6A 5BS6A 4MHGA 3GZ6A 1G3WA 1PP8F 1AWCA 1SAXA 1ZRDA 1XSXA 4L5JA 1TW3A 2UWMA 5AIPA 3VB2A 3N97A 3JAMZ 2Q2EA 2VBYA 3BP8A 5LRRA 4M6YA 4LLNA 2QQ9A 1R5HA 1IUYA 2M45A 5BPDA 2QVOA 3FM5A 2FQ3A 1UFMA 3LA7A 1YW7A 2CYYA 1XD7A 3GFLA 3M9AA 3DV8A 3H3ZA 5LBQA 5FO5A 1FWZA 4B8XA 2HGCA 2V1XA 3RJPA 1XXAA 5CYVA 3SHFA 3K9TA 3TOAA 3FXUA 4BNCA 4M73A 2GIVA 2KIMA 4O6JA 3KLNA 3QPHA 1TW2A 1W7PB 4KICA 2MLKA 1DPRA 4RGUA 4H0EA 1FC3A 3TGNA 4LK0F 4OINF 2VBWA 1PDNC 3QP6A 4DQ2A 2CW0F 3O6BB 1FX7A 5ICFA 1RUOA 1R1UA 4AVPA 2NRAC 4P96A 1O57A 2ISYA 4XBFA 4Q4ZF 3HRTA 3JW4A 3CUQC 1JE8A 1TQPA 1TNSA 2L02A 3EYIA 3BZ6A 4EV0A 5IT3A 4ENMA 3F8FA 5D6FA 2IP2A 2XCOA 1SFUA 3KE2A 1GXQA 4UV8A 3DPLC 5DUIA 4M6XA 3NEUA 2JPBA 1S7OA 4N9IA 4IJAA 3GEZA 2RN7A 4M71A 3RYRA 3KLOA 2QQBA 1SD7A 3E6BA 4EJVA 5HS8A 3LAJA 5JI6A 3KZZA 2OU2A 1Y0UA 3RYPA 1ZRCA 1FP1D 1F9NA 3M8EA 5H6RA 2QQAA 3V7CA 3WTZA 1OYYA 2XKPA 3FX3A 1GE9A 3P9KA 1RNLA 1G4DA
chains in the Genus database with same CATH superfamily
1U0JA 5J8CA 1TC3C 5FLVA 3ML6A 2R7DA 2V26A 3LSHA 4BAYA 4MTDA 3WTYC 1JT0A 1O28A 3MMLB 3KEYA 2F5EA 1OMIA 2EWNA 1YQAA 1ZXOA 4ZYAA 1DUXC 3PL8A 3K4MA 1MMDA 2XPUA 2OF7A 4WWCA 2ESNA 3SDGA 5DS9A 3QPSA 1YCLA 1O27A 4KT5C 3PFIA 2K9NA 1TT0A 2RQQA 4CUGA 4RB2C 5IT9K 1HF0A 2IA1A 1HXDA 5LGNA 4YFXF 3HPGA 4B4CA 1ZVUA 3L2QA 1IE0A 2XF6A 1I6XA 1B9NA 3ONQA 1MH4A 3J81Z 4PJ0C 4A3DC 5IYBK 3GTKJ 2L9SA 4FE7A 1ETYA 3ZQGA 2QSFX 3K1PA 3S17K 4Y52C 3F0CA 3H0GJ 3S1NC 1R58A 3MEXA 3QYEA 5M5WJ 4C3IC 1C0AA 1Z1DA 4U88A 1OYIA 5LRSA 1Y1WK 1R00A 1SVOA 3PNYA 5M3FJ 1EH6A 3GSIA 4GTCA 1L0WA 3FXJA 1EQRA 1OCRH 3VYTB 2DMNA 1NG7A 3REOA 1FMVA 5FKOA 3MZHA 2KIFA 2M87A 3FXOA 4CCLA 1WQHA 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 4QPQA 4F3QA 3KYLA 4KMDA 1SANA 1MZBA 4BE2A 4JYKA 2DU9A 3HOWK 4GO1A 3HG9A 4CZCA 1J6XA 2R7ZJ 3S1RC 4BQOA 3WE3A 4KIBA 1W5SA 4I7HA 5ICGA 4GFQA 1X1BA 2X0LA 2K7LA 4AM3A 4I02A 2R7FA 4Z6YA 2GA2A 4KM9A 5FKMA 3I0TA 3HOSA 1X4PA 1YS6A 2JN6A 2LVSA 5CQEA 4Z2YA 4ZDOA 2CUFA 4JK1A 1U5TB 1WPKA 4KIGA 5IORA 3S14K 2NVQJ 5J6XA 2E5ZA 4BJ5C 1H0MA 4KMFA 3SFIA 1H9GA 4HG2A 4ON0A 2K27A 3GTJC 3RZDK 2IGNA 3TOBA 4A3MC 2CRGA 2EH3A 4M3FA 3L2WA 4CCNA 1I27A 4CHUA 3K4KA 4LITA 3RI4A 2PI0A 2ZO4A 2QEXI 4K2EA 5FLMK 3A0HC 1IRFA 1U5TA 2IW5A 1KGSA 2DFEA 3H9GA 1X1CA 2FSWA 4EATA 3WODF 1Y1VA 4XONA 3W6JB 2C6YA 3ELKA 3NWTA 3A4CA 2KZGA 2K5CA 4IHXA 2Z33A 2F2EA 1BI3A 5L3CA 4C3HJ 3OYCA 2KQRA 3DKYA 4XMYA 4UV9A 3VA7A 1S8NA 4DNCA 3L1PA 3GTPC 5IP7K 2E1MC 3V8LA 4UUVA 4EJUA 2ID3A 3MKZA 3X2QH 3ZMTA 4G0UA 3I3LA 5M3MJ 2XAHA 4C30A 4A93K 5JFRA 1HCRA 1W4MA 4GFBA 2ME6A 5LHGA 3OSFA 1IL2A 3RPUA 3CQZK 3IAM2 3EYYA 3GDZA 3CP8A 4KARA 4XN3A 3BZKA 4A3FJ 1KU9A 3K2AA 2CWEA 2ZNYA 4LJZA 3QWLA 2KRHA 3D5SC 1FEXA 3OYIA 3BWGA 2MBFA 2JA7K 5DDGA 1I50A 2OBPA 5C4JC 1RZ4A 1EH8A 4YEJA 5TJJA 3K4JA 3LA3A 4D9JA 1QQIA 5L3FA 4IO9F 1IXSB 4XL9A 2H94A 1W0TA 1P92A 3K70D 3PO2J 5GADJ 1YE9A 2LH9A 1LDDA 2V9VA 1AKHB 1G59A 1RR7A 4W97A 5C44K 4Y7NK 2XVCA 2O5RA 2WY7Q 4PSWA 4RB0A 2XSJC 3I54A 1I6VA 4L9VA 4AIDA 1C0WA 4G6TB 1VLOA 2DMPA 1BR4A 2IJLA 4BQQA 1WJEA 2YUSA 3L00A 2ZXHA 3DLAA 3I4NK 2E71A 1R4MB 1FBQA 1D0YA 1WH7A 1AKHA 4IHVA 2QGUA 3A03A 3DEUA 4LGWA 1JKOC 1X4OA 2CW8A 3HXLA 1WCMA 1HDDC 1B4AA 1RRJA 3S16J 4LJZF 4U0YA 4KB4A 4QIWL 1HA8A 4V19K 5BPIA 2AQEA 3G1OA 3GTMK 4BY7K 2DJIA 2B63K 4BHBA 1VFCA 3SEZA 2KWAA 3OYJA 1XMKA 2WA0A 2JVHA 3H3VD 5JHFA 2QYOA 3F8CA 1MSEC 1XB4A 3PUBA 3HPHA 3VSLA 2QBYB 1TWGA 3DEEA 2JA6J 3DKWA 2P5KA 3IRRA 2CQKA 3OOUA 1RIOH 3DLLF 9ANTA 2LRDA 4FHTA 1E17A 3QYBA 4I0AA 1GHCA 3K7AC 4GTBA 3FOEA 4X6AC 1ETQA 3E97A 2QBYA 3JRGA 2BXYA 3FK6A 3RZOK 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 1TWCA 3N0BA 5FD5A 2E2HJ 2O03A 2BY1A 2UXXA 3GTLJ 4M1XA 2VONA 4HV5A 1UV7A 3SFZA 4KB2A 1FBSA 1ZG5A 4BQNA 1J5YA 3CESA 3ZQ7A 3ZXSA 2B9SA 2BXZA 2QSGX 4A3LC 2MA3A 2WWYA 4P9SA 3IP4B 3E6CC 3EUHC 2YS9A 2JUGA 1ORKA 1OR7C 4DGWB 2XGDA 3BUEA 4UHTA 5HL8A 3S1MC 1USSA 5F04A 3M4OJ 2KKOA 4AYBD 3HM5A 3S2DC 2EZLA 1TWFA 1SFOC 4PSXA 4FE4A 2L7KA 5A2QZ 1O3RA 3RCOA 4A3BJ 3FXMA 5E1XA 4PGGA 3QAHA 2LG4A 3D5RC 2BHYA 1HLVA 1WQFA 3AG2H 1WWXA 2IRFG 5LEKA 4BLAA 1NG6A 4NBQA 1YJ9I 3E6MA 3T0YA 2ZJRF 1YX3A 1IRXA 4LG0B 4C2MC 5FFXA 5FKNA 1KU2A 3BPVA 3ZR8X 1F93A 3OYHA 3RPUD 3VEPA 2F5DA 2HTJA 3E3VA 1YJWI 1WJCA 3LQRA 4Y3OA 2ZNZA 4GGGA 1P7IA 4D7NA 3FMQA 4PJJA 5CVRA 3BP8C 5D4SA 1RKTA 2ZXIA 3EUAA 2WAEA 4LG0A 1I1GA 2OCEA 3ROUA 3EETA 3CF5F 4MEXA 1GDTA 3W6KB 3VYSB 2X6WA 3S2HC 5IYBJ 1BJAA 1P4WA 1S7AA 3K69A 1UHMA 2K9SA 2OPTA 4E7ZA 4IOCF 4XSZA 3S17J 2BY0A 2TDXA 4UUTA 2ZSIB 1UCRA 2BHZA 3KEQA 3PQJA 3ERMA 4CCMA 1JJ6C 3OOPA 5ILVA 4EGYA 1WSVA 2Y9ZA 2X1DA 1JHHA 4MGRA 2CV1A 2M2EA 1EFWA 3H3VL 1BC7C 2FRHA 1IN6A 1B6AA 3NWSA 3ERED 3ISPA 1EH1A 2EFOA 4RAYA 5FRNA 4NDLA 3ZN0A 2NNYA 4QWQA 2V6SA 2BYVE 3HOYC 1D1BA 1A35A 1JI8A 4IHWA 3UNGC 3WTVC 3DU5A 2O8XA 1UMQA 4CXFA 3D5LA 1GT0C 1IC8A 2JPCA 4HDVA 3HOWJ 4C3IK 1WZ2A 2EILH 2W85A 3NARA 2BE5A 1UB9A 3N3YA 1G8XA 3H0GA 3TFHA 1FSHA 4JX4A 2JVGA 2R92C 2CU7A 2QWWA 5TJ3A 2V1NA 5KK1A 3GO5A 3CCMI 3A8JA 3M8FA 4MFEA 3GLXA 5TMCA 2DA7A 2RGVA 3HGGA 3S14J 4XSZF 4BGDA 4N4OB 1VQOI 5FLXK 2NVTC 2WBMA 4JBAA 1YW9A 4G6DA 2GIZA 2VB6A 3RZDJ 4M3GA 3KP3A 3FKIC 3GFJA 3BJ6A 1VQ8I 1O24A 3LA2A 5FLMJ 2VQLA 2P8TA 3CD6I 1XZQB 1O2FB 1X2MA 3U9GA 4A6EA 3WU0A 2PJRB 2R7ZA 4AYBL 3H3UA 1KYZA 2JSCA 2X6XA 3WG7H 3VFZA 3GW2A 1H8AC 5H20A 1LVKA 5D5UB 3Q3SA 2XUBA 2ZC2A 2GSUA 2VT2A 6PAXA 4A2UA 3D0SA 4A3MK 2EJRA 4CSWA 1VQLI 1XZQA 1Y56A 1IRZA 1SFEA 2X51A 2R7SA 5IP7J 1MD0A 2AXLA 1JT6A 3DTEA 2PJRA 2JA5K 3T8TA 3GCMA 4P9FA 4B09A 1HW2A 1QPIA 5D5XB 1QNTA 1XMXA 5IP9K 4A93J 4F7ZA 3BR6A 3BC8A 1WJDA 4G0WA 4JK1X 1J75A 4U0VA 3CQZJ 1H9TA 3VOEA 1VZ0A 1D1AA 1JGGA 3S15C 1G6NA 1S7EA 5J1UA 3BTJA 1E3PA 1MBJA 5F1JA 1GV2A 1W36C 4GDFA 3V7SA 1JKRC 3V42A 4LLGA 5IYCJ 3G4SI 2JA7J 4ANJA 2DA4A 2XROA 2FJ1A 3WHBA 1BN5A 4RS8A 2K3PA 1QRYA 4F55A 3CJTB 4G7ZA 1D0ZA 1FYLA 1ZGWA 3WU1B 4KFCA 2RAEA 3A1YA 1FSEA 4HNTA 4Y7NJ 1QVUA 2E36A 3S3OA 1U8RA 2HVRA 3RQ4A 3B6AA 3FWEA 3K1NA 3J80Z 3DFGA 3KPHA 3CCRI 4YIIA 5B1AH 2M1BA 5C4JK 2TCTA 3HOUK 3HSRA 5FKLA 3I4NJ 3J7YJ 4B1RA 2R7RA 3VYUB 5CVIA 3W2VA 1PUFB 4B44A 1TWHC 2ESHA 3Q9SA 1I1SA 3ADAC 3ZQFA 4LB5A 1VQ4I 1A6QA 1HSTA 1K83K 3FISA 2JH3A 2PFBA 3KP7A 1BL0A 3HOZJ 4AWXB 1T98A 3LPXA 4MIMA 4LLGF 3GTMJ 4BY7J 2B63J 1OJLA 2GZWA 4P5OA 4YFNA 2OV7A 1PUFA 4QPOA 4E7LA 3KYCB 2YU9C 2LSOA 4U87A 4G7ZF 3PO3C 1BOAA 2B7EA 1AA7A 1YW8A 1IN8A 3BCAA 2LD5A 1HKTA 2ZBKA 3N0CA 2HDCA 4BJ6C 1R6RA 3R6SA 1WHUA 1R9TK 2JA8C 2FBIA 2VBXA 3OL4A 2DPDA 2EPFA 3AQPA 1SVLA 3AQOA 5L3GA 2QM3A 2RGRA 5FGMA 2VOOA 2Y75A 2JWTA 1ZBSA 3VWBA 1W0UA 1UHSA 2HXOA 2XGCA 4BUPA 2O8KA 3G4CA 4XRSA 3P9KA 4Y13A 2GSNA 1HW1A 3OIQA 3RZOJ 2PMHA 4F91B 1PUEE 4L18B 5LGUA 3K70C 3A2KA 5TGTA 4OINA 2VPLA 1BIAA 2CUEA 3I55I 4Y33A 3WU2C 4ENKA 4OIPA 3IRQA 5ICEA 2KP6A 2DDAA 1EI6A 2JA6A 4FT8A 2NVXK 4ESFA 2LREA 1W5CC 4YFNF 1E3OC 2L2OA 1I6HJ 2DA1A 3OEPA 4X6AK 4XORA 3RPQA 4ESBA 2CW0A 1ZRFA 4YG2F 2M7AA 1TNTA 1DU0A 1D8KA 5DM7F 1USMA 2Y30A 3FDYA 2HNHA 4QIWN 1V4RA 4RM3A 3R60A 1QZYA 2NOJB 3TL4X 2O0YA 3WE2A 2VUMC 2QQ8A 5C4XC 2XASA 4II2A 4HV6A 3OS2A 1S72I 3M7GA 4Q4ZA 2E2HA 4A3LK 4QTRA 3GTLA 4AU7A 2QCOA 3PQKA 1G3YA 5LFAA 2BVLA 5E1WA 3C7JA 3TP0A 2ZFZA 3DPTA 1ZN2A 3SXYA 4A3CC 3S1MK 1ZREA 5J4VA 3S2DK 3MZYA 5M5YK 2F5VA 4HQMA 5H6QA 1S6LA 2HWVA 3L7WA 1PJ7A 1SFOK 4ZC3A 4OIPF 3IL2A 4A5NA 3AAFA 1D5YA 2W00A 1SVMA 1HKSA 2WC2A 3CUOA 5GAGJ 3F8MA 1WQ2A 2DK8A 3JRFA 2DJNA 3TP3A 2QUFA 3F72A 1X58A 1SFXA 3LWFA 4ETSA 1XS9A 2R3SA 1E2XA 5HNHA 2FOWA 4XLEA 1DPUA 1B8IB 3GLLA 3U1DA 4BU2A 4DBQA 1PVEA 4C2MK 3L2UA 2G9WA 1XZPB 1ZLJA 4Y4RA 3F6OA 4G8XA 2IT0A 4U0WA 4W1UA 1X3ZB 1WJAA 5J8FA 4B3XA 1VQ7I 4IOAF 1TLHB 1D5VA 5IOSA 2ELHA 4QJVB 3I9V2 1B8IA 2UUZA 3E5XA 3FXRA 5HOOA 4ENJA 2BZTA 2CV2A 5C3EK 3KX2A 1U5TC 3W2WA 3AFHA 3RQIA 5HODA 3EUKL 1XZPA 3JRBA 2XB5A 2CG4A 2W25A 2EQRA 3F9KA 3LSTA 3MWMA 5HS7A 3OREA 1V3FA 4KA4A 1BI1A 1UG0A 4NHJA 3CCQI 4C3IJ 1ZR4A 2H6CA 2Y0MA 3EPZA 4QJVA 4E7JA 3L2VA 4XLNA 3ABUA 2VQHA 1YYVA 1U8BA 2DDBA 2VBZA 1ZH5A 2XCQA 2HVQA 1X19A 4KJZA 3KP4A 4BS9A 4ZYHA 1Y1WA 1B59A 1IXCA 3CCVI 3P7NA 4UVAA 2E2JK 3HOVC 1TQIA 1NTCA 2FU4A 2KRCA 1PJ6A 2V6CA 4HX8A 3G71I 1ONVA 3A02A 1R71A 1STZA 1IGNA 1LEBA 5E68A 2CS3A 3AG4H 1FZPB 4ZZDA 2GAGC 5FD6A 4LB6B 2LKXA 2XPWA 2OUMA 1WORA 4E7KA 4I0BA 4AC0A 4M9ZA 4OOIA 3HSFA 2R7XA 1D8JA 2Q8KA 4C45A 2HQNA 2R92K 4Y15A 4A3IC 1TL8A 4A0ZA 1AB4A 1I50C 4HW0A 2EIJH 3BR3A 1K6YA 2IGKA 2LF7A 1LVAA 2OZUA 5D5WB 2ZJPF 4HDUA 4BLBA 2EINH 2ADUA 2KIUA 2CQQA 1WQGA 4A3MJ 3FKIK 1V5VA 4XLNF 5GAHJ 3GTOK 4NQWB 4Q48A 1XG1A 1QZZA 1GLNA 2Z3YA 1ETVA 3BG3A 3SZYA 2COBA 2JA5J 2FBHA 2PJPA 3DQVC 3G1LA 1IV8A 4RGRA 1ZTRA 2NVYC 5IP9J 4A12A 5D5VB 3GTQC 2LKSA 1OCZH 2E2IK 3OPFA 2XHKA 1UJ8A 1J98A 2R93C 2V6EA 4A3GC 2O7OA 1OLTA 4PFOA 4KASA 4YIFA 3JRAA 2X9DA 2P0WA 1I3AA 3HJEA 4NQWA 4FASD 3HOXK 5D4RA 2O6GE 1WCMC 5K1YA 1RKWA 4OWRB 3GEHA 3CJQB 3AL0B 1DCHA 4LLLA 2EBBA 4KMHA 3H5NA 4BYYA 1IF1A 4A3EC 3IAS2 3ZQQA 2HYFA 4I2OA 1X3WB 1U6GA 3BQZA 3BJAA 2HQ5A 2XKOA 1BA5A 2FMYA 3O2PE 3CDIA 1HC8A 5L3DA 3DEWA 1MMSA 1JTYA 4MTEA 2G7UA 4M74A 1QPMA 4B48A 2ECBA 4HYEA 4HQEA 3S15K 4FISA 1X31C 3R0JA 2RKHA 4AYBN 1Z6TA 5FJ8K 2EA2A 3CQZA 3TFIA 3CCJI 4AIHA 2P5LC 2X6OA 1LPQA 5C4JJ 4XOPA 1Z9CA 3HOUJ 2RNGA 4MNUA 2O61A 1O2AA 4DDQA 2AO9A 2F5CA 2G0EA 3IC7A 3LL7A 2MLGA 2JA7A 2RREA 3F8BA 1OCTC 2E1NA 1GUUA 1ACIA 3WODA 1Q1VA 2LTPA 2XCRB 1OPCA 1K83J 2HPIA 3H5AA 3CMEI 3MVPA 2BV6A 3KETA 2LY2A 3G6EI 1LFPA 2KMUA 2XGXA 1DU6A 2DA3A 2D6FC 1N25A 1R1VA 1VQMI 2VASA 2X6YA 3J7ZI 1R23A 1QZEA 2WADA 2X1CA 1TWAK 4QIWD 1I3QK 2QSHX 3FM3A 3IWZA 2DN0A 4MQ9A 5GP9A 4XK4A 4G6QA 4EEFG 4BDYA 4BBSC 1R9TJ 1W1WE 2ZFWA 3S1QC 2LNBA 1TWFC 1SMYA 2MSYA 2ZCWA 2ZB9A 2JK3A 4LK1F 4A5MA 2K9QA 3TEDA 4R79A 1O29A 2M4KA 2FNAA 1OFCX 4A3JK 2Q1ZB 4KATA 2PX9A 3I56I 2A3SA 2D1HA 1O3QA 2ZJQF 2YU9K 1O7FA 5J1RA 3GTMA 2B63A 2V9KA 2M9HA 1JXSA 5EZGA 3DU6A 4NB5A 4KIFA 1BDFA 4KN7A 2DYSH 2HFHA 4AYBA 3E6DA 3SZGA 2JA8K 2W24A 3ECOA 2HDDA 3JR9A 2R5ZB 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 2NVXJ 1O7LA 4IQ4A 2KJBA 2MD5A 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4X6AJ 1LFBA 1T33A 4GTLA 1JKPC 4WK8F 4ITVA 4BH9A 4ILDA 4DBRA 4MQ9F 4ENNA 4UNOA 2OC6A 5EDNA 5A2QK 4JQFA 2R5ZA 3I53A 2A69F 1SC7A 4EJTA 3U2RA 1H89C 3OWTA 4OIQF 2O3FA 1SMYF 3EDPA 5KAFC 3JRHA 4A3LJ 3I59B 4V2GA 4ZYGA 3LSPA 1JTXA 3GF2A 2L9VA 2Z1DA 2GA1A 4AD9A 3MZ8A 1FPQA 4HX7A 2VJIA 4MLOA 1WOSA 1WOOA 5ERIA 4S0HB 5TRDA 3I4MK 1CF7B 1MMNA 3DPUA 3S93A 3PNVA 4RAGA 3S2DJ 5M5YJ 1VF9A 4IHSA 1MW7A 4I09A 4C3JJ 1SFOJ 1VQNI 1MJBA 1BS2A 2VUMK 2NAZA 2H8WA 5C4XK 3I59A 1MBGA 4NC6A 4PJMA 5K7ZA 3GTKC 1QU3A 2CFOA 1VI0A 2V1DA 4UVCA 1CF7A 3TTGA 5KVRA 2RNJA 4M3DA 3H0GC 2WTEA 2F4MB 3JRIA 1IJWC 4MEYF 3M1EA 5IT9Z 4C2MJ 3WGHA 1SD6A 2JA2A 4E70A 1YITI 2AQFA 3Q0VA 2XAGA 4PFPA 2P6SA 2XSDC 4E6KG 4BACA 5HLIA 3FMRA 1U78A 1IDYA 4BDZA 3GEIA 3R0AA 3IHUA 1LDKB 4LOCA 3DP7A 5C3EJ 5DYMA 1RESA 2A68A 1IDZA 2IAIA 2VC0A 1XGOA 4GXOA 3TO6A 5GTIC 4ZTJA 1N77A 4PCQA 2Z9OA 3T01A 2R7ZC 4BXXK 4MO7A 1BBYA 1DGRM 2HVSA 5IPAA 1ZG3A 3PM1A 2NS7A 5E3OA 1XX5A 2EV6A 1R5GA 3FOFA 4C2TA 1XPXA 2O9LA 1AHDP 2GAUA 4RB1A 4HLXA 4IHTA 4HRIA 5DEQA 4KMUX 3FKJA 3G2BA 4P1WA 3H9JA 4RGXA 3C2GA 1ETOA 4TV7A 2EIKH 4GT9A 2LBFB 2E2JJ 2Z99A 3ZCOA 5H2FC 2K85A 1M1EB 3SZTA 3S0XA 4KN4X 3U21A 3ZOBA 5KAIC 4OU0A 2D2WA 2I5UA 4L5IA 4OAYA 2F4IA 3T02A 1G3TA 4ZDPA 2LY9A 5HNFA 2L3DA 2IBDA 4GTAA 1QHHD 1PYVA 2PLYA 4MQVA 1LE8B 4XSXF 5D8KB 2LBFA 4BHCA 1MIJA 2R92J 3QODA 2YPRA 2DQLA 2L9NA 2CW7A 2DA2A 2A68F 2FUG2 2EV5A 2E35A 2J5PA 2HYJA 4XLAA 4HLYA 1EF4A 3HB9A 3HOVK 2M8EA 3BTIA 4OIRA 2IXSA 1Z3YA 1Z0XA 2FA5A 3G3ZA 3I64A 3MMYB 2TRTA 1F7VA 2L7FP 3FKIJ 1LE8A 3AH5A 4CCKA 3GTOJ 4WJ3M 4ZTFA 1R1TA 1A6IA 4B3AA 3HC7A 3O8HA 1FOWA 4EM1A 1YJNI 4A3IK 3DF8A 4A3FC 2IS1A 2E2IJ 2OAZA 4BJTA 5LD2C 3L2RA 3LSKA 3S2WA 1T39A 5AONA 1SEUA 4PAAA 4BE1A 2CUJA 2FNPA 1WIHA 3GWZA 3MN2A 1LEAA 3CO6C 3VPRA 2DODA 1O26A 3HOXJ 1AOYA 2KRFA 5F64A 2XGEA 3TDZC 2AS5F 1O25A 1IO2A 1WI9A 4L9NA 2VIXA 1OISA 3H5RA 3GMEA 3O3KA 2PPBA 2XC7A 2NVYK 1R4NB 3HTSB 2DOFA 2ELKA 3GTQK 3OIOA 4J00A 4OIRF 2JA5A 3HRSA 3QRFF 2ZUFA 4A3GK 2H09A 1XTAA 4WF2A 2PMZD 4KT6A 2E1MB 5M5XK 1EJ9A 3S15J 4Q5SF 1ZK8A 5E3NA 1RR8C 4F92B 2MC3A 1X1DA 5DCMB 4DIQA 3OS0A 2ETHA 3LSGA 3LNQA 5FJ8J 1N75A 1SAUA 1ZR2A 1JUPA 3GVAA 1LQ1A 4A3EK 3PIOF 2FMLA 5HLGA 1Y1WJ 1IZ1A 4UXNA 1Q1HA 1V5FA 2DTRA 2GSOA 1WH5A 2BY3A 5ILUA 3F3XA 3HHHA 3S16C 2K40A 2Y2ZA 4XKCA 4OMZA 2E5NA 5DCMA 4C9YA 3FHZA 1IW7A 1TBXA 1MGTA 4S04A 5JVTA 4B47A 4A3DK 2P5VA 5CVVA 1N78A 4PZJA 1HW5A 2DT7B 5GAEJ 1B1BA 4Y52K 3JAMK 1BC8C 1IUFA 3BROA 3S1NK 4OMYA 1WOPA 1DGWY 1Z91A 5CKTA 2OTJI 2A61A 3ZGKA 2MYSA 3K4BA 3TW7A 4KITB 1TWAJ 1I3QJ 2WB1N 1G2HA 1YX5A 4N0BA 5ED4A 2HYGD 1A36A 5D4DA 1RUNA 2XDVA 5EEGA 4KMAA 3TBIA 2W4SA 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 1S5LC 3PFYA 3T00A 2KISA 3AG3H 2E60A 2LDUA 3BPXA 2VODA 1ITYA 4IEJA 3COAC 4A3JJ 1K83A 4BHPA 4E7HA 3S1RK 3GTLC 3H0DA 1U9NA 2YU9J 4A0XA 3UR3C 4F93B 2KDZA 1ODDA 1QHGA 2H8RA 5J47A 3K4LA 1IW7F 4D0PA 4BBSK 1V55H 5JLWA 3ESWB 4JP0A 4LMYA 1WRJA 4KUMA 4Q47A 3Q3QA 1T6SA 2L4MA 3S1QK 3GTJK 2A5YB 3NQOA 4RAZA 4A6DA 3M4OC 1R9TA 3PNTA 1IN7A 4G12A 4U7DA 2DMTA 1F1ZA 2XPVA 2LK2A 4QSHA 3OYGA 2JTVA 2E1CA 1BGWA 1MNEA 4A3BC 5IOYA 1S9HA 1KYWA 2R7WA 2IA2A 5GTHC 2IGOA 5EGEA 2NS8A 4EGZA 3EQLA 2Z5UA 4WCGA 5K5RA 1VQ9I 2ELJA 4LD5A 1T56A 3CTAA 3S32A 3LOCA 2V79A 2VL8A 2WB1A 1JVIA 3N4MA 1YTYA 1R22A 3R61A 4ABZA 3GTPK 3F23A 3BR5A 1YO5C 3BLYA 2PMZL 5DD4A 3W3CA 2NVXA 5EEHA 1ZELA 3I4MJ 4M9SA 1ZLKA 2R7OA 4EJOA 2JMWA 3K1MA 2VC1A 2HOEA 3QYFA 2VUMJ 1PP7U 5C4XJ 2KHMA 3CJNA 2YSRA 3PSFA 1O2BA 2CQXA 5JVOA 2QLZA 3ZMVA 5C44J 5IOQA 1MBHA 1IQ0A 3CMYA 4HOBA 3HKZN 3LFUA 4M6VA 1LDJA 4WXHA 4BKXA 3FF5A 1RC9A 3H36A 1ZYRA 3SQNA 1U2WA 4AVZA 3RKQA 4PJNA 1LKXA 5HS9A 2DA6A 1JUSA 4GCVA 2M34A 5L3BA 5DUKA 1IAWA 3EUHA 3EQLF 3D1NI 1OR7A 1ETKA 2CQ7A 4IQJA 5BQTA 2X4HA 4G7OA 2XIGA 1BR2A 1KU7A 1ZAOA 4FM9A 1HKQA 1XN7A 2IGMA 3GTKK 1TZLA 1SFOA 4M9XA 3HEFA 3FZVA 3FXQA 4XRSG 5HLHA 4XIDA 3JRCA 3HOWC 3CCUI 2GQQA 2W84A 4NNJA 4BXXJ 3FHNA 1SD4A 2VPRA 3ECHA 4YG2A 3GFMA 1YRNB 4AIKA 4HX4A 3U1KA 2L7ZA 3C3WA 4WILA 4E7IA 3CLOA 2MW8A 4XN0A 2K4JA 3HSEA 1S3JA 1ZYRF 4O5VA 2H1LA 2W48A 2GOXB 5FKKA 5ICCA 4BE0A 3A8IA 4BBRC 4EQQA 4L0ZB 1K61A 1UG2A 3RZDC 5JHUA 1DD5A 3VYRB 1YRNA 3CJRB 3HRMA 1FT9A 3K4NA 5HLTA 3GXOA 2M3AA 2W1OA 3F6VA 2L5QA 1WJFA 1ZARA 3AD8C 1F43A 4G7OF 3HKZA 4LOWA 1WGXA 4CDGA 1ZG1A 1WKMA 1EH7A 4GTDA 4XNFA 2PA8D 2LYCA 3OSGA 1Y8QB 4PDKA 2EK5A 2K3FA 5E3MA 5FLXZ 2WAFA 3HOVJ 1VQ5I 3K7AK 1RI7A 1HBXG 4XLFA 3BR0A 3HDDA 1INNA 5HDKA 3K6GA 2DO7A 5CJ9A 1YLFA 2X85A 3JSOA 2L7MP 2CFXA 1DQUA 1F4KA 3AD9C 2ZXWH 1USTA 2VQCA 2ZJ2A 3AL0C 4A93C 5KHDA 3KEOA 4KYWA 2Q0OA 3WTSC 4ZYEA 4R1HA 1K6OA 3T8RA 3ABKH 2R93K 2H1KA 2BEOA 3GTGJ 5JR3A 3V8KA 1EKEA 2W57A 2R92A 1GVDA 2HTSA 5IYCC 1J7KA 2ZMEB 3IH4A 3TW6A 3SEQA 2OA4A 2GXGA 4CICA 5M3MK 3FBNB 3W6VA 3C18A 2Y3PA 3KP6A 2F6CA 2K4BA 2FXAA 4BXUA 2UV1A 4IPAA 2OQGA 2E7WA 4EM2A 2HQAA 3CO7C 1F5TA 3ZMZA 3FKIA 3R4KA 1R7JA 2NVYJ 4Y7NC 4A3FK 3GTOA 2WB1D 3GTQJ 2PMUA 2CQNA 2KJCA 2ZMEA 2WAQN 4EM0B 4KNYA 1VQ6I 3J81K 4ZZLA 5CLSA 2GXAA 1ON1A 1ZGAA 2D1VA 4ZH4A 2MH9A 1BIBA 5M5XJ 4AIJA 4KDPA 5L46A 1R49A 1QA6A 2E2IA 1IRGA 5EJCA 2DK5A 1WJ5A 4XLCA 1MBKA 3RIRA 3OS1A 1FNNA 2MC4A 1DP7P 4A3EJ 2A05A 4XOTA 3BTLA 3MFKA 1XCBA 2PBIA 2CO5A 5AIQA 5CHPA 5IYDC 4HF1A 1W7PA 4JX6A 4IRHA 3RSNA 1FP2A 2QF7A 1FOYA 2VE9A 4NC8A 3S8PA 1VH2A 3HOZC 1Z7LA 1LFUP 4P5AA 3GTMC 4XRMA 4AUXA 3S2HK 3OYDA 4A3DJ 1XPPA 5BMZA 1YS7A 2R7UA 2HZDA 1Y1VC 4A3KC 1VGXA 1UAAA 1P6RA 4Y52J 3S1NJ 5CVUA 3ZMSA 2R5YB 1BW5A 3CP2A 1FTTA 4WJ4A 2EV0A 1FJLA 1GVJA 1K4TA 3MKWB 1JOEA 3UKGA 2HI3A 1MNMC 3OYBA 1BI0A 1QO0D 3RKWA 3JTHA 1KQ9A 4ZH4F 3OYEA 2M8GX 3N05A 3KFWX 4RLFA 4N9HA 1FYKA 3HOYK 3V4GA 3M07A 2PA8L 2R5YA 5E17F 2KFDA 2WV1A 2ID6A 5EG0A 2DI3A 1JJ8C 1VJEA 3FK7A 2MH2A 2OD5A 5CVJA 2AXTC 2FD5A 2WAQA 3ZRGA 3S1RJ 1REPC 4LR2A 5FROA 1ZQ1C 2Y48A 2Y0SL 4BBSJ 3DKXA 5GPCA 1I6HC 3GX4X 1CGPA 2YX4A 2Y31A 1TWAA 4P9UA 3S1QJ 1I3QA 2NVTK 4BY1C 1FYMA 3GTJJ 2QA4I 2XAFA 3HKZD 2A6EA 3I4PA 1T0FA 4ASNA 4LQYA 2OQRA 2FOKA 1P2FA 4JOMA 2GBYA 2FE3A 3KZYA 2JRTA 5LEJA 3ZN1A 2P4WA 3ABTA 5FFZA 3E5UA 3OYFA 2VKEA 2YU9A 4NC7A 3GEEA 2L0KA 4E4HA 2KT0A 1IS1A 3CMAI 1IXRC 3HXAA 2KZVA 2ICWG 3KP5A 3DXJA 1XMAA 4HAMA 1LB2A 2P5MA 2HPMA 2WB1L 3LSIA 1ERDA 2P81A 3JCUC 2V6UA 1XSVA 2K02A 3HZJA 3SYTA 2GAHC 4M3EA 3GTPJ 4KISA 1J9IA 2VKVA 4AH6A 1KU3A 1TTYA 2KPMA 4DYCA 2UXNA 3FIWA 3KZIC 2DW4A 3P9CA 4DYQA 1K7AA 5LHIA 4YELA 3IKTA 2WV0A 3BT9A 4FX4A 2VT3A 3RKYA 1XXCA 2A6EF 2NVUB 3T5XA 5HDGA 5B66C 1BJTA 1TWGC 3QX3A 2HOSA 4OIOF 4A0YA 1SD5A 4LK1A 3KP2A 4HEA2 2EZKA 2LKPA 2XAQA 2DOEA 3SDBA 4RBOA 1Y39A 2LOOA 3P5JA 3HOTA 3L4JA 3CCLI 1K79A 4A3BK 3QU6A 1OCOH 3V8JA 5DM6F 3BZCA 3DXJF 4KM8A 1VTNC 1H88C 3OL3A 2FQOA 3L4KA 1TWCC 1D0XA 2DT5A 5K7HA 3WTUC 1OQYA 3GIRA 1YIOA 5BOXA 1L3LA 5LLQA 1T8IA 4FCYA 2VUMA 5D6EA 1F36A 3CMMA 4J01A 4PGHA 1W7PD 2EB7A 3TMOA 4CYDA 2VE8A 3M3YC 3JRDA 4L5EA 1TWHK 4G9YA 4RM2A 3C2BA 2PMZN 1UZCA 5EGOB 2A69A 4XLPA 1P7JA 4OIQA 3NRVA 5D8LB 4LG3A 4CGZA 4G7HA 1S29A 1FMWA 5F1RA 4EVIA 1X2NA 4LIUA 2B0LA 1W36D 2W7NA 3CUQB 3PO3K 3HKZL 1MBFA 5EGOA 4R8HA 3CDLA 4IVNA 2RQPA 3LQQA 3T1BA 3MKLA 3BDDA 2DXIA 1P9QC 3HYIA 3JSPA 4BBRK 1MMAA 2VXDA 3BOQA 5EF6A 4I98B 5IOZA 1HQCA 4BKWA 2WAQD 3K7AJ 2EFQA 3LSMA 1J09A 5K7FA 5TMFA 3QOPA 2EFWA 4RMNA 2JA5C 1ENHA 2DFIA 2HEOA 2BY2A 5F6FA 1JHFA 2JQ7A 1ETXA 2KDOA 4MFDA 5F0FA 1FOKA 3I5UA 4MEYA 1FIPA 5IP9C 1V54H 4DZJA 4XLPF 3Q5FA 1W5TA 2STTA 1G3SA 3BQYA 4XKWA 2A6HA 2MG4A 4GYGA 2GOMA 4G7HF 2R93J 2KIQA 1JQWA 3ZPLA 4HNVA 1XGMA 4D7MA 4IXAA 2DFHA 5F27A 2PMZA 4XQFA 2MD0A 3W2AA 3S1MJ 1WJBA 4D5FA 3AKZA 2YR2A 2DTZA 2DYRH 3L2CA 3JTGA 1Y0NA 2LP0A 1OKRA 3GUDA 1B4BA 2FQTA 2A6TA 3C2HA 1P4XA 1VNDA 2VOPA 2ZXJA 3OV8A 3IH3A 1L0OC 4RGSA 3H92A 3AG1H 2ZKZA 5JFEA 5E8IA 3HRUA 3H3VK 5K5QA 3BY6A 4ZJZA 1KQ8A 1DCOA 4A3CK 2R7QA 4CCJA 4GYIA 3OYNA 5IYCK 3GTGA 1TT5B 3OR1C 1U3EM 3HOUC 2NS0A 4M72A 5JLXA 2DPUA 2UZKA 1MDMB 4IKFA 2A6HF 3QP5A 1XGNA 3GFIA 1FBUA 3DTKA 2BVMA 2M7BA 1K78B 3I58A 1K83C 3JSTA 2M0MA 4BQAA 4XSXA 2M4GA 4H4KC 2HOAA 3OMYA 2CGPA 3BP3A 2FEZA 5ILSA 2ZSHB 3OR2C 2NVYA 1YNJA 3J7AO 2D45A 3HIFA 1MDMA 3S2HJ 3TKYA 2VKDA 3GTQA 2IA0A 2P7VB 2EA4A 2IVMA 4FX0A 2LF8A 3OYMA 1K78A 2HR3A 4HF2A 2L4AA 2DBBA 2M30A 3GBGA 1R9TC 3F21A 5IYDK 1E3HA 1HSJA 2BOLA 3FBIB 2NVQC 1MMGA 4IRIA 3HHGA 2DOAA 3HOZK 4I99C 3GYHX 1VRQC 1NHAA 2LC2A 4RA2A 3CC2I 5EYRA 2DCEA 4D1QA 2PQ8A 4HZFA 3HOYJ 2JJ7A 1V5EA 2LR8A 4QLCU 4X0GA 1Y1VK 4A3KK 1OYWA 1HOMA 5J40A 3A0BC 2E7XA 3DCFA 1SMTA 1HI9A 3B02A 2WAQL 3GTGK 2OJED 4GZYA 5FB2A 3PIPF 3TQNA 3ZQCA 4KDDA 4Y17A 2K9LA 4YRVA 1XXBA 3VDXA 2IEKA 5HVQC 3TFJA 3BTCA 2XV4S 2NVXC 4C3HC 1Z7UA 3IWFA 5E8GA 2VLAA 4KC6A 1I39A 1MKMA 2FX0A 1BJZA 4WXDA 2RC4A 1T38A 2NVTJ 3MCZA 2RVCA 2XAUA 4UUSB 3RKXA 5B5EC 5LGTA 3G73A 4Q5SA 3A8KA 2XF7A 3H35A 4UB6C 2VKHA 3ABLH 5BNGA 3WTWC 2I10A 1XDUA 5IOTA 2LY1A 2H6BA 2DQRA 1T95A 2WY8Q 2XRNA 4I01A 2NNNA 1R36A 1I50K 3G4AA 3HGYA 3FXKA 1I6HK 4UUSA 5F0HA 1IN5A 3CC7I 1ZHFA 3PSIA 4BY1K 1O4XA 3QPTA 2NYXA 4FQGA 1ULYA 4ZYDA 1MNDA 1XCVA 4EMSA 2MFZA 1KQ0A 4L9JA 2VI6A 1VQPI 2EFPA 4U7BA 4C3JC 3BR1A 3GTJA 3PO2C 4KAWX 2F48A 3VSKA 3CAGA 4HBLA 3I71A 3O8GA 1J59A 2H27A 1KONA 4RDUA 2LFBA 1QBJA 3E5QA 5IP6A 2IPQX 5TISC 3LMMA 2EFNA 1D3YA 2OTLI 4YFKA 1EV7A 5JVGF 2QZ8A 2P6TA 5DV5A 2R7TA 5DD8A 3RDIA 1WCMK 1YOVB 3J80K 2Y0SN 4LFUA 3K0LA 1Z6RA 2V6TA 2DLLA 2NOGA 2PHCB 2XB0X 5J1YA 5DTDA 1BOBA 2HKXA 2HZTA 2J5OA 3GTPA 3G1MA 2FF4A 3IV5A 3B73A 2XAJA 3KCCA 3HTUA 5C3EC 3OY9A 1KA8A 1P4AA 1IV6A 2IS6A 2ACJA 3DBHB 1TWGK 2EZIA 1XGSA 1Z05A 4RB3C 3IH2A 1KZHA 3E7LA 1A31A 1ON2A 4II3A 2ME0A 2V1UA 2IS4A 2RDPA 3QU3A 2JT1A 2NXNB 2JA6C 3S3MA 4DOZA 2HKOA 2A07F 3WTTC 3WG9A 1GV5A 2O5JA 3CLQA 2QENA 4YFKF 1TWHJ 4XRFA 2JSPA 3ZMDA 1X3UA 1LNWA 2F5FA 2E2JC 3Q9VA 1TWCK 2CH0A 1T2KA 4EJWA 3NAUA 2BGCA 4P5BA 2OCCH 4C2UA 1LUJB 4ESJA 4IX7A 3DTIA 2GWRA 3CZ6A 2E2HC 1XC5A 1Y6IA 3GTKA 4CCOA 4IL6C 1WSUA 3LFKA 1J2XA 4DZPA 1FLIA 1O3SA 1A04A 3PO3J 4J19A 5DCFA 4CO8A 4O3MA 3M3YK 3SZPA 3PJRA 5F08A 4E7SA 2Y0SA 3HUGB 4MEXF 5KNLA 2JA8J 2P7CB 2MABA 3LAPA 3NUHA 2YU3A 4XM3A 1TWFK 4BBRJ 5B1BH 2N8GA 2V4JC 1VQKI 2DAOA 1K4SA 3BJOA 4LIVA 3RTRA 2M0CA 3SJMA 3GTOC 2CMPA 1QVTA 1DDNA 4GRIA 1E0EA 2CJJA 2JUCA 2X48A 3M8JA 2ZMEC 4HA8A 3HUGA 4XICA 1MH3A 3WGGA 3P9IA 1XSDA 4L9TA 2D5VA 3DBLB 2XRLA 2L01A 1X1AA 3FMSA 3CCEI 1G51A 4D5CA 2DA5A 2E2IC 5K5OA 3ZQLA 2I8DA 2PG4A 3WGIA 3ZMUA 1ZKGA 2ECCA 1J6WA 4YIRX 1BM9A 3VODA 1BW6A 1IN4A 2ISZA 3HOXC 2COMA 3LSRA 1QGPA 2HQRA 2QKLB 2JZYA 1FY7A 3ULQB 5IY5H 3H9QA 3HL2A 1HQMA 2DMUA 4RMFA 2BE5F 3MAJA 1O3TA 5LHHA 3GZ5A 2Z2SB 4G0VA 5HDNA 1B72B 2G7HA 4V2FA 2ZUEA 1IBAA 1POGA 3F22A 4FETA 2F4OB 1YG2A 3MD2A 4KN7X 1RPWA 3L9FA 4XCHA 1UHWA 3M1CA 1ISEA 1USOA 4B43A 5IYBC 5E18F 2KLOA 3MQ0A 4N4NB 4HF0A 1EA3A 5EZHA 5B3SH 3OYKA 1B72A 3S17C 2OZ6A 4GTFA 2PEXA 1LJ9A 2R93A 4A3CJ 3EYIA 3CDHA 1MJAA 1YFHA 1YX2A 1Y1WC 3IUOA 4IF4A 1WSRA 2E19A 1MBEA 5E3LA 4UVBA 4CYCB 4CZZA 4FZBA 2VN2A 2GLOA 4DYRA 2STWA 3OIPA 4OAZA 4L0YB 1XDSA 1MSFC 4S05A 1BI2A 3TO7A 4J3NA 4I6ZA 2X1EA 2RV8A 4WX9A 5E1ZB 1YNNA 2L9RA 5GPAA 4IRGA 3H0GK 4CYCA 5M5WK 3F8NA 1EK8A 2Z16A 3L09A 2Y9YA 5M3FK 4G94A 2CSOA 2K9MA 3J7AY 2Q2EB 1YI2I 1TWAC 1GXPA 1I3QC 2PN6A 5BS6A 4MHGA 3GZ6A 1G3WA 3BR2A 1PP8F 2V7FA 4XR6A 1T0FC 1AWCA 3MKYB 2RH6A 3AD7C 3Q0UA 5KCMA 1SAXA 1ZRDA 1XSXA 5IYDJ 2CV0A 1X1PA 3S14C 4L5JA 1TW3A 2UWMA 5AIPA 3E0JB 3VB2A 3N97A 2MGQA 4A3JC 2Q2EA 2VBYA 3JAMZ 3BP8A 2R7ZK 5LRRA 4M6YA 3S3NA 1D1CA 1Y1VJ 4LLNA 2QQ9A 1BR1A 4A69C 4A3KJ 5FLMC 3WHCA 3HBLA 3CCSI 4FTHA 4CH7A 1R5HA 1IUYA 3FXLA 1NK2P 1JKQC 1NH3A 2M45A 2EZHA 1A5JA 2NVQK 2KL4A 1R5ID 3KYDB 3OYLA 4DW6A 4BXFA 1HDPA 5BPDA 4I76A 1J6VA 2HU9A 1Z67A 2VJ4A 2QVOA 4HPQA 4NUBA 2LLKA 3BG5A 4PK4A 1FIAA 3FM5A 3JREA 2FQ3A 1UFMA 3LA7A 2W82A 5IP7C 1YW7A 1NK3P 2HOTA 2Y0SD 4LK0A 2R4GA 2CYYA 2LMDA 1T08B 1XD7A 4XKBA 5J4YA 2IS2A 2EIMH 3GFLA 3K4CA 3M9AA 2FQ4A 2VQGA 3CQZC 3DV8A 1PJRA 3H3ZA 3QPLA 5LBQA 4XLHA 4A3IJ 5FO5A 2CFAB 4C3HK 1FWZA 4B8XA 1I50J 1SFKA 2VJJA 2Y69H 2HGCA 3ASOH 1V5GA 2V1XA 3RJPA 5F0CA 1XXAA 5CYVA 4GTEA 1DP3A 4BY1J 3SHFA 2JA7C 3I4MC 2W7VA 4PJLA 3K9TA 2EBIA 3TOAA 3FXUA 3CF2A 1Z3XA 3CC4I 2CFAA 5J3LA 4BNCA 4M73A 5EEAA 2GIVA 2KIMA 1ZQ3P 1APLC 4O6JA 3KLNA 5C44C 3QPHA 1TW2A 4UB8C 5CQGA 4A3GJ 1W7PB 4KICA 2A5WA 2MLKA 1DPRA 4RGUA 4H0EA 1FC3A 5FRMA 3TGNA 4BEHB 4LK0F 4RLQA 1WCMJ 2AHQA 4OINF 3I4NC 3DWLE 3QQAA 4HSTA 4C3JK 1IG7A 3ASNH 3PO2K 3QOEA 1OCPA 1UELB 2VBWA 3SZZA 3H1CA 4KMUA 3GZNB 2JRMA 1PDNC 3QP6A 1KQ4A 4NOIA 4BEHA 2CW0F 4DQ2A 3O6BB 1YHQI 1OCCH 4RAFA 4BY7C 2BW3B 2B63C 1FX7A 2ZFUA 4KN4A 1TWGJ 5ICFA 1RUOA 1R1UA 3A01B 1WFXA 4AVPA 2NRAC 4BXXC 4XKVA 4P96A 1DCPA 4JX5A 1O57A 1F7UA 3LSJA 2O5IA 2E34A 2ISYA 1TP4A 4XBFA 5EG0B 4Q4ZF 4IHYA 4IZZA 3HRTA 3JW4A 4UY8I 3CUQC 1JE8A 3S16K 2BW3A 1TQPA 1TNSA 1Y8RB 1ETWA 2L02A 3ABMH 3BZ6A 5CPRB 4EV0A 3BG7A 5IT3A 3OYAA 3A01A 3B6CA 2CUZA 4ENMA 1PJ5A 2XF5A 3F8FA 1TWCJ 5D6FA 5EGHA 2IP2A 1AU7A 4O2DA 1YIJI 2XCOA 1SFUA 1Z21A 1U9OA 3KE2A 3RZOC 2DT6A 1GXQA 4PUSA 4F52A 1RU0A 4UV8A 3CCYA 3DBRB 3DPLC 2JA6K 3Q0WA 4DJAA 5DUIA 4M6XA 3NEUA 1WVRA 2JPBA 3M3YJ 1S7OA 2V9PA 4N9IA 2E1OA 4IJAA 3GEZA 3KIOA 2DMQA 1FTZA 2RN7A 1RETA 1TWFJ 2HDWA 1TWHA 4HSRA 4X1EA 4M71A 3RYRA 3ZQHA 3KLOA 2QQBA 1JUMA 4OIOA 2E2HK 1SD7A 3GTLK 2R0QC 3K10A 1FOXA 4ZDLA 3E6BA 4EJVA 4HNUA 3PUFA 5HS8A 3BG6A 3LAJA 5JI6A 4CA0A 2DFFA 3KZZA 2OU2A 5E79C 1CQTA 2R7VA 1Y0UA 3RYPA 3E1SA 3GTGC 1ZRCA 1FP1D 4YFXA 1F9NA 3BG9A 4BL0B 3M8EA 4M3BA 3ZQIA 3BCBA 3IPJA 4PABA 1WI3A 5H6RA 2QQAA 3M4OK 2GM4A 3V7CA 3WTZA 1OYYA 1Z77A 2HXIA 2XKPA 2QKMB 2VJ5A 3FX3A 1GE9A 2K86A 1RNLA 1G4DA
chains in the Genus database with same CATH topology
5J8CA 3ML6A 2R7DA 4BAYA 4MTDA 3WTYC 1O28A 3MMLB 2F5EA 1OMIA 2EWNA 1YQAA 1ZXOA 1DUXC 4WWCA 2ESNA 1O27A 4KT5C 3PFIA 5IT9K 4RB2C 2IA1A 1HXDA 5LGNA 4YFXF 1ZVUA 1I6XA 1B9NA 3J81Z 3K1PA 1R58A 3MEXA 4C3IC 1Z1DA 4U88A 1OYIA 5LRSA 1R00A 4GTCA 1EH6A 3REOA 3MZHA 2KIFA 2M87A 1WQHA 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 4KMDA 1MZBA 2DU9A 4GO1A 3WE3A 4KIBA 1W5SA 4I7HA 5ICGA 4GFQA 2X0LA 2K7LA 4I02A 2R7FA 2GA2A 4KM9A 3I0TA 3HOSA 1YS6A 4Z2YA 1U5TB 4KIGA 5IORA 5J6XA 1H0MA 4KMFA 1H9GA 4ON0A 2K27A 3TOBA 1I27A 4CHUA 3RI4A 2PI0A 2ZO4A 4K2EA 1IRFA 1U5TA 2IW5A 1KGSA 2FSWA 3WODF 1Y1VA 3W6JB 2C6YA 3ELKA 2Z33A 2F2EA 1BI3A 5L3CA 4UV9A 3VA7A 1S8NA 4DNCA 3V8LA 4UUVA 4EJUA 3ZMTA 4G0UA 2XAHA 5JFRA 1W4MA 5LHGA 3RPUA 3EYYA 4KARA 1KU9A 2CWEA 2ZNYA 3BWGA 2MBFA 5DDGA 1I50A 2OBPA 1RZ4A 1EH8A 5TJJA 3LA3A 5L3FA 1QQIA 1IXSB 2H94A 1P92A 1LDDA 2V9VA 2XVCA 4RB0A 3I54A 4L9VA 1C0WA 2IJLA 3L00A 1FBQA 3DEUA 4LGWA 1WCMA 1B4AA 4LJZF 4U0YA 4KB4A 5BPIA 4BHBA 2KWAA 1XMKA 2QYOA 3F8CA 1XB4A 2QBYB 1TWGA 3DKWA 2P5KA 3IRRA 2CQKA 1RIOH 4FHTA 1E17A 1GHCA 4I0AA 3FOEA 4GTBA 3E97A 2QBYA 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 1TWCA 3N0BA 5FD5A 2O03A 2UXXA 4M1XA 2VONA 4HV5A 3SFZA 4KB2A 1FBSA 1ZG5A 1J5YA 3ZQ7A 2MA3A 2WWYA 3E6CC 3BUEA 4UHTA 1USSA 2KKOA 1TWFA 5A2QZ 1O3RA 5E1XA 4PGGA 3QAHA 1WQFA 1WWXA 2IRFG 5LEKA 4BLAA 3E6MA 3T0YA 4LG0B 4C2MC 5FFXA 1KU2A 3BPVA 3VEPA 2F5DA 2HTJA 3E3VA 3LQRA 2ZNZA 4GGGA 3FMQA 5CVRA 5D4SA 4LG0A 1I1GA 3ROUA 3EETA 3W6KB 1BJAA 1P4WA 1S7AA 3K69A 1UHMA 2TDXA 1UCRA 3KEQA 3PQJA 3OOPA 5ILVA 4EGYA 1JHHA 4MGRA 1BC7C 2FRHA 1IN6A 1B6AA 3ERED 3ISPA 1EH1A 2EFOA 4RAYA 3ZN0A 2NNYA 4QWQA 2BYVE 3WTVC 4CXFA 2O8XA 3D5LA 2JPCA 4HDVA 2W85A 1UB9A 3N3YA 3H0GA 1FSHA 2QWWA 5TJ3A 5KK1A 3GO5A 3M8FA 3GLXA 2RGVA 4XSZF 5FLXK 4JBAA 1YW9A 4G6DA 3KP3A 3GFJA 3BJ6A 1O24A 3LA2A 2P8TA 2K86A 3U9GA 4A6EA 3WU0A 2R7ZA 3H3UA 1KYZA 2JSCA 3VFZA 3GW2A 5H20A 5D5UB 2GSUA 2XUBA 2VT2A 6PAXA 4A2UA 3D0SA 2EJRA 1SFEA 1MD0A 2AXLA 3T8TA 4P9FA 4B09A 1HW2A 5D5XB 1QNTA 4F7ZA 4G0WA 4JK1X 1J75A 4U0VA 1H9TA 3VOEA 1G6NA 3V7SA 2XROA 1BN5A 4RS8A 1FYLA 4KFCA 3WU1B 1FSEA 1U8RA 3FWEA 3K1NA 3J80Z 3DFGA 4YIIA 2M1BA 3HSRA 5CVIA 2ESHA 3Q9SA 1I1SA 4LB5A 1HSTA 2JH3A 2PFBA 3KP7A 3LPXA 4AWXB 1T98A 4LLGF 2GZWA 4P5OA 2LSOA 4G7ZF 1BOAA 1YW8A 1IN8A 3N0CA 1HKTA 2ZBKA 2HDCA 3R6SA 2FBIA 2VBXA 2DPDA 3AQPA 3AQOA 5L3GA 2QM3A 2RGRA 5FGMA 2VOOA 2Y75A 1ZBSA 3G4CA 4Y13A 2GSNA 1HW1A 2PMHA 1PUEE 4L18B 5LGUA 1BIAA 4ENKA 3IRQA 5ICEA 2JA6A 4FT8A 4ESFA 4YFNF 3OEPA 4ESBA 3RPQA 1ZRFA 4YG2F 1TNTA 1D8KA 1V4RA 3R60A 1QZYA 3WE2A 2O0YA 2XASA 4HV6A 3M7GA 2E2HA 3GTLA 3PQKA 1G3YA 5E1WA 3C7JA 2ZFZA 3DPTA 1ZN2A 3SXYA 1ZREA 3MZYA 4HQMA 5H6QA 1S6LA 2HWVA 3L7WA 4OIPF 3IL2A 4A5NA 3AAFA 1HKSA 2WC2A 3CUOA 3F8MA 1WQ2A 2DK8A 2QUFA 3F72A 3LWFA 1SFXA 4ETSA 2R3SA 1E2XA 1DPUA 3U1DA 2G9WA 1ZLJA 3F6OA 4G8XA 2IT0A 4U0WA 5J8FA 1TLHB 1D5VA 5IOSA 2ELHA 3E5XA 3FXRA 5HOOA 4ENJA 1U5TC 2CG4A 2W25A 3LSTA 3MWMA 5HS7A 3OREA 1V3FA 4KA4A 1BI1A 4NHJA 2H6CA 2Y0MA 3ABUA 1YYVA 2VBZA 1ZH5A 2XCQA 3KP4A 4ZYHA 1Y1WA 1B59A 1IXCA 3P7NA 4UVAA 1TQIA 2FU4A 2V6CA 4HX8A 1ONVA 1LEBA 1STZA 1FZPB 4ZZDA 5FD6A 4LB6B 4I0BA 4M9ZA 4OOIA 3HSFA 1D8JA 2Q8KA 2HQNA 4Y15A 4A0ZA 1AB4A 4HW0A 4HDUA 2LF7A 1LVAA 2OZUA 5D5WB 4BLBA 2ADUA 2KIUA 1WQGA 4XLNF 4Q48A 1QZZA 2Z3YA 2FBHA 2PJPA 3DQVC 4RGRA 4A12A 5D5VB 3OPFA 2XHKA 4KASA 4YIFA 4NQWA 5D4RA 2O6GE 5K1YA 4LLLA 4KMHA 4BYYA 1IF1A 2HYFA 4I2OA 1U6GA 3BJAA 2XKOA 2FMYA 3O2PE 5L3DA 4MTEA 2G7UA 4M74A 1QPMA 4HYEA 4HQEA 3R0JA 2RKHA 1Z6TA 2EA2A 3CQZA 4AIHA 2P5LC 2O61A 1Z9CA 4MNUA 1O2AA 4DDQA 2F5CA 3IC7A 2MLGA 2JA7A 3F8BA 2E1NA 2XCRB 1OPCA 2BV6A 3KETA 2XGXA 1R1VA 1R23A 3FM3A 3IWZA 4G6QA 2ZFWA 2LNBA 2ZCWA 4LK1F 4A5MA 4R79A 1O29A 2FNAA 4KATA 2A3SA 2D1HA 1O3QA 1O7FA 3GTMA 2B63A 1JXSA 4NB5A 4KIFA 2HFHA 3E6DA 2W24A 3ECOA 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 1O7LA 2KJBA 2MD5A 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4GTLA 4WK8F 4BH9A 4ILDA 4ENNA 4MQ9F 4UNOA 5A2QK 4JQFA 3I53A 2A69F 4EJTA 3U2RA 4OIQF 2O3FA 1SMYF 3EDPA 3I59B 4ZYGA 3GF2A 4AD9A 2GA1A 1FPQA 4HX7A 5ERIA 5TRDA 1CF7B 4IHSA 4I09A 1MJBA 2NAZA 3I59A 2V1DA 4UVCA 1CF7A 5KVRA 2RNJA 2WTEA 4MEYF 3M1EA 5IT9Z 3WGHA 1SD6A 4E70A 2XAGA 2P6SA 5HLIA 3FMRA 1U78A 3R0AA 3IHUA 1LDKB 3DP7A 5DYMA 2VC0A 1XGOA 4GXOA 3TO6A 4PCQA 2Z9OA 1BBYA 1ZG3A 2EV6A 1R5GA 3FOFA 2GAUA 4RB1A 4HLXA 4IHTA 5DEQA 4KMUX 4RGXA 4TV7A 4GT9A 2Z99A 3SZTA 3S0XA 4KN4X 4OU0A 2D2WA 4L5IA 1G3TA 2L3DA 4GTAA 2PLYA 4MQVA 4XSXF 5D8KB 4BHCA 2YPRA 2DQLA 2A68F 2J5PA 2EV5A 4HLYA 2M8EA 3G3ZA 2FA5A 3I64A 3AH5A 1R1TA 4EM1A 3DF8A 2OAZA 1T39A 3S2WA 5AONA 2FNPA 1WIHA 3GWZA 1LEAA 3CO6C 1O26A 1AOYA 2KRFA 5F64A 3TDZC 2AS5F 1O25A 4L9NA 1WI9A 3O3KA 3HTSB 4OIRF 2JA5A 3HRSA 3QRFF 2H09A 4WF2A 4Q5SF 2MC3A 5DCMB 2ETHA 3GVAA 1LQ1A 2FMLA 5HLGA 1IZ1A 4UXNA 1Q1HA 2DTRA 2GSOA 5ILUA 3F3XA 3HHHA 4OMZA 5DCMA 3FHZA 1TBXA 1MGTA 4S04A 5JVTA 2P5VA 5CVVA 4PZJA 1HW5A 1B1BA 3JAMK 1BC8C 3BROA 4OMYA 1Z91A 2A61A 4N0BA 5ED4A 2HYGD 1RUNA 5EEGA 4KMAA 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 2LDUA 3BPXA 2VODA 3COAC 1K83A 4BHPA 4A0XA 1ODDA 1IW7F 4D0PA 4LMYA 1WRJA 4KUMA 4Q47A 3Q3QA 1T6SA 2L4MA 2A5YB 3NQOA 4RAZA 4A6DA 1R9TA 1IN7A 4U7DA 1F1ZA 2E1CA 2JTVA 1BGWA 1KYWA 2IA2A 5EGEA 4EGZA 2Z5UA 4WCGA 5K5RA 4LD5A 3CTAA 2V79A 3N4MA 1YTYA 1R22A 3R61A 3F23A 1YO5C 5DD4A 2NVXA 5EEHA 4M9SA 1ZLKA 4EJOA 3K1MA 2VC1A 2HOEA 1PP7U 5JVOA 3CJNA 2YSRA 1O2BA 2QLZA 3ZMVA 5IOQA 4HOBA 1LDJA 4WXHA 3FF5A 3SQNA 1U2WA 5HS9A 4GCVA 5L3BA 5DUKA 1IAWA 3EUHA 3EQLF 1OR7A 5BQTA 2X4HA 2XIGA 1KU7A 1ZAOA 4FM9A 1HKQA 1XN7A 1SFOA 4M9XA 3FZVA 3FXQA 5HLHA 2GQQA 2W84A 1SD4A 3ECHA 3GFMA 4AIKA 4HX4A 3C3WA 3CLOA 2K4JA 3HSEA 1S3JA 1ZYRF 4O5VA 5ICCA 4EQQA 4L0ZB 5JHUA 1DD5A 3HRMA 1FT9A 3GXOA 3F6VA 1ZARA 4G7OF 4CDGA 1ZG1A 1WKMA 1EH7A 4GTDA 4PDKA 2EK5A 5FLXZ 1RI7A 1HBXG 5HDKA 2DO7A 5CJ9A 1YLFA 3JSOA 2CFXA 1F4KA 1USTA 2ZJ2A 3KEOA 4KYWA 2Q0OA 3WTSC 4ZYEA 4R1HA 1K6OA 3T8RA 2BEOA 5JR3A 3V8KA 2W57A 2R92A 2HTSA 1J7KA 2ZMEB 2OA4A 2GXGA 4CICA 3C18A 2Y3PA 3KP6A 2K4BA 2FXAA 4BXUA 4IPAA 2OQGA 2E7WA 4EM2A 3CO7C 1F5TA 3ZMZA 3FKIA 3R4KA 1R7JA 3GTOA 2PMUA 2KJCA 2ZMEA 4EM0B 4KNYA 3J81K 4ZZLA 5CLSA 2D1VA 1ZGAA 1ON1A 2MH9A 1BIBA 4AIJA 4KDPA 2E2IA 1IRGA 2DK5A 3RIRA 1FNNA 1DP7P 3MFKA 1XCBA 2PBIA 2CO5A 5AIQA 5CHPA 4HF1A 1W7PA 4IRHA 1FP2A 2VE9A 4P5AA 5BMZA 1YS7A 1P6RA 5CVUA 3ZMSA 2EV0A 1GVJA 1BI0A 1QO0D 3RKWA 3JTHA 1KQ9A 4ZH4F 3KFWX 4N9HA 1FYKA 3V4GA 5E17F 2DI3A 2MH2A 2OD5A 5CVJA 1REPC 4LR2A 2Y48A 3GX4X 1CGPA 2YX4A 1TWAA 4P9UA 1I3QA 1FYMA 2XAFA 3I4PA 1T0FA 4ASNA 4LQYA 2OQRA 2FOKA 1P2FA 2FE3A 3KZYA 2JRTA 5LEJA 3ZN1A 2P4WA 3ABTA 5FFZA 3E5UA 2YU9A 1IS1A 1IXRC 3KP5A 1XMAA 4HAMA 1LB2A 2P5MA 1XSVA 2K02A 1J9IA 1KU3A 1TTYA 2UXNA 2DW4A 3P9CA 1K7AA 5LHIA 3IKTA 2WV0A 4FX4A 2VT3A 3RKYA 1XXCA 2A6EF 3T5XA 5HDGA 1BJTA 3QX3A 4OIOF 4A0YA 1SD5A 3KP2A 2LKPA 2XAQA 3HOTA 3L4JA 1K79A 3QU6A 3V8JA 3DXJF 4KM8A 1VTNC 3L4KA 2DT5A 3WTUC 1YIOA 5BOXA 1L3LA 5LLQA 2VUMA 5D6EA 4PGHA 1W7PD 2EB7A 4CYDA 2VE8A 4G9YA 3NRVA 5D8LB 4CGZA 1S29A 5F1RA 4EVIA 2B0LA 3CUQB 4R8HA 4IVNA 2RQPA 3LQQA 3T1BA 3BDDA 3HYIA 3JSPA 3BOQA 4I98B 1HQCA 4BKWA 2EFQA 3QOPA 2EFWA 2HEOA 2DFIA 5F6FA 1JHFA 1FOKA 3I5UA 4XLPF 3Q5FA 1W5TA 2STTA 1G3SA 4GYGA 4G7HF 3ZPLA 1XGMA 4IXAA 2YR2A 3L2CA 3JTGA 1OKRA 3GUDA 1B4BA 1P4XA 2VOPA 2ZXJA 3OV8A 1L0OC 4RGSA 3H92A 5JFEA 2ZKZA 5E8IA 3HRUA 5K5QA 3BY6A 1KQ8A 4GYIA 3GTGA 1U3EM 2NS0A 4M72A 2DPUA 2UZKA 1MDMB 2A6HF 3QP5A 1XGNA 3GFIA 1FBUA 1K78B 3I58A 4BQAA 2CGPA 2FEZA 5ILSA 2NVYA 3J7AO 2D45A 3HIFA 1MDMA 3GTQA 3TKYA 2IA0A 2P7VB 2EA4A 2IVMA 4FX0A 2LF8A 1K78A 2HR3A 4HF2A 2L4AA 2DBBA 2M30A 3F21A 1HSJA 4IRIA 3HHGA 3GYHX 1NHAA 2PQ8A 4HZFA 4QLCU 1OYWA 2E7XA 1SMTA 3B02A 5FB2A 3TQNA 4KDDA 4Y17A 1XXBA 5HVQC 2XV4S 4C3HC 1Z7UA 3IWFA 5E8GA 4KC6A 1MKMA 4WXDA 2RC4A 1T38A 3MCZA 2RVCA 3RKXA 5LGTA 3G73A 3WTWC 1XDUA 5IOTA 2H6BA 2DQRA 4I01A 2XRNA 2NNNA 1R36A 3G4AA 1IN5A 1ZHFA 3QPTA 2NYXA 1ULYA 4ZYDA 1XCVA 4EMSA 1KQ0A 4L9JA 2EFPA 4U7BA 4C3JC 3GTJA 4KAWX 3CAGA 4HBLA 3I71A 1J59A 2H27A 1QBJA 3E5QA 2IPQX 2EFNA 1D3YA 1EV7A 2QZ8A 2P6TA 5DV5A 5DD8A 3RDIA 3J80K 4LFUA 3K0LA 1Z6RA 2DLLA 2PHCB 2HKXA 2HZTA 2J5OA 3GTPA 2FF4A 3B73A 2XAJA 3KCCA 3HTUA 1KA8A 1P4AA 2ACJA 1XGSA 1Z05A 4RB3C 1ON2A 2V1UA 2RDPA 3QU3A 2JT1A 2A07F 2HKOA 3WTTC 3WG9A 2QENA 4YFKF 4XRFA 3ZMDA 1X3UA 1LNWA 2F5FA 3Q9VA 1T2KA 4EJWA 2BGCA 4P5BA 4ESJA 2GWRA