5CJ9A

Bacillus halodurans arginine repressor, argr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
GSRHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYKYSLPADQRFNPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Insights into the Oligomeric State of an Arginine-Dependent Transcriptional Regulator from Bacillus halodurans.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
molecule keywords Arginine repressor
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cj9A01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5cj9A02
2W84A 5L3FA 4OIOF 3LPXA 3LQRA 2RKHA 3SZPA 1CGPA 2JRTA 3E3VA 4G94A 1Q1HA 1B4AA 4P9FA 3J81Z 1IN5A 4MEYF 5F1RA 4CGZA 5J8CA 1REPC 2H27A 3O6BB 1BI2A 3L7WA 5DDGA 1J0RA 2FBHA 2M87A 1YIOA 4AIJA 3FMQA 3E5XA 1JXSA 3WTZA 1ZRDA 2GWRA 4KNYA 2Z33A 2A3SA 4G7ZF 1P4AA 3EYIA 2HWVA 1TNSA 4LGWA 4ESFA 2XVCA 1OMIA 3W6KB 3CDHA 2Z9OA 4HLYA 1GXQA 1XCVA 4LG0B 3FOFA 4FM9A 2PI0A 2FRHA 2STTA 1B59A 4EJVA 3HHGA 3EDPA 3L9FA 2O6GE 4A0YA 5E8IA 4LD5A 1TQPA 4OOIA 3SQNA 2XAHA 1J7KA 2XCQA 1BN5A 3BJ6A 2FEZA 2M30A 2OQRA 2XAJA 2OD5A 3NEUA 3O3KA 1JHFA 2ZCWA 3OPFA 3E6BA 1S7OA 4I0AA 4LK1F 3VB2A 4Q48A 5BOXA 2F5FA 3OEPA 1R1VA 1MDMB 1I27A 5IT9K 3KLOA 2PMHA 1ZLJA 1YW7A 1OPCA 1QZYA 1FYLA 3M1EA 3RIRA 3DPTA 3SZTA 4N9IA 2FXAA 3M7GA 4I02A 5LHHA 4ZH4F 3CUQB 5H20A 4GO1A 1HBXG 1ZGJA 2RNJA 3OREA 2K27A 3FM5A 4UHTA 2P6TA 4EJUA 3RPUA 1VTNC 2K4JA 1EH1A 3OV8A 1RIOH 4MGRA 5DEQA 3H3ZA 1D8JA 3MQ0A 2EFNA 2CSOA 1QNTA 1KU7A 2UWMA 1U6GA 4RB3C 2DAOA 2XCRB 5FD6A 1YFHA 2IA1A 4ETSA 5DYMA 3K1PA 1XCBA 5ERIA 2P5MA 1BC8C 4UV9A 4CICA 4P55A 1B9MA 2XROA 1T39A 1L0OC 4ESBA 4M6XA 3F22A 1U2WA 3JTGA 3DFGA 3ZPLA 6PAXA 1D5VA 3IWZA 3WTUC 3I58A 2VXZA 2HFHA 3FXQA 5DUKA 4Y17A 4ZZLA 3TO9A 3K2ZA 3EETA 3DKWA 4KN4X 1IN8A 1MZBA 2KJCA 3E6DA 4PZJA 3WGHA 1OYWA 1WQHA 1EH6A 4N9HA 1ON2A 3IRQA 2MH2A 3WTTC 1ISEA 1WQ2A 3QU3A 2DK5A 1WWXA 2CFXA 1FY7A 4L9JA 3R0JA 3Q9SA 1GVJA 2CO5A 4XSXF 2F2EA 4L9VA 3KP4A 2DO7A 3WGGA 1LB2A 4YIFA 4GYIA 3CAGA 3U2RA 2LF8A 3WU1B 2IRFG 1KGSA 2EB7A 1I5ZA 4LMYA 2HR3A 5LHGA 2M45A 2X0LA 2XHKA 2X4HA 5CVIA 2Y0MA 3FF5A 2EFQA 2YU3A 1MJAA 2VBXA 2HQNA 2YR2A 2HTSA 3L2CA 4GGGA 2HKXA 4YG2F 4KIBA 4AIKA 3KCCA 3E6CC 5BMZA 1Z9CA 2EWNA 4HX4A 1FZPB 2ELHA 5E1XA 2EK5A 4KN7X 2KJBA 3DQVC 4DQ2A 1IXRC 3FXRA 3QU6A 1W4MA 4XBFA 1EH7A 4A6DA 2ZNZA 5DD4A 3FMSA 5BPDA 5FFZA 1IN7A 3V8LA 2RGVA 5DD8A 2DPUA 3CTAA 2XV4S 3FMRA 4EGZA 3TOBA 2CYYA 1QBJA 3S2WA 3R61A 5LHIA 1Z1DA 5K5QA 3G3ZA 2ZJ2A 4Y15A 4Q47A 5HS9A 2W57A 5L3GA 2MLGA 1FBUA 2FU4A 1O7FA 3WTVC 2Q2EA 3KP2A 3NUHA 2GA2A 3I64A 3CLOA 2QBYB 2XAGA 1RUNA 1WSUA 4UXNA 2D1HA 3WE2A 5D6EA 3N97A 4P9UA 1DPRA 2Z99A 4UNOA 3IKTA 4P5OA 3BDDA 5ILVA 4LJZF 3E5QA 3U1DA 1FSEA 1J2XA 3V7SA 5CVJA 1ZREA 2QYOA 2ZMEA 4HW0A 4O3MA 4LLGF 4U0WA 4LFUA 4L9TA 2E1NA 3F3XA 1KQ8A 4EVIA 5TJJA 4OINF 5E18F 3R6SA 2FMLA 2M8EA 3B73A 4HAMA 4EM0B 4Q5SF 4HDUA 1KQ9A 3RDIA 1SAXA 4ENJA 3RKXA 2OAZA 3C3WA 1RI7A 4RB1A 2QENA 3KZZA 3MWMA 2GZWA 3SFZA 4WXCA 5F6FA 2MA3A 2LNBA 4Y13A 4BHCA 4M74A 1ON1A 4F7ZA 5FGMA 4L0YB 3QOPA 1B1BA 2O8XA 2D2WA 2ESNA 3QPHA 3FM3A 3BJOA 2XCOA 2JPCA 5JI6A 4GFQA 2VONA 1OYIA 3ABTA 4MNUA 2VBWA 1MKMA 2BV6A 3W6JB 3V4GA 2L4AA 2EV6A 3FOEA 5E8GA 1YS7A 3E5UA 5A2QZ 2A07F 2BYVE 3KFWX 3WTYC 1KA8A 2UZKA 2KRFA 2BGCA 3OOPA 2M5WA 1L3LA 1IXCA 1R1UA 5E1ZB 4G7HF 2IA0A 3DF8A 3M8FA 3ZN0A 5CLSA 1G3TA 4AD9A 4TV7A 1LDJA 2H09A 3T8TA 3HUGA 2KIUA 1HW1A 1G3YA 1OYYA 2XAQA 2R3SA 3HRTA 2VOPA 2L02A 3T1BA 1UHMA 5BQTA 3F6VA 5HS8A 2KKOA 2NRAC 3BP8A 2JTVA 5IT3A 4NHJA 1TTYA 2Z3YA 2FBIA 1PP8F 2LKPA 1D3YA 4KYWA 3J7AO 2HTJA 2DT5A 2D45A 2QWWA 2VC1A 3ABUA 4M9XA 1H9TA 1FSHA 5D6FA 2P5LC 1WQGA 1RNLA 2MC3A 2A69F 1S7AA 3TDZC 4U0YA 2ZO4A 4HF2A 4K2EA 2L54A 3KP7A 1F9NA 2IP2A 1TQMA 2K02A 2RV8A 1U8RA 4ENNA 4I2OA 4JQFA 3DEUA 2EV0A 2ISYA 2EV5A 1UFMA 4OIRF 1QZZA 1P92A 4ON0A 3RKYA 2XRNA 4A0XA 2IJLA 1ZRCA 5DV5A 2KIMA 1LNWA 3PQJA 1BJTA 4M9ZA 2VODA 1IN6A 2PN6A 4ZYDA 3SXYA 3J80K 2NYXA 4PDKA 1KYWA 4L5JA 5FB2A 4HV5A 1TQIA 3KEOA 4IPAA 5HDNA 1BJAA 4KDDA 3TQNA 2DLLA 2Z5UA 1ZG1A 1U5TC 5EEHA 3BPXA 4BHBA 4GYGA 5JFRA 1MD0A 5CYVA 4BNCA 4G0UA 4ASNA 3MEXA 4HQEA 1FC3A 3RI4A 1ODDA 1SMTA 1C0WA 1GHCA 1J75A 1QO0D 4WWCA 2YSRA 2G7HA 2RQPA 5AIPA 4A0ZA 4HF1A 2EA2A 4ENKA 1R5GA 4HV6A 3V7RA 3GUDA 3J80Z 2ZFWA 4M6YA 4G7OF 5LRRA 2Q0OA 1GXPA 1IUYA 4KIGA 3T0YA 1J59A 4YFXF 5E20A 4GXOA 1AB4A 3GF2A 3C7JA 3F8BA 1J9IA 4LLLA 2XKOA 4HZFA 2V9VA 3VFZA 1ZAOA 2K86A 1RUOA 3IKVA 2DU9A 1G6NA 2O3FA 4AVPA 4J3NA 2K4BA 5FD5A 1YW9A 1LDKB 3IL2A 2DI3A 2OBPA 1I1SA 3QPTA 5E1WA 4KIFA 3ECOA 4H0EA 2W24A 5H6QA 4EM2A 3P9IA 3RYPA 4WXHA 1TNTA 1W5TA 2LF7A 1W7PA 1XSVA 5FLXK 1TLHB 1ZGAA 4IF4A 2RGRA 1I6XA 3RJPA 3F6OA 3QX3A 3BZ6A 3WE3A 2ACJA 4KICA 3KP5A 4KB4A 4BH9A 4OIPF 2E7WA 3VEPA 5ICCA 1PDNC 3EQLF 5D8LB 2GAUA 5JR3A 4OIQF 2HKOA 1BC7C 4IRHA 2CGPA 3G73A 1YLFA 2NNNA 2DBBA 4MQ9F 3KP6A 1DUXC 4CO8A 2Y48A 1T38A 3I0TA 1I1GA 3BY6A 4CDGA 1A04A 1IZ1A 1R1TA 4EJTA 2A5YB 2A68F 5JVTA 2UXNA 1V3FA 3ZQ7A 3ZMSA 3ZMZA 1U5TB 4LB5A 2GXGA 1SD7A 2OZ6A 2F5DA 1OR7A 2JZYA 4QWQA 5K5RA 4OMYA 4G0VA 2CQKA 4KUMA 1W7PB 3PFIA 1UHWA 1LJ9A 5ICEA 1T2KA 3LFKA 1USTA 5KK1A 2VT3A 2P6SA 4NQWA 4N0BA 2ESHA 3GWZA 5HLIA 3DXJF 1JGSA 3VOEA 5ICFA 2PFBA 3FHZA 1Z05A 1FP2A 1HSJA 1WKMA 4UVCA 3GZ6A 4EGYA 1Z7UA 4G6QA 1T0FA 3BJAA 5E17F 2P7CB 1PP7U 4XLNF 2Y3PA 4FHTA 2PEXA 1K79A 1F5TA 3F21A 2STWA 4XLPF 4RGRA 2NNYA 1O3QA 2G7UA 2EJRA 2V1XA 4RGXA 3HRMA 1Y0UA 3HSRA 2PJPA 3CJNA 2PQ8A 2HQRA 3HTSB 1XMAA 1R23A 4ZZDA 3HTUA 4LK0F 1CF7B 1AWCA 2QM3A 4WX9A 3R60A 1HKQA 1SFEA 2FF4A 4U7DA 4WCGA 2PLYA 5K5OA 1LEAA 3ML6A 3HHHA 4RB2C 4CHUA 2QZ8A 4EQQA 3MMLB 4MQVA 1RZ4A 3CO6C 1IRFA 3BROA 1B4BA 4R79A 4DNCA 2MH9A 1XDSA 1XXBA 3GZ5A 3L00A 4LG0A 4PCQA 3TKYA 1B6AA 1TBXA 3GW2A 1YQAA 5LEKA 2BBYA 2OA4A 3RTRA 1O7LA 3KEQA 2QBYA 3C18A 2VE9A 5L3EA 3KP3A 2E7XA 4IJAA 1P4XA 2H6CA 3QRFF 1H9GA 3LAJA 4ZYHA 1XGSA 1BOAA 1QGPA 1K7AA 1KQ0A 2IPQX 4YIIA 1UB9A 1DP7P 5DUIA 2OQGA 4JBAA 3LAPA 2HEOA 1GE9A 3V8KA 2IW5A 5ED4A 4IXAA 4KT5C 5F64A 4YFKF 2IA2A 4U7BA 2YX7A 5D5UB 3I4PA 4E70A 4HA8A 5CVRA 1P6RA 1G3SA 4XSZF 3F8NA 3LQQA 4D0PA 3GVAA 4WXDA 3CUQA 2MBFA 1BM9A 4EM1A 1W5SA 2V79A 3F72A 2P5KA 1YS6A 4QLCU 1AOYA 1HW5A 3ZP5A 3JSPA 3GYHX 5JVOA 1P4WA 1QQIA 4MEXF 3FWEA 3GEZA 1BBYA 1BGWA 2F5EA 2BE5F 1FX7A 5DCMA 3JAMZ 3T5XA 3R4KA 3M8EA 4KAWX 1ONVA 2O03A 5D4RA 4ENMA 3L4KA 1ZHFA 4EJWA 3H3UA 1SD5A 3DV8A 4HQMA 2D1VA 2YPRA 3E6MA 5LGUA 4AIHA 2NAZA 5HDGA 2XUBA 4P96A 3AAFA 3VODA 1FBQA 1KU3A 2H94A 3LA3A 3BOQA 4Q4ZF 2IT0A 4HYEA 1DDNA 3BWGA 4IHTA 4KMFA 3ZMTA 5ILUA 4RGUA 3M9AA 3ELKA 3KE2A 1SD4A 4CXFA 2M1BA 1S29A 2KIFA 3F8CA 1S3JA 4U88A 3GX4X 2EFWA 3TO7A 4KA4A 5J6XA 2VC0A 4Z2YA 2FOKA 3I5UA 5CVVA 3GFIA 2A6EF 3HSFA 1FBSA 1S6LA 5ICGA 3V8JA 2XKPA 2QLZA 5FLXZ 3JSOA 5IT9Z 2DK8A 1IAWA 1FOKA 1O57A 2V1DA 3KZYA 4ZYGA 4U0VA 4YFNF 4UV8A 2QQ9A 1LVAA 2HYGD 1O3RA 4FX0A 5L3BA 2VT2A 5CVUA 3QP6A 4ESJA 1KU2A 1STZA 3LA2A 3BUEA 2COMA 1HKSA 5J8FA 1IF1A 5JHUA 1MJ9A 5LGTA 1E2XA 1YYVA 1U5TA 2VBZA 1IXSB 2MD5A 5FFXA 3U9GA 4KMUX 2P7VB 4S04A 1PUEE 3RKWA 5TRDA 3GXOA 3PQKA 2K7LA 3WTXC 1LQ1A 3DPLC 3WU0A 1ZN2A 1F1ZA 1U78A 1XB4A 1Z6TA 2GQQA 1X3UA 2DQLA 4RGSA 1XSXA 2XGXA 2J5PA 2H6BA 2JT1A 2WTEA 3H92A 4GCVA 3BPVA 3GFMA 1TW3A 4PGHA 1HXDA 4M9SA 3MAJA 1K78B 2HZTA 3MZHA 5AONA 4A12A 3IWFA 5KVRA 2QQBA 1ZLKA 1YO5C 4ZYEA 3HRSA 2GIVA 2DW4A 5LBQA 5HDKA 2L01A 3K1MA 5LLQA 1R58A 1XXAA 3FZVA 5K1YA 3HOSA 2EFPA 1XSDA 3ROUA 2GA1A 2RC4A 1XDUA 1TW2A 2HYFA 3L4JA 2RDPA 2Q8KA 3D0SA 4UVAA 2HS5A 2PG4A 4L18B 1SFXA 3V7CA 3O2PE 3EYYA 1ZG3A 2PBIA 2KWAA 2B0LA 1LDDA 2CWEA 2CW0F 1XD7A 1DPUA 3TOAA 2J5OA 1SD6A 1JHHA 1IS1A 2ZBKA 2HDCA 4O5VA 4G8XA 4XRFA 4I01A 3I71A 5HS7A 4KDPA 3HSEA 4JK1X 1FYKA 2XAFA 1IN4A 2ZNYA 3LSTA 2FMYA 4MTEA 1YTYA 1HW2A 3FXUA 1Z91A 3I59B 4IRIA 1OKRA 1ZARA 1HKTA 1R5HA 4HX8A 1ZH5A 4M73A 3KETA 2FA5A 1S8NA 1CF7A 1MJBA 1ZRFA 3TO6A 3CO7C 1KU9A 3HIFA 1O3TA 1FYMA 3NQOA 2BEOA 1MDMA 2QQAA 2DPDA 3NRVA 5LRSA 3RYRA 1QPMA 2ETHA 4IRGA 4BAYA 3ZMDA 5BS6A 2P4WA 2A6HF 1XN7A 4EV0A 3ZN1A 3WG9A 1T6SA 1SFUA 2QUFA 3HOTA 1XGOA 2FBKA 2RVCA 1IRGA 1E17A 2AS5F 2VN2A 2FNAA 3K0LA 3CUOA 5D8KB 4BHPA 3IC7A 4R1HA 1XGNA 1B9NA 1O3SA 4PGGA 1FNNA 3B02A 3I53A 3P9CA 3DP7A 2ZFZA 1JE8A 4HX7A 5CJ9A 4BQAA 1IW7F 4FT8A 5D5VB 1Z6RA 4HF0A 4I98B 4BXUA 3ECHA 3EUHA 1ZG5A 2O61A 2AXLA 1K6OA 3ZMVA 5BPIA 2NS0A 4OU0A 3K9TA 1H0MA 4M72A 1UCRA 2RN7A 4L5IA 2FSWA 2C6YA 4MTDA 3IHUA 3REOA 4KFCA 3K69A 1YW8A 3ERED 3TDUC 2CG4A 4HBLA 3MCZA 5FO5A 1ZVUA 1BIBA 4DDQA 3C1DA 1R36A 5ILSA 3SHFA 2FE3A 2LSOA 2EFOA 3GFLA 5D5XB 2IVMA 3L09A 2VE8A 1P2FA 1LEBA 4MHGA 2DFIA 1NHAA 3E97A 1XMKA 5D5WB 3Q5FA 4RAYA 1MGTA 4IVNA 2PHCB 3WTWC 2P5VA 2HGCA 4OMZA 2EA4A 3RPQA 3LWFA 2LDUA 1WIHA 2VOOA 3HYIA 2MLKA 4I7HA 1ULYA 2PMUA 2WC2A 3K1NA 1D8KA 4UUVA 4G6DA 5HOOA 5AIQA 5HVQC 2ZKZA 4IHSA 2FQ3A 2R7DA 4R8HA 2XIGA 5DCMB 4BYYA 2JSCA 3CUQC 2R7FA 3GO5A 3JW4A 3ZMUA 3IRRA 1BI1A 1KYZA 3HRUA 3QAHA 3D5LA 3WTSC 3QP5A 4UVBA 2YX4A 4LB6B 2V1UA 1EH8A 1BIAA 5LGNA 4S05A 3MFKA 2JPBA 2WV0A 3N4MA 3F8FA 1T98A 1WI9A 2ADUA 4O6JA 4L9NA 1BI0A 3TGNA 2DTRA 3ULQB 2QVOA 2W85A 2L3DA 5L3DA 4EJOA 3I59A 5HLHA 1WQFA 1U3EM 2WWYA 3VA7A 2F5CA 1USSA 4EMSA 2W25A 3Q9VA 1YG2A 4KB2A 1SMYF 4CYDA 2OZUA 1XXCA 1HSTA 2TDXA 5HLGA 2Y75A 4WF2A 3T8RA 4A2UA 5LEJA 2GXBA 4L0ZB 3ISPA 4I0BA 1EK8A 1BI3A 5D4SA 4G0WA 3J81K 1R22A 3WGIA 3JAMK 2OU2A 4M71A 3R0AA 4CZZA 1FPQA 2HOEA 1EV7A 2ZXJA 1K78A 4AWXB 1J5YA 2UXXA 3LA7A 4HDVA 1HQCA 2L4MA 2ZMEB 4NB5A 4RAZA 1FT9A 5H6RA 1F4KA 2VBYA 1ZYRF 2G9WA 5EEGA 2E1CA 4LLNA 1R7JA 5A2QK 1XGMA 1G3WA 4RS8A 1R00A 5L3CA 3KLNA 3COAC 2P8TA 4A6EA 4FX4A 1FLIA 3F8MA 2V6CA 2ISZA 1FWZA 4G9YA 3WODF 2FNPA 1W7PD 3I54A 2XASA 4B8XA 1V4RA 2O0YA 3GLXA 3JTHA 4RB0A 4A5MA 1G4DA 3P9KA 4HOBA 4KC6A 4WK8F 4HLXA 3GFJA 4B09A 1FP1D 4A5NA 1DD5A 5DCFA 2A61A 3P7NA 3MZYA 3F23A 4I09A 2DQRA 1WRJA 3FX3A
chains in the Genus database with same CATH superfamily
2W84A 5L3FA 2XGDA 2RREA 4RLQA 5IOTA 5IP6A 4OIOF 3LPXA 3LQRA 2RKHA 2MABA 3SZPA 1E0EA 4Q5SA 1CGPA 2JRTA 1OISA 3E3VA 1SANA 3S1QC 1Y1VC 1YI2I 4G94A 2WAQA 1Q1HA 2GOMA 1B4AA 3LSGA 4P9FA 3VYTB 3J81Z 1W0TA 1IN5A 1FOWA 3OYGA 4MEYF 1XZPB 1UELB 4BXXC 1C0AA 1PJ7A 2NOGA 1TWAK 5F1RA 2KQRA 4CGZA 4A3DK 5J8CA 3FXMA 1APLC 1REPC 1A6IA 2H27A 3O6BB 1BI2A 4XKCA 3L7WA 5DDGA 1J0RA 4A3CK 5FRMA 2FBHA 2M87A 1YIOA 2WAQN 3GTGJ 1LFPA 4OIQA 1VQ7I 2JA8K 1ITYA 4AIJA 3S2HJ 2CUFA 4BY7J 2A5WA 3E5XA 3FMQA 2ECCA 1JXSA 3WTZA 3MKZA 4RAGA 1ZRDA 2GWRA 4MFEA 4KNYA 4GTDA 4AYBD 1OCPA 2Z33A 1X1AA 2A3SA 2NOJB 4C9YA 2FJ1A 1P4AA 4G7ZF 4A3EC 3EYIA 3A4CA 4FETA 2HWVA 4YELA 1A31A 1TNSA 4LGWA 2HQ5A 4ESFA 2M0MA 2XVCA 1G2HA 3BP8C 1OMIA 3W6KB 3CDHA 2Z9OA 4AM3A 3S14K 4S0HB 4HLYA 1GXQA 2DJNA 2A6HA 1XCVA 3HL2A 4LG0B 1E3PA 1WPKA 3FOFA 2V6SA 1MBEA 4W97A 4PJ0C 1X31C 3AD9C 3AL0C 4LG3A 3GLLA 4FM9A 2PI0A 2FRHA 2STTA 1B59A 2LLKA 4NC7A 3K10A 4EJVA 1MBKA 3HHGA 3EDPA 3GSIA 1S5LC 3L9FA 2LP0A 2O6GE 4A0YA 2JA6A 3T02A 5E8IA 5IOQA 4LD5A 1TQPA 4OOIA 3OYDA 3ESWB 2I5UA 3OYJA 4BXXJ 2LH9A 3S17K 2RNGA 1WI3A 3SQNA 4E7HA 1VLOA 1FTTA 4XLCA 2XAHA 1J7KA 3O8GA 4D7MA 4F3QA 5M5YJ 1IGNA 3PIPF 3Q0WA 4XLPA 5C44C 5GPAA 1SFOJ 1MMDA 2XCQA 4A3FK 1BN5A 3BJ6A 2O8KA 2FEZA 1WVRA 4E7SA 2M30A 2OQRA 5GAGJ 2NS7A 2XAJA 3HXLA 4XR6A 2OD5A 3NEUA 4HSTA 3S3NA 9ANTA 4BEHA 2R7UA 1J09A 1RKTA 2ZJQF 3O3KA 1JHFA 4PABA 2ZCWA 3S17J 3E6BA 1INNA 3OPFA 1S7OA 4I0AA 4LK1F 1UZCA 3VB2A 4C3IC 2DDBA 4Q48A 5BOXA 2F5FA 4IOAF 2PMZN 3OEPA 1SFKA 1R1VA 3PSIA 2AQEA 2E36A 1F43A 1MDMB 1O27A 1I27A 2DODA 3A1YA 5IT9K 2W1OA 3KLOA 3K7AJ 4ANJA 2R93K 2PMHA 3PSFA 1ZLJA 2VXDA 2HDDA 3GTQA 4CH7A 1GVDA 1YW7A 1OPCA 1QZYA 5GTHC 4M3EA 1FYLA 3M1EA 1TC3C 3RIRA 3NWSA 3DPTA 3SZTA 4AYBN 3CJQB 1X3WB 4IHWA 2R5ZA 4N9IA 2FXAA 3M7GA 4I02A 5LHHA 4ZH4F 1QU3A 2NVQK 3CUQB 1WH7A 5H20A 4GTCA 1IC8A 2VJJA 2LYCA 1D0YA 4GO1A 1HBXG 3H3VK 3S17C 1ZGJA 2RNJA 3OREA 5FROA 1OQYA 2K27A 3TW6A 4ZJZA 5HODA 1T8IA 1O25A 1AKHB 4BY7K 4IHYA 3FM5A 4UHTA 1SFOC 2P6TA 4EJUA 2JA8J 2NVYJ 2NVTK 3S2DC 2R7ZJ 2WY8Q 3RPUA 1VTNC 2K4JA 4A3CJ 3OV8A 1EH1A 5H2FC 2HVSA 1RIOH 3DKXA 4MIMA 3M1CA 3HOUK 4XN3A 4MGRA 1B8IB 1F93A 2CUEA 5DEQA 4HRIA 3H3ZA 1D8JA 3MQ0A 4NDLA 5LD2C 2EFNA 2CSOA 2V26A 1IV6A 1QNTA 1KU7A 1KONA 3AG3H 2JN6A 2UWMA 3WHBA 1U6GA 1WORA 4RB3C 4DW6A 3ABLH 2DAOA 5IP7J 2DA5A 3LNQA 5FRNA 2XCRB 1WJAA 4HNTA 1HQMA 5FD6A 1YFHA 1F36A 2IA1A 4C2MC 3GTGA 4ETSA 2GLOA 5DYMA 2XC7A 3K1PA 1XCBA 3HOXC 5ERIA 1F7UA 2P5MA 2X6YA 5EGHA 1BC8C 3CQZK 2VJIA 2DN0A 4UV9A 4CICA 4P55A 1B9MA 2XROA 1T39A 3Q3SA 5K7HA 1L0OC 1ORKA 4ESBA 4M6XA 4XRSA 3F22A 3AH5A 4AVZA 1U2WA 2JA7J 4CA0A 2TCTA 3JTGA 2E2IC 3BTJA 3DFGA 3ZPLA 1DP3A 6PAXA 1D5VA 5F0HA 2EZKA 1LKXA 1VQ4I 3IWZA 3WTUC 5FLVA 3I58A 3UR3C 2VXZA 2HFHA 3FXQA 5DUKA 1B8IA 3S1NC 4A93J 1IE0A 2M4GA 4Y17A 3VDXA 4ZZLA 3TO9A 1IQ0A 1ENHA 3K2ZA 3EETA 3DKWA 4KN4X 1IN8A 5GTIC 1KZHA 4DYCA 3SEQA 4PFOA 2ZB9A 4JK1A 1MZBA 2KJCA 4PSWA 2QSHX 3E6DA 4PZJA 3PM1A 3OSGA 3WGHA 1OYWA 3VYSB 1WQHA 3GTPJ 1O2FB 1EH6A 4N9HA 1ON2A 3IRQA 2HI3A 2MH2A 4RMNA 2CQQA 3CCUI 3WTTC 1AU7A 5K7FA 3GZNB 2KRCA 1ISEA 1WQ2A 3QU3A 5EG0A 2DK5A 5JHFA 1ETVA 1WWXA 1FOXA 4MEXA 2CFXA 1FY7A 4L9JA 3R0JA 4X6AJ 3K2AA 3Q9SA 3JRHA 1GVJA 1YOVB 2CO5A 2KIQA 2I8DA 4XSXF 2D5VA 2F2EA 3HOXJ 1QHGA 2E2HA 4L9VA 1FEXA 1TP4A 1S72I 1Z3XA 3KP4A 2W7VA 2NVXJ 2DO7A 3WGGA 4BJTA 2E2IK 1LB2A 1I6HC 2IS2A 3GTPC 4YIFA 3PO2C 3GBGA 4GYIA 3CAGA 3WG7H 2HYJA 3U2RA 2LF8A 4G7OA 4A3LC 2IXSA 1XPPA 3DCFA 3WU1B 2IRFG 1KGSA 2EB7A 2FX0A 3PL8A 1I5ZA 1DCPA 2EBBA 4LMYA 3PNYA 2HR3A 5LHGA 3PO2K 1IRZA 2M45A 2X0LA 2XHKA 4A3EJ 2X4HA 1IJWC 5CVIA 2Y0MA 3FF5A 4FQGA 3MKYB 3M07A 4LOCA 2EFQA 2YU3A 1MJAA 2L9NA 5E3MA 5KNLA 1JKOC 2VBXA 2VJ5A 2HQNA 2YR2A 2HTSA 3ADAC 3L2CA 4BY1K 3FKIC 4GGGA 1GV2A 1MH4A 4A3MJ 5IPAA 5J1YA 2HKXA 1ZGWA 4OAZA 4XLHA 4YG2F 1I3QA 4CCKA 4KIBA 4DOZA 1SFOK 1GV5A 1SAUA 4AIKA 3KCCA 3E6CC 5BMZA 2JA2A 1MNMC 4PFPA 1Z9CA 2EWNA 3I9V2 4HX4A 2ME0A 4ZDPA 5JVGF 3C2BA 1FZPB 3S1RK 1MNEA 1WCMJ 2ELHA 5E1XA 1X58A 4A3EK 2EK5A 2K9QA 4KN7X 5C4JK 3PO2J 2ZXWH 3H5RA 5DS9A 1TWCA 2KJBA 3S0XA 2BVLA 3DQVC 4DQ2A 1IXRC 3FXRA 3QU6A 1W4MA 4XBFA 3CJRB 4LOWA 4BBSC 1EH7A 4A6DA 2OC6A 4E4HA 3BG9A 4KASA 3ABMH 2ZNZA 1X19A 4FTHA 1TWFA 5KAFC 3HDDA 2WA0A 4F93B 3GTKJ 5DD4A 1XS9A 3FMSA 4Y7NJ 5BPDA 4DBQA 3HOYK 5FFZA 1XTAA 1IN7A 3V8LA 2RGVA 3HKZD 5DD8A 3RZOK 2DPUA 3CTAA 2XV4S 3FMRA 1Z3YA 4CCMA 4EGZA 3TOBA 2CYYA 3S2HK 2BY0A 1L0WA 3A01A 1QBJA 2R92J 2ZSIB 3S2WA 3R61A 2N8GA 5LHIA 1Z1DA 5K5QA 2WAEA 3HC7A 4RAFA 3I4MJ 3G3ZA 2Y69H 2ZJ2A 3BCBA 4Q47A 4Y15A 2E2JJ 2ME6A 5HS9A 1VQ8I 2W82A 2W57A 5L3GA 3TTGA 1SVMA 2MLGA 3GEIA 3N0BA 1FBUA 2BHYA 2FU4A 1O7FA 3WTVC 2KDOA 1P7JA 2Q2EA 3KP2A 3CF5F 3MZ8A 3NUHA 2EQRA 2GA2A 2V9KA 3QOEA 3GDZA 3LSIA 2JQ7A 1ZXOA 3I64A 3CLOA 1DU0A 3A0HC 3S2DJ 4B3AA 2NVYC 2QBYB 2L7MP 2O7OA 2QCOA 2XAGA 3GTLK 1RUNA 1V5VA 1R9TK 1WSUA 4UXNA 1I50K 2D1HA 1FMVA 3WE2A 3KEYA 5D6EA 3N97A 1AKHA 4P9UA 1DPRA 3H5NA 1K83K 2CFAB 2Z99A 4FE7A 1LE8B 3IKTA 4UNOA 1F7VA 4P5OA 3HZJA 2E35A 3BDDA 5B66C 5ILVA 4DYQA 1QRYA 4LJZF 2CV0A 4D5FA 3E5QA 5C4XC 3LSHA 4BEHB 4A3KC 1UJ8A 2F6CA 2M8GX 1SFOA 1OR7C 1FSEA 3U1DA 1J2XA 3V7SA 1EQRA 5CVJA 1ZREA 3ZRGA 2QYOA 5C4JC 2ZMEA 2HU9A 4HW0A 4C3JK 4O3MA 4LLGF 3G1LA 4YFXA 4U0WA 4LFUA 2K9LA 2DJIA 1WJBA 2GXAA 4L9TA 2E1NA 3F3XA 1KQ8A 4EVIA 4I6ZA 5TJJA 1TWHK 1VNDA 5M3FJ 1JI8A 4OINF 5E18F 2Q2EB 2FMLA 3R6SA 2R7VA 4A3DC 1RPWA 1I50J 2M8EA 3B73A 2KZGA 4HAMA 1QHHD 4U87A 3RCOA 4EM0B 2R93C 2FQTA 4Q5SF 1X3ZB 4HDUA 1KQ9A 5CQEA 3FXJA 4NNJA 4CZCA 1AA7A 3RDIA 3H35A 3DLAA 4UB8C 4XKBA 4RMFA 2LG4A 4E7JA 1SAXA 4ENJA 3RKXA 2OAZA 3C3WA 2M4KA 1RI7A 2P81A 4RB1A 2QENA 3KZZA 3OS0A 2Y31A 3MWMA 4KATA 2GAGC 4F91B 2GZWA 4G12A 4A3BK 3SFZA 3SZGA 3HEFA 5J4VA 4WXCA 5F6FA 1N78A 4XLFA 2MA3A 2M2EA 4LITA 2F4IA 2LNBA 2QF7A 1I3QK 4Y13A 2R92K 4BHCA 2LK2A 3C2GA 3MKLA 4M74A 3EUHC 3L2UA 3GTQC 1ON1A 4F7ZA 5FGMA 1FTZA 4A3MC 4L0YB 1WOPA 3QOPA 4JX6A 1B1BA 3NWTA 1DCHA 1WGXA 3GTMC 2NVQJ 2O8XA 2D2WA 3GEEA 5IOZA 1FOYA 2ESNA 5F04A 1M1EB 4OIPA 2EZLA 1X1CA 2CRGA 3KZIC 1LE8A 3HOVK 2P0WA 1MBGA 4E7LA 3RQ4A 3QPHA 3FM3A 3PFYA 4BQOA 3BJOA 2XCOA 2JPCA 2M3AA 3AQPA 5FLMC 1T95A 5JI6A 4GFQA 4CUGA 4G6TB 3S1NJ 5IYCK 2KLOA 3HOVC 3SZYA 1XMXA 3M3YK 2VONA 4ZH4A 3I4NJ 1OYIA 3GTQJ 4P9SA 1VQPI 3ABTA 3S1RJ 4MNUA 1ACIA 2VBWA 2GSNA 2O5JA 1MKMA 2ZC2A 2BV6A 3H1CA 3V4GA 3W6JB 2YU9J 2L4AA 2ELKA 3S8PA 2EV6A 3FOEA 2JA5J 3RZDK 5E8GA 2K9SA 2HOAA 3SFIA 2LREA 1D0ZA 3OYNA 1YS7A 3E5UA 1LUJB 3LSJA 3QQAA 5A2QZ 5E3OA 3ZQLA 2A07F 2BYVE 2F48A 3KFWX 5M5YK 3WTYC 1KA8A 2UZKA 1ERDA 1GDTA 3BCAA 1WJFA 2KRFA 3E1SA 2BGCA 3S2HC 4AYBA 4BXXK 2YU9K 1QZEA 3OOPA 2M5WA 1L3LA 1IXCA 1R1UA 3OYCA 5E1ZB 1VRQC 4G7HF 3H0GK 2IA0A 3S93A 2NVUB 3DF8A 3M8FA 3ZN0A 4GDFA 5CLSA 1G3TA 2XRLA 5FKMA 4AD9A 4TV7A 1LDJA 1JJ6C 4XORA 3QWLA 2H09A 3T8TA 3HUGA 4BE2A 2KIUA 1HW1A 4FISA 2XDVA 4L5EA 2PA8D 1D0XA 1QPIA 1G3YA 3GTJC 1OYYA 1IW7A 2XAQA 3HOZJ 2R3SA 3HRTA 2VQLA 2VOPA 2L02A 3EQLA 3T1BA 1UHMA 5BQTA 3F6VA 2NVQC 5HS8A 2KKOA 2NRAC 2W48A 3BP8A 5M5WK 3NARA 2JTVA 1VQNI 2W4SA 4Y52K 1GT0C 1JTYA 5IT3A 4NHJA 1TTYA 1YX5A 2Z3YA 2FBIA 1PP8F 2LKPA 3Q0VA 4XONA 1D3YA 2XAUA 4KYWA 1X1PA 2HTJA 3J7AO 3H9GA 2DT5A 3J7AY 4Z6YA 5DM7F 2D45A 3Q3QA 5B1BH 3CCMI 4FCYA 4B3XA 2QWWA 1J6XA 2VC1A 1NTCA 3ABUA 4BUPA 4M9XA 5GAHJ 2KPMA 1H9TA 3UKGA 1FSHA 3FK7A 3LSKA 1JKRC 3GTMJ 5D6FA 3CJTB 2P5LC 1WQGA 1RNLA 2NVXA 2YU9C 3LL7A 2DMQA 2GM4A 2MC3A 4IQ4A 2Y0SD 2A69F 1OCRH 3A03A 1S7AA 3TDZC 4U0YA 2ZO4A 4HF2A 4A3LK 2WV1A 3TP3A 3JRFA 4K2EA 2L54A 1JTXA 3KP7A 1F9NA 3ZQIA 2IP2A 1TQMA 4CYCA 1WH5A 2K02A 2RV8A 1U8RA 1RU0A 1D1BA 4ENNA 2JRMA 1K4SA 2EINH 3GTOJ 1TWAC 2I10A 4I2OA 3DBRB 4JQFA 3S1MK 3DEUA 3N3YA 1T08B 2EV0A 3ABKH 2PMZL 1SVOA 2ISYA 3GTPA 4IQJA 1ZBSA 1MBFA 4LIVA 3TMOA 2ZUFA 2EV5A 2KMUA 1UFMA 4OIRF 1QZZA 1P92A 1ZELA 5M3MK 4PUSA 3G1MA 4ON0A 1HI9A 1YCLA 2EH3A 2LVSA 2XRNA 3RKYA 2LKXA 1JT0A 4A0XA 3CCQI 2UUZA 2IJLA 1ZRCA 5DV5A 2KIMA 3SDBA 1LNWA 1B72B 3PQJA 3HB9A 4EEFG 1YJWI 1BJTA 4WJ4A 4M9ZA 2VODA 1IN6A 2PN6A 1Z21A 4ABZA 3CF2A 4ZYDA 3S1MJ 1QA6A 3H0GA 2VUMC 3SXYA 3J80K 2DYRH 2NYXA 3CQZJ 4PDKA 2X6WA 1KYWA 4L5JA 2B9SA 5FB2A 1S9HA 4HV5A 1TQIA 1IO2A 4XICA 3KEOA 4IPAA 5HDNA 1UAAA 1BJAA 4KDDA 4BQQA 3TQNA 1P9QC 1DU6A 5F1JA 3LOCA 4X1EA 4CSWA 4A3FC 3S2DK 2DLLA 2Z5UA 1ZG1A 1U5TC 5EEHA 2KZVA 3BPXA 4BHBA 2HNHA 4GYGA 5JFRA 4WILA 1MD0A 4QTRA 4RM3A 5CYVA 4BNCA 1MBHA 5BNGA 4G0UA 4XM3A 4NUBA 4C3IK 1H8AC 4BXFA 4ASNA 2X85A 2LC2A 4NC8A 3JRCA 3I4MK 3O8HA 3MEXA 1TWCJ 4HQEA 2Y0SN 1Y8QB 4C3HC 1FC3A 3D1NI 3RI4A 1ODDA 1W36C 2HPMA 4OAYA 1Y1WA 3DKYA 1E3HA 3L2WA 2MSYA 2YS9A 5CQGA 1SMTA 2BY3A 4LQYA 1Y1VK 2V6UA 1C0WA 1GHCA 1J75A 4BBRC 1ZR4A 4XLAA 2ZMEC 1QO0D 1UHSA 4WWCA 3I56I 4ZYAA 1TWFC 2W7NA 2D6FC 2YSRA 2G7HA 2PMZD 2WAQL 5M5WJ 2RQPA 5AIPA 4A0ZA 2XF7A 4EATA 1TT5B 2O5IA 4XKVA 4HF1A 3HOWK 5IOSA 1U9OA 2XF5A 2DXIA 2EA2A 4ENKA 1R5GA 2DDAA 2Y2ZA 4HV6A 4HNUA 2VI6A 1J6WA 3V7RA 4N4NB 2B7EA 4D9JA 3GUDA 1YE9A 3J80Z 2ZFWA 4M6YA 2WAFA 4G7OF 5LRRA 2Q0OA 1OCTC 1WCMA 1GXPA 3AL0B 2K5CA 3CC2I 4P5BA 2TRTA 1IUYA 1GUUA 2XGEA 4KIGA 2WB1A 3T0YA 4A3IK 4UUTA 1J59A 2LBFB 4YFXF 5E20A 4GXOA 1AB4A 3GF2A 3C7JA 1I39A 3F8BA 2ZFUA 4LLLA 1J9IA 2XKOA 4HZFA 5EGEA 3OYHA 2V9VA 3VFZA 1ZAOA 2K86A 4KM8A 3IKVA 1RUOA 3CC7I 2DU9A 2BVMA 2B63K 3F9KA 1G6NA 2ZXHA 3DLLF 3I3LA 3MD2A 2CUJA 2O3FA 3A02A 3MVPA 4AVPA 5FLMJ 4D1QA 4J3NA 2K4BA 1IDYA 3VSKA 4QJVA 2HDWA 4A3FJ 5FD5A 2LKSA 1YW9A 2H8RA 5FKNA 5FLMK 3IPJA 1LDKB 2L5QA 1FMWA 5HNHA 3IL2A 2DI3A 1G59A 1V5FA 2OBPA 2CW7A 1I1SA 3QPTA 2JA5K 5E1WA 4KIFA 4DYRA 1R4NB 3ECOA 4H0EA 2QKMB 5HNFA 2W24A 5H6QA 1OFCX 4BJ5C 3P9IA 3RYPA 4EM2A 3I4NK 1BR2A 4WXHA 4A69C 2XPVA 1YX2A 1TNTA 1TT0A 1TWCC 1W5TA 4A3GK 2ZUEA 3FDYA 3LFUA 1JQWA 2LF7A 2OF7A 2R0QC 3H0DA 1W7PA 2M7BA 3A8JA 4HNVA 1XSVA 5EF6A 5FLXK 2BW3B 4WJ3M 1TLHB 1ZGAA 3BG7A 2E2HJ 4IF4A 2RGRA 1I6XA 3RJPA 1VQ9I 2KL4A 3F6OA 4PJJA 3QX3A 3BZ6A 3WE3A 2R7WA 2ACJA 4KICA 5GPCA 3AFHA 3AD7C 1ZQ3P 3KP5A 4KB4A 4KMAA 4BH9A 4JX4A 4XIDA 4OIPF 2E7WA 4UUSB 1EI6A 1I50A 3L2RA 1MMAA 3VEPA 5B3SH 5ICCA 2OTJI 2CFAA 1O2AA 1PDNC 5D4DA 3OYKA 5FJ8K 2BE5A 2R93A 2R7SA 4A3KJ 3S16K 2VKDA 3EQLF 1IV8A 4QJVB 1I3QJ 2VLAA 4LLGA 3KPHA 4AUXA 5D8LB 3VSLA 2GAUA 5JR3A 4DZJA 4OIQF 3T00A 3S15J 1XZPA 2HKOA 3BR0A 4ZTFA 1BC7C 5EGOB 2EPFA 4IRHA 2F4MB 1VJEA 5C44K 4C3IJ 4BLAA 1JKPC 2CGPA 3G73A 1YLFA 1A36A 2NNNA 2H8WA 2DBBA 2BZTA 3OY9A 4MQ9F 3KP6A 1DUXC 3PUFA 2Y48A 3KYDB 4CO8A 1FIPA 1EFWA 1T38A 3I0TA 1I1GA 2OV7A 3BY6A 3SDGA 4CDGA 1WOOA 3GTLC 1O2BA 1A04A 1IZ1A 3A8IA 1R1TA 2X6XA 4EJTA 4A93C 1VQOI 2A5YB 2A68F 3BR1A 2GSOA 5JVTA 2RQQA 4BJ6C 2UXNA 1V3FA 2NXNB 2E2HC 1VI0A 3ZQ7A 4DJAA 1YITI 1HF0A 2EZHA 1W36D 5IYBK 4NC6A 3ZMSA 2GAHC 2L7ZA 3BG6A 3ZMZA 1YJ9I 4G7HA 3QYEA 1U5TB 3FBNB 4LB5A 2ZXIA 2GXGA 2GIZA 1Y1WK 3W2VA 5E3LA 1SD7A 1O28A 2OZ6A 3GTJJ 4LJZA 2F5DA 1OR7A 2JZYA 2LY2A 3G4AA 4QWQA 5K5RA 4OMYA 1HDPA 1V55H 3ASNH 3S16C 4G0VA 2CQKA 2K40A 4GFBA 4KUMA 1W7PB 3PFIA 4C3HK 1UHWA 1LJ9A 5ICEA 2BXYA 4A3CC 1T2KA 3JR9A 1NG7A 2VASA 2BHZA 5EZHA 4XRMA 3LFKA 1USTA 5KK1A 5EGOA 4BY7C 2VT3A 4KMHA 2XF6A 2P6SA 4NQWA 5E68A 1RKWA 1MH3A 4N0BA 4XQFA 2V7FA 1TWGA 2ESHA 3GWZA 5HLIA 2E1OA 3T01A 3GCMA 1ETKA 2MYSA 3DXJF 1JGSA 3VOEA 1WJCA 1R9TJ 5IP7C 3JSTA 5ICFA 1SMYA 2PFBA 3FHZA 3WODA 1Z05A 1FP2A 1HSJA 2LD5A 1DQUA 3L2QA 3DU5A 1WKMA 4UVCA 3K6GA 4XSXA 3GZ6A 3CESA 2XB5A 3S32A 3H36A 2A05A 1MNDA 4EGYA 1Z7UA 5GAEJ 1WOSA 3OWTA 3HOUJ 2DFHA 2CV1A 4G6QA 2JWTA 4C2MK 4JOMA 4XOPA 5C4XK 1T0FA 3BJAA 5E17F 2P7CB 1Y1WC 2NVTJ 1PP7U 2DA2A 2HOSA 2WBMA 4XLNF 3MKWB 2Y3PA 4FHTA 3U21A 3V42A 5F0FA 2PEXA 2NS8A 1K79A 1F5TA 4CCNA 5J1UA 3K4LA 3F21A 2STWA 1RC9A 1Y0NA 4XLPF 2W00A 4RGRA 4CCOA 2DT7B 2Y0SL 1JT6A 2NNYA 1H88C 1RESA 3HXAA 1O3QA 3A0BC 2UV1A 2G7UA 2EJRA 2E2HK 2XSJC 2E1MC 3W3CA 3K4MA 2V1XA 1BA5A 3BR5A 3K4JA 3HRMA 4RGXA 4LIUA 3HSRA 1Y0UA 4OIRA 2PJPA 3CJNA 2PQ8A 2HQRA 1MIJA 1D5YA 3HTSB 2E2IA 1XMAA 2PJRA 1R23A 2Z1DA 1EF4A 5JLXA 1OCCH 2FD5A 4ZZDA 2VUMJ 3HTUA 4M3DA 4LK0F 2R93J 4YIRX 1CF7B 1I6VA 2IEKA 1AWCA 2E2JC 2QM3A 1PJ6A 4WX9A 2KDZA 2LMDA 2M9HA 2YUSA 1Y6IA 3R60A 1HKQA 5JFEA 1SFEA 2FF4A 3HGYA 3PNTA 4U7DA 3HG9A 3M4OJ 4RDUA 4WCGA 3DBLB 3QYBA 2PLYA 3CD6I 1LVKA 4C2TA 5K5OA 1K83A 4II3A 1LEAA 3ML6A 3HHHA 4RB2C 4KN7A 2CJJA 4CHUA 3AG4H 2ZJPF 1MBJA 2QZ8A 4EQQA 2LY9A 4Y7NC 4XK4A 4A3MK 3MMLB 1BOBA 2IAIA 2QA4I 4UY8I 4MQVA 3RZDJ 2JA8C 2BY2A 2BY1A 1RZ4A 1ZR2A 3OOUA 3CO6C 1BW5A 1IRFA 3PNVA 1TWAA 4D5CA 3BROA 1K61A 3CQZA 1B4BA 2EIMH 2Y0SA 2CH0A 4R79A 4DNCA 2MH9A 2LRDA 2NVXC 2Z2SB 5CPRB 3CMYA 1LFUP 4DBRA 4BL0B 3HOUC 1R49A 1XDSA 1XXBA 3GZ5A 5IYCJ 3L00A 1W5CC 1R71A 2RH6A 4LG0A 2VL8A 1UG2A 1ZQ1C 1TWHA 5E79C 3IAM2 2CQ7A 3EPZA 4PCQA 3TKYA 1B6AA 1TBXA 3GW2A 1H89C 1VZ0A 1HA8A 1YQAA 1VQ5I 5LEKA 1IDZA 1BR4A 2BBYA 2MG4A 2OA4A 3OR1C 3RTRA 4XRSG 1O7LA 3KEQA 3OYLA 3BZKA 3G1OA 2QBYA 1MSFC 1X1DA 3B6AA 3FK6A 3RZDC 3C18A 2V6TA 3HOXK 4KMDA 2EBIA 5EDNA 2VE9A 5TMCA 5L3EA 3KP3A 5EZGA 4IHVA 4E7ZA 5IYBC 2E7XA 1G51A 4IJAA 1P4XA 5TISC 2H6CA 3QRFF 4DIQA 1H9GA 4CCJA 3LAJA 3PJRA 2QKLB 5FKLA 4ZYHA 4GTFA 1XGSA 2X48A 1BOAA 3N0CA 3GTKA 1QGPA 3PIOF 1K7AA 2CS3A 1KQ0A 2VPLA 2IPQX 4YIIA 1UB9A 4KITB 3L1PA 1DP7P 1TWGK 5DUIA 3S1MC 2KHMA 2OQGA 3E7LA 4JBAA 3A2KA 3LAPA 2HEOA 2AQFA 3V8KA 2IW5A 2LFBA 3FKIA 1GE9A 5ED4A 1JOEA 3FKJA 4IHXA 4IXAA 4KT5C 2DA6A 5F64A 2IA2A 4YFKF 3JRDA 2OPTA 4U7BA 1I3QC 2YX7A 2X1EA 5D5UB 3I4PA 4E70A 2FQ4A 2K85A 3TL4X 2XSDC 3N05A 4ZDLA 2HPIA 4HA8A 2BOLA 5CVRA 1P6RA 1G3SA 4XSZF 3F8NA 1JGGA 3LQQA 2E60A 1D1AA 1GLNA 4D0PA 3GVAA 4WXDA 1ZYRA 2JA7A 3CUQA 1NG6A 2MBFA 1BM9A 4EM1A 1X1BA 4HEA2 1W5SA 5JLWA 2V79A 3F72A 1EKEA 5IORA 4QSHA 3H9QA 4C3HJ 1TZLA 1UG0A 2ID6A 2DA7A 5M3MJ 3VWBA 2A6EA 2P5KA 5GP9A 3CCJI 1YS6A 4QLCU 3G4SI 1Y1WJ 4BQNA 1AOYA 1RETA 2E71A 2H1KA 2JK3A 1I3AA 1HW5A 3ZP5A 2KP6A 3BC8A 3JSPA 2VUMA 3GYHX 5JVOA 1P4WA 1QQIA 4MEXF 2FOWA 1R4MB 3FWEA 4Y33A 3GEZA 1BBYA 1BGWA 4YEJA 2X1CA 3J7YJ 4RBOA 1B72A 2IBDA 2F5EA 4B1RA 2FUG2 2IGNA 3FHNA 3VYUB 4B4CA 3OYBA 2BE5F 3DU6A 1FX7A 2R5YB 5DCMA 3JAMZ 4KJZA 1NH3A 1A5JA 3CC4I 3T5XA 5IP7K 4FZBA 3I4NC 2DMUA 2VKVA 3VPRA 3HBLA 3R4KA 3OYAA 1HOMA 4YFNA 4A3LJ 3IAS2 2XPUA 3M8EA 4KAWX 4E7IA 1ONVA 3FISA 4A3JK 3OIQA 2E19A 4A3BC 1XZQA 2PX9A 3S3MA 1O26A 4QIWL 4PAAA 1U9NA 2O03A 5D4RA 1XX5A 2VKHA 3CCEI 4J00A 4ENMA 3L4KA 1RR8C 2L9SA 1ZHFA 4EJWA 3E0JB 2E2JK 2R7RA 3H3UA 1SD5A 3IP4B 3DV8A 4HQMA 3I55I 2E5NA 1DGRM 2D1VA 2YPRA 2VJ4A 3E6MA 5LGUA 4AIHA 2O9LA 3ZR8X 3OL4A 2NAZA 3DTIA 5HDGA 2ZJRF 2XUBA 4P5AA 3D5RC 4P96A 3AAFA 5FJ8J 5J40A 3VODA 4Y4RA 1FBQA 1PVEA 3OS2A 3BP3A 1IBAA 2B63A 1KU3A 2H94A 3LA3A 4II2A 3BOQA 5IY5H 4Q4ZF 5FKOA 2IT0A 4E7KA 2DCEA 4HYEA 4B44A 5KCMA 3BWGA 1DDNA 2DOEA 3FKIK 4Y7NK 4IHTA 4YG2A 4KMFA 3ZMTA 5ILUA 4RGUA 3M9AA 1J98A 1LFBA 3ELKA 1I50C 4HSRA 4GTBA 2GBYA 3KE2A 2VKEA 1SD4A 4CXFA 2M1BA 1S29A 3IH4A 2KIFA 5CHPA 3F8CA 4BS9A 1S3JA 4U88A 5KHDA 3GX4X 4BU2A 2EFWA 2CQNA 5GADJ 4B43A 3CLQA 3TO7A 3TW7A 3K7AK 1MMGA 5C3EK 3FBIB 4KA4A 5J6XA 3K70C 2VC0A 4Z2YA 3S1QJ 4M3GA 3H0GJ 2FOKA 2L7KA 1USOA 4O2DA 3HUGB 3QODA 1FIAA 3I5UA 5CVVA 3GFIA 2A6EF 3HSFA 4IZZA 3H5AA 1FBSA 1S6LA 5ICGA 1LPQA 3V8JA 1VQ6I 2XKPA 3M3YC 3DXJA 4GZYA 2QLZA 5EYRA 2QSFX 4B48A 4BBSK 1WHUA 5IYDJ 5FLXZ 3BTIA 3H3VL 1WFXA 3QPSA 3JSOA 4BBSJ 5IT9Z 2K9MA 4M6VA 4V19K 1WSVA 1POGA 1U8BA 2ECBA 3SZZA 2DK8A 4GRIA 5J1RA 1IAWA 2ICWG 1PUFA 1FOKA 1YNJA 3JRAA 2QQ8A 4BBRJ 3LMMA 1O57A 2V1DA 3KZYA 2DMTA 5K7ZA 4ZYGA 2DA4A 4PJLA 2ZSHB 2DA3A 4U0VA 5IP9C 3GTQK 4KT6A 4YFNF 4UV8A 4A3JC 2JUCA 2QQ9A 4FASD 4A3IJ 1Z67A 1LVAA 3S1NK 1IG7A 2HYGD 1O3RA 2LBFA 4HPQA 4FX0A 2JVGA 4J01A 2VIXA 1BDFA 5L3BA 2VT2A 4AIDA 2GSUA 5CVUA 3AKZA 3QP6A 1VQKI 4H4KC 4ESJA 1KU2A 1ETXA 3CCLI 4UB6C 3HOVJ 3PO3J 3DTEA 2XB0X 1STZA 3LA2A 2ID3A 3FKIJ 1HLVA 3H0GC 1XC5A 1HCRA 3NAUA 3TP0A 3F0CA 1W0UA 3FXKA 3BUEA 1N25A 2COMA 2KISA 1HKSA 4PJNA 2X1DA 2O5RA 3U1KA 2DOAA 2EILH 5J8FA 2V9PA 2CQXA 4QPQA 3HPGA 5JHUA 1IF1A 1MJ9A 2MD0A 5LGTA 2A69A 1E2XA 1YYVA 5DTDA 2R7ZA 1Y8RB 1U5TA 2VBZA 3GTGK 1IXSB 4LK0A 5C4XJ 2OCEA 3ERMA 2MD5A 2MW8A 5FFXA 3GTKC 2HXIA 3U9GA 4KMUX 4PJMA 2P7VB 4S04A 1PUEE 3RKWA 2AO9A 5TRDA 1MSEC 1T56A 3GXOA 1WJEA 3PQKA 3ZQCA 2K7LA 4A3JJ 1YNNA 1RR7A 3K4CA 3WTXC 4C3JC 1LQ1A 3DPLC 3KX2A 3WU0A 1X2NA 1ZN2A 1F1ZA 1K4TA 4BE0A 1U78A 3ASOH 2CW8A 1ETQA 1XB4A 1Z77A 1Z6TA 1VGXA 2GQQA 1X3UA 2L9VA 2DQLA 4RGSA 1XSXA 2XGXA 3RZOC 2J5PA 3AQOA 2H6BA 2A68A 2JT1A 2IGOA 2WTEA 2PMZA 3H92A 1X4OA 4GCVA 5KAIC 3BPVA 4AU7A 1YRNA 1UV7A 4A93K 3GFMA 4N4OB 3HPHA 2V4JC 3FXLA 2R92C 1TW3A 4PGHA 3JREA 4A3IC 1XG1A 2E5ZA 1HXDA 1JUMA 4M9SA 3MAJA 4W1UA 1K78B 2HZTA 2WB1N 3MZHA 1CQTA 2IGMA 4JP0A 4IKFA 2E34A 5AONA 4A12A 4M3BA 3IWFA 2Q1ZB 3HKZA 3CDLA 2HVQA 5KVRA 2QQBA 5HLTA 1WZ2A 2CU7A 3JCUC 1UMQA 3PO3C 1ZLKA 1YO5C 4XOTA 4ZYEA 2JA6J 3HRSA 5IYBJ 1PJ5A 2GIVA 3CZ6A 3IV5A 1K83J 2COBA 2DW4A 2K9NA 5LBQA 5HDKA 2QEXI 3J7ZI 2WAQD 2L01A 3K1MA 1Y39A 3A01B 5LLQA 5L46A 3P5JA 3TFIA 1R58A 3K70D 1SVLA 3GMEA 1XXAA 3FZVA 5K1YA 3HOSA 2L7FP 5B5EC 2IS1A 2EFPA 1XSDA 3ROUA 2V6EA 2GA1A 2RC4A 3HKZN 1S7EA 2V1NA 3EUAA 1XDUA 1YHQI 1TW2A 3GIRA 2HYFA 4OWRB 2YU9A 5C44J 2M0CA 3X2QH 1KQ4A 3L4JA 3L2VA 2RDPA 2Q8KA 3D0SA 4ZC3A 4UVAA 3S15K 5C3EC 2HS5A 2PG4A 4L18B 1SFXA 3LSMA 3SYTA 3V7CA 3O2PE 3CMMA 4A3GC 1MMNA 4YFKA 3EYYA 2R7ZK 1ZG3A 4DGWB 4I76A 1VH2A 2PBIA 3BZCA 2KWAA 3GTLA 2B0LA 1LDDA 2CWEA 1TWHC 2CW0F 4P1WA 1XD7A 4OINA 3BTCA 4XLNA 1DPUA 2FQOA 3TOAA 1OCZH 2J5OA 3HOWC 1SD6A 1JHHA 3RZOJ 3HJEA 1IS1A 2ZBKA 2HDCA 1XPXA 4O5VA 4G8XA 4XRFA 4AC0A 3HOYJ 2A6TA 3DEWA 3S14C 2E1MB 4I01A 4BE1A 5B1AH 3I71A 5HS7A 1HDDC 1A35A 4KDPA 3HSEA 4ZDOA 4JK1X 3PUBA 1O4XA 1FYKA 3CP8A 2XAFA 1IN4A 2ZNYA 3LSTA 2FMYA 4OIOA 4D7NA 4MTEA 1TL8A 4E6KG 3G2BA 1YTYA 4A3GJ 1HW2A 5F27A 2OJED 3FXUA 3IUOA 1NK3P 1Z91A 3I59B 1WCMK 4IRIA 1OKRA 2L9RA 2JSPA 2VQCA 3VYRB 1ZARA 1HKTA 2LTPA 1R5HA 3BR6A 4HX8A 1ZH5A 4M73A 5TMFA 1VQMI 2R7OA 3KETA 2FA5A 1BR1A 1S8NA 1CF7A 5EEAA 1MJBA 1ZRFA 3TO6A 2M7AA 3CO7C 2DOFA 3OS1A 3LSPA 3H3VD 4C2UA 2IS4A 1KU9A 3HIFA 5IYDK 2Y30A 2DT6A 3KYCB 4NOIA 1ETWA 2NVYA 1O3TA 3QPLA 4AH6A 1YJNI 1FYMA 3NQOA 2RAEA 1AHDP 2BEOA 1MDMA 2QQAA 2DPDA 2EIKH 3M4OK 4CYCB 4LK1A 3NRVA 5LRSA 3RQIA 3RYRA 5DM6F 5J3LA 3BR3A 1QPMA 4C45A 4BKXA 2ETHA 1ETOA 2R7XA 3S1QK 3OYIA 2CMPA 3M3YJ 4IRGA 1BL0A 4RM2A 2IS6A 4QIWN 5C3EJ 3W6VA 2JJ7A 2EIJH 3Q0UA 1TWFK 4CCLA 4BAYA 3ZMDA 5BS6A 1QVUA 2JVHA 2P4WA 2A6HF 1XN7A 3CDIA 4EV0A 1NK2P 1VF9A 1X4PA 3G71I 3ZN1A 4XSZA 3WG9A 4LR2A 5E3NA 4C30A 1G8XA 2JA5C 1T6SA 3OMYA 2QUFA 4PK4A 3H9JA 3HOTA 3DEEA 1SFUA 2DYSH 3HOWJ 4ILDA 4Q4ZA 1XGOA 2K3FA 2FBKA 2RVCA 2DTZA 2VB6A 1P7IA 1IRGA 2LOOA 2PPBA 1E17A 2JA7C 2GOXB 2AS5F 2VN2A 2FNAA 3K0LA 3ZGKA 2L2OA 2XGCA 1FJLA 3CUOA 5D8KB 2OUMA 4BHPA 1WCMC 3IC7A 4R1HA 1WJ5A 4IEJA 1XGNA 3UNGC 3MMYB 1A6QA 1B9NA 1O3SA 4PGGA 1FNNA 3M8JA 3B02A 3I53A 2DMPA 2ELJA 3P9CA 4GT9A 3DP7A 2ZFZA 1JE8A 1TWAJ 4AYBL 3GTOC 4HX7A 5CJ9A 4BQAA 4IOCF 4XKWA 1R9TC 1IW7F 4FT8A 2AXTC 4HG2A 4B47A 1Z7LA 5D5VB 1Z6RA 1O29A 1T0FC 4XN0A 2M34A 4HF0A 3WU2C 1K83C 4I98B 2NVTC 4BXUA 4NQWB 2DA1A 1BJZA 1Y1VA 3ECHA 3EUHA 3DTKA 1ZG5A 2O61A 2AXLA 4Y52C 4YRVA 1K6OA 3ZMVA 1YIJI 3GTGC 5HL8A 3JRGA 1MW7A 5IP9J 3ONQA 2NS0A 4M3FA 4OU0A 5BPIA 1JVIA 3CCVI 3K9TA 1H0MA 4M72A 1UCRA 3DBHB 2RN7A 4L5IA 2FSWA 2QGUA 2C6YA 3K7AC 4XL9A 4MTDA 3CQZC 3BQZA 3D5SC 3IHUA 3REOA 2CFOA 4BDYA 1RRJA 1I6HK 2KT0A 4X6AC 4C3JJ 4KFCA 3ZXSA 3K69A 4MO7A 1V5GA 1V54H 1YW8A 1DGWY 3DPUA 3KYLA 4MFDA 3ERED 1VFCA 3TDUC 2R7ZC 2CG4A 4HBLA 3MCZA 4F52A 4QPOA 2G0EA 4XNFA 5FO5A 1W1WE 1SC7A 5FKKA 5EG0B 1ZVUA 1BIBA 4DDQA 3S15C 2MFZA 3C1DA 1JJ8C 1I6HJ 2DFEA 1R36A 4BDZA 4BLBA 5ILSA 2FE3A 3SHFA 3HKZL 5IOYA 2LSOA 1ZTRA 2Y9ZA 2EFOA 2EZIA 2XPWA 3GFLA 5D5XB 3GTOK 2IVMA 3L09A 5J47A 3MN2A 4RLFA 5IP9K 2X6OA 3BQYA 3BTLA 3KIOA 3AG1H 2VE8A 1P2FA 4I99C 3ZOBA 2CV2A 3GTLJ 2VQGA 4XLEA 5EJCA 2F4OB 1VQLI 1LEBA 4KMUA 3C2HA 2WB1D 1E3OC 3RSNA 4MHGA 2DFIA 3G4CA 1NHAA 3E97A 4MLOA 4RA2A 1XMKA 4IO9F 4KISA 5D5WB 3Q5FA 4RAYA 1MGTA 1IUFA 4IVNA 1J6VA 2PHCB 3WTWC 2JA6C 2P5VA 1TWGJ 4PSXA 2HGCA 4OMZA 2EA4A 3RPQA 3LWFA 3GTMK 2R92A 4IX7A 2LDUA 1USMA 1WIHA 2VOOA 3HYIA 2MLKA 4I7HA 1ULYA 2PMUA 2WC2A 3K1NA 3WHCA 1D8KA 4UUVA 4XCHA 4G6DA 2NVYK 3BG3A 5HOOA 2HVRA 5AIQA 3S16J 2JUGA 4F55A 5HVQC 4A3KK 2ZKZA 4IHSA 3GTJA 2LR8A 2B63C 4DZPA 4Y52J 4BKWA 1JUSA 1BW6A 1N75A 1Z0XA 2FQ3A 5M5XK 3M4OC 1D1CA 1JKQC 2R7DA 4R8HA 3TEDA 2XIGA 4JX5A 5DCMB 2DMNA 4BYYA 2AHQA 3JRIA 1N77A 3GTKK 2JSCA 3CUQC 3PO3K 2HZDA 2WY7Q 2Y9YA 2MC4A 3ZQFA 3HOZK 4Y3OA 4UUSA 2CUZA 1MMSA 2K3PA 2R7FA 2PA8L 1U0JA 3BR2A 3AG2H 3GO5A 3ZCOA 1T33A 4J19A 1JUPA 1V5EA 2H1LA 2BXZA 4MQ9A 1R6RA 3JW4A 1HC8A 1IRXA 3ZMUA 1TWFJ 3RPUD 3IRRA 1BI1A 3HOZC 2KRHA 2Z16A 5C4JJ 1KYZA 2JH3A 3HRUA 2R4GA 3SEZA 3W2AA 3FIWA 4F92B 3HOYC 5IYCC 3QAHA 3D5LA 1TWGC 3WTSC 3QP5A 4UVBA 3JRBA 4BBRK 2YX4A 3CCRI 2F5VA 4LB6B 2V1UA 1EH8A 2WB1L 1BIAA 1EJ9A 5LGNA 1PJRA 2KFDA 2OTLI 2R7TA 2OCCH 3CMEI 1WSRA 2MGQA 4S05A 3MFKA 3I4MC 1EA3A 2JPBA 2R7QA 2WV0A 3N4MA 1Q1VA 3F8FA 4BY1J 2B63J 1T98A 1WI9A 3OR2C 2ADUA 4O6JA 3HGGA 4L9NA 3IH3A 1BI0A 1OJLA 4M1XA 3TGNA 2DTRA 1ZKGA 3ULQB 4FE4A 4BGDA 3DWLE 2QVOA 2W85A 3S1RC 2IGKA 4V2GA 2L3DA 5L3DA 4EJOA 3I59A 5TJ3A 5HLHA 2VUMK 1PUFB 1OCOH 1U3EM 1WQFA 2WWYA 4GTAA 3VA7A 1WJDA 2F5CA 3K4KA 4ZTJA 2QSGX 1ETYA 1USSA 3K4NA 3OIPA 4EMSA 3FXOA 2W25A 5J4YA 2CW0A 3Q9VA 1YG2A 4KB2A 1SMYF 3ZQGA 2VQHA 4CYDA 2OZUA 1XXCA 2R5ZB 1HSTA 2TDXA 2Y75A 4WF2A 4V2FA 3T8RA 4A2UA 5HLGA 5LEJA 2E2IJ 3S14J 2NVXK 1IL2A 2GXBA 4L0ZB 4JYKA 3GTMA 3BG5A 3ISPA 3BLYA 1K6YA 4I0BA 1EK8A 1BI3A 5D4SA 5M5XJ 4G0WA 4KM9A 5CKTA 3J81K 1QVTA 3OL3A 1R22A 3WGIA 3JAMK 5LFAA 2OU2A 4MEYA 4M71A 1R5ID 1Y1VJ 1SEUA 5F08A 4X6AK 3CP2A 3K4BA 3R0AA 4CZZA 4ITVA 1X2MA 1FPQA 3LSRA 3ZQQA 4KN4A 2HOEA 1EV7A 4C2MJ 1TWCK 4A3BJ 2ZXJA 1K78A 5IYDC 4AWXB 1J5YA 3TBIA 3EUKL 2HQAA 4A3DJ 2X51A 2UXXA 2WADA 3LA7A 3GTOA 4XMYA 4HDVA 3HM5A 4X0GA 1HQCA 2L4MA 2ZMEB 4NB5A 3A8KA 3OIOA 3GTPK 2VPRA 4RAZA 1FT9A 5H6RA 1OLTA 1F4KA 3CMAI 4GTEA 2X9DA 3RKQA 3TFHA 2VBYA 1ZYRF 4GTLA 3QYFA 3IH2A 1BS2A 4G7ZA 4IL6C 2HXOA 3OYFA 2G9WA 5EEGA 2E1CA 4BACA 4LLNA 1R7JA 3W2WA 5A2QK 1XGMA 1G3WA 1Y56A 4RS8A 5TGTA 1R00A 5L3CA 1ZK8A 3BT9A 3KLNA 3COAC 3CCSI 2JA5A 5M3FK 4BY1C 2P8TA 3AD8C 1TWHJ 3OYMA 4A6EA 5F0CA 2R5YA 4FX4A 1FLIA 2JA6K 3F8MA 2V6CA 2ISZA 1PYVA 1FWZA 4G9YA 3WODF 2FNPA 3GEHA 1W7PD 3CCYA 3I54A 1YX3A 2DFFA 2XASA 4B8XA 1V4RA 3GLXA 2O0YA 3JTHA 4RB0A 1XZQB 3ZQHA 4A5MA 3S3OA 1G4DA 2PJRB 2HOTA 2JA7K 3P9KA 4HOBA 3SJMA 2L0KA 3G6EI 1YRNB 2BW3A 4KC6A 4WK8F 4HLXA 3OSFA 3GTJK 3GFJA 4B09A 1O24A 1DCOA 4KARA 3TFJA 1FP1D 4A5NA 1DD5A 3B6CA 5DCFA 2A61A 3P7NA 3MZYA 4NBQA 3F23A 2LY1A 4I09A 1R9TA 2DQRA 1WRJA 4QIWD 2JMWA 3OYEA 3FX3A
chains in the Genus database with same CATH topology
2W84A 5L3FA 5IOTA 4OIOF 3LPXA 3LQRA 2RKHA 3SZPA 1CGPA 2JRTA 3E3VA 4G94A 1Q1HA 1B4AA 4P9FA 3J81Z 1IN5A 4MEYF 5F1RA 4CGZA 5J8CA 1REPC 2H27A 3O6BB 1BI2A 3L7WA 5DDGA 1J0RA 2FBHA 2M87A 1YIOA 4AIJA 3FMQA 3E5XA 1JXSA 3WTZA 1ZRDA 2GWRA 4KNYA 4GTDA 2Z33A 2A3SA 4G7ZF 1P4AA 3EYIA 2HWVA 1TNSA 4LGWA 4ESFA 2XVCA 1OMIA 3W6KB 3CDHA 2Z9OA 4HLYA 1GXQA 1XCVA 4LG0B 3FOFA 4FM9A 2PI0A 2FRHA 2STTA 1B59A 4EJVA 3HHGA 3EDPA 3L9FA 2O6GE 4A0YA 2JA6A 5E8IA 5IOQA 4LD5A 1TQPA 4OOIA 3SQNA 2XAHA 1J7KA 2XCQA 1BN5A 3BJ6A 2FEZA 2M30A 2OQRA 2XAJA 2OD5A 3NEUA 3O3KA 1JHFA 2ZCWA 3OPFA 3E6BA 1S7OA 4I0AA 4LK1F 3VB2A 4C3IC 4Q48A 5BOXA 2F5FA 3OEPA 1R1VA 1MDMB 1O27A 1I27A 5IT9K 3KLOA 2PMHA 1ZLJA 3GTQA 1YW7A 1OPCA 1QZYA 1FYLA 3M1EA 3RIRA 3DPTA 3SZTA 4N9IA 2FXAA 3M7GA 4I02A 5LHHA 4ZH4F 3CUQB 5H20A 4GTCA 4GO1A 1HBXG 1ZGJA 2RNJA 3OREA 2K27A 1O25A 3FM5A 4UHTA 2P6TA 4EJUA 3RPUA 1VTNC 2K4JA 1EH1A 3OV8A 1RIOH 4MGRA 5DEQA 3H3ZA 1D8JA 3MQ0A 2EFNA 2CSOA 1QNTA 1KU7A 2UWMA 1U6GA 4RB3C 2DAOA 2XCRB 5FD6A 1YFHA 2IA1A 4C2MC 3GTGA 4ETSA 5DYMA 3K1PA 1XCBA 5ERIA 2P5MA 5EGHA 1BC8C 4UV9A 4CICA 4P55A 1B9MA 2XROA 1T39A 1L0OC 4ESBA 4M6XA 3F22A 3AH5A 1U2WA 3JTGA 3DFGA 3ZPLA 6PAXA 1D5VA 3IWZA 3WTUC 3I58A 2VXZA 2HFHA 3FXQA 5DUKA 4Y17A 4ZZLA 3TO9A 3K2ZA 3EETA 3DKWA 4KN4X 1IN8A 1MZBA 2KJCA 3E6DA 4PZJA 3WGHA 1OYWA 1WQHA 1EH6A 4N9HA 1ON2A 3IRQA 2MH2A 3WTTC 1ISEA 1WQ2A 3QU3A 2DK5A 1WWXA 2CFXA 1FY7A 4L9JA 3R0JA 3Q9SA 1GVJA 2CO5A 4XSXF 2F2EA 2E2HA 4L9VA 3KP4A 2DO7A 3WGGA 1LB2A 4YIFA 4GYIA 3CAGA 3U2RA 2LF8A 3WU1B 2IRFG 1KGSA 2EB7A 1I5ZA 4LMYA 2HR3A 5LHGA 2M45A 2X0LA 2XHKA 2X4HA 5CVIA 2Y0MA 3FF5A 2EFQA 2YU3A 1MJAA 2VBXA 2HQNA 2YR2A 2HTSA 3L2CA 4GGGA 2HKXA 4YG2F 1I3QA 4KIBA 4AIKA 3KCCA 3E6CC 5BMZA 1Z9CA 2EWNA 4HX4A 1FZPB 2ELHA 5E1XA 2EK5A 4KN7X 1TWCA 2KJBA 3S0XA 3DQVC 4DQ2A 1IXRC 3FXRA 3QU6A 1W4MA 4XBFA 1EH7A 4A6DA 4KASA 2ZNZA 1TWFA 5DD4A 3FMSA 5BPDA 5FFZA 1IN7A 3V8LA 2RGVA 5DD8A 2DPUA 3CTAA 2XV4S 3FMRA 4EGZA 3TOBA 2CYYA 1QBJA 3S2WA 3R61A 5LHIA 1Z1DA 5K5QA 3G3ZA 2ZJ2A 4Y15A 4Q47A 5HS9A 2W57A 5L3GA 2MLGA 3N0BA 1FBUA 2FU4A 1O7FA 3WTVC 2Q2EA 3KP2A 3NUHA 2GA2A 1ZXOA 3I64A 3CLOA 2QBYB 2XAGA 1RUNA 1WSUA 4UXNA 2D1HA 3WE2A 5D6EA 3N97A 4P9UA 1DPRA 2CFAB 2Z99A 4UNOA 3IKTA 4P5OA 3BDDA 5ILVA 4LJZF 3E5QA 1SFOA 3U1DA 1FSEA 1J2XA 3V7SA 5CVJA 1ZREA 2QYOA 2ZMEA 4HW0A 4O3MA 4LLGF 4U0WA 4LFUA 4L9TA 2E1NA 3F3XA 1KQ8A 4EVIA 5TJJA 4OINF 5E18F 3R6SA 2FMLA 2M8EA 3B73A 4HAMA 4EM0B 4Q5SF 4HDUA 1KQ9A 3RDIA 1SAXA 4ENJA 3RKXA 2OAZA 3C3WA 1RI7A 4RB1A 2QENA 3KZZA 3MWMA 4KATA 2GZWA 3SFZA 4WXCA 5F6FA 2MA3A 2LNBA 4Y13A 4BHCA 4M74A 1ON1A 4F7ZA 5FGMA 4L0YB 3QOPA 1B1BA 2O8XA 2D2WA 2ESNA 3QPHA 3FM3A 3BJOA 2XCOA 2JPCA 3AQPA 5JI6A 4GFQA 2VONA 1OYIA 3ABTA 4MNUA 2VBWA 2GSNA 1MKMA 2BV6A 3W6JB 3V4GA 2L4AA 2EV6A 3FOEA 5E8GA 1YS7A 3E5UA 5A2QZ 2A07F 2BYVE 3KFWX 3WTYC 1KA8A 2UZKA 2KRFA 2BGCA 3OOPA 2M5WA 1L3LA 1IXCA 1R1UA 5E1ZB 4G7HF 2IA0A 3DF8A 3M8FA 3ZN0A 5CLSA 1G3TA 4AD9A 4TV7A 1LDJA 2H09A 3T8TA 3HUGA 2KIUA 1HW1A 1G3YA 1OYYA 2XAQA 2R3SA 3HRTA 2VOPA 2L02A 3T1BA 1UHMA 5BQTA 3F6VA 5HS8A 2KKOA 2NRAC 3BP8A 2JTVA 5IT3A 4NHJA 1TTYA 2Z3YA 2FBIA 1PP8F 2LKPA 1D3YA 4KYWA 3J7AO 2HTJA 2DT5A 3Q3QA 2D45A 2QWWA 2VC1A 3ABUA 4M9XA 1H9TA 1FSHA 5D6FA 2P5LC 1WQGA 1RNLA 2NVXA 2MC3A 2A69F 1S7AA 3TDZC 4U0YA 2ZO4A 4HF2A 4K2EA 2L54A 3KP7A 1F9NA 2IP2A 1TQMA 2K02A 2RV8A 1U8RA 4ENNA 4I2OA 4JQFA 3DEUA 3N3YA 2EV0A 2ISYA 3GTPA 1ZBSA 2EV5A 1UFMA 4OIRF 1QZZA 1P92A 4ON0A 3RKYA 2XRNA 4A0XA 2IJLA 1ZRCA 5DV5A 2KIMA 1LNWA 3PQJA 1BJTA 4M9ZA 2VODA 1IN6A 2PN6A 4ZYDA 3H0GA 3SXYA 3J80K 2NYXA 4PDKA 1KYWA 4L5JA 5FB2A 4HV5A 1TQIA 3KEOA 4IPAA 5HDNA 1BJAA 4KDDA 3TQNA 2DLLA 2Z5UA 1ZG1A 1U5TC 5EEHA 3BPXA 4BHBA 4GYGA 5JFRA 1MD0A 5CYVA 4BNCA 4G0UA 4ASNA 3MEXA 4HQEA 4C3HC 1FC3A 3RI4A 1ODDA 1Y1WA 1SMTA 4LQYA 1C0WA 1GHCA 1J75A 1QO0D 4WWCA 2YSRA 2G7HA 2RQPA 5AIPA 4A0ZA 4HF1A 5IOSA 2EA2A 4ENKA 1R5GA 4HV6A 3V7RA 3GUDA 3J80Z 2ZFWA 4M6YA 4G7OF 1WCMA 5LRRA 2Q0OA 1GXPA 4P5BA 1IUYA 4KIGA 3T0YA 1J59A 4YFXF 5E20A 4GXOA 1AB4A 3GF2A 3C7JA 3F8BA 1J9IA 4LLLA 5EGEA 2XKOA 4HZFA 2V9VA 3VFZA 1ZAOA 2K86A 4KM8A 1RUOA 3IKVA 2DU9A 1G6NA 2O3FA 4AVPA 4J3NA 2K4BA 5FD5A 1YW9A 1LDKB 3IL2A 2DI3A 2OBPA 1I1SA 3QPTA 5E1WA 4KIFA 3ECOA 4H0EA 2W24A 5H6QA 4EM2A 3P9IA 3RYPA 4WXHA 1TNTA 1W5TA 2LF7A 1W7PA 1XSVA 5FLXK 1TLHB 1ZGAA 4IF4A 2RGRA 1I6XA 3RJPA 3F6OA 3QX3A 3BZ6A 3WE3A 2ACJA 4KICA 3KP5A 4KB4A 4KMAA 4BH9A 4OIPF 2E7WA 1I50A 3VEPA 5ICCA 2CFAA 1O2AA 1PDNC 2R93A 3EQLF 5D8LB 2GAUA 5JR3A 4OIQF 2HKOA 1BC7C 4IRHA 4BLAA 2CGPA 3G73A 1YLFA 2NNNA 2DBBA 4MQ9F 3KP6A 1DUXC 4CO8A 2Y48A 1T38A 3I0TA 1I1GA 3BY6A 4CDGA 1O2BA 1A04A 1IZ1A 1R1TA 4EJTA 2A5YB 2A68F 2GSOA 5JVTA 2UXNA 1V3FA 3ZQ7A 3ZMSA 3ZMZA 1U5TB 4LB5A 2GXGA 1SD7A 1O28A 2OZ6A 2F5DA 1OR7A 2JZYA 3G4AA 4QWQA 5K5RA 4OMYA 4G0VA 2CQKA 4KUMA 1W7PB 3PFIA 1UHWA 1LJ9A 5ICEA 1T2KA 3LFKA 1USTA 5KK1A 2VT3A 4KMHA 2P6SA 4NQWA 4N0BA 1TWGA 2ESHA 3GWZA 5HLIA 3DXJF 1JGSA 3VOEA 5ICFA 2PFBA 3FHZA 1Z05A 1FP2A 1HSJA 1WKMA 4UVCA 3GZ6A 4EGYA 1Z7UA 4G6QA 1T0FA 3BJAA 5E17F 2P7CB 1PP7U 4XLNF 2Y3PA 4FHTA 2PEXA 1K79A 1F5TA 3F21A 2STWA 4XLPF 4RGRA 2NNYA 1O3QA 2G7UA 2EJRA 2V1XA 4RGXA 3HRMA 1Y0UA 3HSRA 2PJPA 3CJNA 2PQ8A 2HQRA 3HTSB 2E2IA 1XMAA 1R23A 4ZZDA 3HTUA 4LK0F 1CF7B 1AWCA 2QM3A 4WX9A 3R60A 1HKQA 5JFEA 1SFEA 2FF4A 4U7DA 4WCGA 2PLYA 5K5OA 1K83A 1LEAA 3ML6A 3HHHA 4RB2C 4CHUA 2QZ8A 4EQQA 3MMLB 4MQVA 1RZ4A 3CO6C 1IRFA 1TWAA 3BROA 3CQZA 1B4BA 4R79A 4DNCA 2MH9A 1XDSA 1XXBA 3GZ5A 3L00A 2RH6A 4LG0A 1TWHA 4PCQA 3TKYA 1B6AA 1TBXA 3GW2A 1YQAA 5LEKA 2BBYA 2OA4A 3RTRA 1O7LA 3KEQA 2QBYA 3C18A 4KMDA 2VE9A 5L3EA 3KP3A 2E7XA 4IJAA 1P4XA 2H6CA 3QRFF 1H9GA 3LAJA 4ZYHA 4GTFA 1XGSA 1BOAA 3N0CA 3GTKA 1QGPA 1K7AA 1KQ0A 2IPQX 4YIIA 1UB9A 1DP7P 5DUIA 2OQGA 4JBAA 3LAPA 2HEOA 3FKIA 3V8KA 2IW5A 1GE9A 5ED4A 4IXAA 4KT5C 5F64A 4YFKF 2IA2A 4U7BA 2YX7A 5D5UB 3I4PA 4E70A 4HA8A 5CVRA 1P6RA 1G3SA 4XSZF 3F8NA 3LQQA 4D0PA 3GVAA 4WXDA 2JA7A 3CUQA 2MBFA 1BM9A 4EM1A 1W5SA 2V79A 3F72A 5IORA 2P5KA 1YS6A 4QLCU 1AOYA 1HW5A 3ZP5A 3JSPA 2VUMA 3GYHX 5JVOA 1P4WA 1QQIA 4MEXF 3FWEA 3GEZA 1BBYA 1BGWA 2F5EA 2BE5F 1FX7A 5DCMA 3JAMZ 3T5XA 4FZBA 3R4KA 3M8EA 4KAWX 1ONVA 1O26A 2O03A 5D4RA 4ENMA 3L4KA 1ZHFA 4EJWA 3H3UA 1SD5A 3DV8A 4HQMA 2D1VA 2YPRA 3E6MA 5LGUA 4AIHA 2NAZA 5HDGA 2XUBA 4P5AA 4P96A 3AAFA 3VODA 1FBQA 2B63A 1KU3A 2H94A 3LA3A 3BOQA 4Q4ZF 2IT0A 4HYEA 1DDNA 3BWGA 4IHTA 4KMFA 3ZMTA 5ILUA 4RGUA 3M9AA 3ELKA 4GTBA 3KE2A 1SD4A 4CXFA 2M1BA 1S29A 2KIFA 5CHPA 3F8CA 1S3JA 4U88A 3GX4X 2EFWA 3TO7A 4KA4A 5J6XA 2VC0A 4Z2YA 2FOKA 3I5UA 5CVVA 3GFIA 2A6EF 3HSFA 1FBSA 1S6LA 5ICGA 3V8JA 2XKPA 2QLZA 5FLXZ 3JSOA 5IT9Z 2DK8A 1IAWA 1FOKA 1O57A 2V1DA 3KZYA 4ZYGA 4U0VA 4YFNF 4UV8A 2QQ9A 1LVAA 2HYGD 1O3RA 4FX0A 5L3BA 2VT2A 2GSUA 5CVUA 3QP6A 4ESJA 1KU2A 1STZA 3LA2A 3BUEA 2COMA 1HKSA 5J8FA 1IF1A 5JHUA 1MJ9A 5LGTA 1E2XA 1YYVA 2R7ZA 1U5TA 2VBZA 1IXSB 2MD5A 5FFXA 3U9GA 4KMUX 2P7VB 4S04A 1PUEE 3RKWA 5TRDA 3GXOA 3PQKA 2K7LA 4C3JC 3WTXC 1LQ1A 3DPLC 3WU0A 1ZN2A 1F1ZA 1U78A 1XB4A 1Z6TA 2GQQA 1X3UA 2DQLA 4RGSA 1XSXA 2XGXA 2J5PA 3AQOA 2H6BA 2JT1A 2WTEA 3H92A 4GCVA 3BPVA 3GFMA 1TW3A 4PGHA 1HXDA 4M9SA 3MAJA 1K78B 2HZTA 3MZHA 5AONA 4A12A 3IWFA 5KVRA 2QQBA 1ZLKA 1YO5C 4ZYEA 3HRSA 2GIVA 2DW4A 5LBQA 5HDKA 2L01A 3K1MA 5LLQA 1R58A 1XXAA 3FZVA 5K1YA 3HOSA 2EFPA 1XSDA 3ROUA 2GA1A 2RC4A 1XDUA 1TW2A 2HYFA 2YU9A 1KQ4A 3L4JA 2RDPA 2Q8KA 3D0SA 4UVAA 2HS5A 2PG4A 4L18B 1SFXA 3V7CA 3O2PE 3EYYA 1ZG3A 2PBIA 2KWAA 3GTLA 2B0LA 1LDDA 2CWEA 2CW0F 1XD7A 1DPUA 3TOAA 2J5OA 1SD6A 1JHHA 1IS1A 2ZBKA 2HDCA 4O5VA 4G8XA 4XRFA 4I01A 3I71A 5HS7A 4KDPA 3HSEA 4JK1X 1FYKA 2XAFA 1IN4A 2ZNYA 3LSTA 2FMYA 4MTEA 1YTYA 1HW2A 3FXUA 1Z91A 3I59B 4IRIA 1OKRA 1ZARA 1HKTA 1R5HA 4HX8A 1ZH5A 4M73A 3KETA 2FA5A 1S8NA 1CF7A 1MJBA 1ZRFA 3TO6A 3CO7C 1KU9A 3HIFA 2NVYA 1O3TA 1FYMA 3NQOA 2BEOA 1MDMA 2QQAA 2DPDA 3NRVA 5LRSA 3RYRA 1QPMA 2ETHA 4IRGA 4BAYA 3ZMDA 5BS6A 2P4WA 2A6HF 1XN7A 4EV0A 3ZN1A 3WG9A 4LR2A 1T6SA 1SFUA 2QUFA 3HOTA 4ILDA 1XGOA 2FBKA 2RVCA 1IRGA 1E17A 2AS5F 2VN2A 2FNAA 3K0LA 3CUOA 5D8KB 4BHPA 3IC7A 4R1HA 1XGNA 1B9NA 1O3SA 4PGGA 1FNNA 3B02A 3I53A 3P9CA 4GT9A 3DP7A 2ZFZA 1JE8A 4HX7A 5CJ9A 4BQAA 1IW7F 4FT8A 5D5VB 1Z6RA 1O29A 4HF0A 4I98B 4BXUA 1Y1VA 3ECHA 3EUHA 1ZG5A 2O61A 2AXLA 1K6OA 3ZMVA 5BPIA 2NS0A 4OU0A 3K9TA 1H0MA 4M72A 1UCRA 2RN7A 4L5IA 2FSWA 2C6YA 4MTDA 3IHUA