1DCHA

Crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcriptional stimulator,dimerization
molecule keywords DCOH (DIMERIZATION COFACTOR OF HNF-1)
publication title Crystal structure of DCoH, a bifunctional, protein-binding transcriptional coactivator.
pubmed rcsb
source organism Rattus norvegicus
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dchA00
4LOWA 1USOA 2V6SA 3JSTA 4C45A 2V6TA 1DCOA 2EBBA 3HXAA 1USMA 1RU0A 4WILA 1F93A 2V6UA 1DCPA 1DCHA
chains in the Genus database with same CATH superfamily
3RZDK 4Q5SA 2RGRA 1SFOK 3HOZK 2NVXK 1TWCA 4G7OA 3S16K 5IP7K 1IS1A 1TWGK 3GTMA 1PJ5A 2PMZL 2FQOA 1JQWA 2B63A 3GTPC 4GTCA 3PO3C 4P5BA 2NVQC 4JK1A 3S1MC 1SMYA 4KMUA 2P8TA 5C4XK 2VUMK 2ZUEA 4FZBA 5HL8A 3GTMC 1YNJA 2B63C 2A6EA 3GTGA 3HKZL 5C4JC 1RU0A 1YX2A 1F93A 5IORA 2JA7K 1PJ6A 2WAQD 3VA7A 1IL2A 1TWHA 3BUEA 1L0WA 3GTLK 3MMLB 1IBAA 1UV7A 3ERED 3GTGC 3BP3A 2PMZD 2E2IK 4C3IK 3GEEA 1XXCA 2R93K 2GSNA 1TWHC 3L4JA 1VH2A 4A3DC 4BY7C 1YCLA 2XCQA 1TWFA 3S2DC 4A3EK 1K83A 1J98A 3AD8C 3ADAC 3K7AC 3NUHA 4GT9A 1EFWA 1WQFA 4KB2A 4X6AK 4FM9A 1R9TK 5M5YK 1JVIA 4KATA 2E2JK 4A3IC 2V6TA 2GAHC 2NVYK 1TWFC 3AD9C 3HOWC 3HOXK 1WSRA 5D4DA 1K83C 4PAAA 4NOIA 4A3LC 3S15K 1DCHA 4YFXA 1O24A 4C2MC 3HOYC 2CFAA 1X31C 4KM8A 3S14K 4A3FC 2R7ZK 3TTGA 2Y3PA 2XCRB 2NVTK 4ZH4A 3HOUK 3GDZA 1Y1WA 4A3BC 4BBSK 4GZYA 3HOVK 1DCOA 3G4AA 4BBRK 3GTKK 5IOTA 4G0VA 3A8IA 4OIPA 1WOPA 5IYDK 2JA6K 3I4NK 1Y1VK 2JA5K 1Y1WC 4KM9A 5M5WK 3CAGA 1WQGA 4LJZA 1XZPB 3GTOA 2A6HA 1WIHA 2PA8D 4KMAA 3S1NK 4BLAA 5C3EC 3GTQK 3AH5A 3A8KA 3DXJA 4A3JK 4YFKA 3FKIK 4Y7NC 3H0GA 1XXAA 4MQ9A 3LAJA 4QIWD 3GTOC 4A3GC 5FLMC 3CQZA 4XSZA 1VRQC 1JOEA 1B4BA 4BXXC 1USMA 5JFEA 3GTPK 3PO3K 3H0GC 1SFOA 1BS2A 2NVXA 4OIOA 3S1MK 4GFQA 5M3MK 1TWCK 4ILDA 3CQZC 4A3MC 3GSIA 4BLBA 4MEXA 3GTMK 2YU9A 2XCOA 5CHPA 4OIQA 5FJ8K 3RZDC 2B63K 1SFOC 3HOZC 2NVXC 3M4OC 1IE0A 1PJ7A 3L4KA 3RZOK 2PHCB 1O2AA 1KQ4A 2ZUFA 2YU9C 4G7ZA 2D6FC 3GTJK 5EGEA 4LK1A 3GTGK 2E2HK 5C4XC 3TFIA 3N0BA 1ZBSA 4XSXA 4A3CK 4Y52K 3S17C 1I50K 1ZVUA 3S1RC 3GIRA 2KWAA 1IQ0A 3Q3QA 2E2IA 5JVOA 4WJ3M 4AH6A 2CW0A 4GTAA 4AYBD 2R93A 1WORA 3S2HK 3K7AK 4J3NA 2GSUA 1INNA 4GTEA 4KAWX 5EGHA 2R92A 4LQYA 4A3IK 1HI9A 3S1QK 1O29A 2E2IC 4C3IC 4BY1K 4WILA 1J6VA 3G4CA 4KN7A 3A8JA 2R93C 4G0WA 1K83K 3SZZA 1O26A 1WCMA 1R9TA 2JH3A 4LLGA 4DDQA 1VLOA 2PA8L 4C2MK 3HOYK 2BE5A 2NVYA 2R92C 1B4AA 4QJVB 4A3KC 1O27A 4A3FK 1O2FB 2A68A 4G7HA 5C44K 1WOOA 1WSVA 2O5JA 1EH1A 1WQHA 3N0CA 4LK0A 4QIWL 1WCMC 5IP9K 1R9TC 1I6HC 4LR2A 5TJ3A 2E2JC 4MEYA 4Q4ZA 3AD7C 2NVYC 3PO2C 5M3FK 3HOXC 1EK8A 3OREA 1ZYRA 4C3JK 3TFHA 1Y1WK 1XZQB 4KMDA 1BDFA 3GTKA 3SZYA 1TWAK 2V6UA 3IPJA 4M1XA 3S14C 1ISEA 3HOUC 1WOSA 1V5VA 1I3QA 3I4MC 3M3YK 3HOVC 1EI6A 3GEHA 3GTQA 3GTKC 4A3GK 3GEIA 5IYCC 5IYBC 3LPXA 5FLMK 2JA8C 5IYDC 2JA6C 3I4NC 4P5AA 4P9SA 4BXXK 1I3QC 4XLPA 1DCPA 3S1NC 3GTQC 4A93C 2NVQK 1F7UA 5CJ9A 1TWGA 3N3YA 3H3VL 1ZQ1C 3FHZA 4C3HC 4BKWA 4AYBL 3M4OK 2W7VA 3T00A 5C4JK 1BGWA 3OPFA 4OIRA 2VUMA 3S16C 4KB4A 5IP7C 3TFJA 1TWGC 5TMFA 3HXAA 1AB4A 2YU9K 1HQMA 4GTFA 4KN4A 2WB1D 1TWCC 2JA7A 4LOWA 3QX3A 1VJEA 2VUMC 3FOEA 2A69A 4KMHA 3S17K 4YG2A 3S1RK 3GTJA 3GTLA 1TWHK 2E2HA 4A3DK 4BY7K 3OEPA 4O2DA 3H3VD 2GSOA 4OINA 2Y0SL 2JA7C 1F7VA 3S2DK 4GTLA 3RZOC 1I50A 1VGXA 3EQLA 3T01A 4C45A 3GTJC 3LAPA 3GTLC 2E2HC 1DD5A 2PPBA 4GTBA 1XXBA 4PABA 4KARA 3HOWK 1TWFK 4A3CC 2CFAB 3S0XA 3V4GA 4Y52C 1I50C 1XPPA 4A3LK 2R92K 4A3KK 3WODA 3JSTA 1ZXOA 3HKZD 4KC6A 3S2HC 1IW7A 4A3EC 2O5IA 1WCMK 3BP8C 1J6XA 1I6HK 2Y0SD 4A3BK 4X6AC 1J6WA 3S1QC 4RMFA 3PO2K 5TMCA 1O2BA 4BY1C 5L46A 1O28A 2R7ZA 3AQPA 2V6SA 4KDDA 1I6VA 4KASA 1GE9A 3S15C 3FOFA 2GAGC 5E68A 1EQRA 5C44C 5C3EK 2R7ZC 4XLNA 2JA6A 4XCHA 5IP9C 2NVTC 3I4MK 1Y1VA 4QJVA 3AQOA 5IOQA 2JA5A 2RH6A 4BBSC 1TWAA 4Y7NK 1C0AA 1YNNA 4BBRC 5IYCK 5IYBK 3GTOK 2ZFZA 2JA8K 4YFNA 2P5MA 4C3JC 1I3QK 1Y1VC 2WB1L 3FKIA 2JA5C 1O25A 1TWAC 3H0GK 4A93K 5IOSA 2EBBA 3T02A 4GTDA 1F9NA 1XZQA 4G0UA 5M5XK 3M3YC 1USOA 3CQZK 4A3MK 4WJ4A 4C3HK 4A3JC 1BJTA 1G51A 2FQTA 1XZPA 3FKIC 3GTPA 2WAQL
chains in the Genus database with same CATH topology
4LOWA 1USOA 2V6SA 3JSTA 4C45A 2V6TA 1DCOA 2EBBA 3HXAA 1USMA 1RU0A 4WILA 1F93A 2V6UA 1DCPA 1DCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LOW A;  1USO A;  2V6S A;  3JST A;  4C45 A;  2V6T A;  1DCO A;  2EBB A;  3HXA A;  1USM A;  1RU0 A;  4WIL A;  1F93 A;  2V6U A;  1DCP A;  1DCH A; 
#chains in the Genus database with same CATH topology
 3RZD K;  4Q5S A;  2RGR A;  1SFO K;  3HOZ K;  2NVX K;  1TWC A;  4G7O A;  3S16 K;  5IP7 K;  1IS1 A;  1TWG K;  3GTM A;  1PJ5 A;  2PMZ L;  2FQO A;  1JQW A;  2B63 A;  3GTP C;  4GTC A;  3PO3 C;  4P5B A;  2NVQ C;  4JK1 A;  3S1M C;  1SMY A;  4KMU A;  2P8T A;  5C4X K;  2VUM K;  2ZUE A;  4FZB A;  5HL8 A;  3GTM C;  1YNJ A;  2B63 C;  2A6E A;  3GTG A;  3HKZ L;  5C4J C;  1RU0 A;  1YX2 A;  1F93 A;  5IOR A;  2JA7 K;  1PJ6 A;  2WAQ D;  3VA7 A;  1IL2 A;  1TWH A;  3BUE A;  1L0W A;  3GTL K;  3MML B;  1IBA A;  1UV7 A;  3ERE D;  3GTG C;  3BP3 A;  2PMZ D;  2E2I K;  4C3I K;  3GEE A;  1XXC A;  2R93 K;  2GSN A;  1TWH C;  3L4J A;  1VH2 A;  4A3D C;  4BY7 C;  1YCL A;  2XCQ A;  1TWF A;  3S2D C;  4A3E K;  1K83 A;  1J98 A;  3AD8 C;  3ADA C;  3K7A C;  3NUH A;  4GT9 A;  1EFW A;  1WQF A;  4KB2 A;  4X6A K;  4FM9 A;  1R9T K;  5M5Y K;  1JVI A;  4KAT A;  2E2J K;  4A3I C;  2V6T A;  2GAH C;  2NVY K;  1TWF C;  3AD9 C;  3HOW C;  3HOX K;  1WSR A;  5D4D A;  1K83 C;  4PAA A;  4NOI A;  4A3L C;  3S15 K;  1DCH A;  4YFX A;  1O24 A;  4C2M C;  3HOY C;  2CFA A;  1X31 C;  4KM8 A;  3S14 K;  4A3F C;  2R7Z K;  3TTG A;  2Y3P A;  2XCR B;  2NVT K;  4ZH4 A;  3HOU K;  3GDZ A;  1Y1W A;  4A3B C;  4BBS K;  4GZY A;  3HOV K;  1DCO A;  3G4A A;  4BBR K;  3GTK K;  5IOT A;  4G0V A;  3A8I A;  4OIP A;  1WOP A;  5IYD K;  2JA6 K;  3I4N K;  1Y1V K;  2JA5 K;  1Y1W C;  4KM9 A;  5M5W K;  3CAG A;  1WQG A;  4LJZ A;  1XZP B;  3GTO A;  2A6H A;  1WIH A;  2PA8 D;  4KMA A;  3S1N K;  4BLA A;  5C3E C;  3GTQ K;  3AH5 A;  3A8K A;  3DXJ A;  4A3J K;  4YFK A;  3FKI K;  4Y7N C;  3H0G A;  1XXA A;  4MQ9 A;  3LAJ A;  4QIW D;  3GTO C;  4A3G C;  5FLM C;  3CQZ A;  4XSZ A;  1VRQ C;  1JOE A;  1B4B A;  4BXX C;  1USM A;  5JFE A;  3GTP K;  3PO3 K;  3H0G C;  1SFO A;  1BS2 A;  2NVX A;  4OIO A;  3S1M K;  4GFQ A;  5M3M K;  1TWC K;  4ILD A;  3CQZ C;  4A3M C;  3GSI A;  4BLB A;  4MEX A;  3GTM K;  2YU9 A;  2XCO A;  5CHP A;  4OIQ A;  5FJ8 K;  3RZD C;  2B63 K;  1SFO C;  3HOZ C;  2NVX C;  3M4O C;  1IE0 A;  1PJ7 A;  3L4K A;  3RZO K;  2PHC B;  1O2A A;  1KQ4 A;  2ZUF A;  2YU9 C;  4G7Z A;  2D6F C;  3GTJ K;  5EGE A;  4LK1 A;  3GTG K;  2E2H K;  5C4X C;  3TFI A;  3N0B A;  1ZBS A;  4XSX A;  4A3C K;  4Y52 K;  3S17 C;  1I50 K;  1ZVU A;  3S1R C;  3GIR A;  2KWA A;  1IQ0 A;  3Q3Q A;  2E2I A;  5JVO A;  4WJ3 M;  4AH6 A;  2CW0 A;  4GTA A;  4AYB D;  2R93 A;  1WOR A;  3S2H K;  3K7A K;  4J3N A;  2GSU A;  1INN A;  4GTE A;  4KAW X;  5EGH A;  2R92 A;  4LQY A;  4A3I K;  1HI9 A;  3S1Q K;  1O29 A;  2E2I C;  4C3I C;  4BY1 K;  4WIL A;  1J6V A;  3G4C A;  4KN7 A;  3A8J A;  2R93 C;  4G0W A;  1K83 K;  3SZZ A;  1O26 A;  1WCM A;  1R9T A;  2JH3 A;  4LLG A;  4DDQ A;  1VLO A;  2PA8 L;  4C2M K;  3HOY K;  2BE5 A;  2NVY A;  2R92 C;  1B4A A;  4QJV B;  4A3K C;  1O27 A;  4A3F K;  1O2F B;  2A68 A;  4G7H A;  5C44 K;  1WOO A;  1WSV A;  2O5J A;  1EH1 A;  1WQH A;  3N0C A;  4LK0 A;  4QIW L;  1WCM C;  5IP9 K;  1R9T C;  1I6H C;  4LR2 A;  5TJ3 A;  2E2J C;  4MEY A;  4Q4Z A;  3AD7 C;  2NVY C;  3PO2 C;  5M3F K;  3HOX C;  1EK8 A;  3ORE A;  1ZYR A;  4C3J K;  3TFH A;  1Y1W K;  1XZQ B;  4KMD A;  1BDF A;  3GTK A;  3SZY A;  1TWA K;  2V6U A;  3IPJ A;  4M1X A;  3S14 C;  1ISE A;  3HOU C;  1WOS A;  1V5V A;  1I3Q A;  3I4M C;  3M3Y K;  3HOV C;  1EI6 A;  3GEH A;  3GTQ A;  3GTK C;  4A3G K;  3GEI A;  5IYC C;  5IYB C;  3LPX A;  5FLM K;  2JA8 C;  5IYD C;  2JA6 C;  3I4N C;  4P5A A;  4P9S A;  4BXX K;  1I3Q C;  4XLP A;  1DCP A;  3S1N C;  3GTQ C;  4A93 C;  2NVQ K;  1F7U A;  5CJ9 A;  1TWG A;  3N3Y A;  3H3V L;  1ZQ1 C;  3FHZ A;  4C3H C;  4BKW A;  4AYB L;  3M4O K;  2W7V A;  3T00 A;  5C4J K;  1BGW A;  3OPF A;  4OIR A;  2VUM A;  3S16 C;  4KB4 A;  5IP7 C;  3TFJ A;  1TWG C;  5TMF A;  3HXA A;  1AB4 A;  2YU9 K;  1HQM A;  4GTF A;  4KN4 A;  2WB1 D;  1TWC C;  2JA7 A;  4LOW A;  3QX3 A;  1VJE A;  2VUM C;  3FOE A;  2A69 A;  4KMH A;  3S17 K;  4YG2 A;  3S1R K;  3GTJ A;  3GTL A;  1TWH K;  2E2H A;  4A3D K;  4BY7 K;  3OEP A;  4O2D A;  3H3V D;  2GSO A;  4OIN A;  2Y0S L;  2JA7 C;  1F7V A;  3S2D K;  4GTL A;  3RZO C;  1I50 A;  1VGX A;  3EQL A;  3T01 A;  4C45 A;  3GTJ C;  3LAP A;  3GTL C;  2E2H C;  1DD5 A;  2PPB A;  4GTB A;  1XXB A;  4PAB A;  4KAR A;  3HOW K;  1TWF K;  4A3C C;  2CFA B;  3S0X A;  3V4G A;  4Y52 C;  1I50 C;  1XPP A;  4A3L K;  2R92 K;  4A3K K;  3WOD A;  3JST A;  1ZXO A;  3HKZ D;  4KC6 A;  3S2H C;  1IW7 A;  4A3E C;  2O5I A;  1WCM K;  3BP8 C;  1J6X A;  1I6H K;  2Y0S D;  4A3B K;  4X6A C;  1J6W A;  3S1Q C;  4RMF A;  3PO2 K;  5TMC A;  1O2B A;  4BY1 C;  5L46 A;  1O28 A;  2R7Z A;  3AQP A;  2V6S A;  4KDD A;  1I6V A;  4KAS A;  1GE9 A;  3S15 C;  3FOF A;  2GAG C;  5E68 A;  1EQR A;  5C44 C;  5C3E K;  2R7Z C;  4XLN A;  2JA6 A;  4XCH A;  5IP9 C;  2NVT C;  3I4M K;  1Y1V A;  4QJV A;  3AQO A;  5IOQ A;  2JA5 A;  2RH6 A;  4BBS C;  1TWA A;  4Y7N K;  1C0A A;  1YNN A;  4BBR C;  5IYC K;  5IYB K;  3GTO K;  2ZFZ A;  2JA8 K;  4YFN A;  2P5M A;  4C3J C;  1I3Q K;  1Y1V C;  2WB1 L;  3FKI A;  2JA5 C;  1O25 A;  1TWA C;  3H0G K;  4A93 K;  5IOS A;  2EBB A;  3T02 A;  4GTD A;  1F9N A;  1XZQ A;  4G0U A;  5M5X K;  3M3Y C;  1USO A;  3CQZ K;  4A3M K;  4WJ4 A;  4C3H K;  4A3J C;  1BJT A;  1G51 A;  2FQT A;  1XZP A;  3FKI C;  3GTP A;  2WAQ L; 
#chains in the Genus database with same CATH homology
 4LOW A;  1USO A;  2V6S A;  3JST A;  4C45 A;  2V6T A;  1DCO A;  2EBB A;  3HXA A;  1USM A;  1RU0 A;  4WIL A;  1F93 A;  2V6U A;  1DCP A;  1DCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...