1DCHA

Crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH (DIMERIZATION COFACTOR OF HNF-1)
publication title Crystal structure of DCoH, a bifunctional, protein-binding transcriptional coactivator.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator,dimerization
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dchA00
1USMA 2V6UA 1DCPA 1F93A 3JSTA 1DCHA 3HXAA 1RU0A 2EBBA 4LOWA 4WILA 2V6SA 4C45A 1USOA 1DCOA 2V6TA
chains in the Genus database with same CATH superfamily
1SFOK 4KDDA 3S1MK 1IQ0A 5M5WK 5IP7K 3GIRA 2D6FC 2XCOA 2ZUFA 1WOSA 3RZDK 4KMAA 4C3HC 2FQOA 2E2IC 4BBSK 4FZBA 1I3QC 3TFJA 1JVIA 3GTKC 3GTPK 4WJ4A 1V5VA 4BY7C 3HOUK 1VRQC 1J6VA 3M4OK 3H0GK 1F7VA 1WOOA 4P9SA 4A3KC 4QJVA 3HOWK 1TWGC 1JQWA 3CQZK 2JA8K 4A3EK 1SFOC 3S1MC 1BJTA 1Y1VC 5IYCK 2Y3PA 2RH6A 2PMZD 5JFEA 1TWAC 2E2HA 4KAWX 4A3DC 4OIRA 4A3MC 3K7AC 4G0UA 4O2DA 2R93K 1BGWA 4C3IC 3G4AA 2A6EA 4LOWA 4Y7NK 4A3CK 3GTPC 2O5IA 1AB4A 4M1XA 4Q4ZA 3FKIK 1WQFA 4X6AC 1O26A 2A69A 2W7VA 2YU9A 4QJVB 1RU0A 3CQZC 2JA8C 1TWCK 5IORA 2NVYC 4A3EC 2E2IA 1B4BA 5TMCA 4AYBL 3GTGC 1F9NA 5IYCC 2JA6K 3SZYA 1I3QA 2E2JK 3BP3A 3GTKA 1DCHA 4MEXA 4XLNA 4KM8A 3GTLK 4KB4A 5IYDK 2R92K 4KMDA 3V4GA 4Y7NC 4A3CC 3LPXA 1TWGA 3RZOK 3GTJA 3A8JA 2ZFZA 3FOFA 2GAHC 1VGXA 2BE5A 5C4JC 1DCOA 5C4XC 3HOZC 3ERED 2GAGC 3S15C 3TTGA 1IS1A 1DCPA 2A68A 2NVTK 5C44K 1TWCC 2O5JA 4XCHA 4BLBA 3GTOK 2JA7A 2JA6C 4A3GC 3FOEA 1XZQA 1X31C 3T01A 3S16K 1K83K 1O2BA 1YNJA 1O29A 1HQMA 4LQYA 3HKZD 4C3JK 1VLOA 2V6SA 3GTQK 1XPPA 4BXXK 1TWHK 1F7UA 1EH1A 5IP9K 4QIWL 1O24A 3M3YC 3GTGA 4DDQA 1HI9A 2NVTC 4A3FK 2YU9K 4OIQA 3S14C 5C44C 1WQGA 4G0VA 1PJ7A 4OINA 1WQHA 4A3JK 3PO2K 4KN7A 1WSRA 2R7ZK 4A3LC 2ZUEA 1XZQB 3VA7A 4KM9A 3S16C 1K83C 1XXBA 4BLAA 4WJ3M 1I6HK 3NUHA 4C2MC 5FLMC 1Y1WK 1TWFC 2VUMA 3HOYK 3N3YA 2FQTA 3HXAA 3AD8C 3GTQC 4XSZA 4BXXC 4GTDA 3AH5A 4BKWA 4A93C 4A3IK 3S2HK 3S2DK 1YX2A 4BY1C 1R9TC 2JA5C 4KN4A 3I4NK 2B63K 4Q5SA 1VJEA 2R7ZC 1IE0A 2PMZL 2GSOA 1PJ5A 5IP7C 1ZQ1C 4OIPA 3RZDC 5M5XK 3GTMK 5TMFA 3DXJA 1I6HC 4Y52K 4BBSC 4LR2A 3GEIA 5C3EK 4OIOA 4LLGA 1XZPA 2NVXK 3S17K 3A8KA 3HOVK 5L46A 3Q3QA 1I50A 4A3IC 4ZH4A 3HOUC 3M4OC 3H0GC 1ISEA 4LJZA 3HOWC 2B63C 1WCMK 4PABA 2V6UA 4GTFA 1O27A 4GTLA 1JOEA 1TWFA 4KB2A 4GTCA 4KARA 1INNA 4GZYA 4A3BK 5M5YK 4MQ9A 4KASA 4FM9A 4Y52C 5M3MK 3GEEA 1ZVUA 2R93C 5C3EC 1O2AA 1IBAA 1R9TA 1F93A 5CHPA 1GE9A 1XZPB 1YCLA 4YFNA 3TFHA 1USMA 5IYBK 3N0BA 5TJ3A 1SFOA 1I6VA 3FKIC 2GSUA 1Y1VA 1WCMC 1WORA 1TWAA 2WAQL 1BDFA 3WODA 3S0XA 2WAQD 3LAJA 2NVQK 2E2JC 3I4MK 4G7HA 4GTBA 2E2HK 3S1QK 4KMUA 3GTPA 3MMLB 3HKZL 3GTLC 2Y0SL 5IYDC 2CW0A 2R92C 3HOXK 5HL8A 2Y0SD 3H0GA 4LK1A 4LK0A 3IPJA 1I50K 3RZOC 3CQZA 5FJ8K 2NVYA 3AQOA 4G7ZA 4GT9A 5EGHA 1J98A 3QX3A 4C3HK 4C45A 2E2IK 2KWAA 3A8IA 3JSTA 3GTOC 4P5BA 2R93A 5E68A 1ZXOA 1I3QK 3CAGA 3OPFA 3T00A 2E2HC 3AQPA 3GTKK 4BY7K 4G0WA 4GFQA 1WOPA 3FKIA 4C3JC 2XCQA 2P8TA 1TWHC 1BS2A 1TWGK 2PPBA 1TWCA 3GTJK 1WSVA 5IP9C 1PJ6A 2GSNA 3T02A 1L0WA 2JA6A 1Y1VK 1ZBSA 1B4AA 4A3FC 2YU9C 2RGRA 1TWAK 3PO2C 4A3DK 4A3JC 4KMHA 5EGEA 3K7AK 4A3MK 3GTLA 4PAAA 3BP8C 2R92A 2JA7K 4C3IK 1IW7A 4BBRK 1G51A 1O25A 1Y1WC 3HOYC 1SMYA 2EBBA 3PO3K 4X6AK 2A6HA 3S2HC 3GTJC 3S2DC 2NVYK 3GTOA 3S1NK 5D4DA 3GTGK 2CFAA 4WILA 3ADAC 5JVOA 3I4NC 1EI6A 1K83A 4G7OA 1ZYRA 2JA7C 1DD5A 3L4KA 4BBRC 1O28A 4YFKA 3GTMC 3GTQA 1VH2A 2WB1L 1TWHA 4RMFA 1J6XA 1J6WA 3OEPA 2WB1D 3GDZA 2VUMK 3H3VL 1UV7A 3PO3C 5C4XK 5C4JK 4YFXA 3HOZK 1EFWA 2NVXC 3S17C 2JA5A 4KC6A 2V6TA 3H3VD 3S15K 3HOVC 1XXAA 4NOIA 1XXCA 1USOA 2R7ZA 3S1NC 1IL2A 2CFAB 4A3GK 5CJ9A 2XCRB 2PA8L 4AYBD 3AD7C 1C0AA 2JH3A 4J3NA 2PA8D 1Y1WA 3S1RK 4MEYA 1KQ4A 3GEHA 4A3BC 3AD9C 4XSXA 5IOSA 4XLPA 4GTAA 4AH6A 2PHCB 2VUMC 3OREA 4P5AA 4JK1A 3M3YK 3L4JA 2P5MA 2B63A 5IYBC 3S14K 5M3FK 1EQRA 1YNNA 4A3LK 3N0CA 4YG2A 3GTMA 1EK8A 3G4CA 3FHZA 1WIHA 3BUEA 1O2FB 3S1RC 4C2MK 5FLMK 3LAPA 1TWFK 2NVQC 4GTEA 3I4MC 3EQLA 2NVXA 5IOTA 3S1QC 3SZZA 4A93K 3TFIA 3HOXC 4BY1K 1R9TK 4KATA 4ILDA 2JA5K 3GSIA 4QIWD 4A3KK 1WCMA 5IOQA 1I50C
chains in the Genus database with same CATH topology
1USMA 2V6UA 1DCPA 1F93A 3JSTA 1DCHA 3HXAA 1RU0A 2EBBA 4LOWA 4WILA 2V6SA 4C45A 1USOA 1DCOA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USM A;  2V6U A;  1DCP A;  1F93 A;  3JST A;  1DCH A;  3HXA A;  1RU0 A;  2EBB A;  4LOW A;  4WIL A;  2V6S A;  4C45 A;  1USO A;  1DCO A;  2V6T A; 
#chains in the Genus database with same CATH topology
 1SFO K;  4KDD A;  3S1M K;  1IQ0 A;  5M5W K;  5IP7 K;  3GIR A;  2D6F C;  2XCO A;  2ZUF A;  1WOS A;  3RZD K;  4KMA A;  4C3H C;  2FQO A;  2E2I C;  4BBS K;  4FZB A;  1I3Q C;  3TFJ A;  1JVI A;  3GTK C;  3GTP K;  4WJ4 A;  1V5V A;  4BY7 C;  3HOU K;  1VRQ C;  1J6V A;  3M4O K;  3H0G K;  1F7V A;  1WOO A;  4P9S A;  4A3K C;  4QJV A;  3HOW K;  1TWG C;  1JQW A;  3CQZ K;  2JA8 K;  4A3E K;  1SFO C;  3S1M C;  1BJT A;  1Y1V C;  5IYC K;  2Y3P A;  2RH6 A;  2PMZ D;  5JFE A;  1TWA C;  2E2H A;  4KAW X;  4A3D C;  4OIR A;  4A3M C;  3K7A C;  4G0U A;  4O2D A;  2R93 K;  1BGW A;  4C3I C;  3G4A A;  2A6E A;  4LOW A;  4Y7N K;  4A3C K;  3GTP C;  2O5I A;  1AB4 A;  4M1X A;  4Q4Z A;  3FKI K;  1WQF A;  4X6A C;  1O26 A;  2A69 A;  2W7V A;  2YU9 A;  4QJV B;  1RU0 A;  3CQZ C;  2JA8 C;  1TWC K;  5IOR A;  2NVY C;  4A3E C;  2E2I A;  1B4B A;  5TMC A;  4AYB L;  3GTG C;  1F9N A;  5IYC C;  2JA6 K;  3SZY A;  1I3Q A;  2E2J K;  3BP3 A;  3GTK A;  1DCH A;  4MEX A;  4XLN A;  4KM8 A;  3GTL K;  4KB4 A;  5IYD K;  2R92 K;  4KMD A;  3V4G A;  4Y7N C;  4A3C C;  3LPX A;  1TWG A;  3RZO K;  3GTJ A;  3A8J A;  2ZFZ A;  3FOF A;  2GAH C;  1VGX A;  2BE5 A;  5C4J C;  1DCO A;  5C4X C;  3HOZ C;  3ERE D;  2GAG C;  3S15 C;  3TTG A;  1IS1 A;  1DCP A;  2A68 A;  2NVT K;  5C44 K;  1TWC C;  2O5J A;  4XCH A;  4BLB A;  3GTO K;  2JA7 A;  2JA6 C;  4A3G C;  3FOE A;  1XZQ A;  1X31 C;  3T01 A;  3S16 K;  1K83 K;  1O2B A;  1YNJ A;  1O29 A;  1HQM A;  4LQY A;  3HKZ D;  4C3J K;  1VLO A;  2V6S A;  3GTQ K;  1XPP A;  4BXX K;  1TWH K;  1F7U A;  1EH1 A;  5IP9 K;  4QIW L;  1O24 A;  3M3Y C;  3GTG A;  4DDQ A;  1HI9 A;  2NVT C;  4A3F K;  2YU9 K;  4OIQ A;  3S14 C;  5C44 C;  1WQG A;  4G0V A;  1PJ7 A;  4OIN A;  1WQH A;  4A3J K;  3PO2 K;  4KN7 A;  1WSR A;  2R7Z K;  4A3L C;  2ZUE A;  1XZQ B;  3VA7 A;  4KM9 A;  3S16 C;  1K83 C;  1XXB A;  4BLA A;  4WJ3 M;  1I6H K;  3NUH A;  4C2M C;  5FLM C;  1Y1W K;  1TWF C;  2VUM A;  3HOY K;  3N3Y A;  2FQT A;  3HXA A;  3AD8 C;  3GTQ C;  4XSZ A;  4BXX C;  4GTD A;  3AH5 A;  4BKW A;  4A93 C;  4A3I K;  3S2H K;  3S2D K;  1YX2 A;  4BY1 C;  1R9T C;  2JA5 C;  4KN4 A;  3I4N K;  2B63 K;  4Q5S A;  1VJE A;  2R7Z C;  1IE0 A;  2PMZ L;  2GSO A;  1PJ5 A;  5IP7 C;  1ZQ1 C;  4OIP A;  3RZD C;  5M5X K;  3GTM K;  5TMF A;  3DXJ A;  1I6H C;  4Y52 K;  4BBS C;  4LR2 A;  3GEI A;  5C3E K;  4OIO A;  4LLG A;  1XZP A;  2NVX K;  3S17 K;  3A8K A;  3HOV K;  5L46 A;  3Q3Q A;  1I50 A;  4A3I C;  4ZH4 A;  3HOU C;  3M4O C;  3H0G C;  1ISE A;  4LJZ A;  3HOW C;  2B63 C;  1WCM K;  4PAB A;  2V6U A;  4GTF A;  1O27 A;  4GTL A;  1JOE A;  1TWF A;  4KB2 A;  4GTC A;  4KAR A;  1INN A;  4GZY A;  4A3B K;  5M5Y K;  4MQ9 A;  4KAS A;  4FM9 A;  4Y52 C;  5M3M K;  3GEE A;  1ZVU A;  2R93 C;  5C3E C;  1O2A A;  1IBA A;  1R9T A;  1F93 A;  5CHP A;  1GE9 A;  1XZP B;  1YCL A;  4YFN A;  3TFH A;  1USM A;  5IYB K;  3N0B A;  5TJ3 A;  1SFO A;  1I6V A;  3FKI C;  2GSU A;  1Y1V A;  1WCM C;  1WOR A;  1TWA A;  2WAQ L;  1BDF A;  3WOD A;  3S0X A;  2WAQ D;  3LAJ A;  2NVQ K;  2E2J C;  3I4M K;  4G7H A;  4GTB A;  2E2H K;  3S1Q K;  4KMU A;  3GTP A;  3MML B;  3HKZ L;  3GTL C;  2Y0S L;  5IYD C;  2CW0 A;  2R92 C;  3HOX K;  5HL8 A;  2Y0S D;  3H0G A;  4LK1 A;  4LK0 A;  3IPJ A;  1I50 K;  3RZO C;  3CQZ A;  5FJ8 K;  2NVY A;  3AQO A;  4G7Z A;  4GT9 A;  5EGH A;  1J98 A;  3QX3 A;  4C3H K;  4C45 A;  2E2I K;  2KWA A;  3A8I A;  3JST A;  3GTO C;  4P5B A;  2R93 A;  5E68 A;  1ZXO A;  1I3Q K;  3CAG A;  3OPF A;  3T00 A;  2E2H C;  3AQP A;  3GTK K;  4BY7 K;  4G0W A;  4GFQ A;  1WOP A;  3FKI A;  4C3J C;  2XCQ A;  2P8T A;  1TWH C;  1BS2 A;  1TWG K;  2PPB A;  1TWC A;  3GTJ K;  1WSV A;  5IP9 C;  1PJ6 A;  2GSN A;  3T02 A;  1L0W A;  2JA6 A;  1Y1V K;  1ZBS A;  1B4A A;  4A3F C;  2YU9 C;  2RGR A;  1TWA K;  3PO2 C;  4A3D K;  4A3J C;  4KMH A;  5EGE A;  3K7A K;  4A3M K;  3GTL A;  4PAA A;  3BP8 C;  2R92 A;  2JA7 K;  4C3I K;  1IW7 A;  4BBR K;  1G51 A;  1O25 A;  1Y1W C;  3HOY C;  1SMY A;  2EBB A;  3PO3 K;  4X6A K;  2A6H A;  3S2H C;  3GTJ C;  3S2D C;  2NVY K;  3GTO A;  3S1N K;  5D4D A;  3GTG K;  2CFA A;  4WIL A;  3ADA C;  5JVO A;  3I4N C;  1EI6 A;  1K83 A;  4G7O A;  1ZYR A;  2JA7 C;  1DD5 A;  3L4K A;  4BBR C;  1O28 A;  4YFK A;  3GTM C;  3GTQ A;  1VH2 A;  2WB1 L;  1TWH A;  4RMF A;  1J6X A;  1J6W A;  3OEP A;  2WB1 D;  3GDZ A;  2VUM K;  3H3V L;  1UV7 A;  3PO3 C;  5C4X K;  5C4J K;  4YFX A;  3HOZ K;  1EFW A;  2NVX C;  3S17 C;  2JA5 A;  4KC6 A;  2V6T A;  3H3V D;  3S15 K;  3HOV C;  1XXA A;  4NOI A;  1XXC A;  1USO A;  2R7Z A;  3S1N C;  1IL2 A;  2CFA B;  4A3G K;  5CJ9 A;  2XCR B;  2PA8 L;  4AYB D;  3AD7 C;  1C0A A;  2JH3 A;  4J3N A;  2PA8 D;  1Y1W A;  3S1R K;  4MEY A;  1KQ4 A;  3GEH A;  4A3B C;  3AD9 C;  4XSX A;  5IOS A;  4XLP A;  4GTA A;  4AH6 A;  2PHC B;  2VUM C;  3ORE A;  4P5A A;  4JK1 A;  3M3Y K;  3L4J A;  2P5M A;  2B63 A;  5IYB C;  3S14 K;  5M3F K;  1EQR A;  1YNN A;  4A3L K;  3N0C A;  4YG2 A;  3GTM A;  1EK8 A;  3G4C A;  3FHZ A;  1WIH A;  3BUE A;  1O2F B;  3S1R C;  4C2M K;  5FLM K;  3LAP A;  1TWF K;  2NVQ C;  4GTE A;  3I4M C;  3EQL A;  2NVX A;  5IOT A;  3S1Q C;  3SZZ A;  4A93 K;  3TFI A;  3HOX C;  4BY1 K;  1R9T K;  4KAT A;  4ILD A;  2JA5 K;  3GSI A;  4QIW D;  4A3K K;  1WCM A;  5IOQ A;  1I50 C; 
#chains in the Genus database with same CATH homology
 1USM A;  2V6U A;  1DCP A;  1F93 A;  3JST A;  1DCH A;  3HXA A;  1RU0 A;  2EBB A;  4LOW A;  4WIL A;  2V6S A;  4C45 A;  1USO A;  1DCO A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...