1DCHA

Crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DCoH, a bifunctional, protein-binding transcriptional coactivator.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator,dimerization
molecule keywords DCOH (DIMERIZATION COFACTOR OF HNF-1)
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dchA00
3HXAA 1DCOA 3JSTA 2V6TA 4C45A 1USOA 2EBBA 1RU0A 2V6SA 1F93A 1USMA 4WILA 2V6UA 4LOWA 1DCHA 1DCPA
chains in the Genus database with same CATH superfamily
2VUMK 2E2HA 3GTPK 4FZBA 1JVIA 4PABA 2NVXK 1ZVUA 2NVYC 4YFNA 4A3FC 1X31C 4KMAA 5C4XK 1O29A 2R92A 1TWAA 3H3VD 3S16K 4XCHA 3AD9C 4KATA 4GTLA 3GTMA 4G7OA 3FKIK 3HOZC 5IYDK 1WOSA 3I4MC 1PJ5A 2R92K 4KDDA 3MMLB 1EQRA 1USMA 3G4AA 1TWGA 2E2JK 4KM8A 4A3IC 2B63C 1O2AA 1O26A 5EGHA 4AYBD 4KM9A 4BY7C 1SMYA 2GAHC 2CFAB 2GSUA 3QX3A 3S14C 2GSOA 1EFWA 1O2BA 5E68A 4OIPA 4J3NA 1IBAA 3LAJA 3RZDC 4BBSK 2WAQD 3GTKK 3GTMC 3GTOK 4XLNA 3I4NK 1F7UA 2PMZD 3A8IA 4C3HK 2NVYK 3GSIA 4X6AC 1G51A 2B63A 2PPBA 4YFKA 5M3MK 3VA7A 4OIQA 1J6VA 2GSNA 2Y3PA 4GTBA 1SFOK 3GTJA 3GTKC 1TWFA 3RZDK 4PAAA 3RZOC 2WB1L 3CAGA 3GTOA 1WCMC 4A3KC 3FOFA 4BY1K 3S15C 4A3BK 4RMFA 5M3FK 1F9NA 5C4JK 2GAGC 1XPPA 3ADAC 2JA7C 3AD7C 3N0BA 2R7ZC 2V6UA 4LOWA 1XXBA 1SFOA 1VLOA 2YU9K 2RGRA 4QJVA 4A3CK 2E2JC 4C3JC 2NVTC 1R9TK 1DCPA 1TWGK 2R92C 3ERED 3S1MK 4BXXC 3GTKA 4MQ9A 4OIRA 1VJEA 4WJ3M 3OREA 1EK8A 3HOZK 1ZYRA 5M5YK 5IP9K 3NUHA 1YCLA 4KAWX 2V6TA 3S1NC 3RZOK 1WCMA 1TWHK 3FOEA 2A6HA 3S1QC 3T00A 4BLAA 2JA5K 2CW0A 4C3IK 4Q5SA 4A93C 2ZFZA 1C0AA 2JA8K 1TWFC 3FHZA 3GTPC 1IS1A 4Y7NC 3GTQA 3GTOC 3LAPA 3OPFA 4ILDA 3JSTA 1HQMA 1V5VA 1WSRA 4Q4ZA 4P9SA 4LK0A 2XCOA 2JA8C 1TWHA 2O5JA 4YG2A 2JA7A 3N3YA 3TFJA 4G7HA 5TMCA 3H0GC 1O25A 3EQLA 1VH2A 1I6HC 1JQWA 1TWGC 5IOTA 3S1MC 1BDFA 1BS2A 3CQZC 3A8JA 1YNNA 5IP9C 4KARA 2A69A 4QIWL 3GEHA 3LPXA 5IYBK 1Y1VK 2VUMA 2ZUEA 4DDQA 5C44K 3GTPA 3GTGK 2YU9A 3GTLA 1PJ6A 4KN4A 4WJ4A 4O2DA 1WORA 4A3MC 1F7VA 3AQPA 4G0UA 4LR2A 5CJ9A 2O5IA 1INNA 3TFHA 3WODA 4GTAA 4A3GK 5FLMC 2JH3A 2BE5A 5D4DA 3S16C 4C2MK 1IL2A 3S2DC 3H0GK 4G0VA 3HKZD 2XCRB 4KB2A 4X6AK 3G4CA 5C3EC 3PO2C 1WSVA 4KMDA 1K83C 4BY1C 5EGEA 3GDZA 5IP7C 5JVOA 1WCMK 4KN7A 4A3KK 1WIHA 3AH5A 3DXJA 4BBSC 1IE0A 1ISEA 3HOVK 1VRQC 1XZPA 1USOA 2NVYA 3OEPA 4GFQA 1I50K 1Y1WC 4A93K 4FM9A 3M3YC 3HKZL 5C3EK 3H0GA 4C3IC 2E2HC 2JA5C 3GTQK 1O28A 1WQGA 2R7ZA 1J6WA 3S2HC 3S2DK 3N0CA 2PHCB 3HXAA 3I4NC 2CFAA 3HOYC 1HI9A 3S1NK 5IYCC 3BUEA 4BKWA 3L4JA 1O27A 1DCHA 4LQYA 3HOWK 2Y0SD 4BLBA 1ZQ1C 3T01A 4A3EK 3GTLC 2E2IK 3M4OC 3L4KA 3GTGC 2P8TA 2E2IC 4XSXA 4BY7K 4QJVB 3HOWC 2R93A 4Y52K 4A3LC 1XXAA 4JK1A 3GTJK 5M5WK 5IYCK 4BBRC 4OIOA 3FKIA 1I3QA 2P5MA 2A68A 4AYBL 4A3EC 3GTGA 4GTDA 1PJ7A 1O24A 5C4JC 3M3YK 1J98A 4GTFA 5CHPA 2ZUFA 2VUMC 3H3VL 5FJ8K 5TJ3A 3S17K 3K7AK 3GEIA 1Y1WA 3HOYK 4Y7NK 3S2HK 4LJZA 5IP7K 4A3FK 3PO3K 2JA5A 4GTEA 4LLGA 3PO2K 2E2HK 3GTQC 1EH1A 2NVXC 4MEYA 1DCOA 3PO3C 1YNJA 1L0WA 4XLPA 1XZPB 3HOVC 3K7AC 2FQTA 3HOXK 3S17C 1BJTA 3TFIA 4A3GC 4KMUA 4A3JC 2XCQA 2KWAA 1KQ4A 2W7VA 5TMFA 2A6EA 1RU0A 4KASA 2PMZL 3V4GA 3CQZA 2NVQC 4ZH4A 3GIRA 2FQOA 4C45A 3AD8C 4BBRK 5C44C 5FLMK 1R9TC 2EBBA 4G7ZA 2B63K 4A3CC 2YU9C 1UV7A 4Y52C 1TWAK 3HOUK 4M1XA 3CQZK 1EI6A 3M4OK 2WB1D 2R93K 1ZXOA 1WOPA 4WILA 3I4MK 1TWCA 5IYBC 4NOIA 3AQOA 1IQ0A 5L46A 1GE9A 4XSZA 1I3QK 4KB4A 1WOOA 4GT9A 5JFEA 4G0WA 1XZQA 1K83A 4A3DC 4OINA 1B4AA 1Y1VA 1TWCK 3S1RK 1TWCC 4QIWD 1YX2A 3S1RC 1Y1WK 4C3HC 3S1QK 5M5XK 1BGWA 5IORA 1TWHC 2PA8D 4AH6A 3SZYA 1I50A 1J6XA 3Q3QA 1R9TA 1I3QC 2RH6A 1TWFK 2Y0SL 1K83K 1O2FB 3IPJA 4GZYA 5HL8A 3GEEA 3S0XA 4A3DK 3T02A 3S14K 4C2MC 2WAQL 4YFXA 2PA8L 1IW7A 3TTGA 3HOUC 1TWAC 2JA6C 2NVTK 3GTJC 1I6VA 4A3IK 4KC6A 4A3LK 3SZZA 2E2IA 4A3MK 1DD5A 2D6FC 4MEXA 2R93C 4BXXK 4P5AA 3A8KA 2JA7K 3GTLK 1Y1VC 3BP8C 5IOSA 1AB4A 1ZBSA 4C3JK 5IYDC 4KMHA 1XZQB 1WQFA 1JOEA 3FKIC 1XXCA 4LK1A 1B4BA 2JA6K 4A3JK 2V6SA 2R7ZK 1VGXA 1I6HK 5C4XC 1WQHA 2NVXA 2NVQK 2JA6A 5IOQA 4P5BA 3BP3A 3S15K 4A3BC 1I50C 4GTCA 1F93A 3GTMK 3HOXC 1SFOC
chains in the Genus database with same CATH topology
3HXAA 1DCOA 3JSTA 2V6TA 4C45A 1USOA 2EBBA 1RU0A 2V6SA 1F93A 1USMA 4WILA 2V6UA 4LOWA 1DCHA 1DCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  1DCO A;  3JST A;  2V6T A;  4C45 A;  1USO A;  2EBB A;  1RU0 A;  2V6S A;  1F93 A;  1USM A;  4WIL A;  2V6U A;  4LOW A;  1DCH A;  1DCP A; 
#chains in the Genus database with same CATH topology
 2VUM K;  2E2H A;  3GTP K;  4FZB A;  1JVI A;  4PAB A;  2NVX K;  1ZVU A;  2NVY C;  4YFN A;  4A3F C;  1X31 C;  4KMA A;  5C4X K;  1O29 A;  2R92 A;  1TWA A;  3H3V D;  3S16 K;  4XCH A;  3AD9 C;  4KAT A;  4GTL A;  3GTM A;  4G7O A;  3FKI K;  3HOZ C;  5IYD K;  1WOS A;  3I4M C;  1PJ5 A;  2R92 K;  4KDD A;  3MML B;  1EQR A;  1USM A;  3G4A A;  1TWG A;  2E2J K;  4KM8 A;  4A3I C;  2B63 C;  1O2A A;  1O26 A;  5EGH A;  4AYB D;  4KM9 A;  4BY7 C;  1SMY A;  2GAH C;  2CFA B;  2GSU A;  3QX3 A;  3S14 C;  2GSO A;  1EFW A;  1O2B A;  5E68 A;  4OIP A;  4J3N A;  1IBA A;  3LAJ A;  3RZD C;  4BBS K;  2WAQ D;  3GTK K;  3GTM C;  3GTO K;  4XLN A;  3I4N K;  1F7U A;  2PMZ D;  3A8I A;  4C3H K;  2NVY K;  3GSI A;  4X6A C;  1G51 A;  2B63 A;  2PPB A;  4YFK A;  5M3M K;  3VA7 A;  4OIQ A;  1J6V A;  2GSN A;  2Y3P A;  4GTB A;  1SFO K;  3GTJ A;  3GTK C;  1TWF A;  3RZD K;  4PAA A;  3RZO C;  2WB1 L;  3CAG A;  3GTO A;  1WCM C;  4A3K C;  3FOF A;  4BY1 K;  3S15 C;  4A3B K;  4RMF A;  5M3F K;  1F9N A;  5C4J K;  2GAG C;  1XPP A;  3ADA C;  2JA7 C;  3AD7 C;  3N0B A;  2R7Z C;  2V6U A;  4LOW A;  1XXB A;  1SFO A;  1VLO A;  2YU9 K;  2RGR A;  4QJV A;  4A3C K;  2E2J C;  4C3J C;  2NVT C;  1R9T K;  1DCP A;  1TWG K;  2R92 C;  3ERE D;  3S1M K;  4BXX C;  3GTK A;  4MQ9 A;  4OIR A;  1VJE A;  4WJ3 M;  3ORE A;  1EK8 A;  3HOZ K;  1ZYR A;  5M5Y K;  5IP9 K;  3NUH A;  1YCL A;  4KAW X;  2V6T A;  3S1N C;  3RZO K;  1WCM A;  1TWH K;  3FOE A;  2A6H A;  3S1Q C;  3T00 A;  4BLA A;  2JA5 K;  2CW0 A;  4C3I K;  4Q5S A;  4A93 C;  2ZFZ A;  1C0A A;  2JA8 K;  1TWF C;  3FHZ A;  3GTP C;  1IS1 A;  4Y7N C;  3GTQ A;  3GTO C;  3LAP A;  3OPF A;  4ILD A;  3JST A;  1HQM A;  1V5V A;  1WSR A;  4Q4Z A;  4P9S A;  4LK0 A;  2XCO A;  2JA8 C;  1TWH A;  2O5J A;  4YG2 A;  2JA7 A;  3N3Y A;  3TFJ A;  4G7H A;  5TMC A;  3H0G C;  1O25 A;  3EQL A;  1VH2 A;  1I6H C;  1JQW A;  1TWG C;  5IOT A;  3S1M C;  1BDF A;  1BS2 A;  3CQZ C;  3A8J A;  1YNN A;  5IP9 C;  4KAR A;  2A69 A;  4QIW L;  3GEH A;  3LPX A;  5IYB K;  1Y1V K;  2VUM A;  2ZUE A;  4DDQ A;  5C44 K;  3GTP A;  3GTG K;  2YU9 A;  3GTL A;  1PJ6 A;  4KN4 A;  4WJ4 A;  4O2D A;  1WOR A;  4A3M C;  1F7V A;  3AQP A;  4G0U A;  4LR2 A;  5CJ9 A;  2O5I A;  1INN A;  3TFH A;  3WOD A;  4GTA A;  4A3G K;  5FLM C;  2JH3 A;  2BE5 A;  5D4D A;  3S16 C;  4C2M K;  1IL2 A;  3S2D C;  3H0G K;  4G0V A;  3HKZ D;  2XCR B;  4KB2 A;  4X6A K;  3G4C A;  5C3E C;  3PO2 C;  1WSV A;  4KMD A;  1K83 C;  4BY1 C;  5EGE A;  3GDZ A;  5IP7 C;  5JVO A;  1WCM K;  4KN7 A;  4A3K K;  1WIH A;  3AH5 A;  3DXJ A;  4BBS C;  1IE0 A;  1ISE A;  3HOV K;  1VRQ C;  1XZP A;  1USO A;  2NVY A;  3OEP A;  4GFQ A;  1I50 K;  1Y1W C;  4A93 K;  4FM9 A;  3M3Y C;  3HKZ L;  5C3E K;  3H0G A;  4C3I C;  2E2H C;  2JA5 C;  3GTQ K;  1O28 A;  1WQG A;  2R7Z A;  1J6W A;  3S2H C;  3S2D K;  3N0C A;  2PHC B;  3HXA A;  3I4N C;  2CFA A;  3HOY C;  1HI9 A;  3S1N K;  5IYC C;  3BUE A;  4BKW A;  3L4J A;  1O27 A;  1DCH A;  4LQY A;  3HOW K;  2Y0S D;  4BLB A;  1ZQ1 C;  3T01 A;  4A3E K;  3GTL C;  2E2I K;  3M4O C;  3L4K A;  3GTG C;  2P8T A;  2E2I C;  4XSX A;  4BY7 K;  4QJV B;  3HOW C;  2R93 A;  4Y52 K;  4A3L C;  1XXA A;  4JK1 A;  3GTJ K;  5M5W K;  5IYC K;  4BBR C;  4OIO A;  3FKI A;  1I3Q A;  2P5M A;  2A68 A;  4AYB L;  4A3E C;  3GTG A;  4GTD A;  1PJ7 A;  1O24 A;  5C4J C;  3M3Y K;  1J98 A;  4GTF A;  5CHP A;  2ZUF A;  2VUM C;  3H3V L;  5FJ8 K;  5TJ3 A;  3S17 K;  3K7A K;  3GEI A;  1Y1W A;  3HOY K;  4Y7N K;  3S2H K;  4LJZ A;  5IP7 K;  4A3F K;  3PO3 K;  2JA5 A;  4GTE A;  4LLG A;  3PO2 K;  2E2H K;  3GTQ C;  1EH1 A;  2NVX C;  4MEY A;  1DCO A;  3PO3 C;  1YNJ A;  1L0W A;  4XLP A;  1XZP B;  3HOV C;  3K7A C;  2FQT A;  3HOX K;  3S17 C;  1BJT A;  3TFI A;  4A3G C;  4KMU A;  4A3J C;  2XCQ A;  2KWA A;  1KQ4 A;  2W7V A;  5TMF A;  2A6E A;  1RU0 A;  4KAS A;  2PMZ L;  3V4G A;  3CQZ A;  2NVQ C;  4ZH4 A;  3GIR A;  2FQO A;  4C45 A;  3AD8 C;  4BBR K;  5C44 C;  5FLM K;  1R9T C;  2EBB A;  4G7Z A;  2B63 K;  4A3C C;  2YU9 C;  1UV7 A;  4Y52 C;  1TWA K;  3HOU K;  4M1X A;  3CQZ K;  1EI6 A;  3M4O K;  2WB1 D;  2R93 K;  1ZXO A;  1WOP A;  4WIL A;  3I4M K;  1TWC A;  5IYB C;  4NOI A;  3AQO A;  1IQ0 A;  5L46 A;  1GE9 A;  4XSZ A;  1I3Q K;  4KB4 A;  1WOO A;  4GT9 A;  5JFE A;  4G0W A;  1XZQ A;  1K83 A;  4A3D C;  4OIN A;  1B4A A;  1Y1V A;  1TWC K;  3S1R K;  1TWC C;  4QIW D;  1YX2 A;  3S1R C;  1Y1W K;  4C3H C;  3S1Q K;  5M5X K;  1BGW A;  5IOR A;  1TWH C;  2PA8 D;  4AH6 A;  3SZY A;  1I50 A;  1J6X A;  3Q3Q A;  1R9T A;  1I3Q C;  2RH6 A;  1TWF K;  2Y0S L;  1K83 K;  1O2F B;  3IPJ A;  4GZY A;  5HL8 A;  3GEE A;  3S0X A;  4A3D K;  3T02 A;  3S14 K;  4C2M C;  2WAQ L;  4YFX A;  2PA8 L;  1IW7 A;  3TTG A;  3HOU C;  1TWA C;  2JA6 C;  2NVT K;  3GTJ C;  1I6V A;  4A3I K;  4KC6 A;  4A3L K;  3SZZ A;  2E2I A;  4A3M K;  1DD5 A;  2D6F C;  4MEX A;  2R93 C;  4BXX K;  4P5A A;  3A8K A;  2JA7 K;  3GTL K;  1Y1V C;  3BP8 C;  5IOS A;  1AB4 A;  1ZBS A;  4C3J K;  5IYD C;  4KMH A;  1XZQ B;  1WQF A;  1JOE A;  3FKI C;  1XXC A;  4LK1 A;  1B4B A;  2JA6 K;  4A3J K;  2V6S A;  2R7Z K;  1VGX A;  1I6H K;  5C4X C;  1WQH A;  2NVX A;  2NVQ K;  2JA6 A;  5IOQ A;  4P5B A;  3BP3 A;  3S15 K;  4A3B C;  1I50 C;  4GTC A;  1F93 A;  3GTM K;  3HOX C;  1SFO C; 
#chains in the Genus database with same CATH homology
 3HXA A;  1DCO A;  3JST A;  2V6T A;  4C45 A;  1USO A;  2EBB A;  1RU0 A;  2V6S A;  1F93 A;  1USM A;  4WIL A;  2V6U A;  4LOW A;  1DCH A;  1DCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...