2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
1YNJA 3HOUC 3H0GC 5IP7K 1SFOK 2WB1D 4QJVA 3GTLC 2PMZL 2E2JK 1TWAK 4QIWD 2YU9K 2VUMK 3S14K 4BY7C 1TWCC 4A3GC 4BBRC 5FLMC 3RZOK 3S1NC 5IYDC 4GZYA 3S1MK 5IYBK 4G7OA 3K7AC 3S17C 3PO2C 2JA5K 4XLPA 4XSZA 5C44C 3CQZK 3I4MK 3S2DC 2A6EA 1XPPA 4MEXA 2R7ZK 3HOWC 1Y1WC 4OIPA 4XSXA 2NVXC 4BY1K 5M5YK 2VUMC 3GTJC 4A3BC 3S2HK 3M4OK 2JA6K 4YFNA 4C3JK 5C3EC 2CW0A 5IYCK 4A3FK 2WAQL 2NVYC 4A3MK 4C3IK 5IYBC 2B63K 4A3KC 3GTQC 5C4XK 3S1QC 4Y52K 4BBSK 2JA7K 3GTKK 3HOVK 4ZH4A 4G7HA 2JA5C 3DXJA 4KN7A 4Y7NC 4LK0A 3FKIC 4BXXK 4A3JC 2O5JA 2NVTC 2NVQC 3GTMK 3HOZC 4YFXA 1HQMA 3GTPC 2E2HK 2R93C 2WB1L 2A69A 4QIWL 1TWFK 3HOYC 3M3YC 1WCMC 1ZYRA 4LLGA 1I3QC 4KN4A 4G7ZA 5IP9K 5TMFA 5M5WK 3HKZD 1Y1VK 4MQ9A 5M5XK 1R9TC 2E2IK 3S16K 3GTOK 5IP7C 4A3LK 1SFOC 4A3IC 3S14C 4YFKA 2E2JC 1TWAC 4AYBL 2YU9C 2Y0SD 4OIOA 4A3DK 3GTGK 3RZOC 1YNNA 2PMZD 2A6HA 2R93K 3S1MC 2JA8K 3H3VD 1TWGK 3HOXK 4OINA 4A3EK 3PO3K 4NOIA 2R92K 4X6AK 1I50K 1K83K 3S15K 3CQZC 4C3HK 3S1RK 3I4NK 3I4MC 1I6VA 2R7ZC 4A3LC 4A3CK 3RZDK 1TWHK 4BY1C 4Q5SA 4A93K 1I6HK 3S2HC 5C4JK 4A3IK 2JA6C 3M4OC 2A68A 5FJ8K 3H0GK 4C2MK 5IYCC 4A3FC 4A3MC 5M3MK 2B63C 4Y52C 4BY7K 4LJZA 4BBSC 2JA7C 3GTKC 4A3GK 2PA8D 1TWCK 4JK1A 2O5IA 3HOVC 4BBRK 5FLMK 2WAQD 4BXXC 2PPBA 3S1NK 5IYDK 3GTMC 3EQLA 3K7AK 3S17K 3PO2K 2E2HC 3WODA 4QJVB 5TMCA 4A93C 1IW7A 4XLNA 1TWFC 2Y0SL 5C44K 3S2DK 3HOWK 4MEYA 1Y1WK 5IP9C 4A3BK 5M3FK 4Q4ZA 1Y1VC 2NVXK 3GTJK 3H3VL 4LK1A 5C3EK 2E2IC 3S16C 3GTOC 2NVYK 3S1QK 3GTQK 4A3DC 4A3KK 1SMYA 2BE5A 3GTGC 3HOUK 4Y7NK 3FKIK 4AYBD 4A3JK 2JA8C 2NVTK 1TWGC 2NVQK 3GTLK 3HOXC 3PO3C 4KMUA 4A3EC 3HOZK 5C4XC 3GTPK 2R92C 4X6AC 4OIRA 1I50C 1K83C 3HKZL 3S15C 2PA8L 3S1RC 3HOYK 1WCMK 3M3YK 5D4DA 3I4NC 1I3QK 4YG2A 4A3CC 3RZDC 1TWHC 4OIQA 1I6HC 5C4JC 1R9TK 1BDFA
chains in the Genus database with same CATH superfamily
3HOUC 2VUMA 1USMA 1EFWA 5IP7K 4LR2A 2XCRB 3SZZA 1TWAK 1WQFA 4GTAA 2NVYA 4RMFA 4BBRC 1AB4A 3K7AC 1O25A 1XXBA 3I4MK 2A6EA 3HOWC 4GTDA 4XSXA 1I3QA 2JA6K 4C3JK 4A3FK 4GZYA 5IYBC 3GTQC 2B63K 3TFHA 2GSOA 3IPJA 5CHPA 3DXJA 3A8IA 3GSIA 4G7HA 4KDDA 2JA5C 4PAAA 4LK0A 3FKIC 4A3JC 1X31C 2WB1L 1O29A 4QIWL 3M3YC 3HKZD 2V6SA 1B4BA 3S16K 5IP7C 4A3DK 1TWAC 1ZBSA 1C0AA 2FQOA 1BJTA 1O2AA 2PMZD 2R93K 3H3VD 2Y3PA 4NOIA 3GTMA 3MMLB 3S15K 3I4MC 3S1RK 4G0UA 3I4NK 1I6VA 4A3LC 1IL2A 4Q5SA 5HL8A 4A93K 1I6HK 4GTLA 1O2FB 2RH6A 2JA6C 4C3JC 1EQRA 1Y1VA 3H0GK 4A3FC 2B63C 4A3GK 1TWCK 1YCLA 4KATA 3S1NK 1J6XA 2CFAB 2Y0SL 4J3NA 4GTBA 1I50A 4KAWX 1F7VA 5M3FK 3BP3A 3OREA 5JFEA 3GTJK 3S16C 4O2DA 3S1QK 4KB4A 4A3KK 4ILDA 4A3DC 1VGXA 5EGHA 3HOUK 4Y7NK 2R93C 1PJ7A 4KMUA 1RU0A 3GTPK 3HKZL 3S15C 3S1RC 3I4NC 1WCMK 2GSUA 4OIQA 1I6HC 4KM8A 1R9TK 1BDFA 1Y1WA 1YNJA 2NVXA 3H0GC 4AH6A 4GTFA 3ADAC 2WB1D 2PMZL 2E2JK 4QIWD 4A3GC 1TWCC 3RZOK 1WORA 3S1NC 4P5AA 3NUHA 5IYBK 1VRQC 4G7OA 2JA5K 4XSZA 1XXCA 3CQZK 5IORA 1PJ6A 4MEXA 1GE9A 1B4AA 4OIPA 1O2BA 3GTJC 3S2HK 4YFNA 4XCHA 3S1QC 2XCQA 4A3KC 4Y52K 2JA7K 3GTKK 4KMAA 2YU9A 3SZYA 4Y7NC 3G4CA 2O5JA 3N0BA 1HQMA 3GTPC 2E2HK 3T01A 1TWFK 1XXAA 1WCMC 1EK8A 4LLGA 4G7ZA 3LPXA 2R7ZA 1INNA 1R9TC 5M5XK 4FM9A 1O28A 2E2IK 2D6FC 1KQ4A 4A3LK 4YFKA 2E2JC 2Y0SD 3ERED 3GTGK 3RZOC 1TWGK 2XCOA 3HOXK 4A3EK 1WSRA 1K83K 3CQZC 4C3HK 3Q3QA 2GAGC 5IOQA 2ZFZA 1O26A 3A8KA 4KMHA 3S2HC 5C4JK 4A3IK 3AD9C 4C2MK 4KASA 4BKWA 4Y52C 4BY7K 3OPFA 3GTOA 2JA7C 3GTKC 2WAQD 2PPBA 1ZQ1C 4GFQA 5IYDK 3EQLA 3S17K 3PO2K 2E2HC 3BP8C 3GEHA 4XLNA 1TWFC 3TFIA 5C44K 3LAPA 3S2DK 2R92A 4P5BA 4P9SA 4GTEA 4A3BK 5E68A 5C3EK 3GEIA 2E2IC 2PHCB 2NVYK 2BE5A 2EBBA 3GTGC 1TWGC 3HOXC 4KC6A 4A3EC 3HOZK 2V6UA 4KM9A 1IS1A 1K83C 2PA8L 1UV7A 4C3HC 5IOTA 3T00A 2W7VA 5D4DA 1R9TA 1I3QK 5C4JC 4A3IC 3FOFA 4C2MC 3GTLC 3S14K 4BY7C 3VA7A 1ISEA 3GTQA 4M1XA 2JA5A 5IYDC 3S1MK 1ZXOA 1USOA 3S17C 3FKIA 1WOSA 3PO2C 1J6WA 4G0WA 5C44C 3S2DC 1DCPA 4BY1K 4A3BC 2VUMC 4KARA 4C45A 3M4OK 5C3EC 2CW0A 2P8TA 4A3MK 2WAQL 2NVYC 4LOWA 3HOVK 4KN7A 1BGWA 1TWAA 4BXXK 3GTMK 1VLOA 3HOZC 2CFAA 3AH5A 1DCOA 2A69A 4KB2A 1ZYRA 3AD7C 1I3QC 4KN4A 5IP9K 5TMFA 5M5WK 1Y1VK 4WILA 2JA6A 3S14C 1WOPA 1ZVUA 5EGEA 1L0WA 4OIOA 2KWAA 2B63A 2ZUEA 3S1MC 2JA8K 1EH1A 1IBAA 1EI6A 1I50K 2P5MA 1HI9A 4WJ3M 1TWHK 4BY1C 3M4OC 2A68A 5FJ8K 1IQ0A 4A3MC 5M3MK 2PA8D 4JK1A 3HOVC 1G51A 3CAGA 5FLMK 3L4JA 4BXXC 3N0CA 4G0VA 3GTMC 1O27A 2R93A 3WODA 4QJVB 5TMCA 1J6VA 1J98A 1Y1WK 5IP9C 2NVXK 4Q4ZA 1Y1VC 4LK1A 3H0GA 1SMYA 3GEEA 3LAJA 2FQTA 1TWCA 4DDQA 5JVOA 4AYBD 2JA8C 2NVTK 2NVQK 3GTLK 3T02A 4OIRA 1I50C 4LQYA 1VJEA 3HOYK 4YG2A 1BS2A 1TWHC 3L4KA 3GTJA 1YX2A 1SFOK 4QJVA 3AD8C 2YU9K 2VUMK 1IE0A 5FLMC 4BLAA 3JSTA 4XLPA 3GTPA 2R7ZK 1XPPA 1Y1WC 1WCMA 2NVXC 5M5YK 5CJ9A 5IYCK 1O24A 4C3IK 4GTCA 5C4XK 4BBSK 4ZH4A 2GAHC 2RGRA 2NVTC 2NVQC 4YFXA 3BUEA 1JVIA 3HXAA 3S0XA 3HOYC 3CQZA 4MQ9A 1XZQB 3GTOK 1SFOC 2YU9C 4AYBL 1XZPB 3TFJA 3V4GA 1YNNA 2JA7A 3GTKA 5L46A 2A6HA 4KMDA 4OINA 3PO3K 2R92K 4X6AK 4BLBA 1TWHA 3GDZA 2E2HA 1WOOA 2R7ZC 3GIRA 1TWFA 3RZDK 1WIHA 4A3CK 3AQPA 1DD5A 3AQOA 3G4AA 5IYCC 4C3IC 2E2IA 1DCHA 4GT9A 4LJZA 4BBSC 5C4XC 2O5IA 4BBRK 1JOEA 1F93A 3GTGA 2V6TA 1PJ5A 3K7AK 1WSVA 4A93C 4FZBA 1TWGA 1IW7A 1XZQA 3OEPA 3FHZA 1K83A 1F9NA 1XZPA 4MEYA 3TTGA 3HOWK 3H3VL 1VH2A 3GTOC 1V5VA 3GTQK 3A8JA 1WQGA 2GSNA 4PABA 1WQHA 3FOEA 3GTLA 5TJ3A 2JH3A 3FKIK 4A3JK 3PO3C 2ZUFA 2R92C 4X6AC 3N3YA 4WJ4A 5IOSA 1JQWA 3QX3A 3M3YK 1F7UA 4A3CC 3RZDC 1SFOA
chains in the Genus database with same CATH topology
1YNJA 3HOUC 3H0GC 5IP7K 1SFOK 2WB1D 4QJVA 3GTLC 2PMZL 2E2JK 1TWAK 4QIWD 2YU9K 2VUMK 3S14K 4BY7C 1TWCC 4A3GC 4BBRC 5FLMC 3RZOK 3S1NC 5IYDC 4GZYA 3S1MK 5IYBK 4G7OA 3K7AC 3S17C 3PO2C 2JA5K 4XLPA 4XSZA 5C44C 3CQZK 3I4MK 3S2DC 2A6EA 1XPPA 4MEXA 2R7ZK 3HOWC 1Y1WC 4OIPA 4XSXA 2NVXC 4BY1K 5M5YK 2VUMC 3GTJC 4A3BC 3S2HK 3M4OK 2JA6K 4YFNA 4C3JK 5C3EC 2CW0A 5IYCK 4A3FK 2WAQL 2NVYC 4A3MK 4C3IK 5IYBC 2B63K 4A3KC 3GTQC 5C4XK 3S1QC 4Y52K 4BBSK 2JA7K 3GTKK 3HOVK 4ZH4A 4G7HA 2JA5C 3DXJA 4KN7A 4Y7NC 4LK0A 3FKIC 4BXXK 4A3JC 2O5JA 2NVTC 2NVQC 3GTMK 3HOZC 4YFXA 1HQMA 3GTPC 2E2HK 2R93C 2WB1L 2A69A 4QIWL 1TWFK 3HOYC 3M3YC 1WCMC 1ZYRA 4LLGA 1I3QC 4KN4A 4G7ZA 5IP9K 5TMFA 5M5WK 3HKZD 1Y1VK 4MQ9A 5M5XK 1R9TC 2E2IK 3S16K 3GTOK 5IP7C 4A3LK 1SFOC 4A3IC 3S14C 4YFKA 2E2JC 1TWAC 4AYBL 2YU9C 2Y0SD 4OIOA 4A3DK 3GTGK 3RZOC 1YNNA 2PMZD 2A6HA 2R93K 3S1MC 2JA8K 3H3VD 1TWGK 3HOXK 4OINA 4A3EK 3PO3K 4NOIA 2R92K 4X6AK 1I50K 1K83K 3S15K 3CQZC 4C3HK 3S1RK 3I4NK 3I4MC 1I6VA 2R7ZC 4A3LC 4A3CK 3RZDK 1TWHK 4BY1C 4Q5SA 4A93K 1I6HK 3S2HC 5C4JK 4A3IK 2JA6C 3M4OC 2A68A 5FJ8K 3H0GK 4C2MK 5IYCC 4A3FC 4A3MC 5M3MK 2B63C 4Y52C 4BY7K 4LJZA 4BBSC 2JA7C 3GTKC 4A3GK 2PA8D 1TWCK 4JK1A 2O5IA 3HOVC 4BBRK 5FLMK 2WAQD 4BXXC 2PPBA 3S1NK 5IYDK 3GTMC 3EQLA 3K7AK 3S17K 3PO2K 2E2HC 3WODA 4QJVB 5TMCA 4A93C 1IW7A 4XLNA 1TWFC 2Y0SL 5C44K 3S2DK 3HOWK 4MEYA 1Y1WK 5IP9C 4A3BK 5M3FK 4Q4ZA 1Y1VC 2NVXK 3GTJK 3H3VL 4LK1A 5C3EK 2E2IC 3S16C 3GTOC 2NVYK 3S1QK 3GTQK 4A3DC 4A3KK 1SMYA 2BE5A 3GTGC 3HOUK 4Y7NK 3FKIK 4AYBD 4A3JK 2JA8C 2NVTK 1TWGC 2NVQK 3GTLK 3HOXC 3PO3C 4KMUA 4A3EC 3HOZK 5C4XC 3GTPK 2R92C 4X6AC 4OIRA 1I50C 1K83C 3HKZL 3S15C 2PA8L 3S1RC 3HOYK 1WCMK 3M3YK 5D4DA 3I4NC 1I3QK 4YG2A 4A3CC 3RZDC 1TWHC 4OIQA 1I6HC 5C4JC 1R9TK 1BDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNJ A;  3HOU C;  3H0G C;  5IP7 K;  1SFO K;  2WB1 D;  4QJV A;  3GTL C;  2PMZ L;  2E2J K;  1TWA K;  4QIW D;  2YU9 K;  2VUM K;  3S14 K;  4BY7 C;  1TWC C;  4A3G C;  4BBR C;  5FLM C;  3RZO K;  3S1N C;  5IYD C;  4GZY A;  3S1M K;  5IYB K;  4G7O A;  3K7A C;  3S17 C;  3PO2 C;  2JA5 K;  4XLP A;  4XSZ A;  5C44 C;  3CQZ K;  3I4M K;  3S2D C;  2A6E A;  1XPP A;  4MEX A;  2R7Z K;  3HOW C;  1Y1W C;  4OIP A;  4XSX A;  2NVX C;  4BY1 K;  5M5Y K;  2VUM C;  3GTJ C;  4A3B C;  3S2H K;  3M4O K;  2JA6 K;  4YFN A;  4C3J K;  5C3E C;  2CW0 A;  5IYC K;  4A3F K;  2WAQ L;  2NVY C;  4A3M K;  4C3I K;  5IYB C;  2B63 K;  4A3K C;  3GTQ C;  5C4X K;  3S1Q C;  4Y52 K;  4BBS K;  2JA7 K;  3GTK K;  3HOV K;  4ZH4 A;  4G7H A;  2JA5 C;  3DXJ A;  4KN7 A;  4Y7N C;  4LK0 A;  3FKI C;  4BXX K;  4A3J C;  2O5J A;  2NVT C;  2NVQ C;  3GTM K;  3HOZ C;  4YFX A;  1HQM A;  3GTP C;  2E2H K;  2R93 C;  2WB1 L;  2A69 A;  4QIW L;  1TWF K;  3HOY C;  3M3Y C;  1WCM C;  1ZYR A;  4LLG A;  1I3Q C;  4KN4 A;  4G7Z A;  5IP9 K;  5TMF A;  5M5W K;  3HKZ D;  1Y1V K;  4MQ9 A;  5M5X K;  1R9T C;  2E2I K;  3S16 K;  3GTO K;  5IP7 C;  4A3L K;  1SFO C;  4A3I C;  3S14 C;  4YFK A;  2E2J C;  1TWA C;  4AYB L;  2YU9 C;  2Y0S D;  4OIO A;  4A3D K;  3GTG K;  3RZO C;  1YNN A;  2PMZ D;  2A6H A;  2R93 K;  3S1M C;  2JA8 K;  3H3V D;  1TWG K;  3HOX K;  4OIN A;  4A3E K;  3PO3 K;  4NOI A;  2R92 K;  4X6A K;  1I50 K;  1K83 K;  3S15 K;  3CQZ C;  4C3H K;  3S1R K;  3I4N K;  3I4M C;  1I6V A;  2R7Z C;  4A3L C;  4A3C K;  3RZD K;  1TWH K;  4BY1 C;  4Q5S A;  4A93 K;  1I6H K;  3S2H C;  5C4J K;  4A3I K;  2JA6 C;  3M4O C;  2A68 A;  5FJ8 K;  3H0G K;  4C2M K;  5IYC C;  4A3F C;  4A3M C;  5M3M K;  2B63 C;  4Y52 C;  4BY7 K;  4LJZ A;  4BBS C;  2JA7 C;  3GTK C;  4A3G K;  2PA8 D;  1TWC K;  4JK1 A;  2O5I A;  3HOV C;  4BBR K;  5FLM K;  2WAQ D;  4BXX C;  2PPB A;  3S1N K;  5IYD K;  3GTM C;  3EQL A;  3K7A K;  3S17 K;  3PO2 K;  2E2H C;  3WOD A;  4QJV B;  5TMC A;  4A93 C;  1IW7 A;  4XLN A;  1TWF C;  2Y0S L;  5C44 K;  3S2D K;  3HOW K;  4MEY A;  1Y1W K;  5IP9 C;  4A3B K;  5M3F K;  4Q4Z A;  1Y1V C;  2NVX K;  3GTJ K;  3H3V L;  4LK1 A;  5C3E K;  2E2I C;  3S16 C;  3GTO C;  2NVY K;  3S1Q K;  3GTQ K;  4A3D C;  4A3K K;  1SMY A;  2BE5 A;  3GTG C;  3HOU K;  4Y7N K;  3FKI K;  4AYB D;  4A3J K;  2JA8 C;  2NVT K;  1TWG C;  2NVQ K;  3GTL K;  3HOX C;  3PO3 C;  4KMU A;  4A3E C;  3HOZ K;  5C4X C;  3GTP K;  2R92 C;  4X6A C;  4OIR A;  1I50 C;  1K83 C;  3HKZ L;  3S15 C;  2PA8 L;  3S1R C;  3HOY K;  1WCM K;  3M3Y K;  5D4D A;  3I4N C;  1I3Q K;  4YG2 A;  4A3C C;  3RZD C;  1TWH C;  4OIQ A;  1I6H C;  5C4J C;  1R9T K;  1BDF A; 
#chains in the Genus database with same CATH topology
 3HOU C;  2VUM A;  1USM A;  1EFW A;  5IP7 K;  4LR2 A;  2XCR B;  3SZZ A;  1TWA K;  1WQF A;  4GTA A;  2NVY A;  4RMF A;  4BBR C;  1AB4 A;  3K7A C;  1O25 A;  1XXB A;  3I4M K;  2A6E A;  3HOW C;  4GTD A;  4XSX A;  1I3Q A;  2JA6 K;  4C3J K;  4A3F K;  4GZY A;  5IYB C;  3GTQ C;  2B63 K;  3TFH A;  2GSO A;  3IPJ A;  5CHP A;  3DXJ A;  3A8I A;  3GSI A;  4G7H A;  4KDD A;  2JA5 C;  4PAA A;  4LK0 A;  3FKI C;  4A3J C;  1X31 C;  2WB1 L;  1O29 A;  4QIW L;  3M3Y C;  3HKZ D;  2V6S A;  1B4B A;  3S16 K;  5IP7 C;  4A3D K;  1TWA C;  1ZBS A;  1C0A A;  2FQO A;  1BJT A;  1O2A A;  2PMZ D;  2R93 K;  3H3V D;  2Y3P A;  4NOI A;  3GTM A;  3MML B;  3S15 K;  3I4M C;  3S1R K;  4G0U A;  3I4N K;  1I6V A;  4A3L C;  1IL2 A;  4Q5S A;  5HL8 A;  4A93 K;  1I6H K;  4GTL A;  1O2F B;  2RH6 A;  2JA6 C;  4C3J C;  1EQR A;  1Y1V A;  3H0G K;  4A3F C;  2B63 C;  4A3G K;  1TWC K;  1YCL A;  4KAT A;  3S1N K;  1J6X A;  2CFA B;  2Y0S L;  4J3N A;  4GTB A;  1I50 A;  4KAW X;  1F7V A;  5M3F K;  3BP3 A;  3ORE A;  5JFE A;  3GTJ K;  3S16 C;  4O2D A;  3S1Q K;  4KB4 A;  4A3K K;  4ILD A;  4A3D C;  1VGX A;  5EGH A;  3HOU K;  4Y7N K;  2R93 C;  1PJ7 A;  4KMU A;  1RU0 A;  3GTP K;  3HKZ L;  3S15 C;  3S1R C;  3I4N C;  1WCM K;  2GSU A;  4OIQ A;  1I6H C;  4KM8 A;  1R9T K;  1BDF A;  1Y1W A;  1YNJ A;  2NVX A;  3H0G C;  4AH6 A;  4GTF A;  3ADA C;  2WB1 D;  2PMZ L;  2E2J K;  4QIW D;  4A3G C;  1TWC C;  3RZO K;  1WOR A;  3S1N C;  4P5A A;  3NUH A;  5IYB K;  1VRQ C;  4G7O A;  2JA5 K;  4XSZ A;  1XXC A;  3CQZ K;  5IOR A;  1PJ6 A;  4MEX A;  1GE9 A;  1B4A A;  4OIP A;  1O2B A;  3GTJ C;  3S2H K;  4YFN A;  4XCH A;  3S1Q C;  2XCQ A;  4A3K C;  4Y52 K;  2JA7 K;  3GTK K;  4KMA A;  2YU9 A;  3SZY A;  4Y7N C;  3G4C A;  2O5J A;  3N0B A;  1HQM A;  3GTP C;  2E2H K;  3T01 A;  1TWF K;  1XXA A;  1WCM C;  1EK8 A;  4LLG A;  4G7Z A;  3LPX A;  2R7Z A;  1INN A;  1R9T C;  5M5X K;  4FM9 A;  1O28 A;  2E2I K;  2D6F C;  1KQ4 A;  4A3L K;  4YFK A;  2E2J C;  2Y0S D;  3ERE D;  3GTG K;  3RZO C;  1TWG K;  2XCO A;  3HOX K;  4A3E K;  1WSR A;  1K83 K;  3CQZ C;  4C3H K;  3Q3Q A;  2GAG C;  5IOQ A;  2ZFZ A;  1O26 A;  3A8K A;  4KMH A;  3S2H C;  5C4J K;  4A3I K;  3AD9 C;  4C2M K;  4KAS A;  4BKW A;  4Y52 C;  4BY7 K;  3OPF A;  3GTO A;  2JA7 C;  3GTK C;  2WAQ D;  2PPB A;  1ZQ1 C;  4GFQ A;  5IYD K;  3EQL A;  3S17 K;  3PO2 K;  2E2H C;  3BP8 C;  3GEH A;  4XLN A;  1TWF C;  3TFI A;  5C44 K;  3LAP A;  3S2D K;  2R92 A;  4P5B A;  4P9S A;  4GTE A;  4A3B K;  5E68 A;  5C3E K;  3GEI A;  2E2I C;  2PHC B;  2NVY K;  2BE5 A;  2EBB A;  3GTG C;  1TWG C;  3HOX C;  4KC6 A;  4A3E C;  3HOZ K;  2V6U A;  4KM9 A;  1IS1 A;  1K83 C;  2PA8 L;  1UV7 A;  4C3H C;  5IOT A;  3T00 A;  2W7V A;  5D4D A;  1R9T A;  1I3Q K;  5C4J C;  4A3I C;  3FOF A;  4C2M C;  3GTL C;  3S14 K;  4BY7 C;  3VA7 A;  1ISE A;  3GTQ A;  4M1X A;  2JA5 A;  5IYD C;  3S1M K;  1ZXO A;  1USO A;  3S17 C;  3FKI A;  1WOS A;  3PO2 C;  1J6W A;  4G0W A;  5C44 C;  3S2D C;  1DCP A;  4BY1 K;  4A3B C;  2VUM C;  4KAR A;  4C45 A;  3M4O K;  5C3E C;  2CW0 A;  2P8T A;  4A3M K;  2WAQ L;  2NVY C;  4LOW A;  3HOV K;  4KN7 A;  1BGW A;  1TWA A;  4BXX K;  3GTM K;  1VLO A;  3HOZ C;  2CFA A;  3AH5 A;  1DCO A;  2A69 A;  4KB2 A;  1ZYR A;  3AD7 C;  1I3Q C;  4KN4 A;  5IP9 K;  5TMF A;  5M5W K;  1Y1V K;  4WIL A;  2JA6 A;  3S14 C;  1WOP A;  1ZVU A;  5EGE A;  1L0W A;  4OIO A;  2KWA A;  2B63 A;  2ZUE A;  3S1M C;  2JA8 K;  1EH1 A;  1IBA A;  1EI6 A;  1I50 K;  2P5M A;  1HI9 A;  4WJ3 M;  1TWH K;  4BY1 C;  3M4O C;  2A68 A;  5FJ8 K;  1IQ0 A;  4A3M C;  5M3M K;  2PA8 D;  4JK1 A;  3HOV C;  1G51 A;  3CAG A;  5FLM K;  3L4J A;  4BXX C;  3N0C A;  4G0V A;  3GTM C;  1O27 A;  2R93 A;  3WOD A;  4QJV B;  5TMC A;  1J6V A;  1J98 A;  1Y1W K;  5IP9 C;  2NVX K;  4Q4Z A;  1Y1V C;  4LK1 A;  3H0G A;  1SMY A;  3GEE A;  3LAJ A;  2FQT A;  1TWC A;  4DDQ A;  5JVO A;  4AYB D;  2JA8 C;  2NVT K;  2NVQ K;  3GTL K;  3T02 A;  4OIR A;  1I50 C;  4LQY A;  1VJE A;  3HOY K;  4YG2 A;  1BS2 A;  1TWH C;  3L4K A;  3GTJ A;  1YX2 A;  1SFO K;  4QJV A;  3AD8 C;  2YU9 K;  2VUM K;  1IE0 A;  5FLM C;  4BLA A;  3JST A;  4XLP A;  3GTP A;  2R7Z K;  1XPP A;  1Y1W C;  1WCM A;  2NVX C;  5M5Y K;  5CJ9 A;  5IYC K;  1O24 A;  4C3I K;  4GTC A;  5C4X K;  4BBS K;  4ZH4 A;  2GAH C;  2RGR A;  2NVT C;  2NVQ C;  4YFX A;  3BUE A;  1JVI A;  3HXA A;  3S0X A;  3HOY C;  3CQZ A;  4MQ9 A;  1XZQ B;  3GTO K;  1SFO C;  2YU9 C;  4AYB L;  1XZP B;  3TFJ A;  3V4G A;  1YNN A;  2JA7 A;  3GTK A;  5L46 A;  2A6H A;  4KMD A;  4OIN A;  3PO3 K;  2R92 K;  4X6A K;  4BLB A;  1TWH A;  3GDZ A;  2E2H A;  1WOO A;  2R7Z C;  3GIR A;  1TWF A;  3RZD K;  1WIH A;  4A3C K;  3AQP A;  1DD5 A;  3AQO A;  3G4A A;  5IYC C;  4C3I C;  2E2I A;  1DCH A;  4GT9 A;  4LJZ A;  4BBS C;  5C4X C;  2O5I A;  4BBR K;  1JOE A;  1F93 A;  3GTG A;  2V6T A;  1PJ5 A;  3K7A K;  1WSV A;  4A93 C;  4FZB A;  1TWG A;  1IW7 A;  1XZQ A;  3OEP A;  3FHZ A;  1K83 A;  1F9N A;  1XZP A;  4MEY A;  3TTG A;  3HOW K;  3H3V L;  1VH2 A;  3GTO C;  1V5V A;  3GTQ K;  3A8J A;  1WQG A;  2GSN A;  4PAB A;  1WQH A;  3FOE A;  3GTL A;  5TJ3 A;  2JH3 A;  3FKI K;  4A3J K;  3PO3 C;  2ZUF A;  2R92 C;  4X6A C;  3N3Y A;  4WJ4 A;  5IOS A;  1JQW A;  3QX3 A;  3M3Y K;  1F7U A;  4A3C C;  3RZD C;  1SFO A; 
#chains in the Genus database with same CATH homology
 1YNJ A;  3HOU C;  3H0G C;  5IP7 K;  1SFO K;  2WB1 D;  4QJV A;  3GTL C;  2PMZ L;  2E2J K;  1TWA K;  4QIW D;  2YU9 K;  2VUM K;  3S14 K;  4BY7 C;  1TWC C;  4A3G C;  4BBR C;  5FLM C;  3RZO K;  3S1N C;  5IYD C;  4GZY A;  3S1M K;  5IYB K;  4G7O A;  3K7A C;  3S17 C;  3PO2 C;  2JA5 K;  4XLP A;  4XSZ A;  5C44 C;  3CQZ K;  3I4M K;  3S2D C;  2A6E A;  1XPP A;  4MEX A;  2R7Z K;  3HOW C;  1Y1W C;  4OIP A;  4XSX A;  2NVX C;  4BY1 K;  5M5Y K;  2VUM C;  3GTJ C;  4A3B C;  3S2H K;  3M4O K;  2JA6 K;  4YFN A;  4C3J K;  5C3E C;  2CW0 A;  5IYC K;  4A3F K;  2WAQ L;  2NVY C;  4A3M K;  4C3I K;  5IYB C;  2B63 K;  4A3K C;  3GTQ C;  5C4X K;  3S1Q C;  4Y52 K;  4BBS K;  2JA7 K;  3GTK K;  3HOV K;  4ZH4 A;  4G7H A;  2JA5 C;  3DXJ A;  4KN7 A;  4Y7N C;  4LK0 A;  3FKI C;  4BXX K;  4A3J C;  2O5J A;  2NVT C;  2NVQ C;  3GTM K;  3HOZ C;  4YFX A;  1HQM A;  3GTP C;  2E2H K;  2R93 C;  2WB1 L;  2A69 A;  4QIW L;  1TWF K;  3HOY C;  3M3Y C;  1WCM C;  1ZYR A;  4LLG A;  1I3Q C;  4KN4 A;  4G7Z A;  5IP9 K;  5TMF A;  5M5W K;  3HKZ D;  1Y1V K;  4MQ9 A;  5M5X K;  1R9T C;  2E2I K;  3S16 K;  3GTO K;  5IP7 C;  4A3L K;  1SFO C;  4A3I C;  3S14 C;  4YFK A;  2E2J C;  1TWA C;  4AYB L;  2YU9 C;  2Y0S D;  4OIO A;  4A3D K;  3GTG K;  3RZO C;  1YNN A;  2PMZ D;  2A6H A;  2R93 K;  3S1M C;  2JA8 K;  3H3V D;  1TWG K;  3HOX K;  4OIN A;  4A3E K;  3PO3 K;  4NOI A;  2R92 K;  4X6A K;  1I50 K;  1K83 K;  3S15 K;  3CQZ C;  4C3H K;  3S1R K;  3I4N K;  3I4M C;  1I6V A;  2R7Z C;  4A3L C;  4A3C K;  3RZD K;  1TWH K;  4BY1 C;  4Q5S A;  4A93 K;  1I6H K;  3S2H C;  5C4J K;  4A3I K;  2JA6 C;  3M4O C;  2A68 A;  5FJ8 K;  3H0G K;  4C2M K;  5IYC C;  4A3F C;  4A3M C;  5M3M K;  2B63 C;  4Y52 C;  4BY7 K;  4LJZ A;  4BBS C;  2JA7 C;  3GTK C;  4A3G K;  2PA8 D;  1TWC K;  4JK1 A;  2O5I A;  3HOV C;  4BBR K;  5FLM K;  2WAQ D;  4BXX C;  2PPB A;  3S1N K;  5IYD K;  3GTM C;  3EQL A;  3K7A K;  3S17 K;  3PO2 K;  2E2H C;  3WOD A;  4QJV B;  5TMC A;  4A93 C;  1IW7 A;  4XLN A;  1TWF C;  2Y0S L;  5C44 K;  3S2D K;  3HOW K;  4MEY A;  1Y1W K;  5IP9 C;  4A3B K;  5M3F K;  4Q4Z A;  1Y1V C;  2NVX K;  3GTJ K;  3H3V L;  4LK1 A;  5C3E K;  2E2I C;  3S16 C;  3GTO C;  2NVY K;  3S1Q K;  3GTQ K;  4A3D C;  4A3K K;  1SMY A;  2BE5 A;  3GTG C;  3HOU K;  4Y7N K;  3FKI K;  4AYB D;  4A3J K;  2JA8 C;  2NVT K;  1TWG C;  2NVQ K;  3GTL K;  3HOX C;  3PO3 C;  4KMU A;  4A3E C;  3HOZ K;  5C4X C;  3GTP K;  2R92 C;  4X6A C;  4OIR A;  1I50 C;  1K83 C;  3HKZ L;  3S15 C;  2PA8 L;  3S1R C;  3HOY K;  1WCM K;  3M3Y K;  5D4D A;  3I4N C;  1I3Q K;  4YG2 A;  4A3C C;  3RZD C;  1TWH C;  4OIQ A;  1I6H C;  5C4J C;  1R9T K;  1BDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...