2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
3HKZL 3S17C 3M3YC 4A3JK 1WCMK 4MQ9A 4OIOA 4G7OA 4Y7NK 3CQZK 3HOVK 1BDFA 3S15C 4LLGA 2NVYC 1I3QC 2JA7K 5M5YK 1ZYRA 1TWGC 4A3MK 5FJ8K 5M3MK 2E2IC 4XLNA 5C3EK 4AYBD 1K83K 4A3DK 3HOWK 5IYCK 4XLPA 3RZDK 4A3IC 4OINA 2R93C 1Y1WK 3S1RK 3PO2C 3HOYK 4YG2A 5IYDC 5FLMK 1Y1WC 2NVXK 3S1MC 2WAQD 3HOXC 3GTJK 5TMFA 3HOYC 3HOUK 4X6AC 4OIRA 2B63K 3GTPK 3PO3K 3GTJC 3M3YK 2PA8D 5C4JK 2JA8K 4BBSC 4C2MK 3PO3C 4MEYA 3S1NC 5C44C 4G7ZA 3GTGK 1TWFC 4BBSK 2R7ZK 4XSZA 3H0GC 3S1QK 3S14K 1R9TC 1I3QK 4Y52C 5IP7C 3GTOC 1IW7A 2WB1D 2JA7C 4A3GC 2A68A 3M4OK 1TWGK 5C4XK 4BBRC 4A3EK 3GTOK 1I6VA 4Y52K 2NVTK 4A3DC 4A3EC 5IYCC 4G7HA 1I50K 2NVTC 3RZDC 1TWCC 4BY7K 2E2JK 2Y0SL 3GTLK 4BY7C 3S16C 2PMZD 3S1RC 3S2DC 4A3JC 1SMYA 2B63C 3GTPC 4A3FK 4C3HK 3H3VL 1HQMA 4Y7NC 4OIQA 2YU9C 3HOVC 3S15K 4A3FC 3S2DK 4ZH4A 2NVQC 2E2HK 3GTKC 4A3CC 2O5JA 4GZYA 3WODA 2E2HC 1TWAK 4Q5SA 4BXXK 3HKZD 4A3MC 2Y0SD 4MEXA 3GTQC 5C4XC 2PMZL 3S2HC 1K83C 4KN7A 4QJVB 4A3IK 4A93C 4BY1C 4LK0A 4A93K 4A3BK 2VUMK 4A3LC 3GTMC 3I4NK 4KN4A 2WB1L 3CQZC 5M3FK 2VUMC 3EQLA 5C4JC 4A3LK 3I4NC 4JK1A 2JA8C 3GTGC 5IYBK 2O5IA 2YU9K 3S1NK 3K7AC 4QJVA 1TWFK 3S14C 5IYBC 3H0GK 4A3CK 5IP9K 3K7AK 1R9TK 3I4MK 5IP7K 4A3GK 4KMUA 2JA5C 2PA8L 5IP9C 4C3IK 5C3EC 2R92C 3I4MC 3RZOC 3HOWC 2R93K 2JA5K 2A69A 3RZOK 3GTLC 3H3VD 1TWHK 2A6EA 1I50C 3HOZK 3PO2K 5M5WK 2CW0A 4QIWD 4XSXA 2NVXC 5FLMC 3S1MK 5IYDK 1TWCK 4BY1K 1XPPA 3HOXK 2BE5A 4AYBL 3HOUC 4X6AK 4OIPA 3GTMK 1I6HC 5C44K 1Y1VK 3FKIK 2A6HA 1I6HK 2NVYK 4C3JK 5M5XK 1Y1VC 2WAQL 3FKIC 2R7ZC 3GTKK 2NVQK 3S1QC 1TWAC 2E2IK 3M4OC 4NOIA 4QIWL 4BXXC 1YNNA 4LK1A 2E2JC 4BBRK 1WCMC 3S2HK 4A3KK 3GTQK 2R92K 5TMCA 1SFOC 3DXJA 4Q4ZA 2JA6K 4A3KC 4LJZA 1SFOK 1TWHC 4YFNA 3HOZC 3S17K 5D4DA 4YFKA 2JA6C 4YFXA 1YNJA 2PPBA 3S16K 4A3BC
chains in the Genus database with same CATH superfamily
4A3JK 2V6SA 2CFAA 3HOVK 3ADAC 3GDZA 4ILDA 4BLAA 1I3QC 5JFEA 2R92A 5M3MK 1K83K 4J3NA 1O28A 4OINA 2R93C 4YG2A 5FLMK 2E2IA 1XXAA 3GTLA 3M3YK 1IS1A 5C4JK 2JA8K 4BBSC 5C44C 4BBSK 4XSZA 3S14K 3T00A 4AH6A 1I3QK 3GTOC 5IP7C 1IW7A 2A68A 4BBRC 2GSNA 4A3EK 1O27A 3GTOK 4G0WA 2NVTK 3SZYA 4KATA 4A3EC 1XZQB 2NVTC 1J6WA 1TWCC 2JA7A 2FQOA 2E2JK 2EBBA 3S1RC 1EK8A 3A8KA 4LR2A 2B63C 4KASA 3H3VL 5IOTA 3S2DK 2YU9C 5JVOA 2NVQC 1XZPB 3GTKC 3JSTA 1TWGA 1O2FB 4C3IC 3HKZD 4GTLA 3AH5A 2Y0SD 3G4AA 4A3MC 3GTMA 3FOFA 2R7ZA 1ISEA 4A93C 4KB2A 4BY1C 4LK0A 1WQGA 4A93K 4A3LC 3GIRA 1UV7A 5TJ3A 4WILA 4KM9A 1BS2A 3GTGC 2O5IA 4P5BA 3GEEA 3K7AC 1TWFK 4C45A 1I50A 1B4AA 4GTDA 3K7AK 1WORA 4G0UA 4KMUA 2PA8L 1WOOA 2R92C 3N3YA 3HOWC 1VGXA 2R93K 2A69A 3GEIA 4BY1K 1XPPA 3HOXK 4GTAA 5C44K 2NVYK 1Y1VC 2R7ZC 1VJEA 1J6XA 2VUMA 1TWAC 2V6UA 2PHCB 2E2IK 2ZUFA 4LK1A 1EFWA 1F7UA 1PJ6A 2JA6K 5EGHA 5D4DA 3GTJA 2B63A 3HKZL 3S17C 4G7OA 1XXCA 1L0WA 4LLGA 2JA7K 1ZBSA 1TWGC 1XXBA 2E2IC 1IL2A 3IPJA 3RZDK 4A3IC 1Y1WK 1O2AA 4P9SA 2RGRA 4G0VA 2NVXK 2WAQD 3HOYC 2JH3A 1AB4A 3GTPK 2GAGC 2GAHC 4C2MK 3PO3C 1F7VA 4O2DA 3VA7A 4C3JC 3S1QK 1F9NA 2JA7C 2D6FC 1ZQ1C 3M4OK 3AD9C 4Y52K 3FOEA 4A3DC 2YU9A 3N0CA 3TTGA 2Y0SL 3GTLK 4BY7C 1HI9A 3H0GA 2W7VA 3GTPC 2GSOA 4A3FK 3HOVC 4ZH4A 3CAGA 1DCOA 2E2HK 4A3CC 4P5AA 3WODA 2E2HC 4Q5SA 5CJ9A 1GE9A 3GTOA 3GEHA 3OPFA 4KAWX 1DCPA 4A3BK 3ERED 4KC6A 3CQZC 4GTBA 3I4NC 2ZUEA 2JA8C 5IYBK 5IYBC 5IP9K 1R9TK 3LAJA 1O25A 5IP7K 2JA5C 3I4MC 1O26A 3RZOC 2JA5K 3H3VD 2A6EA 3HOZK 1WSRA 1EQRA 1IE0A 2CW0A 4QIWD 4XSXA 2NVXC 5FLMC 3PO2K 1TWCK 4PAAA 3BP3A 2JA6A 1VH2A 2E2HA 1ZVUA 4FZBA 1I6HC 3LAPA 4KMHA 4C3JK 3S1QC 5IOSA 3V4GA 4BXXC 1YNNA 4M1XA 4BBRK 3AD7C 3GTGA 3GTQK 5TMCA 3DXJA 4Q4ZA 1SFOK 4YFKA 1YNJA 2PPBA 3GTPA 3NUHA 3GSIA 3M3YC 4MQ9A 3TFIA 1BDFA 3S15C 1G51A 4KB4A 5IOQA 2XCQA 3SZZA 5IORA 1USMA 1YCLA 1EI6A 4XCHA 4XLPA 1DCHA 4KM8A 1F93A 1TWAA 4BKWA 3QX3A 3PO2C 3GTJK 3CQZA 3HOUK 4X6AC 2B63K 5L46A 3GTJC 4C3HC 2PA8D 4G7ZA 3GTGK 1O24A 5EGEA 2FQTA 4GTCA 1R9TC 4A3GC 2WB1D 5C4XK 3G4CA 1WIHA 1J6VA 1I50K 3OREA 3S16C 2PMZD 1WSVA 1XZPA 3S2DC 2CFAB 4C3HK 1JQWA 4Y7NC 2XCOA 3S15K 5E68A 2O5JA 4GZYA 1TWAK 1O29A 4MEXA 3GTQC 5C4XC 4BLBA 4KN7A 4QJVB 4A3IK 1IBAA 3A8IA 1J98A 1VRQC 2P5MA 3TFJA 5CHPA 4A3LK 5C4JC 3AQPA 3OEPA 3S1NK 2YU9K 4QJVA 3FKIA 1WCMA 3S14C 3H0GK 1WQFA 5C3EC 4C3IK 1TWHK 5M5WK 4DDQA 5IYDK 2XCRB 2BE5A 2KWAA 1Y1VK 1IQ0A 1XZQA 1R9TA 1X31C 5M5XK 3GTKK 1DD5A 1JVIA 4QIWL 3N0BA 1K83A 4KMDA 4A3KK 2R92K 1BGWA 1VLOA 2JA5A 4A3KC 4RMFA 1TWHC 4YFNA 3S17K 2JA6C 3GTLC 4BY7K 4WJ3M 3S1RK 1WCMC 1WQHA 1WCMK 4OIOA 4Y7NK 3CQZK 1YX2A 3BUEA 2NVYC 5M5YK 1ZYRA 4A3MK 5FJ8K 4XLNA 2Y3PA 5C3EK 3T01A 4AYBD 4A3DK 3HOWK 5IYCK 3GTQA 4PABA 1WOSA 3T02A 3HOYK 5IYDC 1Y1WC 3S1MC 3AQOA 3HOXC 5TMFA 2P8TA 3A8JA 3GTKA 3L4KA 4OIRA 4C2MC 3PO3K 1JOEA 5HL8A 4MEYA 3S1NC 1KQ4A 1TWFC 2R7ZK 3H0GC 1ZXOA 1USOA 4Y52C 1TWGK 1I6VA 5IYCC 4G7HA 3BP8C 3RZDC 3Q3QA 4GTFA 1PJ7A 4A3JC 1SMYA 1HQMA 4OIQA 1TWCA 3FHZA 4A3FC 1PJ5A 1Y1WA 1I3QA 4BXXK 2GSUA 2R93A 2PMZL 3S2HC 1K83C 4GT9A 1TWHA 1EH1A 4FM9A 4KARA 3HXAA 2VUMK 3GTMC 3I4NK 4KN4A 2WB1L 3TFHA 5M3FK 2VUMC 3EQLA 1SFOA 4JK1A 3LPXA 4GTEA 2ZFZA 4GFQA 1Y1VA 1INNA 4A3CK 1O2BA 1WOPA 3I4MK 2NVYA 3S0XA 2V6TA 3MMLB 4A3GK 5IP9C 3L4JA 4KDDA 4LOWA 3RZOK 1I50C 3S1MK 1B4BA 4AYBL 3HOUC 4X6AK 4OIPA 3GTMK 4WJ4A 1RU0A 3FKIK 2A6HA 4KMAA 3AD8C 1I6HK 2RH6A 3FKIC 2WAQL 2NVQK 1TWFA 2NVXA 3M4OC 4NOIA 1BJTA 3S2HK 1V5VA 4LQYA 1SFOC 4LJZA 1C0AA 3HOZC 2E2JC 4YFXA 3S16K 4A3BC
chains in the Genus database with same CATH topology
3HKZL 3S17C 3M3YC 4A3JK 1WCMK 4MQ9A 4OIOA 4G7OA 4Y7NK 3CQZK 3HOVK 1BDFA 3S15C 4LLGA 2NVYC 1I3QC 2JA7K 5M5YK 1ZYRA 1TWGC 4A3MK 5FJ8K 5M3MK 2E2IC 4XLNA 5C3EK 4AYBD 1K83K 4A3DK 3HOWK 5IYCK 4XLPA 3RZDK 4A3IC 4OINA 2R93C 1Y1WK 3S1RK 3PO2C 3HOYK 4YG2A 5IYDC 5FLMK 1Y1WC 2NVXK 3S1MC 2WAQD 3HOXC 3GTJK 5TMFA 3HOYC 3HOUK 4X6AC 4OIRA 2B63K 3GTPK 3PO3K 3GTJC 3M3YK 2PA8D 5C4JK 2JA8K 4BBSC 4C2MK 3PO3C 4MEYA 3S1NC 5C44C 4G7ZA 3GTGK 1TWFC 4BBSK 2R7ZK 4XSZA 3H0GC 3S1QK 3S14K 1R9TC 1I3QK 4Y52C 5IP7C 3GTOC 1IW7A 2WB1D 2JA7C 4A3GC 2A68A 3M4OK 1TWGK 5C4XK 4BBRC 4A3EK 3GTOK 1I6VA 4Y52K 2NVTK 4A3DC 4A3EC 5IYCC 4G7HA 1I50K 2NVTC 3RZDC 1TWCC 4BY7K 2E2JK 2Y0SL 3GTLK 4BY7C 3S16C 2PMZD 3S1RC 3S2DC 4A3JC 1SMYA 2B63C 3GTPC 4A3FK 4C3HK 3H3VL 1HQMA 4Y7NC 4OIQA 2YU9C 3HOVC 3S15K 4A3FC 3S2DK 4ZH4A 2NVQC 2E2HK 3GTKC 4A3CC 2O5JA 4GZYA 3WODA 2E2HC 1TWAK 4Q5SA 4BXXK 3HKZD 4A3MC 2Y0SD 4MEXA 3GTQC 5C4XC 2PMZL 3S2HC 1K83C 4KN7A 4QJVB 4A3IK 4A93C 4BY1C 4LK0A 4A93K 4A3BK 2VUMK 4A3LC 3GTMC 3I4NK 4KN4A 2WB1L 3CQZC 5M3FK 2VUMC 3EQLA 5C4JC 4A3LK 3I4NC 4JK1A 2JA8C 3GTGC 5IYBK 2O5IA 2YU9K 3S1NK 3K7AC 4QJVA 1TWFK 3S14C 5IYBC 3H0GK 4A3CK 5IP9K 3K7AK 1R9TK 3I4MK 5IP7K 4A3GK 4KMUA 2JA5C 2PA8L 5IP9C 4C3IK 5C3EC 2R92C 3I4MC 3RZOC 3HOWC 2R93K 2JA5K 2A69A 3RZOK 3GTLC 3H3VD 1TWHK 2A6EA 1I50C 3HOZK 3PO2K 5M5WK 2CW0A 4QIWD 4XSXA 2NVXC 5FLMC 3S1MK 5IYDK 1TWCK 4BY1K 1XPPA 3HOXK 2BE5A 4AYBL 3HOUC 4X6AK 4OIPA 3GTMK 1I6HC 5C44K 1Y1VK 3FKIK 2A6HA 1I6HK 2NVYK 4C3JK 5M5XK 1Y1VC 2WAQL 3FKIC 2R7ZC 3GTKK 2NVQK 3S1QC 1TWAC 2E2IK 3M4OC 4NOIA 4QIWL 4BXXC 1YNNA 4LK1A 2E2JC 4BBRK 1WCMC 3S2HK 4A3KK 3GTQK 2R92K 5TMCA 1SFOC 3DXJA 4Q4ZA 2JA6K 4A3KC 4LJZA 1SFOK 1TWHC 4YFNA 3HOZC 3S17K 5D4DA 4YFKA 2JA6C 4YFXA 1YNJA 2PPBA 3S16K 4A3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ L;  3S17 C;  3M3Y C;  4A3J K;  1WCM K;  4MQ9 A;  4OIO A;  4G7O A;  4Y7N K;  3CQZ K;  3HOV K;  1BDF A;  3S15 C;  4LLG A;  2NVY C;  1I3Q C;  2JA7 K;  5M5Y K;  1ZYR A;  1TWG C;  4A3M K;  5FJ8 K;  5M3M K;  2E2I C;  4XLN A;  5C3E K;  4AYB D;  1K83 K;  4A3D K;  3HOW K;  5IYC K;  4XLP A;  3RZD K;  4A3I C;  4OIN A;  2R93 C;  1Y1W K;  3S1R K;  3PO2 C;  3HOY K;  4YG2 A;  5IYD C;  5FLM K;  1Y1W C;  2NVX K;  3S1M C;  2WAQ D;  3HOX C;  3GTJ K;  5TMF A;  3HOY C;  3HOU K;  4X6A C;  4OIR A;  2B63 K;  3GTP K;  3PO3 K;  3GTJ C;  3M3Y K;  2PA8 D;  5C4J K;  2JA8 K;  4BBS C;  4C2M K;  3PO3 C;  4MEY A;  3S1N C;  5C44 C;  4G7Z A;  3GTG K;  1TWF C;  4BBS K;  2R7Z K;  4XSZ A;  3H0G C;  3S1Q K;  3S14 K;  1R9T C;  1I3Q K;  4Y52 C;  5IP7 C;  3GTO C;  1IW7 A;  2WB1 D;  2JA7 C;  4A3G C;  2A68 A;  3M4O K;  1TWG K;  5C4X K;  4BBR C;  4A3E K;  3GTO K;  1I6V A;  4Y52 K;  2NVT K;  4A3D C;  4A3E C;  5IYC C;  4G7H A;  1I50 K;  2NVT C;  3RZD C;  1TWC C;  4BY7 K;  2E2J K;  2Y0S L;  3GTL K;  4BY7 C;  3S16 C;  2PMZ D;  3S1R C;  3S2D C;  4A3J C;  1SMY A;  2B63 C;  3GTP C;  4A3F K;  4C3H K;  3H3V L;  1HQM A;  4Y7N C;  4OIQ A;  2YU9 C;  3HOV C;  3S15 K;  4A3F C;  3S2D K;  4ZH4 A;  2NVQ C;  2E2H K;  3GTK C;  4A3C C;  2O5J A;  4GZY A;  3WOD A;  2E2H C;  1TWA K;  4Q5S A;  4BXX K;  3HKZ D;  4A3M C;  2Y0S D;  4MEX A;  3GTQ C;  5C4X C;  2PMZ L;  3S2H C;  1K83 C;  4KN7 A;  4QJV B;  4A3I K;  4A93 C;  4BY1 C;  4LK0 A;  4A93 K;  4A3B K;  2VUM K;  4A3L C;  3GTM C;  3I4N K;  4KN4 A;  2WB1 L;  3CQZ C;  5M3F K;  2VUM C;  3EQL A;  5C4J C;  4A3L K;  3I4N C;  4JK1 A;  2JA8 C;  3GTG C;  5IYB K;  2O5I A;  2YU9 K;  3S1N K;  3K7A C;  4QJV A;  1TWF K;  3S14 C;  5IYB C;  3H0G K;  4A3C K;  5IP9 K;  3K7A K;  1R9T K;  3I4M K;  5IP7 K;  4A3G K;  4KMU A;  2JA5 C;  2PA8 L;  5IP9 C;  4C3I K;  5C3E C;  2R92 C;  3I4M C;  3RZO C;  3HOW C;  2R93 K;  2JA5 K;  2A69 A;  3RZO K;  3GTL C;  3H3V D;  1TWH K;  2A6E A;  1I50 C;  3HOZ K;  3PO2 K;  5M5W K;  2CW0 A;  4QIW D;  4XSX A;  2NVX C;  5FLM C;  3S1M K;  5IYD K;  1TWC K;  4BY1 K;  1XPP A;  3HOX K;  2BE5 A;  4AYB L;  3HOU C;  4X6A K;  4OIP A;  3GTM K;  1I6H C;  5C44 K;  1Y1V K;  3FKI K;  2A6H A;  1I6H K;  2NVY K;  4C3J K;  5M5X K;  1Y1V C;  2WAQ L;  3FKI C;  2R7Z C;  3GTK K;  2NVQ K;  3S1Q C;  1TWA C;  2E2I K;  3M4O C;  4NOI A;  4QIW L;  4BXX C;  1YNN A;  4LK1 A;  2E2J C;  4BBR K;  1WCM C;  3S2H K;  4A3K K;  3GTQ K;  2R92 K;  5TMC A;  1SFO C;  3DXJ A;  4Q4Z A;  2JA6 K;  4A3K C;  4LJZ A;  1SFO K;  1TWH C;  4YFN A;  3HOZ C;  3S17 K;  5D4D A;  4YFK A;  2JA6 C;  4YFX A;  1YNJ A;  2PPB A;  3S16 K;  4A3B C; 
#chains in the Genus database with same CATH topology
 4A3J K;  2V6S A;  2CFA A;  3HOV K;  3ADA C;  3GDZ A;  4ILD A;  4BLA A;  1I3Q C;  5JFE A;  2R92 A;  5M3M K;  1K83 K;  4J3N A;  1O28 A;  4OIN A;  2R93 C;  4YG2 A;  5FLM K;  2E2I A;  1XXA A;  3GTL A;  3M3Y K;  1IS1 A;  5C4J K;  2JA8 K;  4BBS C;  5C44 C;  4BBS K;  4XSZ A;  3S14 K;  3T00 A;  4AH6 A;  1I3Q K;  3GTO C;  5IP7 C;  1IW7 A;  2A68 A;  4BBR C;  2GSN A;  4A3E K;  1O27 A;  3GTO K;  4G0W A;  2NVT K;  3SZY A;  4KAT A;  4A3E C;  1XZQ B;  2NVT C;  1J6W A;  1TWC C;  2JA7 A;  2FQO A;  2E2J K;  2EBB A;  3S1R C;  1EK8 A;  3A8K A;  4LR2 A;  2B63 C;  4KAS A;  3H3V L;  5IOT A;  3S2D K;  2YU9 C;  5JVO A;  2NVQ C;  1XZP B;  3GTK C;  3JST A;  1TWG A;  1O2F B;  4C3I C;  3HKZ D;  4GTL A;  3AH5 A;  2Y0S D;  3G4A A;  4A3M C;  3GTM A;  3FOF A;  2R7Z A;  1ISE A;  4A93 C;  4KB2 A;  4BY1 C;  4LK0 A;  1WQG A;  4A93 K;  4A3L C;  3GIR A;  1UV7 A;  5TJ3 A;  4WIL A;  4KM9 A;  1BS2 A;  3GTG C;  2O5I A;  4P5B A;  3GEE A;  3K7A C;  1TWF K;  4C45 A;  1I50 A;  1B4A A;  4GTD A;  3K7A K;  1WOR A;  4G0U A;  4KMU A;  2PA8 L;  1WOO A;  2R92 C;  3N3Y A;  3HOW C;  1VGX A;  2R93 K;  2A69 A;  3GEI A;  4BY1 K;  1XPP A;  3HOX K;  4GTA A;  5C44 K;  2NVY K;  1Y1V C;  2R7Z C;  1VJE A;  1J6X A;  2VUM A;  1TWA C;  2V6U A;  2PHC B;  2E2I K;  2ZUF A;  4LK1 A;  1EFW A;  1F7U A;  1PJ6 A;  2JA6 K;  5EGH A;  5D4D A;  3GTJ A;  2B63 A;  3HKZ L;  3S17 C;  4G7O A;  1XXC A;  1L0W A;  4LLG A;  2JA7 K;  1ZBS A;  1TWG C;  1XXB A;  2E2I C;  1IL2 A;  3IPJ A;  3RZD K;  4A3I C;  1Y1W K;  1O2A A;  4P9S A;  2RGR A;  4G0V A;  2NVX K;  2WAQ D;  3HOY C;  2JH3 A;  1AB4 A;  3GTP K;  2GAG C;  2GAH C;  4C2M K;  3PO3 C;  1F7V A;  4O2D A;  3VA7 A;  4C3J C;  3S1Q K;  1F9N A;  2JA7 C;  2D6F C;  1ZQ1 C;  3M4O K;  3AD9 C;  4Y52 K;  3FOE A;  4A3D C;  2YU9 A;  3N0C A;  3TTG A;  2Y0S L;  3GTL K;  4BY7 C;  1HI9 A;  3H0G A;  2W7V A;  3GTP C;  2GSO A;  4A3F K;  3HOV C;  4ZH4 A;  3CAG A;  1DCO A;  2E2H K;  4A3C C;  4P5A A;  3WOD A;  2E2H C;  4Q5S A;  5CJ9 A;  1GE9 A;  3GTO A;  3GEH A;  3OPF A;  4KAW X;  1DCP A;  4A3B K;  3ERE D;  4KC6 A;  3CQZ C;  4GTB A;  3I4N C;  2ZUE A;  2JA8 C;  5IYB K;  5IYB C;  5IP9 K;  1R9T K;  3LAJ A;  1O25 A;  5IP7 K;  2JA5 C;  3I4M C;  1O26 A;  3RZO C;  2JA5 K;  3H3V D;  2A6E A;  3HOZ K;  1WSR A;  1EQR A;  1IE0 A;  2CW0 A;  4QIW D;  4XSX A;  2NVX C;  5FLM C;  3PO2 K;  1TWC K;  4PAA A;  3BP3 A;  2JA6 A;  1VH2 A;  2E2H A;  1ZVU A;  4FZB A;  1I6H C;  3LAP A;  4KMH A;  4C3J K;  3S1Q C;  5IOS A;  3V4G A;  4BXX C;  1YNN A;  4M1X A;  4BBR K;  3AD7 C;  3GTG A;  3GTQ K;  5TMC A;  3DXJ A;  4Q4Z A;  1SFO K;  4YFK A;  1YNJ A;  2PPB A;  3GTP A;  3NUH A;  3GSI A;  3M3Y C;  4MQ9 A;  3TFI A;  1BDF A;  3S15 C;  1G51 A;  4KB4 A;  5IOQ A;  2XCQ A;  3SZZ A;  5IOR A;  1USM A;  1YCL A;  1EI6 A;  4XCH A;  4XLP A;  1DCH A;  4KM8 A;  1F93 A;  1TWA A;  4BKW A;  3QX3 A;  3PO2 C;  3GTJ K;  3CQZ A;  3HOU K;  4X6A C;  2B63 K;  5L46 A;  3GTJ C;  4C3H C;  2PA8 D;  4G7Z A;  3GTG K;  1O24 A;  5EGE A;  2FQT A;  4GTC A;  1R9T C;  4A3G C;  2WB1 D;  5C4X K;  3G4C A;  1WIH A;  1J6V A;  1I50 K;  3ORE A;  3S16 C;  2PMZ D;  1WSV A;  1XZP A;  3S2D C;  2CFA B;  4C3H K;  1JQW A;  4Y7N C;  2XCO A;  3S15 K;  5E68 A;  2O5J A;  4GZY A;  1TWA K;  1O29 A;  4MEX A;  3GTQ C;  5C4X C;  4BLB A;  4KN7 A;  4QJV B;  4A3I K;  1IBA A;  3A8I A;  1J98 A;  1VRQ C;  2P5M A;  3TFJ A;  5CHP A;  4A3L K;  5C4J C;  3AQP A;  3OEP A;  3S1N K;  2YU9 K;  4QJV A;  3FKI A;  1WCM A;  3S14 C;  3H0G K;  1WQF A;  5C3E C;  4C3I K;  1TWH K;  5M5W K;  4DDQ A;  5IYD K;  2XCR B;  2BE5 A;  2KWA A;  1Y1V K;  1IQ0 A;  1XZQ A;  1R9T A;  1X31 C;  5M5X K;  3GTK K;  1DD5 A;  1JVI A;  4QIW L;  3N0B A;  1K83 A;  4KMD A;  4A3K K;  2R92 K;  1BGW A;  1VLO A;  2JA5 A;  4A3K C;  4RMF A;  1TWH C;  4YFN A;  3S17 K;  2JA6 C;  3GTL C;  4BY7 K;  4WJ3 M;  3S1R K;  1WCM C;  1WQH A;  1WCM K;  4OIO A;  4Y7N K;  3CQZ K;  1YX2 A;  3BUE A;  2NVY C;  5M5Y K;  1ZYR A;  4A3M K;  5FJ8 K;  4XLN A;  2Y3P A;  5C3E K;  3T01 A;  4AYB D;  4A3D K;  3HOW K;  5IYC K;  3GTQ A;  4PAB A;  1WOS A;  3T02 A;  3HOY K;  5IYD C;  1Y1W C;  3S1M C;  3AQO A;  3HOX C;  5TMF A;  2P8T A;  3A8J A;  3GTK A;  3L4K A;  4OIR A;  4C2M C;  3PO3 K;  1JOE A;  5HL8 A;  4MEY A;  3S1N C;  1KQ4 A;  1TWF C;  2R7Z K;  3H0G C;  1ZXO A;  1USO A;  4Y52 C;  1TWG K;  1I6V A;  5IYC C;  4G7H A;  3BP8 C;  3RZD C;  3Q3Q A;  4GTF A;  1PJ7 A;  4A3J C;  1SMY A;  1HQM A;  4OIQ A;  1TWC A;  3FHZ A;  4A3F C;  1PJ5 A;  1Y1W A;  1I3Q A;  4BXX K;  2GSU A;  2R93 A;  2PMZ L;  3S2H C;  1K83 C;  4GT9 A;  1TWH A;  1EH1 A;  4FM9 A;  4KAR A;  3HXA A;  2VUM K;  3GTM C;  3I4N K;  4KN4 A;  2WB1 L;  3TFH A;  5M3F K;  2VUM C;  3EQL A;  1SFO A;  4JK1 A;  3LPX A;  4GTE A;  2ZFZ A;  4GFQ A;  1Y1V A;  1INN A;  4A3C K;  1O2B A;  1WOP A;  3I4M K;  2NVY A;  3S0X A;  2V6T A;  3MML B;  4A3G K;  5IP9 C;  3L4J A;  4KDD A;  4LOW A;  3RZO K;  1I50 C;  3S1M K;  1B4B A;  4AYB L;  3HOU C;  4X6A K;  4OIP A;  3GTM K;  4WJ4 A;  1RU0 A;  3FKI K;  2A6H A;  4KMA A;  3AD8 C;  1I6H K;  2RH6 A;  3FKI C;  2WAQ L;  2NVQ K;  1TWF A;  2NVX A;  3M4O C;  4NOI A;  1BJT A;  3S2H K;  1V5V A;  4LQY A;  1SFO C;  4LJZ A;  1C0A A;  3HOZ C;  2E2J C;  4YFX A;  3S16 K;  4A3B C; 
#chains in the Genus database with same CATH homology
 3HKZ L;  3S17 C;  3M3Y C;  4A3J K;  1WCM K;  4MQ9 A;  4OIO A;  4G7O A;  4Y7N K;  3CQZ K;  3HOV K;  1BDF A;  3S15 C;  4LLG A;  2NVY C;  1I3Q C;  2JA7 K;  5M5Y K;  1ZYR A;  1TWG C;  4A3M K;  5FJ8 K;  5M3M K;  2E2I C;  4XLN A;  5C3E K;  4AYB D;  1K83 K;  4A3D K;  3HOW K;  5IYC K;  4XLP A;  3RZD K;  4A3I C;  4OIN A;  2R93 C;  1Y1W K;  3S1R K;  3PO2 C;  3HOY K;  4YG2 A;  5IYD C;  5FLM K;  1Y1W C;  2NVX K;  3S1M C;  2WAQ D;  3HOX C;  3GTJ K;  5TMF A;  3HOY C;  3HOU K;  4X6A C;  4OIR A;  2B63 K;  3GTP K;  3PO3 K;  3GTJ C;  3M3Y K;  2PA8 D;  5C4J K;  2JA8 K;  4BBS C;  4C2M K;  3PO3 C;  4MEY A;  3S1N C;  5C44 C;  4G7Z A;  3GTG K;  1TWF C;  4BBS K;  2R7Z K;  4XSZ A;  3H0G C;  3S1Q K;  3S14 K;  1R9T C;  1I3Q K;  4Y52 C;  5IP7 C;  3GTO C;  1IW7 A;  2WB1 D;  2JA7 C;  4A3G C;  2A68 A;  3M4O K;  1TWG K;  5C4X K;  4BBR C;  4A3E K;  3GTO K;  1I6V A;  4Y52 K;  2NVT K;  4A3D C;  4A3E C;  5IYC C;  4G7H A;  1I50 K;  2NVT C;  3RZD C;  1TWC C;  4BY7 K;  2E2J K;  2Y0S L;  3GTL K;  4BY7 C;  3S16 C;  2PMZ D;  3S1R C;  3S2D C;  4A3J C;  1SMY A;  2B63 C;  3GTP C;  4A3F K;  4C3H K;  3H3V L;  1HQM A;  4Y7N C;  4OIQ A;  2YU9 C;  3HOV C;  3S15 K;  4A3F C;  3S2D K;  4ZH4 A;  2NVQ C;  2E2H K;  3GTK C;  4A3C C;  2O5J A;  4GZY A;  3WOD A;  2E2H C;  1TWA K;  4Q5S A;  4BXX K;  3HKZ D;  4A3M C;  2Y0S D;  4MEX A;  3GTQ C;  5C4X C;  2PMZ L;  3S2H C;  1K83 C;  4KN7 A;  4QJV B;  4A3I K;  4A93 C;  4BY1 C;  4LK0 A;  4A93 K;  4A3B K;  2VUM K;  4A3L C;  3GTM C;  3I4N K;  4KN4 A;  2WB1 L;  3CQZ C;  5M3F K;  2VUM C;  3EQL A;  5C4J C;  4A3L K;  3I4N C;  4JK1 A;  2JA8 C;  3GTG C;  5IYB K;  2O5I A;  2YU9 K;  3S1N K;  3K7A C;  4QJV A;  1TWF K;  3S14 C;  5IYB C;  3H0G K;  4A3C K;  5IP9 K;  3K7A K;  1R9T K;  3I4M K;  5IP7 K;  4A3G K;  4KMU A;  2JA5 C;  2PA8 L;  5IP9 C;  4C3I K;  5C3E C;  2R92 C;  3I4M C;  3RZO C;  3HOW C;  2R93 K;  2JA5 K;  2A69 A;  3RZO K;  3GTL C;  3H3V D;  1TWH K;  2A6E A;  1I50 C;  3HOZ K;  3PO2 K;  5M5W K;  2CW0 A;  4QIW D;  4XSX A;  2NVX C;  5FLM C;  3S1M K;  5IYD K;  1TWC K;  4BY1 K;  1XPP A;  3HOX K;  2BE5 A;  4AYB L;  3HOU C;  4X6A K;  4OIP A;  3GTM K;  1I6H C;  5C44 K;  1Y1V K;  3FKI K;  2A6H A;  1I6H K;  2NVY K;  4C3J K;  5M5X K;  1Y1V C;  2WAQ L;  3FKI C;  2R7Z C;  3GTK K;  2NVQ K;  3S1Q C;  1TWA C;  2E2I K;  3M4O C;  4NOI A;  4QIW L;  4BXX C;  1YNN A;  4LK1 A;  2E2J C;  4BBR K;  1WCM C;  3S2H K;  4A3K K;  3GTQ K;  2R92 K;  5TMC A;  1SFO C;  3DXJ A;  4Q4Z A;  2JA6 K;  4A3K C;  4LJZ A;  1SFO K;  1TWH C;  4YFN A;  3HOZ C;  3S17 K;  5D4D A;  4YFK A;  2JA6 C;  4YFX A;  1YNJ A;  2PPB A;  3S16 K;  4A3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...