2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
3HOZK 4X6AK 3RZDK 4A3BK 2WB1L 5C4XC 1Y1WK 3HKZD 2NVXK 3HOVK 3S14C 5C44C 1SFOK 4A3LK 4BY7K 3GTMC 3CQZC 4C3JK 5M5YK 2R92K 3HOZC 4X6AC 4Y52K 1I6VA 3DXJA 1Y1WC 4BBRC 2NVXC 1XPPA 2PA8L 4JK1A 1SFOC 2PMZD 3GTGK 4YG2A 5IYCK 2R92C 3PO3K 3WODA 4Y52C 4A3FC 2E2JK 1TWHK 3H0GK 4XSZA 2YU9K 4A3DK 3GTJK 1Y1VC 3GTGC 5IYCC 4A3IK 2A6EA 3HOXK 4A3MK 5IP7K 2E2JC 1TWHC 3H0GC 1I3QK 2YU9C 1I6HK 3GTLK 2A6HA 1WCMK 3I4NK 1TWCC 4A3DC 4A3IC 2A69A 1ZYRA 4KN7A 5IP7C 1TWFK 5D4DA 2JA8C 1WCMC 2NVYK 5IP9K 4Y7NK 3GTLC 3I4MC 3S2DK 2WAQD 3GTKC 4OIPA 3GTPK 3RZOK 2VUMK 3K7AK 1K83K 3RZDC 4A3BC 3HOWK 2B63K 1TWFC 4LK1A 2O5IA 3HOVC 4MQ9A 5IP9C 3S2DC 4A3CK 4BBSK 2NVTK 4MEXA 3M3YK 4ZH4A 4BY7C 4A3LC 3GTPC 2E2HK 3RZOC 3EQLA 4BY1K 3K7AC 4OINA 2NVQK 2VUMC 4XLNA 4A3EK 5IYDK 3HOWC 5M5XK 2B63C 4YFNA 3S17K 2JA6K 3M4OK 4BBSC 4A3CC 2NVTC 3M3YC 2Y0SL 5M5WK 3PO3C 2E2HC 4AYBD 5IYDC 4BY1C 3GTOK 2R7ZK 4A93K 2WB1D 1TWGK 4A3EC 1IW7A 2R93K 5TMFA 3S17C 2JA6C 1I50K 4XLPA 2O5JA 3GTJC 4YFXA 4LK0A 4C3IK 5FLMK 3GTOC 4A93C 3HOXC 4A3GK 1TWGC 4A3MC 2R93C 5M3FK 1I3QC 1I6HC 1R9TK 3I4NC 1I50C 2E2IK 4OIQA 3GTKK 3S1MK 3S1NK 3HKZL 4Q4ZA 5FLMC 4QJVB 4A3GC 2PPBA 4G7HA 4A3KK 2WAQL 4G7ZA 3S1RK 3S1QK 4A3JK 2NVYC 2E2IC 4Y7NC 4QIWD 2JA7K 3S1MC 3S1NC 3HOYK 3S16K 1YNNA 1K83C 2PMZL 5C3EK 3S1QC 5M3MK 5C4XK 3FKIK 1TWAK 3H3VD 2JA7C 1HQMA 4NOIA 3S14K 4KN4A 5C44K 4MEYA 5C4JK 2CW0A 3HOYC 3S16C 2NVQC 3GTMK 3CQZK 4AYBL 4YFKA 1SMYA 1YNJA 3S15K 3FKIC 1TWAC 3M4OC 4BBRK 4QJVA 5C4JC 2R7ZC 5IYBK 4Q5SA 4C3HK 5TMCA 4A3FK 3HOUK 2PA8D 3S15C 2JA5K 1BDFA 1Y1VK 3GTQK 4GZYA 5IYBC 3PO2K 4BXXK 4XSXA 3HOUC 4OIOA 1R9TC 2Y0SD 1TWCK 2JA5C 3GTQC 3S2HK 4QIWL 4KMUA 4A3KC 3PO2C 4BXXC 5FJ8K 3S1RC 4A3JC 4C2MK 4G7OA 2A68A 2JA8K 3I4MK 4OIRA 2BE5A 3S2HC 4LLGA 3H3VL 4LJZA 5C3EC
chains in the Genus database with same CATH superfamily
3H0GA 3NUHA 3RZDK 1EH1A 2KWAA 4A3BK 5C4XC 3HKZD 4BY7K 1O2FB 5M5YK 2R92K 3HOZC 4X6AC 4Y52K 1I6VA 1WCMA 3DXJA 1USMA 2NVXC 4AH6A 3GTKA 2PMZD 3MMLB 4C3JC 2E2JK 3H0GK 2V6UA 4A3DK 3GTJK 1Y1VC 4GTBA 3TTGA 3GTGC 1TWHC 1I3QK 1I6HK 1WCMK 1TWCC 1ZYRA 3LAJA 5IP7C 1ZXOA 2JA8C 1KQ4A 3GTLC 1AB4A 1F93A 3S0XA 3K7AK 1DD5A 4WILA 2O5IA 4A3CK 1ISEA 4WJ3M 4BY1K 4OINA 4XLNA 2NVYA 5M5XK 3S17K 4GTDA 4KM9A 2RGRA 2Y0SL 1K83A 3PO3C 2E2HC 1DCPA 5IYDC 1YX2A 3GIRA 5TMFA 4BLBA 2JA6C 4A3GK 4RMFA 1R9TK 4BLAA 4OIQA 5FLMC 1XXCA 3S1RK 1F7UA 4Y7NC 4QIWD 5C3EK 1EK8A 1B4BA 5C4XK 3H3VD 3IPJA 3GTQA 2JA5A 1HQMA 4GTEA 1BJTA 4KARA 2NVQC 2FQTA 4AYBL 3FKIC 3M4OC 1WOSA 3A8KA 2R7ZC 5EGHA 2V6TA 2PA8D 1EQRA 1IQ0A 3T02A 4G0UA 1WORA 2JA5K 1Y1VK 3GTQK 4GZYA 4BXXK 1Y1WA 3HOUC 1WQHA 1SFOA 1TWCK 4KASA 1BGWA 4A3KC 5FJ8K 1G51A 1J98A 2JA8K 1XZPB 4BKWA 4LLGA 1O29A 1WSVA 2YU9A 1INNA 1WQGA 1Y1WK 3S14C 1SFOK 3CQZC 1XPPA 4KM8A 4JK1A 1JVIA 2GAGC 5IYCK 1O2BA 3PO3K 1DCHA 4XSZA 2YU9K 3AD9C 3L4KA 3GTPA 2VUMA 3T01A 3BP3A 4A3IK 2A6EA 2B63A 1WIHA 3CAGA 1PJ7A 4P9SA 4GTLA 1BS2A 2A69A 2RH6A 3GTJA 5D4DA 4FM9A 5IP9K 4Y7NK 3GTOA 2WAQD 1TWGA 4OIPA 3GTPK 3RZOK 3N0BA 2VUMK 1I3QA 1J6XA 2B63K 1TWFC 4LK1A 4BBSK 3S2DC 4MEXA 3M3YK 4ZH4A 2NVQK 4A3EK 3HOWC 5IORA 3GEHA 3M4OK 4GTCA 2NVTC 2R7ZK 3TFJA 3GTOK 4LOWA 3T00A 1TWGK 3LAPA 1JOEA 4C45A 4YFXA 4KMHA 1EFWA 4A93C 5CJ9A 2R93C 3N0CA 3I4NC 1I50C 3S1MK 4FZBA 4C3IC 4QJVB 3VA7A 4A3KK 4LR2A 4J3NA 3S1QK 2E2IC 3FOFA 1GE9A 1RU0A 1VRQC 3S1NC 3HOYK 3S16K 2V6SA 1R9TA 3ADAC 4KAWX 5M3MK 1JQWA 2JA7C 4NOIA 3S14K 5C4JK 3CQZK 2CFAB 4YFKA 4LQYA 3S15K 1TWAC 1HI9A 3AQOA 5IYBK 4Q5SA 4G0VA 1F9NA 4PABA 3G4AA 1X31C 3PO2K 2NVXA 4OIOA 2Y0SD 3S2HK 4QIWL 3SZYA 4A3JC 5L46A 2A68A 1Y1VA 3GTGA 4OIRA 3H3VL 4LJZA 3HOZK 1TWHA 2GAHC 4X6AK 2WB1L 1TWCA 2NVXK 5C44C 2FQOA 3L4JA 3GTMC 4C3JK 4XCHA 3GTLA 1VLOA 4BBRC 2PA8L 4DDQA 3GTGK 1C0AA 2R92C 3AD7C 2W7VA 3AD8C 4Y52C 4A3FC 1O27A 1TWHK 3V4GA 4GFQA 5IOSA 1EI6A 5EGEA 5IP7K 2E2JC 3H0GC 3GTLK 3I4NK 4A3DC 3GEEA 2E2HA 1IBAA 3N3YA 3FOEA 2JA6A 2D6FC 1O24A 3TFHA 1WCMC 1XZQB 3GTKC 3HOVC 3HXAA 4A3LC 3JSTA 2E2HK 3EQLA 5IYDK 3K7AC 4KC6A 3SZZA 2JA6K 1O28A 4A3CC 2XCQA 4BY1C 4GTAA 3S17C 5FLMK 3HOXC 4A3MC 3FKIA 2R7ZA 3HKZL 4Q4ZA 4A3GC 2P5MA 2PPBA 4GT9A 1VJEA 2WAQL 4G7ZA 1XXAA 4A3JK 2NVYC 3AH5A 1PJ6A 1K83C 2PMZL 4KATA 1YCLA 3FKIK 3AQPA 3GSIA 2ZFZA 4KN4A 5C44K 2CW0A 4KB2A 3GTMK 4BBRK 4QJVA 2GSUA 4KDDA 5TMCA 4A3FK 3HOUK 5E68A 3CQZA 1BDFA 1WOPA 4KMAA 4KMDA 4XSXA 1WSRA 5JFEA 2XCOA 2JA5C 3GTQC 4GTFA 4P5BA 2CFAA 4BXXC 1V5VA 4P5AA 1USOA 2XCRB 3GTKK 1L0WA 1J6WA 4O2DA 2ZUEA 3HOVK 2GSNA 2ZUFA 1IE0A 4A3LK 2EBBA 5TJ3A 3QX3A 1WOOA 1Y1WC 5CHPA 1SFOC 5HL8A 1ZQ1C 4YG2A 4C3HC 3WODA 1TWFA 2GSOA 3GDZA 5IYCC 3HOXK 4A3MK 2YU9C 2A6HA 2JH3A 4A3IC 2P8TA 4KN7A 4C2MC 1TWFK 2NVYK 3OPFA 3I4MC 3S2DK 2R93A 1K83K 3RZDC 5JVOA 4A3BC 1I50A 3HOWK 4MQ9A 5IP9C 2NVTK 4BY7C 3GTPC 3RZOC 2VUMC 2E2IA 2B63C 4YFNA 5IOQA 1XZPA 4BBSC 3M3YC 5M5WK 4A93K 4ILDA 4AYBD 2WB1D 4A3EC 1IW7A 3FHZA 2R93K 2JA7A 1XZQA 1I50K 4XLPA 2O5JA 3GTJC 4LK0A 4C3IK 3GTOC 1J6VA 1TWGC 3G4CA 1TWAA 5M3FK 1I3QC 1I6HC 2E2IK 3S1NK 3ERED 4G7HA 1B4AA 2JA7K 3S1MC 4KB4A 1XXBA 1IL2A 1YNNA 3S1QC 1DCOA 1TWAK 3OEPA 1F7VA 4MEYA 3HOYC 1PJ5A 3S16C 4WJ4A 1VH2A 1SMYA 1YNJA 1ZVUA 5C4JC 2Y3PA 5IOTA 4C3HK 1O25A 1ZBSA 3A8JA 3BUEA 1UV7A 3OREA 3S15C 3GTMA 3GEIA 5IYBC 4PAAA 1R9TC 3Q3QA 2R92A 4M1XA 4G0WA 3TFIA 1O2AA 4KMUA 3PO2C 3S1RC 1VGXA 4C2MK 4G7OA 2PHCB 1WQFA 1O26A 3I4MK 1IS1A 2BE5A 3LPXA 3A8IA 3BP8C 3S2HC 5C3EC
chains in the Genus database with same CATH topology
3HOZK 4X6AK 3RZDK 4A3BK 2WB1L 5C4XC 1Y1WK 3HKZD 2NVXK 3HOVK 3S14C 5C44C 1SFOK 4A3LK 4BY7K 3GTMC 3CQZC 4C3JK 5M5YK 2R92K 3HOZC 4X6AC 4Y52K 1I6VA 3DXJA 1Y1WC 4BBRC 2NVXC 1XPPA 2PA8L 4JK1A 1SFOC 2PMZD 3GTGK 4YG2A 5IYCK 2R92C 3PO3K 3WODA 4Y52C 4A3FC 2E2JK 1TWHK 3H0GK 4XSZA 2YU9K 4A3DK 3GTJK 1Y1VC 3GTGC 5IYCC 4A3IK 2A6EA 3HOXK 4A3MK 5IP7K 2E2JC 1TWHC 3H0GC 1I3QK 2YU9C 1I6HK 3GTLK 2A6HA 1WCMK 3I4NK 1TWCC 4A3DC 4A3IC 2A69A 1ZYRA 4KN7A 5IP7C 1TWFK 5D4DA 2JA8C 1WCMC 2NVYK 5IP9K 4Y7NK 3GTLC 3I4MC 3S2DK 2WAQD 3GTKC 4OIPA 3GTPK 3RZOK 2VUMK 3K7AK 1K83K 3RZDC 4A3BC 3HOWK 2B63K 1TWFC 4LK1A 2O5IA 3HOVC 4MQ9A 5IP9C 3S2DC 4A3CK 4BBSK 2NVTK 4MEXA 3M3YK 4ZH4A 4BY7C 4A3LC 3GTPC 2E2HK 3RZOC 3EQLA 4BY1K 3K7AC 4OINA 2NVQK 2VUMC 4XLNA 4A3EK 5IYDK 3HOWC 5M5XK 2B63C 4YFNA 3S17K 2JA6K 3M4OK 4BBSC 4A3CC 2NVTC 3M3YC 2Y0SL 5M5WK 3PO3C 2E2HC 4AYBD 5IYDC 4BY1C 3GTOK 2R7ZK 4A93K 2WB1D 1TWGK 4A3EC 1IW7A 2R93K 5TMFA 3S17C 2JA6C 1I50K 4XLPA 2O5JA 3GTJC 4YFXA 4LK0A 4C3IK 5FLMK 3GTOC 4A93C 3HOXC 4A3GK 1TWGC 4A3MC 2R93C 5M3FK 1I3QC 1I6HC 1R9TK 3I4NC 1I50C 2E2IK 4OIQA 3GTKK 3S1MK 3S1NK 3HKZL 4Q4ZA 5FLMC 4QJVB 4A3GC 2PPBA 4G7HA 4A3KK 2WAQL 4G7ZA 3S1RK 3S1QK 4A3JK 2NVYC 2E2IC 4Y7NC 4QIWD 2JA7K 3S1MC 3S1NC 3HOYK 3S16K 1YNNA 1K83C 2PMZL 5C3EK 3S1QC 5M3MK 5C4XK 3FKIK 1TWAK 3H3VD 2JA7C 1HQMA 4NOIA 3S14K 4KN4A 5C44K 4MEYA 5C4JK 2CW0A 3HOYC 3S16C 2NVQC 3GTMK 3CQZK 4AYBL 4YFKA 1SMYA 1YNJA 3S15K 3FKIC 1TWAC 3M4OC 4BBRK 4QJVA 5C4JC 2R7ZC 5IYBK 4Q5SA 4C3HK 5TMCA 4A3FK 3HOUK 2PA8D 3S15C 2JA5K 1BDFA 1Y1VK 3GTQK 4GZYA 5IYBC 3PO2K 4BXXK 4XSXA 3HOUC 4OIOA 1R9TC 2Y0SD 1TWCK 2JA5C 3GTQC 3S2HK 4QIWL 4KMUA 4A3KC 3PO2C 4BXXC 5FJ8K 3S1RC 4A3JC 4C2MK 4G7OA 2A68A 2JA8K 3I4MK 4OIRA 2BE5A 3S2HC 4LLGA 3H3VL 4LJZA 5C3EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ K;  4X6A K;  3RZD K;  4A3B K;  2WB1 L;  5C4X C;  1Y1W K;  3HKZ D;  2NVX K;  3HOV K;  3S14 C;  5C44 C;  1SFO K;  4A3L K;  4BY7 K;  3GTM C;  3CQZ C;  4C3J K;  5M5Y K;  2R92 K;  3HOZ C;  4X6A C;  4Y52 K;  1I6V A;  3DXJ A;  1Y1W C;  4BBR C;  2NVX C;  1XPP A;  2PA8 L;  4JK1 A;  1SFO C;  2PMZ D;  3GTG K;  4YG2 A;  5IYC K;  2R92 C;  3PO3 K;  3WOD A;  4Y52 C;  4A3F C;  2E2J K;  1TWH K;  3H0G K;  4XSZ A;  2YU9 K;  4A3D K;  3GTJ K;  1Y1V C;  3GTG C;  5IYC C;  4A3I K;  2A6E A;  3HOX K;  4A3M K;  5IP7 K;  2E2J C;  1TWH C;  3H0G C;  1I3Q K;  2YU9 C;  1I6H K;  3GTL K;  2A6H A;  1WCM K;  3I4N K;  1TWC C;  4A3D C;  4A3I C;  2A69 A;  1ZYR A;  4KN7 A;  5IP7 C;  1TWF K;  5D4D A;  2JA8 C;  1WCM C;  2NVY K;  5IP9 K;  4Y7N K;  3GTL C;  3I4M C;  3S2D K;  2WAQ D;  3GTK C;  4OIP A;  3GTP K;  3RZO K;  2VUM K;  3K7A K;  1K83 K;  3RZD C;  4A3B C;  3HOW K;  2B63 K;  1TWF C;  4LK1 A;  2O5I A;  3HOV C;  4MQ9 A;  5IP9 C;  3S2D C;  4A3C K;  4BBS K;  2NVT K;  4MEX A;  3M3Y K;  4ZH4 A;  4BY7 C;  4A3L C;  3GTP C;  2E2H K;  3RZO C;  3EQL A;  4BY1 K;  3K7A C;  4OIN A;  2NVQ K;  2VUM C;  4XLN A;  4A3E K;  5IYD K;  3HOW C;  5M5X K;  2B63 C;  4YFN A;  3S17 K;  2JA6 K;  3M4O K;  4BBS C;  4A3C C;  2NVT C;  3M3Y C;  2Y0S L;  5M5W K;  3PO3 C;  2E2H C;  4AYB D;  5IYD C;  4BY1 C;  3GTO K;  2R7Z K;  4A93 K;  2WB1 D;  1TWG K;  4A3E C;  1IW7 A;  2R93 K;  5TMF A;  3S17 C;  2JA6 C;  1I50 K;  4XLP A;  2O5J A;  3GTJ C;  4YFX A;  4LK0 A;  4C3I K;  5FLM K;  3GTO C;  4A93 C;  3HOX C;  4A3G K;  1TWG C;  4A3M C;  2R93 C;  5M3F K;  1I3Q C;  1I6H C;  1R9T K;  3I4N C;  1I50 C;  2E2I K;  4OIQ A;  3GTK K;  3S1M K;  3S1N K;  3HKZ L;  4Q4Z A;  5FLM C;  4QJV B;  4A3G C;  2PPB A;  4G7H A;  4A3K K;  2WAQ L;  4G7Z A;  3S1R K;  3S1Q K;  4A3J K;  2NVY C;  2E2I C;  4Y7N C;  4QIW D;  2JA7 K;  3S1M C;  3S1N C;  3HOY K;  3S16 K;  1YNN A;  1K83 C;  2PMZ L;  5C3E K;  3S1Q C;  5M3M K;  5C4X K;  3FKI K;  1TWA K;  3H3V D;  2JA7 C;  1HQM A;  4NOI A;  3S14 K;  4KN4 A;  5C44 K;  4MEY A;  5C4J K;  2CW0 A;  3HOY C;  3S16 C;  2NVQ C;  3GTM K;  3CQZ K;  4AYB L;  4YFK A;  1SMY A;  1YNJ A;  3S15 K;  3FKI C;  1TWA C;  3M4O C;  4BBR K;  4QJV A;  5C4J C;  2R7Z C;  5IYB K;  4Q5S A;  4C3H K;  5TMC A;  4A3F K;  3HOU K;  2PA8 D;  3S15 C;  2JA5 K;  1BDF A;  1Y1V K;  3GTQ K;  4GZY A;  5IYB C;  3PO2 K;  4BXX K;  4XSX A;  3HOU C;  4OIO A;  1R9T C;  2Y0S D;  1TWC K;  2JA5 C;  3GTQ C;  3S2H K;  4QIW L;  4KMU A;  4A3K C;  3PO2 C;  4BXX C;  5FJ8 K;  3S1R C;  4A3J C;  4C2M K;  4G7O A;  2A68 A;  2JA8 K;  3I4M K;  4OIR A;  2BE5 A;  3S2H C;  4LLG A;  3H3V L;  4LJZ A;  5C3E C; 
#chains in the Genus database with same CATH topology
 3H0G A;  3NUH A;  3RZD K;  1EH1 A;  2KWA A;  4A3B K;  5C4X C;  3HKZ D;  4BY7 K;  1O2F B;  5M5Y K;  2R92 K;  3HOZ C;  4X6A C;  4Y52 K;  1I6V A;  1WCM A;  3DXJ A;  1USM A;  2NVX C;  4AH6 A;  3GTK A;  2PMZ D;  3MML B;  4C3J C;  2E2J K;  3H0G K;  2V6U A;  4A3D K;  3GTJ K;  1Y1V C;  4GTB A;  3TTG A;  3GTG C;  1TWH C;  1I3Q K;  1I6H K;  1WCM K;  1TWC C;  1ZYR A;  3LAJ A;  5IP7 C;  1ZXO A;  2JA8 C;  1KQ4 A;  3GTL C;  1AB4 A;  1F93 A;  3S0X A;  3K7A K;  1DD5 A;  4WIL A;  2O5I A;  4A3C K;  1ISE A;  4WJ3 M;  4BY1 K;  4OIN A;  4XLN A;  2NVY A;  5M5X K;  3S17 K;  4GTD A;  4KM9 A;  2RGR A;  2Y0S L;  1K83 A;  3PO3 C;  2E2H C;  1DCP A;  5IYD C;  1YX2 A;  3GIR A;  5TMF A;  4BLB A;  2JA6 C;  4A3G K;  4RMF A;  1R9T K;  4BLA A;  4OIQ A;  5FLM C;  1XXC A;  3S1R K;  1F7U A;  4Y7N C;  4QIW D;  5C3E K;  1EK8 A;  1B4B A;  5C4X K;  3H3V D;  3IPJ A;  3GTQ A;  2JA5 A;  1HQM A;  4GTE A;  1BJT A;  4KAR A;  2NVQ C;  2FQT A;  4AYB L;  3FKI C;  3M4O C;  1WOS A;  3A8K A;  2R7Z C;  5EGH A;  2V6T A;  2PA8 D;  1EQR A;  1IQ0 A;  3T02 A;  4G0U A;  1WOR A;  2JA5 K;  1Y1V K;  3GTQ K;  4GZY A;  4BXX K;  1Y1W A;  3HOU C;  1WQH A;  1SFO A;  1TWC K;  4KAS A;  1BGW A;  4A3K C;  5FJ8 K;  1G51 A;  1J98 A;  2JA8 K;  1XZP B;  4BKW A;  4LLG A;  1O29 A;  1WSV A;  2YU9 A;  1INN A;  1WQG A;  1Y1W K;  3S14 C;  1SFO K;  3CQZ C;  1XPP A;  4KM8 A;  4JK1 A;  1JVI A;  2GAG C;  5IYC K;  1O2B A;  3PO3 K;  1DCH A;  4XSZ A;  2YU9 K;  3AD9 C;  3L4K A;  3GTP A;  2VUM A;  3T01 A;  3BP3 A;  4A3I K;  2A6E A;  2B63 A;  1WIH A;  3CAG A;  1PJ7 A;  4P9S A;  4GTL A;  1BS2 A;  2A69 A;  2RH6 A;  3GTJ A;  5D4D A;  4FM9 A;  5IP9 K;  4Y7N K;  3GTO A;  2WAQ D;  1TWG A;  4OIP A;  3GTP K;  3RZO K;  3N0B A;  2VUM K;  1I3Q A;  1J6X A;  2B63 K;  1TWF C;  4LK1 A;  4BBS K;  3S2D C;  4MEX A;  3M3Y K;  4ZH4 A;  2NVQ K;  4A3E K;  3HOW C;  5IOR A;  3GEH A;  3M4O K;  4GTC A;  2NVT C;  2R7Z K;  3TFJ A;  3GTO K;  4LOW A;  3T00 A;  1TWG K;  3LAP A;  1JOE A;  4C45 A;  4YFX A;  4KMH A;  1EFW A;  4A93 C;  5CJ9 A;  2R93 C;  3N0C A;  3I4N C;  1I50 C;  3S1M K;  4FZB A;  4C3I C;  4QJV B;  3VA7 A;  4A3K K;  4LR2 A;  4J3N A;  3S1Q K;  2E2I C;  3FOF A;  1GE9 A;  1RU0 A;  1VRQ C;  3S1N C;  3HOY K;  3S16 K;  2V6S A;  1R9T A;  3ADA C;  4KAW X;  5M3M K;  1JQW A;  2JA7 C;  4NOI A;  3S14 K;  5C4J K;  3CQZ K;  2CFA B;  4YFK A;  4LQY A;  3S15 K;  1TWA C;  1HI9 A;  3AQO A;  5IYB K;  4Q5S A;  4G0V A;  1F9N A;  4PAB A;  3G4A A;  1X31 C;  3PO2 K;  2NVX A;  4OIO A;  2Y0S D;  3S2H K;  4QIW L;  3SZY A;  4A3J C;  5L46 A;  2A68 A;  1Y1V A;  3GTG A;  4OIR A;  3H3V L;  4LJZ A;  3HOZ K;  1TWH A;  2GAH C;  4X6A K;  2WB1 L;  1TWC A;  2NVX K;  5C44 C;  2FQO A;  3L4J A;  3GTM C;  4C3J K;  4XCH A;  3GTL A;  1VLO A;  4BBR C;  2PA8 L;  4DDQ A;  3GTG K;  1C0A A;  2R92 C;  3AD7 C;  2W7V A;  3AD8 C;  4Y52 C;  4A3F C;  1O27 A;  1TWH K;  3V4G A;  4GFQ A;  5IOS A;  1EI6 A;  5EGE A;  5IP7 K;  2E2J C;  3H0G C;  3GTL K;  3I4N K;  4A3D C;  3GEE A;  2E2H A;  1IBA A;  3N3Y A;  3FOE A;  2JA6 A;  2D6F C;  1O24 A;  3TFH A;  1WCM C;  1XZQ B;  3GTK C;  3HOV C;  3HXA A;  4A3L C;  3JST A;  2E2H K;  3EQL A;  5IYD K;  3K7A C;  4KC6 A;  3SZZ A;  2JA6 K;  1O28 A;  4A3C C;  2XCQ A;  4BY1 C;  4GTA A;  3S17 C;  5FLM K;  3HOX C;  4A3M C;  3FKI A;  2R7Z A;  3HKZ L;  4Q4Z A;  4A3G C;  2P5M A;  2PPB A;  4GT9 A;  1VJE A;  2WAQ L;  4G7Z A;  1XXA A;  4A3J K;  2NVY C;  3AH5 A;  1PJ6 A;  1K83 C;  2PMZ L;  4KAT A;  1YCL A;  3FKI K;  3AQP A;  3GSI A;  2ZFZ A;  4KN4 A;  5C44 K;  2CW0 A;  4KB2 A;  3GTM K;  4BBR K;  4QJV A;  2GSU A;  4KDD A;  5TMC A;  4A3F K;  3HOU K;  5E68 A;  3CQZ A;  1BDF A;  1WOP A;  4KMA A;  4KMD A;  4XSX A;  1WSR A;  5JFE A;  2XCO A;  2JA5 C;  3GTQ C;  4GTF A;  4P5B A;  2CFA A;  4BXX C;  1V5V A;  4P5A A;  1USO A;  2XCR B;  3GTK K;  1L0W A;  1J6W A;  4O2D A;  2ZUE A;  3HOV K;  2GSN A;  2ZUF A;  1IE0 A;  4A3L K;  2EBB A;  5TJ3 A;  3QX3 A;  1WOO A;  1Y1W C;  5CHP A;  1SFO C;  5HL8 A;  1ZQ1 C;  4YG2 A;  4C3H C;  3WOD A;  1TWF A;  2GSO A;  3GDZ A;  5IYC C;  3HOX K;  4A3M K;  2YU9 C;  2A6H A;  2JH3 A;  4A3I C;  2P8T A;  4KN7 A;  4C2M C;  1TWF K;  2NVY K;  3OPF A;  3I4M C;  3S2D K;  2R93 A;  1K83 K;  3RZD C;  5JVO A;  4A3B C;  1I50 A;  3HOW K;  4MQ9 A;  5IP9 C;  2NVT K;  4BY7 C;  3GTP C;  3RZO C;  2VUM C;  2E2I A;  2B63 C;  4YFN A;  5IOQ A;  1XZP A;  4BBS C;  3M3Y C;  5M5W K;  4A93 K;  4ILD A;  4AYB D;  2WB1 D;  4A3E C;  1IW7 A;  3FHZ A;  2R93 K;  2JA7 A;  1XZQ A;  1I50 K;  4XLP A;  2O5J A;  3GTJ C;  4LK0 A;  4C3I K;  3GTO C;  1J6V A;  1TWG C;  3G4C A;  1TWA A;  5M3F K;  1I3Q C;  1I6H C;  2E2I K;  3S1N K;  3ERE D;  4G7H A;  1B4A A;  2JA7 K;  3S1M C;  4KB4 A;  1XXB A;  1IL2 A;  1YNN A;  3S1Q C;  1DCO A;  1TWA K;  3OEP A;  1F7V A;  4MEY A;  3HOY C;  1PJ5 A;  3S16 C;  4WJ4 A;  1VH2 A;  1SMY A;  1YNJ A;  1ZVU A;  5C4J C;  2Y3P A;  5IOT A;  4C3H K;  1O25 A;  1ZBS A;  3A8J A;  3BUE A;  1UV7 A;  3ORE A;  3S15 C;  3GTM A;  3GEI A;  5IYB C;  4PAA A;  1R9T C;  3Q3Q A;  2R92 A;  4M1X A;  4G0W A;  3TFI A;  1O2A A;  4KMU A;  3PO2 C;  3S1R C;  1VGX A;  4C2M K;  4G7O A;  2PHC B;  1WQF A;  1O26 A;  3I4M K;  1IS1 A;  2BE5 A;  3LPX A;  3A8I A;  3BP8 C;  3S2H C;  5C3E C; 
#chains in the Genus database with same CATH homology
 3HOZ K;  4X6A K;  3RZD K;  4A3B K;  2WB1 L;  5C4X C;  1Y1W K;  3HKZ D;  2NVX K;  3HOV K;  3S14 C;  5C44 C;  1SFO K;  4A3L K;  4BY7 K;  3GTM C;  3CQZ C;  4C3J K;  5M5Y K;  2R92 K;  3HOZ C;  4X6A C;  4Y52 K;  1I6V A;  3DXJ A;  1Y1W C;  4BBR C;  2NVX C;  1XPP A;  2PA8 L;  4JK1 A;  1SFO C;  2PMZ D;  3GTG K;  4YG2 A;  5IYC K;  2R92 C;  3PO3 K;  3WOD A;  4Y52 C;  4A3F C;  2E2J K;  1TWH K;  3H0G K;  4XSZ A;  2YU9 K;  4A3D K;  3GTJ K;  1Y1V C;  3GTG C;  5IYC C;  4A3I K;  2A6E A;  3HOX K;  4A3M K;  5IP7 K;  2E2J C;  1TWH C;  3H0G C;  1I3Q K;  2YU9 C;  1I6H K;  3GTL K;  2A6H A;  1WCM K;  3I4N K;  1TWC C;  4A3D C;  4A3I C;  2A69 A;  1ZYR A;  4KN7 A;  5IP7 C;  1TWF K;  5D4D A;  2JA8 C;  1WCM C;  2NVY K;  5IP9 K;  4Y7N K;  3GTL C;  3I4M C;  3S2D K;  2WAQ D;  3GTK C;  4OIP A;  3GTP K;  3RZO K;  2VUM K;  3K7A K;  1K83 K;  3RZD C;  4A3B C;  3HOW K;  2B63 K;  1TWF C;  4LK1 A;  2O5I A;  3HOV C;  4MQ9 A;  5IP9 C;  3S2D C;  4A3C K;  4BBS K;  2NVT K;  4MEX A;  3M3Y K;  4ZH4 A;  4BY7 C;  4A3L C;  3GTP C;  2E2H K;  3RZO C;  3EQL A;  4BY1 K;  3K7A C;  4OIN A;  2NVQ K;  2VUM C;  4XLN A;  4A3E K;  5IYD K;  3HOW C;  5M5X K;  2B63 C;  4YFN A;  3S17 K;  2JA6 K;  3M4O K;  4BBS C;  4A3C C;  2NVT C;  3M3Y C;  2Y0S L;  5M5W K;  3PO3 C;  2E2H C;  4AYB D;  5IYD C;  4BY1 C;  3GTO K;  2R7Z K;  4A93 K;  2WB1 D;  1TWG K;  4A3E C;  1IW7 A;  2R93 K;  5TMF A;  3S17 C;  2JA6 C;  1I50 K;  4XLP A;  2O5J A;  3GTJ C;  4YFX A;  4LK0 A;  4C3I K;  5FLM K;  3GTO C;  4A93 C;  3HOX C;  4A3G K;  1TWG C;  4A3M C;  2R93 C;  5M3F K;  1I3Q C;  1I6H C;  1R9T K;  3I4N C;  1I50 C;  2E2I K;  4OIQ A;  3GTK K;  3S1M K;  3S1N K;  3HKZ L;  4Q4Z A;  5FLM C;  4QJV B;  4A3G C;  2PPB A;  4G7H A;  4A3K K;  2WAQ L;  4G7Z A;  3S1R K;  3S1Q K;  4A3J K;  2NVY C;  2E2I C;  4Y7N C;  4QIW D;  2JA7 K;  3S1M C;  3S1N C;  3HOY K;  3S16 K;  1YNN A;  1K83 C;  2PMZ L;  5C3E K;  3S1Q C;  5M3M K;  5C4X K;  3FKI K;  1TWA K;  3H3V D;  2JA7 C;  1HQM A;  4NOI A;  3S14 K;  4KN4 A;  5C44 K;  4MEY A;  5C4J K;  2CW0 A;  3HOY C;  3S16 C;  2NVQ C;  3GTM K;  3CQZ K;  4AYB L;  4YFK A;  1SMY A;  1YNJ A;  3S15 K;  3FKI C;  1TWA C;  3M4O C;  4BBR K;  4QJV A;  5C4J C;  2R7Z C;  5IYB K;  4Q5S A;  4C3H K;  5TMC A;  4A3F K;  3HOU K;  2PA8 D;  3S15 C;  2JA5 K;  1BDF A;  1Y1V K;  3GTQ K;  4GZY A;  5IYB C;  3PO2 K;  4BXX K;  4XSX A;  3HOU C;  4OIO A;  1R9T C;  2Y0S D;  1TWC K;  2JA5 C;  3GTQ C;  3S2H K;  4QIW L;  4KMU A;  4A3K C;  3PO2 C;  4BXX C;  5FJ8 K;  3S1R C;  4A3J C;  4C2M K;  4G7O A;  2A68 A;  2JA8 K;  3I4M K;  4OIR A;  2BE5 A;  3S2H C;  4LLG A;  3H3V L;  4LJZ A;  5C3E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...