2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
1XPPA 4BY7K 4A93C 4C3JK 4OINA 4A3IK 3S14C 3H0GC 3HKZD 3FKIC 5IYDC 4G7ZA 1I6HC 4X6AK 5M3MK 1K83K 2JA6C 1TWHK 4A3JC 4Y7NC 1TWFC 4A3FC 2JA8K 3GTGK 1YNNA 2JA7K 3HKZL 4LK0A 4A3KC 5M5YK 1BDFA 4MEYA 2R92C 4BBRK 2A6EA 3CQZC 3S17C 2CW0A 3S1MK 2JA5C 1TWAC 4LK1A 1SMYA 4AYBL 3GTPC 3HOVC 5C3EC 3S15K 2A68A 1Y1VC 4A3MC 3I4MK 1TWCK 4A3CC 2NVXK 4A3GK 1HQMA 3RZDC 3HOZC 1Y1WC 2E2IC 1TWFK 3HOXC 1SFOC 1R9TK 2VUMC 1I3QK 4A93K 2E2HC 3S14K 5IYBK 4A3LC 3H0GK 5IYCK 3PO3K 4Y52C 2WAQD 3S1RC 3M4OC 1I6HK 1IW7A 1YNJA 1I50C 3PO2C 4Q5SA 5FLMC 4BXXK 5C44K 2PA8L 4A3DK 4A3KK 2WAQL 3GTQC 3GTLK 2YU9C 3I4NC 3S2HC 3CQZK 2E2JK 5C4XC 4OIPA 5D4DA 3GTKK 2B63C 2R93C 4AYBD 3GTPK 3HOWC 3HOYK 2NVTC 2NVYK 3GTMK 1TWGK 5M3FK 3S16K 4YFXA 3RZOC 4BY1C 4A3BC 5C4JC 1Y1WK 2E2IK 3S2DC 4ZH4A 4LJZA 3S1NC 1WCMC 3GTJK 2E2HK 2NVQC 2R7ZC 4C3HK 3HOUC 4KN7A 4Y52K 3M4OK 4BBSC 2Y0SL 3GTLC 3PO2K 5FLMK 4G7HA 4GZYA 2PA8D 3FKIK 3GTKC 5IYDK 4YG2A 4BY7C 4YFNA 2JA6K 1ZYRA 4A3JK 4OIOA 4Y7NK 4Q4ZA 4A3FK 3DXJA 2R93K 1TWHC 4A3EC 2R92K 3GTGC 4C2MK 3HOWK 3S17K 2JA7C 2JA5K 1TWAK 2PMZL 5IP7C 4OIRA 3GTOC 3EQLA 3S1MC 3HOVK 5C3EK 4BXXC 4BY1K 1Y1VK 4A3MK 2O5IA 4G7OA 4A3CK 3S15C 1WCMK 3RZDK 3HOZK 4KN4A 2R7ZK 1TWCC 4XSXA 3HOXK 1SFOK 2NVXC 5FJ8K 2Y0SD 2VUMK 4BBSK 2A6HA 5TMCA 3M3YC 4A3GC 4A3LK 3S1QC 4YFKA 4KMUA 3S1RK 1R9TC 5IP9C 4QJVB 1I3QC 1I50K 5IYBC 3H3VL 5IYCC 3PO3C 3K7AC 3GTQK 4A3EK 2WB1D 2YU9K 4A3IC 3I4NK 3S2HK 2PPBA 5C44C 4A3DC 4XSZA 5C4XK 4NOIA 2PMZD 4JK1A 1K83C 5IP7K 4XLNA 2B63K 2WB1L 4QIWD 1I6VA 4XLPA 4MQ9A 2E2JC 4OIQA 2JA8C 3GTOK 2NVTK 2O5JA 4LLGA 4MEXA 4X6AC 4BBRC 2A69A 4QIWL 5TMFA 3WODA 3RZOK 3HOYC 4A3BK 2NVYC 5C4JK 3S2DK 2BE5A 3GTMC 4C3IK 1TWGC 3S16C 3S1NK 2NVQK 3M3YK 3S1QK 4QJVA 3HOUK 5M5WK 3I4MC 5M5XK 5IP9K 3GTJC 3H3VD 3K7AK
chains in the Genus database with same CATH superfamily
3GEEA 1WOSA 1AB4A 3LAJA 3H0GC 1WOOA 3HKZD 1F7UA 3GDZA 1K83K 1TWHK 4A3JC 1F9NA 2JA8K 4PAAA 1XXAA 2R92C 1TWFA 2A6EA 1O26A 2JA5C 1IQ0A 4LK1A 1SMYA 3GTPC 5TJ3A 3TTGA 1Y1VC 3T02A 2NVXK 3BP8C 2R93A 1Y1WC 1VJEA 3HOXC 1SFOC 1R9TK 3S14K 1JQWA 5IYBK 4WILA 1WIHA 1YNJA 4Q5SA 5FLMC 4A3DK 3I4NC 2VUMA 4G0WA 5C4XC 4OIPA 3ADAC 2B63C 2R93C 3HOWC 1I50A 2NVYK 2GSUA 3GTMK 1TWGK 2CFAB 5JFEA 4A3BC 2YU9A 3S2DC 2XCRB 1XXCA 1WQFA 2E2HK 1EK8A 1UV7A 4P5AA 3SZYA 3M4OK 4FM9A 4BBSC 1O2AA 4GTDA 4GZYA 3GTKC 4YFNA 2JA6K 1ZYRA 5E68A 4OIOA 4Y7NK 4A3FK 4DDQA 1WCMA 4KDDA 3T01A 1TWHC 4A3EC 3S17K 3FHZA 4BY1K 1J6WA 4A3MK 5EGEA 2R7ZK 3TFIA 2NVXC 2A6HA 5TMCA 3M3YC 3GTOA 1R9TC 4QJVB 5JVOA 3V4GA 5IYBC 4KATA 4O2DA 3OREA 4LR2A 3GTQK 2WB1D 4A3IC 3S2HK 4A3DC 2PMZD 1PJ5A 1ZQ1C 4XLNA 2Y3PA 2W7VA 4PABA 4RMFA 2XCQA 4MEXA 2NVYC 5C4JK 2BE5A 3GTMC 1TWGC 2GSOA 1C0AA 3S0XA 3L4KA 3HOUK 5M5WK 1XZQA 5IOSA 1XPPA 4WJ4A 4C3JK 4OINA 1O29A 3QX3A 1EFWA 1YCLA 4G7ZA 2JA6C 4Y7NC 4A3FC 3GTGK 2JA7K 1INNA 5M5YK 1BDFA 1IE0A 4MEYA 3S1MK 3S17C 3CQZC 3H0GA 1BS2A 1WSVA 1YX2A 4A3MC 3I4MK 4LQYA 3AD8C 3JSTA 4A3GK 2V6SA 2ZUEA 2R92A 4KASA 1TWFK 2JA5A 4XCHA 4A93K 1I3QK 3A8KA 3GTPA 3AH5A 3LAPA 4Y52C 1ZVUA 1I6HK 1Y1VA 1IW7A 3AD9C 4A3KK 2WAQL 3GTQC 1Y1WA 1SFOA 3S2HC 4AYBD 4GTFA 5CHPA 3HOYK 4BKWA 5L46A 5M3FK 4YFXA 3G4CA 5C4JC 4BLAA 2E2IK 4LJZA 3GTJK 5HL8A 2B63A 4C3HK 2P8TA 3SZZA 3HOUC 4KN7A 3ERED 3PO2K 4G7HA 3FKIK 4YG2A 4GTEA 3A8IA 1EQRA 3L4JA 3DXJA 1IL2A 3GTGC 4C2MK 1WOPA 2JA7C 3CAGA 2CFAA 5IOQA 1TWAK 2PMZL 5IP7C 4OIRA 3S1MC 4BXXC 3GTKA 3HOVK 5C3EK 3Q3QA 4A3CK 1IS1A 3T00A 1WCMK 3IPJA 4KB2A 1TWHA 4KN4A 3HOZK 1J6VA 4A3GC 2RGRA 1DCOA 2FQOA 1L0WA 2ZFZA 3OPFA 5IP9C 1I3QC 3NUHA 4GTBA 1O2BA 2NVXA 1WQHA 4LOWA 4NOIA 4JK1A 1K83C 3GTOK 1VRQC 4QIWD 1R9TA 1USMA 4OIQA 2JA8C 2NVTK 3N0BA 5CJ9A 4P9SA 3HOYC 3GEIA 4C3IK 1ZBSA 3TFHA 3S1NK 2NVQK 2P5MA 4KB4A 3S1QK 4QJVA 4KMAA 5M5XK 2RH6A 3GTJC 4C3HC 3K7AK 4BY7K 2NVYA 3GTMA 2XCOA 1TWGA 3S14C 3FKIC 1O28A 3GSIA 5M3MK 1O25A 1RU0A 1YNNA 1V5VA 3HKZL 4X6AK 4BBRK 4C2MC 2CW0A 1TWAC 1WSRA 1PJ7A 4AYBL 3HOVC 5C3EC 3S15K 2JA6A 1TWCK 4KM8A 4A3CC 3LPXA 3MMLB 1XZPB 1HQMA 3HOZC 3GIRA 3CQZA 1DCPA 2E2HC 3H0GK 1DCHA 5IYCK 3PO3K 3M4OC 4KARA 5C44K 2GAHC 3GTLK 1ZXOA 1JOEA 3GTPK 2V6UA 1XXBA 1EH1A 2NVTC 4GT9A 1VH2A 3S16K 3GTQA 3AD7C 4BY1C 1Y1WK 4C3IC 3S1NC 2NVQC 2R7ZC 4GTCA 1IBAA 3FOEA 5FLMK 2PA8D 5IYDK 4BY7C 4KMHA 4Q4ZA 1BJTA 1B4AA 2R93K 1WORA 3HOWK 2EBBA 2FQTA 3EQLA 4G7OA 3S15C 2PHCB 3RZDK 1TWCC 3GTGA 2JA7A 4BBSK 2Y0SD 4KC6A 4C45A 2VUMK 4A3LK 4YFKA 1VGXA 3S1RK 1I50K 1F93A 4KAWX 5IYCC 3PO3C 4A3EK 4C3JC 2YU9K 5C44C 4XSZA 3FOFA 2GAGC 3GTLC 2WB1L 4XLPA 1I6VA 1I3QA 4LLGA 3RZOK 1J98A 3S16C 3M3YK 1K83A 3I4MC 4WJ3M 3H3VD 1TWFC 4A93C 4A3IK 2JH3A 5IYDC 1O2FB 1JVIA 1I6HC 2E2IA 3GTJA 1O27A 4LK0A 4A3KC 4GTLA 4GTAA 4KM9A 1DD5A 3FKIA 1GE9A 2A68A 3HXAA 3OEPA 1BGWA 1WQGA 3TFJA 3RZDC 2E2IC 3N3YA 2VUMC 1TWAA 4A3LC 3S1RC 2WAQD 4ILDA 1I50C 3PO2C 2PA8L 1O24A 2YU9C 3CQZK 2E2JK 3GEHA 2E2HA 5D4DA 1XZPA 3VA7A 4J3NA 4G0VA 5IORA 1G51A 3RZOC 1B4BA 2D6FC 4ZH4A 1WCMC 3BUEA 2ZUFA 4Y52K 3AQPA 2Y0SL 4KMDA 3G4AA 1PJ6A 4AH6A 4A3JK 1F7VA 2V6TA 3AQOA 2R7ZA 2R92K 1X31C 2JA5K 3GTOC 1Y1VK 2O5IA 4XSXA 1EI6A 3HOXK 1SFOK 5FJ8K 3S1QC 1HI9A 2GSNA 4KMUA 4P5BA 3H3VL 3K7AC 1XZQB 5EGHA 1TWCA 3I4NK 1J6XA 1KQ4A 2PPBA 4BLBA 5C4XK 4M1XA 1ISEA 5IP7K 2B63K 4G0UA 4BXXK 1USOA 2KWAA 4MQ9A 2E2JC 2O5JA 4X6AC 3N0CA 4BBRC 2A69A 3A8JA 4QIWL 3BP3A 5TMFA 3WODA 4A3BK 3S2DK 4FZBA 4GFQA 5IOTA 3GTLA 5IP9K 1VLOA 3GTKK
chains in the Genus database with same CATH topology
1XPPA 4BY7K 4A93C 4C3JK 4OINA 4A3IK 3S14C 3H0GC 3HKZD 3FKIC 5IYDC 4G7ZA 1I6HC 4X6AK 5M3MK 1K83K 2JA6C 1TWHK 4A3JC 4Y7NC 1TWFC 4A3FC 2JA8K 3GTGK 1YNNA 2JA7K 3HKZL 4LK0A 4A3KC 5M5YK 1BDFA 4MEYA 2R92C 4BBRK 2A6EA 3CQZC 3S17C 2CW0A 3S1MK 2JA5C 1TWAC 4LK1A 1SMYA 4AYBL 3GTPC 3HOVC 5C3EC 3S15K 2A68A 1Y1VC 4A3MC 3I4MK 1TWCK 4A3CC 2NVXK 4A3GK 1HQMA 3RZDC 3HOZC 1Y1WC 2E2IC 1TWFK 3HOXC 1SFOC 1R9TK 2VUMC 1I3QK 4A93K 2E2HC 3S14K 5IYBK 4A3LC 3H0GK 5IYCK 3PO3K 4Y52C 2WAQD 3S1RC 3M4OC 1I6HK 1IW7A 1YNJA 1I50C 3PO2C 4Q5SA 5FLMC 4BXXK 5C44K 2PA8L 4A3DK 4A3KK 2WAQL 3GTQC 3GTLK 2YU9C 3I4NC 3S2HC 3CQZK 2E2JK 5C4XC 4OIPA 5D4DA 3GTKK 2B63C 2R93C 4AYBD 3GTPK 3HOWC 3HOYK 2NVTC 2NVYK 3GTMK 1TWGK 5M3FK 3S16K 4YFXA 3RZOC 4BY1C 4A3BC 5C4JC 1Y1WK 2E2IK 3S2DC 4ZH4A 4LJZA 3S1NC 1WCMC 3GTJK 2E2HK 2NVQC 2R7ZC 4C3HK 3HOUC 4KN7A 4Y52K 3M4OK 4BBSC 2Y0SL 3GTLC 3PO2K 5FLMK 4G7HA 4GZYA 2PA8D 3FKIK 3GTKC 5IYDK 4YG2A 4BY7C 4YFNA 2JA6K 1ZYRA 4A3JK 4OIOA 4Y7NK 4Q4ZA 4A3FK 3DXJA 2R93K 1TWHC 4A3EC 2R92K 3GTGC 4C2MK 3HOWK 3S17K 2JA7C 2JA5K 1TWAK 2PMZL 5IP7C 4OIRA 3GTOC 3EQLA 3S1MC 3HOVK 5C3EK 4BXXC 4BY1K 1Y1VK 4A3MK 2O5IA 4G7OA 4A3CK 3S15C 1WCMK 3RZDK 3HOZK 4KN4A 2R7ZK 1TWCC 4XSXA 3HOXK 1SFOK 2NVXC 5FJ8K 2Y0SD 2VUMK 4BBSK 2A6HA 5TMCA 3M3YC 4A3GC 4A3LK 3S1QC 4YFKA 4KMUA 3S1RK 1R9TC 5IP9C 4QJVB 1I3QC 1I50K 5IYBC 3H3VL 5IYCC 3PO3C 3K7AC 3GTQK 4A3EK 2WB1D 2YU9K 4A3IC 3I4NK 3S2HK 2PPBA 5C44C 4A3DC 4XSZA 5C4XK 4NOIA 2PMZD 4JK1A 1K83C 5IP7K 4XLNA 2B63K 2WB1L 4QIWD 1I6VA 4XLPA 4MQ9A 2E2JC 4OIQA 2JA8C 3GTOK 2NVTK 2O5JA 4LLGA 4MEXA 4X6AC 4BBRC 2A69A 4QIWL 5TMFA 3WODA 3RZOK 3HOYC 4A3BK 2NVYC 5C4JK 3S2DK 2BE5A 3GTMC 4C3IK 1TWGC 3S16C 3S1NK 2NVQK 3M3YK 3S1QK 4QJVA 3HOUK 5M5WK 3I4MC 5M5XK 5IP9K 3GTJC 3H3VD 3K7AK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPP A;  4BY7 K;  4A93 C;  4C3J K;  4OIN A;  4A3I K;  3S14 C;  3H0G C;  3HKZ D;  3FKI C;  5IYD C;  4G7Z A;  1I6H C;  4X6A K;  5M3M K;  1K83 K;  2JA6 C;  1TWH K;  4A3J C;  4Y7N C;  1TWF C;  4A3F C;  2JA8 K;  3GTG K;  1YNN A;  2JA7 K;  3HKZ L;  4LK0 A;  4A3K C;  5M5Y K;  1BDF A;  4MEY A;  2R92 C;  4BBR K;  2A6E A;  3CQZ C;  3S17 C;  2CW0 A;  3S1M K;  2JA5 C;  1TWA C;  4LK1 A;  1SMY A;  4AYB L;  3GTP C;  3HOV C;  5C3E C;  3S15 K;  2A68 A;  1Y1V C;  4A3M C;  3I4M K;  1TWC K;  4A3C C;  2NVX K;  4A3G K;  1HQM A;  3RZD C;  3HOZ C;  1Y1W C;  2E2I C;  1TWF K;  3HOX C;  1SFO C;  1R9T K;  2VUM C;  1I3Q K;  4A93 K;  2E2H C;  3S14 K;  5IYB K;  4A3L C;  3H0G K;  5IYC K;  3PO3 K;  4Y52 C;  2WAQ D;  3S1R C;  3M4O C;  1I6H K;  1IW7 A;  1YNJ A;  1I50 C;  3PO2 C;  4Q5S A;  5FLM C;  4BXX K;  5C44 K;  2PA8 L;  4A3D K;  4A3K K;  2WAQ L;  3GTQ C;  3GTL K;  2YU9 C;  3I4N C;  3S2H C;  3CQZ K;  2E2J K;  5C4X C;  4OIP A;  5D4D A;  3GTK K;  2B63 C;  2R93 C;  4AYB D;  3GTP K;  3HOW C;  3HOY K;  2NVT C;  2NVY K;  3GTM K;  1TWG K;  5M3F K;  3S16 K;  4YFX A;  3RZO C;  4BY1 C;  4A3B C;  5C4J C;  1Y1W K;  2E2I K;  3S2D C;  4ZH4 A;  4LJZ A;  3S1N C;  1WCM C;  3GTJ K;  2E2H K;  2NVQ C;  2R7Z C;  4C3H K;  3HOU C;  4KN7 A;  4Y52 K;  3M4O K;  4BBS C;  2Y0S L;  3GTL C;  3PO2 K;  5FLM K;  4G7H A;  4GZY A;  2PA8 D;  3FKI K;  3GTK C;  5IYD K;  4YG2 A;  4BY7 C;  4YFN A;  2JA6 K;  1ZYR A;  4A3J K;  4OIO A;  4Y7N K;  4Q4Z A;  4A3F K;  3DXJ A;  2R93 K;  1TWH C;  4A3E C;  2R92 K;  3GTG C;  4C2M K;  3HOW K;  3S17 K;  2JA7 C;  2JA5 K;  1TWA K;  2PMZ L;  5IP7 C;  4OIR A;  3GTO C;  3EQL A;  3S1M C;  3HOV K;  5C3E K;  4BXX C;  4BY1 K;  1Y1V K;  4A3M K;  2O5I A;  4G7O A;  4A3C K;  3S15 C;  1WCM K;  3RZD K;  3HOZ K;  4KN4 A;  2R7Z K;  1TWC C;  4XSX A;  3HOX K;  1SFO K;  2NVX C;  5FJ8 K;  2Y0S D;  2VUM K;  4BBS K;  2A6H A;  5TMC A;  3M3Y C;  4A3G C;  4A3L K;  3S1Q C;  4YFK A;  4KMU A;  3S1R K;  1R9T C;  5IP9 C;  4QJV B;  1I3Q C;  1I50 K;  5IYB C;  3H3V L;  5IYC C;  3PO3 C;  3K7A C;  3GTQ K;  4A3E K;  2WB1 D;  2YU9 K;  4A3I C;  3I4N K;  3S2H K;  2PPB A;  5C44 C;  4A3D C;  4XSZ A;  5C4X K;  4NOI A;  2PMZ D;  4JK1 A;  1K83 C;  5IP7 K;  4XLN A;  2B63 K;  2WB1 L;  4QIW D;  1I6V A;  4XLP A;  4MQ9 A;  2E2J C;  4OIQ A;  2JA8 C;  3GTO K;  2NVT K;  2O5J A;  4LLG A;  4MEX A;  4X6A C;  4BBR C;  2A69 A;  4QIW L;  5TMF A;  3WOD A;  3RZO K;  3HOY C;  4A3B K;  2NVY C;  5C4J K;  3S2D K;  2BE5 A;  3GTM C;  4C3I K;  1TWG C;  3S16 C;  3S1N K;  2NVQ K;  3M3Y K;  3S1Q K;  4QJV A;  3HOU K;  5M5W K;  3I4M C;  5M5X K;  5IP9 K;  3GTJ C;  3H3V D;  3K7A K; 
#chains in the Genus database with same CATH topology
 3GEE A;  1WOS A;  1AB4 A;  3LAJ A;  3H0G C;  1WOO A;  3HKZ D;  1F7U A;  3GDZ A;  1K83 K;  1TWH K;  4A3J C;  1F9N A;  2JA8 K;  4PAA A;  1XXA A;  2R92 C;  1TWF A;  2A6E A;  1O26 A;  2JA5 C;  1IQ0 A;  4LK1 A;  1SMY A;  3GTP C;  5TJ3 A;  3TTG A;  1Y1V C;  3T02 A;  2NVX K;  3BP8 C;  2R93 A;  1Y1W C;  1VJE A;  3HOX C;  1SFO C;  1R9T K;  3S14 K;  1JQW A;  5IYB K;  4WIL A;  1WIH A;  1YNJ A;  4Q5S A;  5FLM C;  4A3D K;  3I4N C;  2VUM A;  4G0W A;  5C4X C;  4OIP A;  3ADA C;  2B63 C;  2R93 C;  3HOW C;  1I50 A;  2NVY K;  2GSU A;  3GTM K;  1TWG K;  2CFA B;  5JFE A;  4A3B C;  2YU9 A;  3S2D C;  2XCR B;  1XXC A;  1WQF A;  2E2H K;  1EK8 A;  1UV7 A;  4P5A A;  3SZY A;  3M4O K;  4FM9 A;  4BBS C;  1O2A A;  4GTD A;  4GZY A;  3GTK C;  4YFN A;  2JA6 K;  1ZYR A;  5E68 A;  4OIO A;  4Y7N K;  4A3F K;  4DDQ A;  1WCM A;  4KDD A;  3T01 A;  1TWH C;  4A3E C;  3S17 K;  3FHZ A;  4BY1 K;  1J6W A;  4A3M K;  5EGE A;  2R7Z K;  3TFI A;  2NVX C;  2A6H A;  5TMC A;  3M3Y C;  3GTO A;  1R9T C;  4QJV B;  5JVO A;  3V4G A;  5IYB C;  4KAT A;  4O2D A;  3ORE A;  4LR2 A;  3GTQ K;  2WB1 D;  4A3I C;  3S2H K;  4A3D C;  2PMZ D;  1PJ5 A;  1ZQ1 C;  4XLN A;  2Y3P A;  2W7V A;  4PAB A;  4RMF A;  2XCQ A;  4MEX A;  2NVY C;  5C4J K;  2BE5 A;  3GTM C;  1TWG C;  2GSO A;  1C0A A;  3S0X A;  3L4K A;  3HOU K;  5M5W K;  1XZQ A;  5IOS A;  1XPP A;  4WJ4 A;  4C3J K;  4OIN A;  1O29 A;  3QX3 A;  1EFW A;  1YCL A;  4G7Z A;  2JA6 C;  4Y7N C;  4A3F C;  3GTG K;  2JA7 K;  1INN A;  5M5Y K;  1BDF A;  1IE0 A;  4MEY A;  3S1M K;  3S17 C;  3CQZ C;  3H0G A;  1BS2 A;  1WSV A;  1YX2 A;  4A3M C;  3I4M K;  4LQY A;  3AD8 C;  3JST A;  4A3G K;  2V6S A;  2ZUE A;  2R92 A;  4KAS A;  1TWF K;  2JA5 A;  4XCH A;  4A93 K;  1I3Q K;  3A8K A;  3GTP A;  3AH5 A;  3LAP A;  4Y52 C;  1ZVU A;  1I6H K;  1Y1V A;  1IW7 A;  3AD9 C;  4A3K K;  2WAQ L;  3GTQ C;  1Y1W A;  1SFO A;  3S2H C;  4AYB D;  4GTF A;  5CHP A;  3HOY K;  4BKW A;  5L46 A;  5M3F K;  4YFX A;  3G4C A;  5C4J C;  4BLA A;  2E2I K;  4LJZ A;  3GTJ K;  5HL8 A;  2B63 A;  4C3H K;  2P8T A;  3SZZ A;  3HOU C;  4KN7 A;  3ERE D;  3PO2 K;  4G7H A;  3FKI K;  4YG2 A;  4GTE A;  3A8I A;  1EQR A;  3L4J A;  3DXJ A;  1IL2 A;  3GTG C;  4C2M K;  1WOP A;  2JA7 C;  3CAG A;  2CFA A;  5IOQ A;  1TWA K;  2PMZ L;  5IP7 C;  4OIR A;  3S1M C;  4BXX C;  3GTK A;  3HOV K;  5C3E K;  3Q3Q A;  4A3C K;  1IS1 A;  3T00 A;  1WCM K;  3IPJ A;  4KB2 A;  1TWH A;  4KN4 A;  3HOZ K;  1J6V A;  4A3G C;  2RGR A;  1DCO A;  2FQO A;  1L0W A;  2ZFZ A;  3OPF A;  5IP9 C;  1I3Q C;  3NUH A;  4GTB A;  1O2B A;  2NVX A;  1WQH A;  4LOW A;  4NOI A;  4JK1 A;  1K83 C;  3GTO K;  1VRQ C;  4QIW D;  1R9T A;  1USM A;  4OIQ A;  2JA8 C;  2NVT K;  3N0B A;  5CJ9 A;  4P9S A;  3HOY C;  3GEI A;  4C3I K;  1ZBS A;  3TFH A;  3S1N K;  2NVQ K;  2P5M A;  4KB4 A;  3S1Q K;  4QJV A;  4KMA A;  5M5X K;  2RH6 A;  3GTJ C;  4C3H C;  3K7A K;  4BY7 K;  2NVY A;  3GTM A;  2XCO A;  1TWG A;  3S14 C;  3FKI C;  1O28 A;  3GSI A;  5M3M K;  1O25 A;  1RU0 A;  1YNN A;  1V5V A;  3HKZ L;  4X6A K;  4BBR K;  4C2M C;  2CW0 A;  1TWA C;  1WSR A;  1PJ7 A;  4AYB L;  3HOV C;  5C3E C;  3S15 K;  2JA6 A;  1TWC K;  4KM8 A;  4A3C C;  3LPX A;  3MML B;  1XZP B;  1HQM A;  3HOZ C;  3GIR A;  3CQZ A;  1DCP A;  2E2H C;  3H0G K;  1DCH A;  5IYC K;  3PO3 K;  3M4O C;  4KAR A;  5C44 K;  2GAH C;  3GTL K;  1ZXO A;  1JOE A;  3GTP K;  2V6U A;  1XXB A;  1EH1 A;  2NVT C;  4GT9 A;  1VH2 A;  3S16 K;  3GTQ A;  3AD7 C;  4BY1 C;  1Y1W K;  4C3I C;  3S1N C;  2NVQ C;  2R7Z C;  4GTC A;  1IBA A;  3FOE A;  5FLM K;  2PA8 D;  5IYD K;  4BY7 C;  4KMH A;  4Q4Z A;  1BJT A;  1B4A A;  2R93 K;  1WOR A;  3HOW K;  2EBB A;  2FQT A;  3EQL A;  4G7O A;  3S15 C;  2PHC B;  3RZD K;  1TWC C;  3GTG A;  2JA7 A;  4BBS K;  2Y0S D;  4KC6 A;  4C45 A;  2VUM K;  4A3L K;  4YFK A;  1VGX A;  3S1R K;  1I50 K;  1F93 A;  4KAW X;  5IYC C;  3PO3 C;  4A3E K;  4C3J C;  2YU9 K;  5C44 C;  4XSZ A;  3FOF A;  2GAG C;  3GTL C;  2WB1 L;  4XLP A;  1I6V A;  1I3Q A;  4LLG A;  3RZO K;  1J98 A;  3S16 C;  3M3Y K;  1K83 A;  3I4M C;  4WJ3 M;  3H3V D;  1TWF C;  4A93 C;  4A3I K;  2JH3 A;  5IYD C;  1O2F B;  1JVI A;  1I6H C;  2E2I A;  3GTJ A;  1O27 A;  4LK0 A;  4A3K C;  4GTL A;  4GTA A;  4KM9 A;  1DD5 A;  3FKI A;  1GE9 A;  2A68 A;  3HXA A;  3OEP A;  1BGW A;  1WQG A;  3TFJ A;  3RZD C;  2E2I C;  3N3Y A;  2VUM C;  1TWA A;  4A3L C;  3S1R C;  2WAQ D;  4ILD A;  1I50 C;  3PO2 C;  2PA8 L;  1O24 A;  2YU9 C;  3CQZ K;  2E2J K;  3GEH A;  2E2H A;  5D4D A;  1XZP A;  3VA7 A;  4J3N A;  4G0V A;  5IOR A;  1G51 A;  3RZO C;  1B4B A;  2D6F C;  4ZH4 A;  1WCM C;  3BUE A;  2ZUF A;  4Y52 K;  3AQP A;  2Y0S L;  4KMD A;  3G4A A;  1PJ6 A;  4AH6 A;  4A3J K;  1F7V A;  2V6T A;  3AQO A;  2R7Z A;  2R92 K;  1X31 C;  2JA5 K;  3GTO C;  1Y1V K;  2O5I A;  4XSX A;  1EI6 A;  3HOX K;  1SFO K;  5FJ8 K;  3S1Q C;  1HI9 A;  2GSN A;  4KMU A;  4P5B A;  3H3V L;  3K7A C;  1XZQ B;  5EGH A;  1TWC A;  3I4N K;  1J6X A;  1KQ4 A;  2PPB A;  4BLB A;  5C4X K;  4M1X A;  1ISE A;  5IP7 K;  2B63 K;  4G0U A;  4BXX K;  1USO A;  2KWA A;  4MQ9 A;  2E2J C;  2O5J A;  4X6A C;  3N0C A;  4BBR C;  2A69 A;  3A8J A;  4QIW L;  3BP3 A;  5TMF A;  3WOD A;  4A3B K;  3S2D K;  4FZB A;  4GFQ A;  5IOT A;  3GTL A;  5IP9 K;  1VLO A;  3GTK K; 
#chains in the Genus database with same CATH homology
 1XPP A;  4BY7 K;  4A93 C;  4C3J K;  4OIN A;  4A3I K;  3S14 C;  3H0G C;  3HKZ D;  3FKI C;  5IYD C;  4G7Z A;  1I6H C;  4X6A K;  5M3M K;  1K83 K;  2JA6 C;  1TWH K;  4A3J C;  4Y7N C;  1TWF C;  4A3F C;  2JA8 K;  3GTG K;  1YNN A;  2JA7 K;  3HKZ L;  4LK0 A;  4A3K C;  5M5Y K;  1BDF A;  4MEY A;  2R92 C;  4BBR K;  2A6E A;  3CQZ C;  3S17 C;  2CW0 A;  3S1M K;  2JA5 C;  1TWA C;  4LK1 A;  1SMY A;  4AYB L;  3GTP C;  3HOV C;  5C3E C;  3S15 K;  2A68 A;  1Y1V C;  4A3M C;  3I4M K;  1TWC K;  4A3C C;  2NVX K;  4A3G K;  1HQM A;  3RZD C;  3HOZ C;  1Y1W C;  2E2I C;  1TWF K;  3HOX C;  1SFO C;  1R9T K;  2VUM C;  1I3Q K;  4A93 K;  2E2H C;  3S14 K;  5IYB K;  4A3L C;  3H0G K;  5IYC K;  3PO3 K;  4Y52 C;  2WAQ D;  3S1R C;  3M4O C;  1I6H K;  1IW7 A;  1YNJ A;  1I50 C;  3PO2 C;  4Q5S A;  5FLM C;  4BXX K;  5C44 K;  2PA8 L;  4A3D K;  4A3K K;  2WAQ L;  3GTQ C;  3GTL K;  2YU9 C;  3I4N C;  3S2H C;  3CQZ K;  2E2J K;  5C4X C;  4OIP A;  5D4D A;  3GTK K;  2B63 C;  2R93 C;  4AYB D;  3GTP K;  3HOW C;  3HOY K;  2NVT C;  2NVY K;  3GTM K;  1TWG K;  5M3F K;  3S16 K;  4YFX A;  3RZO C;  4BY1 C;  4A3B C;  5C4J C;  1Y1W K;  2E2I K;  3S2D C;  4ZH4 A;  4LJZ A;  3S1N C;  1WCM C;  3GTJ K;  2E2H K;  2NVQ C;  2R7Z C;  4C3H K;  3HOU C;  4KN7 A;  4Y52 K;  3M4O K;  4BBS C;  2Y0S L;  3GTL C;  3PO2 K;  5FLM K;  4G7H A;  4GZY A;  2PA8 D;  3FKI K;  3GTK C;  5IYD K;  4YG2 A;  4BY7 C;  4YFN A;  2JA6 K;  1ZYR A;  4A3J K;  4OIO A;  4Y7N K;  4Q4Z A;  4A3F K;  3DXJ A;  2R93 K;  1TWH C;  4A3E C;  2R92 K;  3GTG C;  4C2M K;  3HOW K;  3S17 K;  2JA7 C;  2JA5 K;  1TWA K;  2PMZ L;  5IP7 C;  4OIR A;  3GTO C;  3EQL A;  3S1M C;  3HOV K;  5C3E K;  4BXX C;  4BY1 K;  1Y1V K;  4A3M K;  2O5I A;  4G7O A;  4A3C K;  3S15 C;  1WCM K;  3RZD K;  3HOZ K;  4KN4 A;  2R7Z K;  1TWC C;  4XSX A;  3HOX K;  1SFO K;  2NVX C;  5FJ8 K;  2Y0S D;  2VUM K;  4BBS K;  2A6H A;  5TMC A;  3M3Y C;  4A3G C;  4A3L K;  3S1Q C;  4YFK A;  4KMU A;  3S1R K;  1R9T C;  5IP9 C;  4QJV B;  1I3Q C;  1I50 K;  5IYB C;  3H3V L;  5IYC C;  3PO3 C;  3K7A C;  3GTQ K;  4A3E K;  2WB1 D;  2YU9 K;  4A3I C;  3I4N K;  3S2H K;  2PPB A;  5C44 C;  4A3D C;  4XSZ A;  5C4X K;  4NOI A;  2PMZ D;  4JK1 A;  1K83 C;  5IP7 K;  4XLN A;  2B63 K;  2WB1 L;  4QIW D;  1I6V A;  4XLP A;  4MQ9 A;  2E2J C;  4OIQ A;  2JA8 C;  3GTO K;  2NVT K;  2O5J A;  4LLG A;  4MEX A;  4X6A C;  4BBR C;  2A69 A;  4QIW L;  5TMF A;  3WOD A;  3RZO K;  3HOY C;  4A3B K;  2NVY C;  5C4J K;  3S2D K;  2BE5 A;  3GTM C;  4C3I K;  1TWG C;  3S16 C;  3S1N K;  2NVQ K;  3M3Y K;  3S1Q K;  4QJV A;  3HOU K;  5M5W K;  3I4M C;  5M5X K;  5IP9 K;  3GTJ C;  3H3V D;  3K7A K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...