2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
4BY1K 4LK1A 4LJZA 3RZDC 4C2MK 2JA8K 4MEYA 4YFKA 3PO2K 3S17C 1TWCC 4A3DK 1IW7A 2JA7C 3S1NC 1I6VA 1YNJA 2NVYK 2NVXC 5IP7K 3S15K 3S1MK 3M3YC 2VUMK 4A3KK 4Q5SA 1I6HK 4NOIA 2E2IC 4Y52C 2R92C 3GTQC 1TWHK 1TWAK 5C4JC 1Y1WC 2PMZL 5TMCA 2PPBA 2R7ZC 4BXXC 1R9TK 3GTKK 3HOXC 3RZOC 4G7OA 1Y1VC 3FKIC 3CQZK 2A6EA 3K7AC 1TWFC 4LK0A 1I3QK 4LLGA 4AYBL 4XLPA 5M5WK 4BY7C 1K83C 1TWFK 3K7AK 4A3EK 2Y0SL 4A3MK 2JA5K 4A3IC 4BBSK 3S14C 3HOUK 3M4OK 3GTPK 4MQ9A 5FJ8K 1SMYA 4XLNA 3I4NC 2E2IK 3HOWK 4Q4ZA 3S16K 2R93C 5IYDC 4ZH4A 5IP7C 5M3FK 4YG2A 3HOWC 5FLMK 3S16C 3S2HC 3S17K 1BDFA 2CW0A 4G7ZA 3RZDK 4OIOA 2NVTK 3GTPC 2WAQL 3HOUC 1I50C 4A3IK 3GTOK 2JA5C 4BBSC 2PA8L 3EQLA 3H3VD 2WAQD 3S2HK 5FLMC 2O5IA 3H0GK 4BY7K 2O5JA 1I3QC 5IYDK 4Y7NK 2E2HK 3H3VL 1TWGK 5IYBC 3CQZC 3I4NK 3DXJA 2E2JK 3HOXK 1YNNA 3M4OC 3S14K 4A3BK 2E2JC 3GTQK 4KN7A 2WB1L 2NVQC 1TWGC 5IYBK 2VUMC 1K83K 4C3IK 4Y7NC 3S15C 4C3JK 3S1MC 3GTLK 3H0GC 4KMUA 4QJVA 2JA7K 2BE5A 3S1NK 4OIPA 3PO2C 4X6AC 4QIWD 3HKZL 4A93K 3WODA 1R9TC 2R7ZK 4A3GC 5C4JK 2NVTC 1TWHC 4A3CK 3HOZK 3S1RK 4YFNA 3I4MK 1I6HC 4A3KC 4KN4A 4C3HK 5IYCC 3GTJC 5C3EC 3GTGC 3S1QK 2PA8D 5C3EK 2Y0SD 4BBRC 3S1QC 2R93K 1TWCK 4A3FK 4OIRA 3HOZC 4A3CC 2JA8C 2JA6K 4BY1C 4GZYA 4A3JC 1HQMA 1ZYRA 2WB1D 5M5YK 2A69A 4A3MC 4QJVB 2B63K 2A68A 3HOVK 5C44C 4A93C 4X6AK 4A3EC 4A3LC 5IP9K 3HOYK 3GTLC 1WCMK 3PO3K 5C4XC 1WCMC 1SFOC 3S2DK 5IP9C 4A3LK 4JK1A 3GTMK 5M5XK 2NVQK 3FKIK 1Y1VK 5C44K 5D4DA 1XPPA 4YFXA 2YU9C 4A3BC 3GTKC 3RZOK 4BXXK 4XSXA 1Y1WK 4OINA 2JA6C 1TWAC 2PMZD 2YU9K 4AYBD 4G7HA 2R92K 4Y52K 4A3FC 2A6HA 4QIWL 4XSZA 3GTMC 2E2HC 3M3YK 1SFOK 3S2DC 4BBRK 5C4XK 2NVYC 2NVXK 3GTGK 3PO3C 5M3MK 3HOYC 5IYCK 3GTJK 4MEXA 4A3DC 3I4MC 3S1RC 4OIQA 5TMFA 3HOVC 3HKZD 3GTOC 4A3GK 2B63C 1I50K 4A3JK
chains in the Genus database with same CATH superfamily
1ZXOA 3RZDC 3GEEA 1O27A 3S0XA 3PO2K 1TWCC 3CAGA 1J6WA 2Y3PA 1HI9A 2V6TA 2NVXC 1O26A 3OEPA 4A3KK 1I6HK 2E2IC 2R92C 4O2DA 1TWHK 1TWAK 5C4JC 1Y1VA 1Y1WC 1R9TK 5EGEA 4BLAA 1G51A 1TWCA 4J3NA 3GTGA 4AYBL 5M5WK 4DDQA 3K7AK 1WQFA 2Y0SL 3FHZA 3ERED 3GIRA 2JA5K 4RMFA 1J6XA 4P5AA 4MQ9A 4XLNA 1XXCA 4G0UA 3I4NC 4KASA 2ZUEA 1BDFA 4LR2A 4WILA 2CW0A 1EQRA 2CFAB 1AB4A 3EQLA 3H3VD 4KARA 3S2HK 1ZQ1C 2O5JA 4Y7NK 2E2HK 1VLOA 2FQOA 5IYBC 4KATA 3GTPA 1X31C 1TWGA 4A3BK 2E2JC 1BS2A 1K83K 3N3YA 1VRQC 3SZYA 4KM9A 3H0GC 2JA7K 2BE5A 3S1NK 1R9TA 2CFAA 4QIWD 3LAJA 1B4BA 1YX2A 1TWFA 3I4MK 1XZPB 4KN4A 5IYCC 1ZBSA 2PA8D 5C3EK 2Y0SD 3L4JA 3H0GA 3HOZC 4A3CC 1F7UA 2JH3A 5C44C 1K83A 4A3EC 2PHCB 3N0BA 1WCMK 3GTLC 3S2DK 5JFEA 3GTLA 3FKIK 3GEIA 5C44K 1XPPA 3RZOK 4OINA 3CQZA 2JA6C 1XXAA 4A3FC 4XSZA 4KMHA 3M3YK 4BLBA 3GTGK 3HOYC 5JVOA 4MEXA 4A3DC 5TMFA 4C45A 3GTOC 4WJ4A 4BY1K 2XCQA 3N0CA 3S17C 4A3DK 1IS1A 3A8IA 1BGWA 2NVYK 1ISEA 5IP7K 2R7ZA 1WQGA 1F7VA 3RZOC 1Y1VC 1VJEA 2EBBA 5E68A 3TTGA 1Y1WA 2A6EA 3ADAC 4BKWA 4LLGA 4XLPA 4BY7C 5IORA 4C3IC 3AD8C 4A3EK 3BUEA 4LQYA 3S14C 3M4OK 4PAAA 1PJ6A 5FJ8K 3GTPK 1IL2A 3OPFA 2R93C 4ZH4A 5IP7C 3JSTA 5M3FK 1PJ7A 5FLMK 1WSRA 3GTPC 2WAQL 3HXAA 3GTOK 2JA5C 5IOSA 5FLMC 4FZBA 3H0GK 1WQHA 4BY7K 2RGRA 5IYDK 3H3VL 3G4CA 1XZPA 2NVXA 1WSVA 1YNNA 3M4OC 2V6UA 1USOA 2NVYA 4G0VA 1VGXA 1F9NA 2GAGC 4C3IK 4KMUA 4QJVA 3FKIA 4X6AC 3WODA 2JA7A 4GTLA 4YFNA 3A8KA 1JVIA 5C3EC 3GTGC 4FM9A 1DCOA 2R93K 1ZVUA 4AH6A 4WJ3M 4A3FK 3Q3QA 4OIRA 5IOQA 1L0WA 2JA6K 3GSIA 5M5YK 4QJVB 3HOVK 4X6AK 3GTMA 4GTAA 3T00A 3HOYK 2FQTA 1C0AA 1WCMC 4JK1A 1Y1VK 1WCMA 4A3BC 4KB2A 3T01A 4M1XA 1Y1WK 1J98A 1TWAC 2PMZD 3AQPA 2E2HC 4BBRK 2NVYC 5IYCK 3I4MC 3GEHA 4LOWA 3BP3A 2JA5A 4OIQA 3HOVC 3HKZD 1O24A 4LK1A 4LJZA 2B63A 4YFKA 2VUMA 2JA7C 3S1NC 1YNJA 3S15K 3M3YC 4Q5SA 4Y52C 3NUHA 5TMCA 4BXXC 1O29A 2R92A 1IE0A 3FKIC 1K83C 1JQWA 4A3IC 4BBSK 1KQ4A 3HOUK 1SMYA 2ZFZA 2E2IK 1INNA 3HOWK 4Q4ZA 2W7VA 4KDDA 3S16K 5IYDC 5TJ3A 1PJ5A 3S2HC 3S17K 3SZZA 3QX3A 4G7ZA 2NVTK 3RZDK 4OIOA 4KAWX 1I50C 3TFJA 2PA8L 4GTEA 1EH1A 1I3QA 2WAQD 2R93A 2YU9A 5HL8A 3GDZA 2V6SA 3T02A 3CQZC 2JA6A 2XCOA 4KMDA 2E2JK 4GT9A 3HOXK 3L4KA 1USMA 3S14K 2E2IA 3GTQK 4KN7A 2WB1L 1GE9A 5IYBK 5CHPA 2RH6A 2VUMC 4Y7NC 3S1MC 3GTLK 1B4AA 4OIPA 3PO2C 3TFIA 1IBAA 3HKZL 1WORA 4A93K 3TFHA 1DCHA 5C4JK 1TWHC 4A3CK 3HOZK 3S1RK 4A3KC 4C3HK 3GTJC 3BP8C 3S1QK 1V5VA 1O25A 5IOTA 1TWCK 1RU0A 5L46A 4BY1C 4A3JC 4GTFA 5IP9K 5C4XC 4C3JC 5IP9C 4A3LK 5M5XK 2NVQK 3GTKC 2D6FC 4XSXA 2YU9K 2R92K 1EI6A 3FOFA 3IPJA 4QIWL 1XXBA 1WOSA 3S2DC 1O28A 3PO3C 2NVXK 1I50A 4A3GK 2XCRB 4C2MK 2JA8K 4KM8A 4MEYA 1IW7A 1I6VA 1TWHA 3S1MK 4GFQA 2VUMK 1EK8A 4NOIA 5EGHA 3GTQC 1O2FB 3GTOA 4GTCA 2P5MA 2PMZL 2PPBA 2R7ZC 3GTKK 3HOXC 4G7OA 2GSOA 3CQZK 3K7AC 1TWFC 4LK0A 4P5BA 1I3QK 3GTJA 1J6VA 1TWFK 3LAPA 4G0WA 4A3MK 3A8JA 3AD9C 1DCPA 1O2AA 1DD5A 4YG2A 3HOWC 3S16C 1XZQB 1UV7A 4KB4A 3FOEA 3HOUC 1TWAA 4A3IK 4BBSC 2GAHC 3AD7C 3VA7A 2E2HA 1WIHA 2O5IA 2KWAA 1I3QC 3V4GA 1TWGK 1JOEA 3I4NK 3DXJA 3MMLB 5CJ9A 3G4AA 1XZQA 4P9SA 2NVQC 1TWGC 3S15C 4C3JK 4GTBA 4ILDA 4PABA 1O2BA 1R9TC 2R7ZK 4A3GC 1YCLA 1F93A 2NVTC 1I6HC 2ZUFA 3S1QC 4BBRC 1IQ0A 1SFOA 4C3HC 4KMAA 1WOOA 4C2MC 2JA8C 4GZYA 1HQMA 1ZYRA 2WB1D 2B63K 2A69A 4A3MC 3LPXA 4A93C 2A68A 1EFWA 2GSUA 4A3LC 3AQOA 3PO3K 1SFOC 4XCHA 3GTMK 4GTDA 4KC6A 4YFXA 2GSNA 5D4DA 2YU9C 1BJTA 1VH2A 4BXXK 3OREA 4AYBD 4G7HA 3GTKA 4Y52K 2A6HA 3GTMC 3AH5A 1SFOK 5C4XK 1WOPA 5M3MK 3GTJK 3S1RC 2P8TA 3GTQA 2B63C 1I50K 4A3JK
chains in the Genus database with same CATH topology
4BY1K 4LK1A 4LJZA 3RZDC 4C2MK 2JA8K 4MEYA 4YFKA 3PO2K 3S17C 1TWCC 4A3DK 1IW7A 2JA7C 3S1NC 1I6VA 1YNJA 2NVYK 2NVXC 5IP7K 3S15K 3S1MK 3M3YC 2VUMK 4A3KK 4Q5SA 1I6HK 4NOIA 2E2IC 4Y52C 2R92C 3GTQC 1TWHK 1TWAK 5C4JC 1Y1WC 2PMZL 5TMCA 2PPBA 2R7ZC 4BXXC 1R9TK 3GTKK 3HOXC 3RZOC 4G7OA 1Y1VC 3FKIC 3CQZK 2A6EA 3K7AC 1TWFC 4LK0A 1I3QK 4LLGA 4AYBL 4XLPA 5M5WK 4BY7C 1K83C 1TWFK 3K7AK 4A3EK 2Y0SL 4A3MK 2JA5K 4A3IC 4BBSK 3S14C 3HOUK 3M4OK 3GTPK 4MQ9A 5FJ8K 1SMYA 4XLNA 3I4NC 2E2IK 3HOWK 4Q4ZA 3S16K 2R93C 5IYDC 4ZH4A 5IP7C 5M3FK 4YG2A 3HOWC 5FLMK 3S16C 3S2HC 3S17K 1BDFA 2CW0A 4G7ZA 3RZDK 4OIOA 2NVTK 3GTPC 2WAQL 3HOUC 1I50C 4A3IK 3GTOK 2JA5C 4BBSC 2PA8L 3EQLA 3H3VD 2WAQD 3S2HK 5FLMC 2O5IA 3H0GK 4BY7K 2O5JA 1I3QC 5IYDK 4Y7NK 2E2HK 3H3VL 1TWGK 5IYBC 3CQZC 3I4NK 3DXJA 2E2JK 3HOXK 1YNNA 3M4OC 3S14K 4A3BK 2E2JC 3GTQK 4KN7A 2WB1L 2NVQC 1TWGC 5IYBK 2VUMC 1K83K 4C3IK 4Y7NC 3S15C 4C3JK 3S1MC 3GTLK 3H0GC 4KMUA 4QJVA 2JA7K 2BE5A 3S1NK 4OIPA 3PO2C 4X6AC 4QIWD 3HKZL 4A93K 3WODA 1R9TC 2R7ZK 4A3GC 5C4JK 2NVTC 1TWHC 4A3CK 3HOZK 3S1RK 4YFNA 3I4MK 1I6HC 4A3KC 4KN4A 4C3HK 5IYCC 3GTJC 5C3EC 3GTGC 3S1QK 2PA8D 5C3EK 2Y0SD 4BBRC 3S1QC 2R93K 1TWCK 4A3FK 4OIRA 3HOZC 4A3CC 2JA8C 2JA6K 4BY1C 4GZYA 4A3JC 1HQMA 1ZYRA 2WB1D 5M5YK 2A69A 4A3MC 4QJVB 2B63K 2A68A 3HOVK 5C44C 4A93C 4X6AK 4A3EC 4A3LC 5IP9K 3HOYK 3GTLC 1WCMK 3PO3K 5C4XC 1WCMC 1SFOC 3S2DK 5IP9C 4A3LK 4JK1A 3GTMK 5M5XK 2NVQK 3FKIK 1Y1VK 5C44K 5D4DA 1XPPA 4YFXA 2YU9C 4A3BC 3GTKC 3RZOK 4BXXK 4XSXA 1Y1WK 4OINA 2JA6C 1TWAC 2PMZD 2YU9K 4AYBD 4G7HA 2R92K 4Y52K 4A3FC 2A6HA 4QIWL 4XSZA 3GTMC 2E2HC 3M3YK 1SFOK 3S2DC 4BBRK 5C4XK 2NVYC 2NVXK 3GTGK 3PO3C 5M3MK 3HOYC 5IYCK 3GTJK 4MEXA 4A3DC 3I4MC 3S1RC 4OIQA 5TMFA 3HOVC 3HKZD 3GTOC 4A3GK 2B63C 1I50K 4A3JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 K;  4LK1 A;  4LJZ A;  3RZD C;  4C2M K;  2JA8 K;  4MEY A;  4YFK A;  3PO2 K;  3S17 C;  1TWC C;  4A3D K;  1IW7 A;  2JA7 C;  3S1N C;  1I6V A;  1YNJ A;  2NVY K;  2NVX C;  5IP7 K;  3S15 K;  3S1M K;  3M3Y C;  2VUM K;  4A3K K;  4Q5S A;  1I6H K;  4NOI A;  2E2I C;  4Y52 C;  2R92 C;  3GTQ C;  1TWH K;  1TWA K;  5C4J C;  1Y1W C;  2PMZ L;  5TMC A;  2PPB A;  2R7Z C;  4BXX C;  1R9T K;  3GTK K;  3HOX C;  3RZO C;  4G7O A;  1Y1V C;  3FKI C;  3CQZ K;  2A6E A;  3K7A C;  1TWF C;  4LK0 A;  1I3Q K;  4LLG A;  4AYB L;  4XLP A;  5M5W K;  4BY7 C;  1K83 C;  1TWF K;  3K7A K;  4A3E K;  2Y0S L;  4A3M K;  2JA5 K;  4A3I C;  4BBS K;  3S14 C;  3HOU K;  3M4O K;  3GTP K;  4MQ9 A;  5FJ8 K;  1SMY A;  4XLN A;  3I4N C;  2E2I K;  3HOW K;  4Q4Z A;  3S16 K;  2R93 C;  5IYD C;  4ZH4 A;  5IP7 C;  5M3F K;  4YG2 A;  3HOW C;  5FLM K;  3S16 C;  3S2H C;  3S17 K;  1BDF A;  2CW0 A;  4G7Z A;  3RZD K;  4OIO A;  2NVT K;  3GTP C;  2WAQ L;  3HOU C;  1I50 C;  4A3I K;  3GTO K;  2JA5 C;  4BBS C;  2PA8 L;  3EQL A;  3H3V D;  2WAQ D;  3S2H K;  5FLM C;  2O5I A;  3H0G K;  4BY7 K;  2O5J A;  1I3Q C;  5IYD K;  4Y7N K;  2E2H K;  3H3V L;  1TWG K;  5IYB C;  3CQZ C;  3I4N K;  3DXJ A;  2E2J K;  3HOX K;  1YNN A;  3M4O C;  3S14 K;  4A3B K;  2E2J C;  3GTQ K;  4KN7 A;  2WB1 L;  2NVQ C;  1TWG C;  5IYB K;  2VUM C;  1K83 K;  4C3I K;  4Y7N C;  3S15 C;  4C3J K;  3S1M C;  3GTL K;  3H0G C;  4KMU A;  4QJV A;  2JA7 K;  2BE5 A;  3S1N K;  4OIP A;  3PO2 C;  4X6A C;  4QIW D;  3HKZ L;  4A93 K;  3WOD A;  1R9T C;  2R7Z K;  4A3G C;  5C4J K;  2NVT C;  1TWH C;  4A3C K;  3HOZ K;  3S1R K;  4YFN A;  3I4M K;  1I6H C;  4A3K C;  4KN4 A;  4C3H K;  5IYC C;  3GTJ C;  5C3E C;  3GTG C;  3S1Q K;  2PA8 D;  5C3E K;  2Y0S D;  4BBR C;  3S1Q C;  2R93 K;  1TWC K;  4A3F K;  4OIR A;  3HOZ C;  4A3C C;  2JA8 C;  2JA6 K;  4BY1 C;  4GZY A;  4A3J C;  1HQM A;  1ZYR A;  2WB1 D;  5M5Y K;  2A69 A;  4A3M C;  4QJV B;  2B63 K;  2A68 A;  3HOV K;  5C44 C;  4A93 C;  4X6A K;  4A3E C;  4A3L C;  5IP9 K;  3HOY K;  3GTL C;  1WCM K;  3PO3 K;  5C4X C;  1WCM C;  1SFO C;  3S2D K;  5IP9 C;  4A3L K;  4JK1 A;  3GTM K;  5M5X K;  2NVQ K;  3FKI K;  1Y1V K;  5C44 K;  5D4D A;  1XPP A;  4YFX A;  2YU9 C;  4A3B C;  3GTK C;  3RZO K;  4BXX K;  4XSX A;  1Y1W K;  4OIN A;  2JA6 C;  1TWA C;  2PMZ D;  2YU9 K;  4AYB D;  4G7H A;  2R92 K;  4Y52 K;  4A3F C;  2A6H A;  4QIW L;  4XSZ A;  3GTM C;  2E2H C;  3M3Y K;  1SFO K;  3S2D C;  4BBR K;  5C4X K;  2NVY C;  2NVX K;  3GTG K;  3PO3 C;  5M3M K;  3HOY C;  5IYC K;  3GTJ K;  4MEX A;  4A3D C;  3I4M C;  3S1R C;  4OIQ A;  5TMF A;  3HOV C;  3HKZ D;  3GTO C;  4A3G K;  2B63 C;  1I50 K;  4A3J K; 
#chains in the Genus database with same CATH topology
 1ZXO A;  3RZD C;  3GEE A;  1O27 A;  3S0X A;  3PO2 K;  1TWC C;  3CAG A;  1J6W A;  2Y3P A;  1HI9 A;  2V6T A;  2NVX C;  1O26 A;  3OEP A;  4A3K K;  1I6H K;  2E2I C;  2R92 C;  4O2D A;  1TWH K;  1TWA K;  5C4J C;  1Y1V A;  1Y1W C;  1R9T K;  5EGE A;  4BLA A;  1G51 A;  1TWC A;  4J3N A;  3GTG A;  4AYB L;  5M5W K;  4DDQ A;  3K7A K;  1WQF A;  2Y0S L;  3FHZ A;  3ERE D;  3GIR A;  2JA5 K;  4RMF A;  1J6X A;  4P5A A;  4MQ9 A;  4XLN A;  1XXC A;  4G0U A;  3I4N C;  4KAS A;  2ZUE A;  1BDF A;  4LR2 A;  4WIL A;  2CW0 A;  1EQR A;  2CFA B;  1AB4 A;  3EQL A;  3H3V D;  4KAR A;  3S2H K;  1ZQ1 C;  2O5J A;  4Y7N K;  2E2H K;  1VLO A;  2FQO A;  5IYB C;  4KAT A;  3GTP A;  1X31 C;  1TWG A;  4A3B K;  2E2J C;  1BS2 A;  1K83 K;  3N3Y A;  1VRQ C;  3SZY A;  4KM9 A;  3H0G C;  2JA7 K;  2BE5 A;  3S1N K;  1R9T A;  2CFA A;  4QIW D;  3LAJ A;  1B4B A;  1YX2 A;  1TWF A;  3I4M K;  1XZP B;  4KN4 A;  5IYC C;  1ZBS A;  2PA8 D;  5C3E K;  2Y0S D;  3L4J A;  3H0G A;  3HOZ C;  4A3C C;  1F7U A;  2JH3 A;  5C44 C;  1K83 A;  4A3E C;  2PHC B;  3N0B A;  1WCM K;  3GTL C;  3S2D K;  5JFE A;  3GTL A;  3FKI K;  3GEI A;  5C44 K;  1XPP A;  3RZO K;  4OIN A;  3CQZ A;  2JA6 C;  1XXA A;  4A3F C;  4XSZ A;  4KMH A;  3M3Y K;  4BLB A;  3GTG K;  3HOY C;  5JVO A;  4MEX A;  4A3D C;  5TMF A;  4C45 A;  3GTO C;  4WJ4 A;  4BY1 K;  2XCQ A;  3N0C A;  3S17 C;  4A3D K;  1IS1 A;  3A8I A;  1BGW A;  2NVY K;  1ISE A;  5IP7 K;  2R7Z A;  1WQG A;  1F7V A;  3RZO C;  1Y1V C;  1VJE A;  2EBB A;  5E68 A;  3TTG A;  1Y1W A;  2A6E A;  3ADA C;  4BKW A;  4LLG A;  4XLP A;  4BY7 C;  5IOR A;  4C3I C;  3AD8 C;  4A3E K;  3BUE A;  4LQY A;  3S14 C;  3M4O K;  4PAA A;  1PJ6 A;  5FJ8 K;  3GTP K;  1IL2 A;  3OPF A;  2R93 C;  4ZH4 A;  5IP7 C;  3JST A;  5M3F K;  1PJ7 A;  5FLM K;  1WSR A;  3GTP C;  2WAQ L;  3HXA A;  3GTO K;  2JA5 C;  5IOS A;  5FLM C;  4FZB A;  3H0G K;  1WQH A;  4BY7 K;  2RGR A;  5IYD K;  3H3V L;  3G4C A;  1XZP A;  2NVX A;  1WSV A;  1YNN A;  3M4O C;  2V6U A;  1USO A;  2NVY A;  4G0V A;  1VGX A;  1F9N A;  2GAG C;  4C3I K;  4KMU A;  4QJV A;  3FKI A;  4X6A C;  3WOD A;  2JA7 A;  4GTL A;  4YFN A;  3A8K A;  1JVI A;  5C3E C;  3GTG C;  4FM9 A;  1DCO A;  2R93 K;  1ZVU A;  4AH6 A;  4WJ3 M;  4A3F K;  3Q3Q A;  4OIR A;  5IOQ A;  1L0W A;  2JA6 K;  3GSI A;  5M5Y K;  4QJV B;  3HOV K;  4X6A K;  3GTM A;  4GTA A;  3T00 A;  3HOY K;  2FQT A;  1C0A A;  1WCM C;  4JK1 A;  1Y1V K;  1WCM A;  4A3B C;  4KB2 A;  3T01 A;  4M1X A;  1Y1W K;  1J98 A;  1TWA C;  2PMZ D;  3AQP A;  2E2H C;  4BBR K;  2NVY C;  5IYC K;  3I4M C;  3GEH A;  4LOW A;  3BP3 A;  2JA5 A;  4OIQ A;  3HOV C;  3HKZ D;  1O24 A;  4LK1 A;  4LJZ A;  2B63 A;  4YFK A;  2VUM A;  2JA7 C;  3S1N C;  1YNJ A;  3S15 K;  3M3Y C;  4Q5S A;  4Y52 C;  3NUH A;  5TMC A;  4BXX C;  1O29 A;  2R92 A;  1IE0 A;  3FKI C;  1K83 C;  1JQW A;  4A3I C;  4BBS K;  1KQ4 A;  3HOU K;  1SMY A;  2ZFZ A;  2E2I K;  1INN A;  3HOW K;  4Q4Z A;  2W7V A;  4KDD A;  3S16 K;  5IYD C;  5TJ3 A;  1PJ5 A;  3S2H C;  3S17 K;  3SZZ A;  3QX3 A;  4G7Z A;  2NVT K;  3RZD K;  4OIO A;  4KAW X;  1I50 C;  3TFJ A;  2PA8 L;  4GTE A;  1EH1 A;  1I3Q A;  2WAQ D;  2R93 A;  2YU9 A;  5HL8 A;  3GDZ A;  2V6S A;  3T02 A;  3CQZ C;  2JA6 A;  2XCO A;  4KMD A;  2E2J K;  4GT9 A;  3HOX K;  3L4K A;  1USM A;  3S14 K;  2E2I A;  3GTQ K;  4KN7 A;  2WB1 L;  1GE9 A;  5IYB K;  5CHP A;  2RH6 A;  2VUM C;  4Y7N C;  3S1M C;  3GTL K;  1B4A A;  4OIP A;  3PO2 C;  3TFI A;  1IBA A;  3HKZ L;  1WOR A;  4A93 K;  3TFH A;  1DCH A;  5C4J K;  1TWH C;  4A3C K;  3HOZ K;  3S1R K;  4A3K C;  4C3H K;  3GTJ C;  3BP8 C;  3S1Q K;  1V5V A;  1O25 A;  5IOT A;  1TWC K;  1RU0 A;  5L46 A;  4BY1 C;  4A3J C;  4GTF A;  5IP9 K;  5C4X C;  4C3J C;  5IP9 C;  4A3L K;  5M5X K;  2NVQ K;  3GTK C;  2D6F C;  4XSX A;  2YU9 K;  2R92 K;  1EI6 A;  3FOF A;  3IPJ A;  4QIW L;  1XXB A;  1WOS A;  3S2D C;  1O28 A;  3PO3 C;  2NVX K;  1I50 A;  4A3G K;  2XCR B;  4C2M K;  2JA8 K;  4KM8 A;  4MEY A;  1IW7 A;  1I6V A;  1TWH A;  3S1M K;  4GFQ A;  2VUM K;  1EK8 A;  4NOI A;  5EGH A;  3GTQ C;  1O2F B;  3GTO A;  4GTC A;  2P5M A;  2PMZ L;  2PPB A;  2R7Z C;  3GTK K;  3HOX C;  4G7O A;  2GSO A;  3CQZ K;  3K7A C;  1TWF C;  4LK0 A;  4P5B A;  1I3Q K;  3GTJ A;  1J6V A;  1TWF K;  3LAP A;  4G0W A;  4A3M K;  3A8J A;  3AD9 C;  1DCP A;  1O2A A;  1DD5 A;  4YG2 A;  3HOW C;  3S16 C;  1XZQ B;  1UV7 A;  4KB4 A;  3FOE A;  3HOU C;  1TWA A;  4A3I K;  4BBS C;  2GAH C;  3AD7 C;  3VA7 A;  2E2H A;  1WIH A;  2O5I A;  2KWA A;  1I3Q C;  3V4G A;  1TWG K;  1JOE A;  3I4N K;  3DXJ A;  3MML B;  5CJ9 A;  3G4A A;  1XZQ A;  4P9S A;  2NVQ C;  1TWG C;  3S15 C;  4C3J K;  4GTB A;  4ILD A;  4PAB A;  1O2B A;  1R9T C;  2R7Z K;  4A3G C;  1YCL A;  1F93 A;  2NVT C;  1I6H C;  2ZUF A;  3S1Q C;  4BBR C;  1IQ0 A;  1SFO A;  4C3H C;  4KMA A;  1WOO A;  4C2M C;  2JA8 C;  4GZY A;  1HQM A;  1ZYR A;  2WB1 D;  2B63 K;  2A69 A;  4A3M C;  3LPX A;  4A93 C;  2A68 A;  1EFW A;  2GSU A;  4A3L C;  3AQO A;  3PO3 K;  1SFO C;  4XCH A;  3GTM K;  4GTD A;  4KC6 A;  4YFX A;  2GSN A;  5D4D A;  2YU9 C;  1BJT A;  1VH2 A;  4BXX K;  3ORE A;  4AYB D;  4G7H A;  3GTK A;  4Y52 K;  2A6H A;  3GTM C;  3AH5 A;  1SFO K;  5C4X K;  1WOP A;  5M3M K;  3GTJ K;  3S1R C;  2P8T A;  3GTQ A;  2B63 C;  1I50 K;  4A3J K; 
#chains in the Genus database with same CATH homology
 4BY1 K;  4LK1 A;  4LJZ A;  3RZD C;  4C2M K;  2JA8 K;  4MEY A;  4YFK A;  3PO2 K;  3S17 C;  1TWC C;  4A3D K;  1IW7 A;  2JA7 C;  3S1N C;  1I6V A;  1YNJ A;  2NVY K;  2NVX C;  5IP7 K;  3S15 K;  3S1M K;  3M3Y C;  2VUM K;  4A3K K;  4Q5S A;  1I6H K;  4NOI A;  2E2I C;  4Y52 C;  2R92 C;  3GTQ C;  1TWH K;  1TWA K;  5C4J C;  1Y1W C;  2PMZ L;  5TMC A;  2PPB A;  2R7Z C;  4BXX C;  1R9T K;  3GTK K;  3HOX C;  3RZO C;  4G7O A;  1Y1V C;  3FKI C;  3CQZ K;  2A6E A;  3K7A C;  1TWF C;  4LK0 A;  1I3Q K;  4LLG A;  4AYB L;  4XLP A;  5M5W K;  4BY7 C;  1K83 C;  1TWF K;  3K7A K;  4A3E K;  2Y0S L;  4A3M K;  2JA5 K;  4A3I C;  4BBS K;  3S14 C;  3HOU K;  3M4O K;  3GTP K;  4MQ9 A;  5FJ8 K;  1SMY A;  4XLN A;  3I4N C;  2E2I K;  3HOW K;  4Q4Z A;  3S16 K;  2R93 C;  5IYD C;  4ZH4 A;  5IP7 C;  5M3F K;  4YG2 A;  3HOW C;  5FLM K;  3S16 C;  3S2H C;  3S17 K;  1BDF A;  2CW0 A;  4G7Z A;  3RZD K;  4OIO A;  2NVT K;  3GTP C;  2WAQ L;  3HOU C;  1I50 C;  4A3I K;  3GTO K;  2JA5 C;  4BBS C;  2PA8 L;  3EQL A;  3H3V D;  2WAQ D;  3S2H K;  5FLM C;  2O5I A;  3H0G K;  4BY7 K;  2O5J A;  1I3Q C;  5IYD K;  4Y7N K;  2E2H K;  3H3V L;  1TWG K;  5IYB C;  3CQZ C;  3I4N K;  3DXJ A;  2E2J K;  3HOX K;  1YNN A;  3M4O C;  3S14 K;  4A3B K;  2E2J C;  3GTQ K;  4KN7 A;  2WB1 L;  2NVQ C;  1TWG C;  5IYB K;  2VUM C;  1K83 K;  4C3I K;  4Y7N C;  3S15 C;  4C3J K;  3S1M C;  3GTL K;  3H0G C;  4KMU A;  4QJV A;  2JA7 K;  2BE5 A;  3S1N K;  4OIP A;  3PO2 C;  4X6A C;  4QIW D;  3HKZ L;  4A93 K;  3WOD A;  1R9T C;  2R7Z K;  4A3G C;  5C4J K;  2NVT C;  1TWH C;  4A3C K;  3HOZ K;  3S1R K;  4YFN A;  3I4M K;  1I6H C;  4A3K C;  4KN4 A;  4C3H K;  5IYC C;  3GTJ C;  5C3E C;  3GTG C;  3S1Q K;  2PA8 D;  5C3E K;  2Y0S D;  4BBR C;  3S1Q C;  2R93 K;  1TWC K;  4A3F K;  4OIR A;  3HOZ C;  4A3C C;  2JA8 C;  2JA6 K;  4BY1 C;  4GZY A;  4A3J C;  1HQM A;  1ZYR A;  2WB1 D;  5M5Y K;  2A69 A;  4A3M C;  4QJV B;  2B63 K;  2A68 A;  3HOV K;  5C44 C;  4A93 C;  4X6A K;  4A3E C;  4A3L C;  5IP9 K;  3HOY K;  3GTL C;  1WCM K;  3PO3 K;  5C4X C;  1WCM C;  1SFO C;  3S2D K;  5IP9 C;  4A3L K;  4JK1 A;  3GTM K;  5M5X K;  2NVQ K;  3FKI K;  1Y1V K;  5C44 K;  5D4D A;  1XPP A;  4YFX A;  2YU9 C;  4A3B C;  3GTK C;  3RZO K;  4BXX K;  4XSX A;  1Y1W K;  4OIN A;  2JA6 C;  1TWA C;  2PMZ D;  2YU9 K;  4AYB D;  4G7H A;  2R92 K;  4Y52 K;  4A3F C;  2A6H A;  4QIW L;  4XSZ A;  3GTM C;  2E2H C;  3M3Y K;  1SFO K;  3S2D C;  4BBR K;  5C4X K;  2NVY C;  2NVX K;  3GTG K;  3PO3 C;  5M3M K;  3HOY C;  5IYC K;  3GTJ K;  4MEX A;  4A3D C;  3I4M C;  3S1R C;  4OIQ A;  5TMF A;  3HOV C;  3HKZ D;  3GTO C;  4A3G K;  2B63 C;  1I50 K;  4A3J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...