2JA8K

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
molecule tags Transferase
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja8K00
3FKIK 4XSZA 3GTLC 3HOXC 4XLPA 3RZDK 2Y0SD 1R9TC 2B63C 4Y7NC 4BY1K 2NVTC 3PO2C 2YU9K 4C3JK 4MEXA 3I4MK 3HOZK 5M5YK 4KN7A 3H3VD 1I3QC 1SFOK 4Y52K 3GTQK 1TWHK 5C4JC 3S1NC 4LK1A 2E2IK 3S2HK 5IP9K 3HOVK 1I6HK 4AYBL 4A3IK 1Y1WC 3S1RK 1YNNA 2R7ZK 1Y1VK 4LLGA 4YFKA 5D4DA 4BXXC 3GTPC 4Q5SA 5C4XC 2E2JC 5C3EK 4QIWL 1I6VA 3GTMC 2PA8L 4MEYA 4ZH4A 3M4OK 4MQ9A 3S14K 2E2HK 3GTGK 4YFXA 4BBRC 4G7HA 4A3JK 3I4NK 4A3EC 2A6EA 3S2DC 4Q4ZA 3HOYC 3PO2K 4Y7NK 4BY1C 2R92K 4A3CC 4KN4A 3PO3C 5IYBC 2BE5A 4A3LK 5FJ8K 3GTOC 2R93C 5IYCK 4QJVB 4OINA 3H0GK 1TWCC 3M3YK 3S1MK 3H3VL 5IP7K 3S16C 4BY7C 3HKZD 3S1NK 1WCMK 4BBSC 3GTJC 3HOUK 3K7AK 4A3FK 4NOIA 1HQMA 1I50K 2NVQC 3S1QC 4G7ZA 1BDFA 1TWAC 3EQLA 2PMZD 1XPPA 1Y1VC 3DXJA 5M3MK 4XLNA 2JA5C 3S17K 4A93C 2NVXK 2PMZL 5C4XK 2JA8C 4BXXK 4X6AC 1IW7A 2A6HA 2NVYK 2JA6K 4GZYA 3GTKC 3GTLK 2A69A 4A3GK 3GTMK 5IYDC 3CQZK 5TMFA 4XSXA 3RZOC 4LK0A 4BY7K 4A3BC 4C3IK 3HOZC 5M5XK 5M3FK 4YG2A 1TWFK 3GTQC 3HOXK 4BBRK 4A3JC 3RZDC 1R9TK 2B63K 2NVTK 4OIPA 2YU9C 3HOVC 2WAQD 3I4MC 1I6HC 2PPBA 3HOWC 4A3IC 2WB1D 4Y52C 4JK1A 5C44C 4A3MC 3S1RC 2O5IA 5IYBK 1TWHC 4KMUA 5C4JK 4A3KK 2JA7C 3GTOK 5IYCC 4OIQA 3GTPK 5IP9C 4A3DK 2E2JK 5IP7C 5FLMC 3S16K 4LJZA 3S15K 1Y1WK 4C2MK 2VUMK 2O5JA 1K83C 2R7ZC 4OIOA 3M4OC 1TWGC 1YNJA 3HOYK 1TWAK 5C3EC 3FKIC 3GTGC 2NVXC 2WB1L 4X6AK 4QJVA 4A3EK 2NVYC 2JA6C 3GTKK 2PA8D 4A3GC 2E2HC 4YFNA 4OIRA 4G7OA 1I3QK 4QIWD 1SFOC 2R92C 4A3CK 3PO3K 3I4NC 4A3LC 2E2IC 3S2HC 3S2DK 1TWFC 2A68A 1TWCK 3M3YC 3S1MC 2WAQL 4AYBD 3GTJK 3HOUC 2CW0A 3HOWK 2R93K 4C3HK 1SMYA 1ZYRA 3H0GC 3WODA 5C44K 4A3MK 4A93K 4A3KC 2JA7K 1WCMC 2JA5K 3S17C 4BBSK 4A3DC 3K7AC 5FLMK 5M5WK 4A3FC 2NVQK 3S15C 1I50C 2Y0SL 2VUMC 1K83K 3S14C 3S1QK 5IYDK 3HKZL 3CQZC 5TMCA 3RZOK 1TWGK 4A3BK 2JA8K
chains in the Genus database with same CATH superfamily
2GSOA 4XSZA 1J98A 3JSTA 1TWCA 2ZUEA 5M5YK 4Y52K 3GTQK 4DDQA 3S1NC 5IP9K 3HOVK 2P8TA 1I6HK 3OPFA 3L4JA 3S1RK 1O2AA 1O2FB 2R92A 1Y1VK 3VA7A 3GTMA 3GTMC 1WOPA 3BP8C 2CFAB 2GSUA 1G51A 3AQOA 2E2HK 1WQFA 1PJ7A 4A3EC 5CHPA 2A6EA 3QX3A 3HOYC 2XCOA 1O24A 3PO3C 5IYBC 4A3LK 5FJ8K 3A8KA 3M3YK 1VLOA 3GTQA 5EGHA 3AQPA 4KASA 4NOIA 4A3FK 3AD9C 1TWAC 4WILA 5M3MK 1XPPA 1Y1VC 3DXJA 2JA5C 4BXXK 2ZUFA 2PMZL 2NVXK 3TFJA 1O26A 2V6SA 2A6HA 1WCMA 4GZYA 3GTMK 3RZOC 4A3BC 4C3IK 4P5AA 5M5XK 4YG2A 3GTQC 3RZDC 2B63K 4G0WA 2NVTK 3HOVC 1X31C 4GTBA 3I4MC 1SFOA 1JQWA 3S1RC 5IYBK 1TWHC 4KARA 2PHCB 2GAGC 5FLMC 4LJZA 3S15K 1Y1WK 2O5JA 2VUMK 1K83C 2R7ZC 1TWGC 4XCHA 2CFAA 4KB4A 4M1XA 5TJ3A 3NUHA 2NVXC 4X6AK 3GDZA 1WORA 3FHZA 4YFNA 1VGXA 2R92C 3I4NC 1B4BA 1O2BA 1F93A 3M3YC 1YX2A 5E68A 4BKWA 2CW0A 3GEEA 1ZYRA 3N0CA 4KM8A 2JA5K 1IBAA 5FLMK 3S15C 3S1QK 2VUMC 1K83K 3S14C 5IYDK 3BP3A 5IOSA 3RZOK 4P5BA 1TWGK 2VUMA 3AH5A 1WSVA 3FKIK 4GTLA 4GT9A 3GEIA 2RGRA 3RZDK 2B63C 2NVTC 4C45A 4BY1K 5L46A 1F7VA 1ZQ1C 4KN7A 3H3VD 4LK1A 4GTDA 1AB4A 4A3IK 3GIRA 1Y1WC 1UV7A 1XZPA 4KDDA 2R7ZK 4AH6A 4FZBA 4YFKA 2E2HA 5C4XC 2E2JC 1I6VA 4C2MC 2PA8L 3GTPA 1DCHA 3S14K 4PABA 3MMLB 1K83A 1BJTA 4BBRC 3L4KA 1XZQB 1EFWA 4RMFA 3PO2K 2JA7A 4Y7NK 1I3QA 4KN4A 3S0XA 1J6XA 5CJ9A 3GTOC 4OINA 1R9TA 3S1MK 5IP7K 1VJEA 3S16C 1VRQC 3HKZD 3HOUK 3K7AK 1I50K 3T02A 4G7ZA 4XLNA 2PMZD 5IOQA 3GTKA 2JA8C 4A3GK 3CQZK 1TWAA 4LK0A 3AD7C 5M3FK 1TWFK 4BBRK 2E2IA 1F9NA 2D6FC 2WAQD 2R93A 4Y52C 5C44C 4A3MC 5C4JK 4KMUA 1DCOA 1XZPB 3IPJA 5IYCC 4OIQA 4A3DK 2E2JK 2W7VA 4OIOA 3M4OC 3OEPA 3HOYK 1YNJA 1C0AA 3GTGC 1WOSA 2WB1L 4KMDA 3ERED 3GTKK 2JH3A 3LPXA 3S2DK 1TWFC 3SZZA 1TWCK 2WAQL 1O27A 1BS2A 5JFEA 3GSIA 4C3HK 5C44K 1PJ6A 3WODA 4A3MK 4A3KC 1VH2A 2JA7K 4GTEA 3GTLA 4KMAA 2NVQK 2Y0SL 3CQZC 1YCLA 4J3NA 3HOXC 4XLPA 1R9TC 2GSNA 2XCRB 3GTOA 3H0GA 2YU9K 4C3IC 1I3QC 3GEHA 1IL2A 1O29A 3SZYA 5C4JC 3S2HK 4AYBL 1EK8A 2RH6A 4LLGA 5D4DA 4Q5SA 4BXXC 2NVYA 2JA6A 3N3YA 5C3EK 4QIWL 3FKIA 4MEYA 1WQHA 4MQ9A 1Y1WA 1IE0A 3FOFA 2FQTA 4KB2A 3S2DC 3AD8C 1XZQA 2R92K 3N0BA 1JOEA 2BE5A 1O25A 2V6TA 3H0GK 4QJVB 2YU9A 2B63A 1O28A 3H3VL 3S1NK 1WCMK 3GTJC 3FOEA 2NVQC 1HQMA 1KQ4A 4P9SA 2FQOA 4A93C 3S17K 4X6AC 1XXAA 1IW7A 4PAAA 1JVIA 2A69A 4LQYA 5IYDC 4BY7K 1J6WA 1DD5A 3G4CA 3GTJA 1XXCA 4LR2A 1I6HC 2WB1D 4O2DA 4WJ4A 4GTFA 1WSRA 2NVXA 1B4AA 1WQGA 1USMA 1F7UA 2R7ZA 1TWAK 3OREA 3FKIC 4KAWX 4A3EK 1ZXOA 4OIRA 1SFOC 4QIWD 3PO3K 4WJ3M 4A3LC 2E2IC 4AYBD 3GTJK 4G0VA 2R93K 2V6UA 3TFIA 3TFHA 4A93K 4BBSK 3S17C 3LAPA 5EGEA 1L0WA 3K7AC 3TTGA 1IQ0A 3T00A 5M5WK 1Y1VA 1I50C 1XXBA 3HKZL 5TMCA 4BY7C 4BLBA 1I50A 4A3BK 2GAHC 2JA8K 3LAJA 3GTLC 2Y0SD 3PO2C 1ISEA 4Y7NC 3T01A 4C3JK 4MEXA 3I4MK 3HOZK 1RU0A 1SFOK 1EI6A 4KMHA 1TWHK 2E2IK 1TWFA 3Q3QA 2Y3PA 1YNNA 3GTPC 1GE9A 3GTGA 1ZVUA 4FM9A 4ZH4A 3M4OK 1IS1A 3A8IA 1V5VA 2KWAA 3GTGK 4YFXA 4G7HA 4A3JK 3I4NK 4Q4ZA 3CAGA 2EBBA 1INNA 4BY1C 4A3CC 3BUEA 4GFQA 2R93C 5IYCK 1TWCC 4ILDA 4BBSC 3G4AA 1J6VA 4G0UA 4C3HC 3S1QC 1BDFA 3EQLA 5C4XK 2NVYK 2JA6K 3GTKC 3GTLK 5TMFA 4XSXA 4KATA 5IORA 4C3JC 3HOZC 5JVOA 1HI9A 3HOXK 4A3JC 3A8JA 1R9TK 4OIPA 2YU9C 1EQRA 1USOA 2PPBA 3HOWC 4A3IC 2O5IA 4JK1A 4A3KK 2JA7C 3GTOK 1WOOA 4KC6A 5IOTA 5IP9C 3GTPK 2XCQA 4BLAA 5IP7C 3S16K 4GTCA 4C2MK 1WIHA 1TWGA 5C3EC 3ADAC 1DCPA 4QJVA 2NVYC 2JA6C 2PA8D 1TWHA 4A3GC 2E2HC 4G7OA 1I3QK 4A3CK 3S2HC 1ZBSA 2A68A 3S1MC 2ZFZA 4GTAA 1BGWA 3V4GA 3HOUC 3HOWK 4KM9A 1SMYA 3H0GC 4LOWA 1WCMC 4A3DC 1EH1A 2JA5A 4A3FC 5HL8A 3CQZA 3HXAA 1PJ5A 2P5MA
chains in the Genus database with same CATH topology
3FKIK 4XSZA 3GTLC 3HOXC 4XLPA 3RZDK 2Y0SD 1R9TC 2B63C 4Y7NC 4BY1K 2NVTC 3PO2C 2YU9K 4C3JK 4MEXA 3I4MK 3HOZK 5M5YK 4KN7A 3H3VD 1I3QC 1SFOK 4Y52K 3GTQK 1TWHK 5C4JC 3S1NC 4LK1A 2E2IK 3S2HK 5IP9K 3HOVK 1I6HK 4AYBL 4A3IK 1Y1WC 3S1RK 1YNNA 2R7ZK 1Y1VK 4LLGA 4YFKA 5D4DA 4BXXC 3GTPC 4Q5SA 5C4XC 2E2JC 5C3EK 4QIWL 1I6VA 3GTMC 2PA8L 4MEYA 4ZH4A 3M4OK 4MQ9A 3S14K 2E2HK 3GTGK 4YFXA 4BBRC 4G7HA 4A3JK 3I4NK 4A3EC 2A6EA 3S2DC 4Q4ZA 3HOYC 3PO2K 4Y7NK 4BY1C 2R92K 4A3CC 4KN4A 3PO3C 5IYBC 2BE5A 4A3LK 5FJ8K 3GTOC 2R93C 5IYCK 4QJVB 4OINA 3H0GK 1TWCC 3M3YK 3S1MK 3H3VL 5IP7K 3S16C 4BY7C 3HKZD 3S1NK 1WCMK 4BBSC 3GTJC 3HOUK 3K7AK 4A3FK 4NOIA 1HQMA 1I50K 2NVQC 3S1QC 4G7ZA 1BDFA 1TWAC 3EQLA 2PMZD 1XPPA 1Y1VC 3DXJA 5M3MK 4XLNA 2JA5C 3S17K 4A93C 2NVXK 2PMZL 5C4XK 2JA8C 4BXXK 4X6AC 1IW7A 2A6HA 2NVYK 2JA6K 4GZYA 3GTKC 3GTLK 2A69A 4A3GK 3GTMK 5IYDC 3CQZK 5TMFA 4XSXA 3RZOC 4LK0A 4BY7K 4A3BC 4C3IK 3HOZC 5M5XK 5M3FK 4YG2A 1TWFK 3GTQC 3HOXK 4BBRK 4A3JC 3RZDC 1R9TK 2B63K 2NVTK 4OIPA 2YU9C 3HOVC 2WAQD 3I4MC 1I6HC 2PPBA 3HOWC 4A3IC 2WB1D 4Y52C 4JK1A 5C44C 4A3MC 3S1RC 2O5IA 5IYBK 1TWHC 4KMUA 5C4JK 4A3KK 2JA7C 3GTOK 5IYCC 4OIQA 3GTPK 5IP9C 4A3DK 2E2JK 5IP7C 5FLMC 3S16K 4LJZA 3S15K 1Y1WK 4C2MK 2VUMK 2O5JA 1K83C 2R7ZC 4OIOA 3M4OC 1TWGC 1YNJA 3HOYK 1TWAK 5C3EC 3FKIC 3GTGC 2NVXC 2WB1L 4X6AK 4QJVA 4A3EK 2NVYC 2JA6C 3GTKK 2PA8D 4A3GC 2E2HC 4YFNA 4OIRA 4G7OA 1I3QK 4QIWD 1SFOC 2R92C 4A3CK 3PO3K 3I4NC 4A3LC 2E2IC 3S2HC 3S2DK 1TWFC 2A68A 1TWCK 3M3YC 3S1MC 2WAQL 4AYBD 3GTJK 3HOUC 2CW0A 3HOWK 2R93K 4C3HK 1SMYA 1ZYRA 3H0GC 3WODA 5C44K 4A3MK 4A93K 4A3KC 2JA7K 1WCMC 2JA5K 3S17C 4BBSK 4A3DC 3K7AC 5FLMK 5M5WK 4A3FC 2NVQK 3S15C 1I50C 2Y0SL 2VUMC 1K83K 3S14C 3S1QK 5IYDK 3HKZL 3CQZC 5TMCA 3RZOK 1TWGK 4A3BK 2JA8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI K;  4XSZ A;  3GTL C;  3HOX C;  4XLP A;  3RZD K;  2Y0S D;  1R9T C;  2B63 C;  4Y7N C;  4BY1 K;  2NVT C;  3PO2 C;  2YU9 K;  4C3J K;  4MEX A;  3I4M K;  3HOZ K;  5M5Y K;  4KN7 A;  3H3V D;  1I3Q C;  1SFO K;  4Y52 K;  3GTQ K;  1TWH K;  5C4J C;  3S1N C;  4LK1 A;  2E2I K;  3S2H K;  5IP9 K;  3HOV K;  1I6H K;  4AYB L;  4A3I K;  1Y1W C;  3S1R K;  1YNN A;  2R7Z K;  1Y1V K;  4LLG A;  4YFK A;  5D4D A;  4BXX C;  3GTP C;  4Q5S A;  5C4X C;  2E2J C;  5C3E K;  4QIW L;  1I6V A;  3GTM C;  2PA8 L;  4MEY A;  4ZH4 A;  3M4O K;  4MQ9 A;  3S14 K;  2E2H K;  3GTG K;  4YFX A;  4BBR C;  4G7H A;  4A3J K;  3I4N K;  4A3E C;  2A6E A;  3S2D C;  4Q4Z A;  3HOY C;  3PO2 K;  4Y7N K;  4BY1 C;  2R92 K;  4A3C C;  4KN4 A;  3PO3 C;  5IYB C;  2BE5 A;  4A3L K;  5FJ8 K;  3GTO C;  2R93 C;  5IYC K;  4QJV B;  4OIN A;  3H0G K;  1TWC C;  3M3Y K;  3S1M K;  3H3V L;  5IP7 K;  3S16 C;  4BY7 C;  3HKZ D;  3S1N K;  1WCM K;  4BBS C;  3GTJ C;  3HOU K;  3K7A K;  4A3F K;  4NOI A;  1HQM A;  1I50 K;  2NVQ C;  3S1Q C;  4G7Z A;  1BDF A;  1TWA C;  3EQL A;  2PMZ D;  1XPP A;  1Y1V C;  3DXJ A;  5M3M K;  4XLN A;  2JA5 C;  3S17 K;  4A93 C;  2NVX K;  2PMZ L;  5C4X K;  2JA8 C;  4BXX K;  4X6A C;  1IW7 A;  2A6H A;  2NVY K;  2JA6 K;  4GZY A;  3GTK C;  3GTL K;  2A69 A;  4A3G K;  3GTM K;  5IYD C;  3CQZ K;  5TMF A;  4XSX A;  3RZO C;  4LK0 A;  4BY7 K;  4A3B C;  4C3I K;  3HOZ C;  5M5X K;  5M3F K;  4YG2 A;  1TWF K;  3GTQ C;  3HOX K;  4BBR K;  4A3J C;  3RZD C;  1R9T K;  2B63 K;  2NVT K;  4OIP A;  2YU9 C;  3HOV C;  2WAQ D;  3I4M C;  1I6H C;  2PPB A;  3HOW C;  4A3I C;  2WB1 D;  4Y52 C;  4JK1 A;  5C44 C;  4A3M C;  3S1R C;  2O5I A;  5IYB K;  1TWH C;  4KMU A;  5C4J K;  4A3K K;  2JA7 C;  3GTO K;  5IYC C;  4OIQ A;  3GTP K;  5IP9 C;  4A3D K;  2E2J K;  5IP7 C;  5FLM C;  3S16 K;  4LJZ A;  3S15 K;  1Y1W K;  4C2M K;  2VUM K;  2O5J A;  1K83 C;  2R7Z C;  4OIO A;  3M4O C;  1TWG C;  1YNJ A;  3HOY K;  1TWA K;  5C3E C;  3FKI C;  3GTG C;  2NVX C;  2WB1 L;  4X6A K;  4QJV A;  4A3E K;  2NVY C;  2JA6 C;  3GTK K;  2PA8 D;  4A3G C;  2E2H C;  4YFN A;  4OIR A;  4G7O A;  1I3Q K;  4QIW D;  1SFO C;  2R92 C;  4A3C K;  3PO3 K;  3I4N C;  4A3L C;  2E2I C;  3S2H C;  3S2D K;  1TWF C;  2A68 A;  1TWC K;  3M3Y C;  3S1M C;  2WAQ L;  4AYB D;  3GTJ K;  3HOU C;  2CW0 A;  3HOW K;  2R93 K;  4C3H K;  1SMY A;  1ZYR A;  3H0G C;  3WOD A;  5C44 K;  4A3M K;  4A93 K;  4A3K C;  2JA7 K;  1WCM C;  2JA5 K;  3S17 C;  4BBS K;  4A3D C;  3K7A C;  5FLM K;  5M5W K;  4A3F C;  2NVQ K;  3S15 C;  1I50 C;  2Y0S L;  2VUM C;  1K83 K;  3S14 C;  3S1Q K;  5IYD K;  3HKZ L;  3CQZ C;  5TMC A;  3RZO K;  1TWG K;  4A3B K;  2JA8 K; 
#chains in the Genus database with same CATH topology
 2GSO A;  4XSZ A;  1J98 A;  3JST A;  1TWC A;  2ZUE A;  5M5Y K;  4Y52 K;  3GTQ K;  4DDQ A;  3S1N C;  5IP9 K;  3HOV K;  2P8T A;  1I6H K;  3OPF A;  3L4J A;  3S1R K;  1O2A A;  1O2F B;  2R92 A;  1Y1V K;  3VA7 A;  3GTM A;  3GTM C;  1WOP A;  3BP8 C;  2CFA B;  2GSU A;  1G51 A;  3AQO A;  2E2H K;  1WQF A;  1PJ7 A;  4A3E C;  5CHP A;  2A6E A;  3QX3 A;  3HOY C;  2XCO A;  1O24 A;  3PO3 C;  5IYB C;  4A3L K;  5FJ8 K;  3A8K A;  3M3Y K;  1VLO A;  3GTQ A;  5EGH A;  3AQP A;  4KAS A;  4NOI A;  4A3F K;  3AD9 C;  1TWA C;  4WIL A;  5M3M K;  1XPP A;  1Y1V C;  3DXJ A;  2JA5 C;  4BXX K;  2ZUF A;  2PMZ L;  2NVX K;  3TFJ A;  1O26 A;  2V6S A;  2A6H A;  1WCM A;  4GZY A;  3GTM K;  3RZO C;  4A3B C;  4C3I K;  4P5A A;  5M5X K;  4YG2 A;  3GTQ C;  3RZD C;  2B63 K;  4G0W A;  2NVT K;  3HOV C;  1X31 C;  4GTB A;  3I4M C;  1SFO A;  1JQW A;  3S1R C;  5IYB K;  1TWH C;  4KAR A;  2PHC B;  2GAG C;  5FLM C;  4LJZ A;  3S15 K;  1Y1W K;  2O5J A;  2VUM K;  1K83 C;  2R7Z C;  1TWG C;  4XCH A;  2CFA A;  4KB4 A;  4M1X A;  5TJ3 A;  3NUH A;  2NVX C;  4X6A K;  3GDZ A;  1WOR A;  3FHZ A;  4YFN A;  1VGX A;  2R92 C;  3I4N C;  1B4B A;  1O2B A;  1F93 A;  3M3Y C;  1YX2 A;  5E68 A;  4BKW A;  2CW0 A;  3GEE A;  1ZYR A;  3N0C A;  4KM8 A;  2JA5 K;  1IBA A;  5FLM K;  3S15 C;  3S1Q K;  2VUM C;  1K83 K;  3S14 C;  5IYD K;  3BP3 A;  5IOS A;  3RZO K;  4P5B A;  1TWG K;  2VUM A;  3AH5 A;  1WSV A;  3FKI K;  4GTL A;  4GT9 A;  3GEI A;  2RGR A;  3RZD K;  2B63 C;  2NVT C;  4C45 A;  4BY1 K;  5L46 A;  1F7V A;  1ZQ1 C;  4KN7 A;  3H3V D;  4LK1 A;  4GTD A;  1AB4 A;  4A3I K;  3GIR A;  1Y1W C;  1UV7 A;  1XZP A;  4KDD A;  2R7Z K;  4AH6 A;  4FZB A;  4YFK A;  2E2H A;  5C4X C;  2E2J C;  1I6V A;  4C2M C;  2PA8 L;  3GTP A;  1DCH A;  3S14 K;  4PAB A;  3MML B;  1K83 A;  1BJT A;  4BBR C;  3L4K A;  1XZQ B;  1EFW A;  4RMF A;  3PO2 K;  2JA7 A;  4Y7N K;  1I3Q A;  4KN4 A;  3S0X A;  1J6X A;  5CJ9 A;  3GTO C;  4OIN A;  1R9T A;  3S1M K;  5IP7 K;  1VJE A;  3S16 C;  1VRQ C;  3HKZ D;  3HOU K;  3K7A K;  1I50 K;  3T02 A;  4G7Z A;  4XLN A;  2PMZ D;  5IOQ A;  3GTK A;  2JA8 C;  4A3G K;  3CQZ K;  1TWA A;  4LK0 A;  3AD7 C;  5M3F K;  1TWF K;  4BBR K;  2E2I A;  1F9N A;  2D6F C;  2WAQ D;  2R93 A;  4Y52 C;  5C44 C;  4A3M C;  5C4J K;  4KMU A;  1DCO A;  1XZP B;  3IPJ A;  5IYC C;  4OIQ A;  4A3D K;  2E2J K;  2W7V A;  4OIO A;  3M4O C;  3OEP A;  3HOY K;  1YNJ A;  1C0A A;  3GTG C;  1WOS A;  2WB1 L;  4KMD A;  3ERE D;  3GTK K;  2JH3 A;  3LPX A;  3S2D K;  1TWF C;  3SZZ A;  1TWC K;  2WAQ L;  1O27 A;  1BS2 A;  5JFE A;  3GSI A;  4C3H K;  5C44 K;  1PJ6 A;  3WOD A;  4A3M K;  4A3K C;  1VH2 A;  2JA7 K;  4GTE A;  3GTL A;  4KMA A;  2NVQ K;  2Y0S L;  3CQZ C;  1YCL A;  4J3N A;  3HOX C;  4XLP A;  1R9T C;  2GSN A;  2XCR B;  3GTO A;  3H0G A;  2YU9 K;  4C3I C;  1I3Q C;  3GEH A;  1IL2 A;  1O29 A;  3SZY A;  5C4J C;  3S2H K;  4AYB L;  1EK8 A;  2RH6 A;  4LLG A;  5D4D A;  4Q5S A;  4BXX C;  2NVY A;  2JA6 A;  3N3Y A;  5C3E K;  4QIW L;  3FKI A;  4MEY A;  1WQH A;  4MQ9 A;  1Y1W A;  1IE0 A;  3FOF A;  2FQT A;  4KB2 A;  3S2D C;  3AD8 C;  1XZQ A;  2R92 K;  3N0B A;  1JOE A;  2BE5 A;  1O25 A;  2V6T A;  3H0G K;  4QJV B;  2YU9 A;  2B63 A;  1O28 A;  3H3V L;  3S1N K;  1WCM K;  3GTJ C;  3FOE A;  2NVQ C;  1HQM A;  1KQ4 A;  4P9S A;  2FQO A;  4A93 C;  3S17 K;  4X6A C;  1XXA A;  1IW7 A;  4PAA A;  1JVI A;  2A69 A;  4LQY A;  5IYD C;  4BY7 K;  1J6W A;  1DD5 A;  3G4C A;  3GTJ A;  1XXC A;  4LR2 A;  1I6H C;  2WB1 D;  4O2D A;  4WJ4 A;  4GTF A;  1WSR A;  2NVX A;  1B4A A;  1WQG A;  1USM A;  1F7U A;  2R7Z A;  1TWA K;  3ORE A;  3FKI C;  4KAW X;  4A3E K;  1ZXO A;  4OIR A;  1SFO C;  4QIW D;  3PO3 K;  4WJ3 M;  4A3L C;  2E2I C;  4AYB D;  3GTJ K;  4G0V A;  2R93 K;  2V6U A;  3TFI A;  3TFH A;  4A93 K;  4BBS K;  3S17 C;  3LAP A;  5EGE A;  1L0W A;  3K7A C;  3TTG A;  1IQ0 A;  3T00 A;  5M5W K;  1Y1V A;  1I50 C;  1XXB A;  3HKZ L;  5TMC A;  4BY7 C;  4BLB A;  1I50 A;  4A3B K;  2GAH C;  2JA8 K;  3LAJ A;  3GTL C;  2Y0S D;  3PO2 C;  1ISE A;  4Y7N C;  3T01 A;  4C3J K;  4MEX A;  3I4M K;  3HOZ K;  1RU0 A;  1SFO K;  1EI6 A;  4KMH A;  1TWH K;  2E2I K;  1TWF A;  3Q3Q A;  2Y3P A;  1YNN A;  3GTP C;  1GE9 A;  3GTG A;  1ZVU A;  4FM9 A;  4ZH4 A;  3M4O K;  1IS1 A;  3A8I A;  1V5V A;  2KWA A;  3GTG K;  4YFX A;  4G7H A;  4A3J K;  3I4N K;  4Q4Z A;  3CAG A;  2EBB A;  1INN A;  4BY1 C;  4A3C C;  3BUE A;  4GFQ A;  2R93 C;  5IYC K;  1TWC C;  4ILD A;  4BBS C;  3G4A A;  1J6V A;  4G0U A;  4C3H C;  3S1Q C;  1BDF A;  3EQL A;  5C4X K;  2NVY K;  2JA6 K;  3GTK C;  3GTL K;  5TMF A;  4XSX A;  4KAT A;  5IOR A;  4C3J C;  3HOZ C;  5JVO A;  1HI9 A;  3HOX K;  4A3J C;  3A8J A;  1R9T K;  4OIP A;  2YU9 C;  1EQR A;  1USO A;  2PPB A;  3HOW C;  4A3I C;  2O5I A;  4JK1 A;  4A3K K;  2JA7 C;  3GTO K;  1WOO A;  4KC6 A;  5IOT A;  5IP9 C;  3GTP K;  2XCQ A;  4BLA A;  5IP7 C;  3S16 K;  4GTC A;  4C2M K;  1WIH A;  1TWG A;  5C3E C;  3ADA C;  1DCP A;  4QJV A;  2NVY C;  2JA6 C;  2PA8 D;  1TWH A;  4A3G C;  2E2H C;  4G7O A;  1I3Q K;  4A3C K;  3S2H C;  1ZBS A;  2A68 A;  3S1M C;  2ZFZ A;  4GTA A;  1BGW A;  3V4G A;  3HOU C;  3HOW K;  4KM9 A;  1SMY A;  3H0G C;  4LOW A;  1WCM C;  4A3D C;  1EH1 A;  2JA5 A;  4A3F C;  5HL8 A;  3CQZ A;  3HXA A;  1PJ5 A;  2P5M A; 
#chains in the Genus database with same CATH homology
 3FKI K;  4XSZ A;  3GTL C;  3HOX C;  4XLP A;  3RZD K;  2Y0S D;  1R9T C;  2B63 C;  4Y7N C;  4BY1 K;  2NVT C;  3PO2 C;  2YU9 K;  4C3J K;  4MEX A;  3I4M K;  3HOZ K;  5M5Y K;  4KN7 A;  3H3V D;  1I3Q C;  1SFO K;  4Y52 K;  3GTQ K;  1TWH K;  5C4J C;  3S1N C;  4LK1 A;  2E2I K;  3S2H K;  5IP9 K;  3HOV K;  1I6H K;  4AYB L;  4A3I K;  1Y1W C;  3S1R K;  1YNN A;  2R7Z K;  1Y1V K;  4LLG A;  4YFK A;  5D4D A;  4BXX C;  3GTP C;  4Q5S A;  5C4X C;  2E2J C;  5C3E K;  4QIW L;  1I6V A;  3GTM C;  2PA8 L;  4MEY A;  4ZH4 A;  3M4O K;  4MQ9 A;  3S14 K;  2E2H K;  3GTG K;  4YFX A;  4BBR C;  4G7H A;  4A3J K;  3I4N K;  4A3E C;  2A6E A;  3S2D C;  4Q4Z A;  3HOY C;  3PO2 K;  4Y7N K;  4BY1 C;  2R92 K;  4A3C C;  4KN4 A;  3PO3 C;  5IYB C;  2BE5 A;  4A3L K;  5FJ8 K;  3GTO C;  2R93 C;  5IYC K;  4QJV B;  4OIN A;  3H0G K;  1TWC C;  3M3Y K;  3S1M K;  3H3V L;  5IP7 K;  3S16 C;  4BY7 C;  3HKZ D;  3S1N K;  1WCM K;  4BBS C;  3GTJ C;  3HOU K;  3K7A K;  4A3F K;  4NOI A;  1HQM A;  1I50 K;  2NVQ C;  3S1Q C;  4G7Z A;  1BDF A;  1TWA C;  3EQL A;  2PMZ D;  1XPP A;  1Y1V C;  3DXJ A;  5M3M K;  4XLN A;  2JA5 C;  3S17 K;  4A93 C;  2NVX K;  2PMZ L;  5C4X K;  2JA8 C;  4BXX K;  4X6A C;  1IW7 A;  2A6H A;  2NVY K;  2JA6 K;  4GZY A;  3GTK C;  3GTL K;  2A69 A;  4A3G K;  3GTM K;  5IYD C;  3CQZ K;  5TMF A;  4XSX A;  3RZO C;  4LK0 A;  4BY7 K;  4A3B C;  4C3I K;  3HOZ C;  5M5X K;  5M3F K;  4YG2 A;  1TWF K;  3GTQ C;  3HOX K;  4BBR K;  4A3J C;  3RZD C;  1R9T K;  2B63 K;  2NVT K;  4OIP A;  2YU9 C;  3HOV C;  2WAQ D;  3I4M C;  1I6H C;  2PPB A;  3HOW C;  4A3I C;  2WB1 D;  4Y52 C;  4JK1 A;  5C44 C;  4A3M C;  3S1R C;  2O5I A;  5IYB K;  1TWH C;  4KMU A;  5C4J K;  4A3K K;  2JA7 C;  3GTO K;  5IYC C;  4OIQ A;  3GTP K;  5IP9 C;  4A3D K;  2E2J K;  5IP7 C;  5FLM C;  3S16 K;  4LJZ A;  3S15 K;  1Y1W K;  4C2M K;  2VUM K;  2O5J A;  1K83 C;  2R7Z C;  4OIO A;  3M4O C;  1TWG C;  1YNJ A;  3HOY K;  1TWA K;  5C3E C;  3FKI C;  3GTG C;  2NVX C;  2WB1 L;  4X6A K;  4QJV A;  4A3E K;  2NVY C;  2JA6 C;  3GTK K;  2PA8 D;  4A3G C;  2E2H C;  4YFN A;  4OIR A;  4G7O A;  1I3Q K;  4QIW D;  1SFO C;  2R92 C;  4A3C K;  3PO3 K;  3I4N C;  4A3L C;  2E2I C;  3S2H C;  3S2D K;  1TWF C;  2A68 A;  1TWC K;  3M3Y C;  3S1M C;  2WAQ L;  4AYB D;  3GTJ K;  3HOU C;  2CW0 A;  3HOW K;  2R93 K;  4C3H K;  1SMY A;  1ZYR A;  3H0G C;  3WOD A;  5C44 K;  4A3M K;  4A93 K;  4A3K C;  2JA7 K;  1WCM C;  2JA5 K;  3S17 C;  4BBS K;  4A3D C;  3K7A C;  5FLM K;  5M5W K;  4A3F C;  2NVQ K;  3S15 C;  1I50 C;  2Y0S L;  2VUM C;  1K83 K;  3S14 C;  3S1Q K;  5IYD K;  3HKZ L;  3CQZ C;  5TMC A;  3RZO K;  1TWG K;  4A3B K;  2JA8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...