3CQZK

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3cqzK00
4QJVB 3GTJK 3S1QC 5C4XC 1TWHC 2A69A 4XSZA 3PO2K 4A3BK 5M5XK 1TWCK 1WCMK 3HKZL 5IYCC 1Y1WK 2E2IC 2E2HK 3PO3K 3S1QK 1TWHK 4BBRC 3H0GC 3WODA 5IYDC 5IYCK 2E2IK 3S1MC 4LJZA 2JA7C 4BBRK 3H0GK 4OIOA 2VUMC 3S1MK 5IYDK 4LK1A 5IYBK 4A3JC 2JA7K 5TMFA 3GTOC 3GTMC 4A3KK 4KMUA 2VUMK 1I3QC 3S1NC 2Y0SL 3S14C 3GTMK 4A3JK 2NVYC 3GTOK 3HOUC 3S1NK 1I3QK 3HOXC 3GTGC 3H3VD 3M4OC 4BY1C 3S2DC 3M3YC 3HOUK 3S14K 2NVYK 1TWAC 4ZH4A 3K7AC 2R93C 1I6HC 4AYBL 4XSXA 3HOXK 4MEXA 3GTGK 3RZOC 4BY1K 2R93K 1TWAK 4MQ9A 2PA8L 3K7AK 5C4XK 2E2JC 5M5YK 3I4MC 3RZOK 1I6HK 2JA8C 4A3MC 4YFKA 3I4MK 3PO2C 2E2JK 5C4JC 3I4NC 2JA8K 4A3MK 2E2HC 2R7ZC 4A3GC 2PPBA 2PMZL 4QJVA 4A3IC 5C4JK 3I4NK 2R7ZK 4A3GK 4KN4A 3HOVC 4A3IK 2B63C 2NVTC 3CQZC 1K83C 5IYBC 4A3FC 4G7ZA 1IW7A 3HOVK 4A3KC 2WB1L 2A6HA 2B63K 2NVTK 3CQZK 1K83K 4A3FK 4YFNA 1Y1VC 2O5IA 3S16C 4BXXC 2WAQL 4QIWL 3S16K 1Y1VK 4YFXA 4BXXK 1XPPA 1ZYRA 4BBSC 2NVXC 3S2HC 4G7HA 5C44C 4Y52C 4BBSK 4LK0A 2NVXK 3S2HK 5C44K 4Y52K 2JA6C 2YU9C 3HKZD 4A3EK 5C3EC 5M3FK 2CW0A 3S1RC 3GTLC 3EQLA 4XLNA 2YU9K 2JA6K 5C3EK 3S1RK 3FKIK 3GTLK 2JA5C 4X6AC 3GTKK 1YNNA 3GTPC 3HOZC 5IP9C 2JA5K 2Y0SD 1I50K 1YNJA 3HOZK 3GTPK 5IP9K 5D4DA 4A3DK 4A3CC 4Y7NC 4AYBD 4A3LC 4BY7C 4YG2A 4A3CK 2A6EA 2PA8D 4Y7NK 4OIQA 4XLPA 5M3MK 3S17C 3H3VL 4A3LK 4BY7K 5M5WK 4OIRA 3S17K 2NVQC 4Q5SA 4JK1A 4A3EC 3PO3C 2R92C 1SFOC 1TWGC 2PMZD 4C3IK 4LLGA 4Q4ZA 2NVQK 3HOWC 2O5JA 2R92K 1SFOK 1TWGK 3FKIC 3HOWK 4A93C 3GTKC 1HQMA 4KN7A 1BDFA 1R9TC 4G7OA 2WB1D 2A68A 1I6VA 4A93K 1I50C 5IP7C 2BE5A 4NOIA 4C3HK 1R9TK 1SMYA 3RZDC 2WAQD 3S15C 4QIWD 4C3JK 5IP7K 3HOYC 4A3DC 3GTQC 3RZDK 3S15K 1TWFC 3HOYK 4OIPA 4GZYA 3GTQK 4X6AK 4C2MK 3S2DK 1TWFK 3M4OK 3DXJA 4OINA 5TMCA 3M3YK 5FLMC 4MEYA 3GTJC 5FJ8K 4A3BC 5FLMK 1Y1WC 1TWCC 1WCMC
chains in the Genus database with same CATH superfamily
1ZQ1C 3PO2K 1Y1WK 1TWCK 5HL8A 1IL2A 3S1QK 1HI9A 3GTOA 1TWHK 3S0XA 3H0GC 1O28A 1I3QA 2VUMC 1ZVUA 1XZPB 3GTMC 4A3JC 5TMFA 1TWAA 4KMUA 2Y0SL 3GTOK 1I3QK 3GEHA 3M3YC 2NVYK 4ZH4A 1J98A 3G4CA 1G51A 3K7AC 4XSXA 3GTGK 3JSTA 1TWAK 3I4MC 1I6HK 3CAGA 5EGHA 4A3MC 3OPFA 4KMDA 2B63A 2E2HC 3CQZA 1O27A 2PPBA 4QJVA 5C4JK 4M1XA 3IPJA 4KN4A 4A3FC 1K83C 5IYBC 3HOVK 2WB1L 2B63K 3CQZK 1EK8A 2NVXA 4KC6A 1XZQA 4BBSC 1EQRA 4G7HA 2GSUA 5C44C 1J6XA 1F93A 2NVXK 4GTEA 3HKZD 2YU9C 5JFEA 5C3EC 5M3FK 4G0WA 3GTPA 4GT9A 3GTLC 3T02A 4PABA 3OEPA 3AH5A 3L4JA 3SZYA 5IP9K 3FHZA 5D4DA 3GTPK 2W7VA 3N0CA 1JQWA 4AYBD 4A3LC 1TWGA 3S17K 3FKIA 2NVQC 4Q5SA 4JK1A 4A3EC 3FOFA 2R92C 1SFOC 2PMZD 4LLGA 2JA5A 1I50A 1TWGK 1J6WA 1O25A 4A93C 3GTKC 4G7OA 2A68A 5CHPA 2GSNA 4C3JC 4C3HK 1SMYA 4J3NA 1JVIA 1X31C 2XCQA 3RZDK 3S15K 1WOOA 3HOYK 4OIPA 3GTQK 3A8IA 3M3YK 5FLMC 1EH1A 4BKWA 2E2IA 5FJ8K 4A3BC 4GTDA 1WCMC 4QJVB 2A69A 3HKZL 2E2HK 1ZBSA 3MMLB 3WODA 5IYCK 2E2IK 4LJZA 4BBRK 5IYDK 3S1MK 5TJ3A 5IYBK 2JA7K 2R93A 3QX3A 5EGEA 3S14C 2PHCB 1XZQB 1WQHA 3S1NK 4C2MC 3HOXC 3S2DC 4BY1C 3HOUK 4X6AC 1ISEA 4AYBL 1AB4A 1Y1WA 4C45A 1PJ6A 2R93K 2P5MA 5C4XK 3RZOK 5JVOA 4YFKA 3FOEA 4O2DA 2E2JK 1XXBA 2JA8K 2R7ZC 1ZXOA 1WQFA 2PMZL 3I4NK 2V6UA 3GEIA 4A3GK 1VGXA 1XXAA 4A3IK 2ZFZA 3OREA 2XCOA 2NVTC 4G7ZA 2NVYA 3GTGA 5IOTA 1F9NA 1IQ0A 4BXXC 1YCLA 3S16K 1DCPA 1Y1VK 1B4BA 2JA6A 1L0WA 1INNA 3A8KA 3S2HC 1XXCA 4Y52C 3TFJA 3T00A 4KAWX 2V6TA 4XCHA 4A3EK 1IS1A 3S1RC 3HXAA 3EQLA 2JA6K 1PJ5A 2XCRB 1VJEA 2JA5C 3GTKK 1YNNA 1USMA 3A8JA 5L46A 3HOZK 4RMFA 3TTGA 4Y7NC 4WJ4A 3Q3QA 4BY7C 4A3CK 2A6EA 1WQGA 5CJ9A 2FQTA 1YX2A 4KM9A 3ERED 4PAAA 5IOQA 4Q4ZA 2EBBA 1VRQC 3HOWK 1HQMA 4KN7A 1BGWA 1R9TC 4BLAA 5IP7C 3G4AA 2ZUFA 4NOIA 3LAPA 2GAHC 2WAQD 3BP3A 4P9SA 4A3DC 4FZBA 4KARA 1TWFC 1C0AA 4GZYA 3GTJA 4C2MK 3S2DK 1USOA 2CFAA 4C3IC 1Y1WC 1TWCC 3ADAC 1IBAA 3S1QC 3GTJK 1TWHC 2VUMA 5M5XK 3PO3K 3AD8C 3GTQA 3H0GK 1DCOA 4LK1A 3GTOC 1WIHA 1XZPA 4KB4A 2VUMK 1I3QC 1KQ4A 3GEEA 4A3JK 2NVYC 3GTMK 3GTGC 1WOSA 3H3VD 3BP8C 3M4OC 2RH6A 1TWAC 1I6HC 4P5AA 4MEXA 3SZZA 2E2HA 3GSIA 3K7AK 1UV7A 5M5YK 3I4MK 3L4KA 5C4JC 4A3MK 2JA7A 3AQPA 3GIRA 3HOVC 5IOSA 2B63C 3CQZC 4KMHA 1IW7A 4A3KC 2A6HA 4A3FK 1K83K 5E68A 4G0UA 4LOWA 2WAQL 1JOEA 4YFXA 1XPPA 4GTAA 2V6SA 2YU9A 2NVXC 4KATA 4BLBA 1F7UA 4BBSK 1WORA 4LK0A 5C44K 4GTBA 3V4GA 1O2BA 1WSVA 1O2AA 4P5BA 4WJ3M 4XLNA 2YU9K 4WILA 2FQOA 5C3EK 1GE9A 3GTLK 1DD5A 1Y1VA 3GTPC 5IP9C 1BJTA 4GTCA 3T01A 4A3DK 1EI6A 2CFAB 4YG2A 2PA8D 3S17C 4A3LK 3H3VL 4OIRA 3GTKA 1TWGC 4C3IK 2D6FC 2NVQK 3TFHA 3AD7C 2R92K 1SFOK 3FKIC 1O24A 4C3HC 1BDFA 1WOPA 4A93K 1I50C 2BE5A 4LR2A 3LPXA 3RZDC 3S15C 3N0BA 4QIWD 4C3JK 3HOYC 3GTQC 3M4OK 1WCMA 4OINA 4MEYA 5FLMK 4XSZA 4A3BK 5IYCC 2E2IC 1WCMK 4BBRC 5IYDC 3S1MC 2JA7C 1O29A 4DDQA 4OIOA 2ZUEA 2GSOA 4KASA 3S1NC 4A3KK 3HOUC 3AQOA 3S14K 2R93C 5C4XC 3LAJA 3RZOC 3HOXK 4BY1K 2R7ZA 1WSRA 4MQ9A 4X6AK 2PA8L 2E2JC 2JA8C 1PJ7A 1VH2A 4KDDA 3PO2C 3I4NC 3H0GA 2KWAA 4A3GC 4A3IC 1F7VA 2R7ZK 1J6VA 3GTMA 2NVTK 2O5IA 3S16C 4YFNA 1Y1VC 3AD9C 4FM9A 3NUHA 4QIWL 4BXXK 1ZYRA 2RGRA 1DCHA 3N3YA 2P8TA 1BS2A 1O2FB 3BUEA 3S2HK 4Y52K 2JA6C 2CW0A 4KB2A 1K83A 4AH6A 3S1RK 3FKIK 1RU0A 3HOZC 4GTFA 2JA5K 2Y0SD 1I50K 1YNJA 2Y3PA 1V5VA 4A3CC 4ILDA 4Y7NK 4OIQA 4XLPA 5M3MK 4BY7K 5M5WK 3GTLA 4GFQA 4KMAA 1R9TA 1IE0A 3HOWC 2O5JA 4KM8A 3VA7A 4GTLA 2WB1D 1I6VA 3GDZA 1TWFA 1R9TK 2GAGC 4G0VA 5IP7K 1O26A 5IORA 3TFIA 2JH3A 1B4AA 1TWFK 1TWCA 3DXJA 1SFOA 5TMCA 2R92A 1VLOA 1TWHA 4LQYA 3GTJC 1EFWA 3PO3C
chains in the Genus database with same CATH topology
4QJVB 3GTJK 3S1QC 5C4XC 1TWHC 2A69A 4XSZA 3PO2K 4A3BK 5M5XK 1TWCK 1WCMK 3HKZL 5IYCC 1Y1WK 2E2IC 2E2HK 3PO3K 3S1QK 1TWHK 4BBRC 3H0GC 3WODA 5IYDC 5IYCK 2E2IK 3S1MC 4LJZA 2JA7C 4BBRK 3H0GK 4OIOA 2VUMC 3S1MK 5IYDK 4LK1A 5IYBK 4A3JC 2JA7K 5TMFA 3GTOC 3GTMC 4A3KK 4KMUA 2VUMK 1I3QC 3S1NC 2Y0SL 3S14C 3GTMK 4A3JK 2NVYC 3GTOK 3HOUC 3S1NK 1I3QK 3HOXC 3GTGC 3H3VD 3M4OC 4BY1C 3S2DC 3M3YC 3HOUK 3S14K 2NVYK 1TWAC 4ZH4A 3K7AC 2R93C 1I6HC 4AYBL 4XSXA 3HOXK 4MEXA 3GTGK 3RZOC 4BY1K 2R93K 1TWAK 4MQ9A 2PA8L 3K7AK 5C4XK 2E2JC 5M5YK 3I4MC 3RZOK 1I6HK 2JA8C 4A3MC 4YFKA 3I4MK 3PO2C 2E2JK 5C4JC 3I4NC 2JA8K 4A3MK 2E2HC 2R7ZC 4A3GC 2PPBA 2PMZL 4QJVA 4A3IC 5C4JK 3I4NK 2R7ZK 4A3GK 4KN4A 3HOVC 4A3IK 2B63C 2NVTC 3CQZC 1K83C 5IYBC 4A3FC 4G7ZA 1IW7A 3HOVK 4A3KC 2WB1L 2A6HA 2B63K 2NVTK 3CQZK 1K83K 4A3FK 4YFNA 1Y1VC 2O5IA 3S16C 4BXXC 2WAQL 4QIWL 3S16K 1Y1VK 4YFXA 4BXXK 1XPPA 1ZYRA 4BBSC 2NVXC 3S2HC 4G7HA 5C44C 4Y52C 4BBSK 4LK0A 2NVXK 3S2HK 5C44K 4Y52K 2JA6C 2YU9C 3HKZD 4A3EK 5C3EC 5M3FK 2CW0A 3S1RC 3GTLC 3EQLA 4XLNA 2YU9K 2JA6K 5C3EK 3S1RK 3FKIK 3GTLK 2JA5C 4X6AC 3GTKK 1YNNA 3GTPC 3HOZC 5IP9C 2JA5K 2Y0SD 1I50K 1YNJA 3HOZK 3GTPK 5IP9K 5D4DA 4A3DK 4A3CC 4Y7NC 4AYBD 4A3LC 4BY7C 4YG2A 4A3CK 2A6EA 2PA8D 4Y7NK 4OIQA 4XLPA 5M3MK 3S17C 3H3VL 4A3LK 4BY7K 5M5WK 4OIRA 3S17K 2NVQC 4Q5SA 4JK1A 4A3EC 3PO3C 2R92C 1SFOC 1TWGC 2PMZD 4C3IK 4LLGA 4Q4ZA 2NVQK 3HOWC 2O5JA 2R92K 1SFOK 1TWGK 3FKIC 3HOWK 4A93C 3GTKC 1HQMA 4KN7A 1BDFA 1R9TC 4G7OA 2WB1D 2A68A 1I6VA 4A93K 1I50C 5IP7C 2BE5A 4NOIA 4C3HK 1R9TK 1SMYA 3RZDC 2WAQD 3S15C 4QIWD 4C3JK 5IP7K 3HOYC 4A3DC 3GTQC 3RZDK 3S15K 1TWFC 3HOYK 4OIPA 4GZYA 3GTQK 4X6AK 4C2MK 3S2DK 1TWFK 3M4OK 3DXJA 4OINA 5TMCA 3M3YK 5FLMC 4MEYA 3GTJC 5FJ8K 4A3BC 5FLMK 1Y1WC 1TWCC 1WCMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJV B;  3GTJ K;  3S1Q C;  5C4X C;  1TWH C;  2A69 A;  4XSZ A;  3PO2 K;  4A3B K;  5M5X K;  1TWC K;  1WCM K;  3HKZ L;  5IYC C;  1Y1W K;  2E2I C;  2E2H K;  3PO3 K;  3S1Q K;  1TWH K;  4BBR C;  3H0G C;  3WOD A;  5IYD C;  5IYC K;  2E2I K;  3S1M C;  4LJZ A;  2JA7 C;  4BBR K;  3H0G K;  4OIO A;  2VUM C;  3S1M K;  5IYD K;  4LK1 A;  5IYB K;  4A3J C;  2JA7 K;  5TMF A;  3GTO C;  3GTM C;  4A3K K;  4KMU A;  2VUM K;  1I3Q C;  3S1N C;  2Y0S L;  3S14 C;  3GTM K;  4A3J K;  2NVY C;  3GTO K;  3HOU C;  3S1N K;  1I3Q K;  3HOX C;  3GTG C;  3H3V D;  3M4O C;  4BY1 C;  3S2D C;  3M3Y C;  3HOU K;  3S14 K;  2NVY K;  1TWA C;  4ZH4 A;  3K7A C;  2R93 C;  1I6H C;  4AYB L;  4XSX A;  3HOX K;  4MEX A;  3GTG K;  3RZO C;  4BY1 K;  2R93 K;  1TWA K;  4MQ9 A;  2PA8 L;  3K7A K;  5C4X K;  2E2J C;  5M5Y K;  3I4M C;  3RZO K;  1I6H K;  2JA8 C;  4A3M C;  4YFK A;  3I4M K;  3PO2 C;  2E2J K;  5C4J C;  3I4N C;  2JA8 K;  4A3M K;  2E2H C;  2R7Z C;  4A3G C;  2PPB A;  2PMZ L;  4QJV A;  4A3I C;  5C4J K;  3I4N K;  2R7Z K;  4A3G K;  4KN4 A;  3HOV C;  4A3I K;  2B63 C;  2NVT C;  3CQZ C;  1K83 C;  5IYB C;  4A3F C;  4G7Z A;  1IW7 A;  3HOV K;  4A3K C;  2WB1 L;  2A6H A;  2B63 K;  2NVT K;  3CQZ K;  1K83 K;  4A3F K;  4YFN A;  1Y1V C;  2O5I A;  3S16 C;  4BXX C;  2WAQ L;  4QIW L;  3S16 K;  1Y1V K;  4YFX A;  4BXX K;  1XPP A;  1ZYR A;  4BBS C;  2NVX C;  3S2H C;  4G7H A;  5C44 C;  4Y52 C;  4BBS K;  4LK0 A;  2NVX K;  3S2H K;  5C44 K;  4Y52 K;  2JA6 C;  2YU9 C;  3HKZ D;  4A3E K;  5C3E C;  5M3F K;  2CW0 A;  3S1R C;  3GTL C;  3EQL A;  4XLN A;  2YU9 K;  2JA6 K;  5C3E K;  3S1R K;  3FKI K;  3GTL K;  2JA5 C;  4X6A C;  3GTK K;  1YNN A;  3GTP C;  3HOZ C;  5IP9 C;  2JA5 K;  2Y0S D;  1I50 K;  1YNJ A;  3HOZ K;  3GTP K;  5IP9 K;  5D4D A;  4A3D K;  4A3C C;  4Y7N C;  4AYB D;  4A3L C;  4BY7 C;  4YG2 A;  4A3C K;  2A6E A;  2PA8 D;  4Y7N K;  4OIQ A;  4XLP A;  5M3M K;  3S17 C;  3H3V L;  4A3L K;  4BY7 K;  5M5W K;  4OIR A;  3S17 K;  2NVQ C;  4Q5S A;  4JK1 A;  4A3E C;  3PO3 C;  2R92 C;  1SFO C;  1TWG C;  2PMZ D;  4C3I K;  4LLG A;  4Q4Z A;  2NVQ K;  3HOW C;  2O5J A;  2R92 K;  1SFO K;  1TWG K;  3FKI C;  3HOW K;  4A93 C;  3GTK C;  1HQM A;  4KN7 A;  1BDF A;  1R9T C;  4G7O A;  2WB1 D;  2A68 A;  1I6V A;  4A93 K;  1I50 C;  5IP7 C;  2BE5 A;  4NOI A;  4C3H K;  1R9T K;  1SMY A;  3RZD C;  2WAQ D;  3S15 C;  4QIW D;  4C3J K;  5IP7 K;  3HOY C;  4A3D C;  3GTQ C;  3RZD K;  3S15 K;  1TWF C;  3HOY K;  4OIP A;  4GZY A;  3GTQ K;  4X6A K;  4C2M K;  3S2D K;  1TWF K;  3M4O K;  3DXJ A;  4OIN A;  5TMC A;  3M3Y K;  5FLM C;  4MEY A;  3GTJ C;  5FJ8 K;  4A3B C;  5FLM K;  1Y1W C;  1TWC C;  1WCM C; 
#chains in the Genus database with same CATH topology
 1ZQ1 C;  3PO2 K;  1Y1W K;  1TWC K;  5HL8 A;  1IL2 A;  3S1Q K;  1HI9 A;  3GTO A;  1TWH K;  3S0X A;  3H0G C;  1O28 A;  1I3Q A;  2VUM C;  1ZVU A;  1XZP B;  3GTM C;  4A3J C;  5TMF A;  1TWA A;  4KMU A;  2Y0S L;  3GTO K;  1I3Q K;  3GEH A;  3M3Y C;  2NVY K;  4ZH4 A;  1J98 A;  3G4C A;  1G51 A;  3K7A C;  4XSX A;  3GTG K;  3JST A;  1TWA K;  3I4M C;  1I6H K;  3CAG A;  5EGH A;  4A3M C;  3OPF A;  4KMD A;  2B63 A;  2E2H C;  3CQZ A;  1O27 A;  2PPB A;  4QJV A;  5C4J K;  4M1X A;  3IPJ A;  4KN4 A;  4A3F C;  1K83 C;  5IYB C;  3HOV K;  2WB1 L;  2B63 K;  3CQZ K;  1EK8 A;  2NVX A;  4KC6 A;  1XZQ A;  4BBS C;  1EQR A;  4G7H A;  2GSU A;  5C44 C;  1J6X A;  1F93 A;  2NVX K;  4GTE A;  3HKZ D;  2YU9 C;  5JFE A;  5C3E C;  5M3F K;  4G0W A;  3GTP A;  4GT9 A;  3GTL C;  3T02 A;  4PAB A;  3OEP A;  3AH5 A;  3L4J A;  3SZY A;  5IP9 K;  3FHZ A;  5D4D A;  3GTP K;  2W7V A;  3N0C A;  1JQW A;  4AYB D;  4A3L C;  1TWG A;  3S17 K;  3FKI A;  2NVQ C;  4Q5S A;  4JK1 A;  4A3E C;  3FOF A;  2R92 C;  1SFO C;  2PMZ D;  4LLG A;  2JA5 A;  1I50 A;  1TWG K;  1J6W A;  1O25 A;  4A93 C;  3GTK C;  4G7O A;  2A68 A;  5CHP A;  2GSN A;  4C3J C;  4C3H K;  1SMY A;  4J3N A;  1JVI A;  1X31 C;  2XCQ A;  3RZD K;  3S15 K;  1WOO A;  3HOY K;  4OIP A;  3GTQ K;  3A8I A;  3M3Y K;  5FLM C;  1EH1 A;  4BKW A;  2E2I A;  5FJ8 K;  4A3B C;  4GTD A;  1WCM C;  4QJV B;  2A69 A;  3HKZ L;  2E2H K;  1ZBS A;  3MML B;  3WOD A;  5IYC K;  2E2I K;  4LJZ A;  4BBR K;  5IYD K;  3S1M K;  5TJ3 A;  5IYB K;  2JA7 K;  2R93 A;  3QX3 A;  5EGE A;  3S14 C;  2PHC B;  1XZQ B;  1WQH A;  3S1N K;  4C2M C;  3HOX C;  3S2D C;  4BY1 C;  3HOU K;  4X6A C;  1ISE A;  4AYB L;  1AB4 A;  1Y1W A;  4C45 A;  1PJ6 A;  2R93 K;  2P5M A;  5C4X K;  3RZO K;  5JVO A;  4YFK A;  3FOE A;  4O2D A;  2E2J K;  1XXB A;  2JA8 K;  2R7Z C;  1ZXO A;  1WQF A;  2PMZ L;  3I4N K;  2V6U A;  3GEI A;  4A3G K;  1VGX A;  1XXA A;  4A3I K;  2ZFZ A;  3ORE A;  2XCO A;  2NVT C;  4G7Z A;  2NVY A;  3GTG A;  5IOT A;  1F9N A;  1IQ0 A;  4BXX C;  1YCL A;  3S16 K;  1DCP A;  1Y1V K;  1B4B A;  2JA6 A;  1L0W A;  1INN A;  3A8K A;  3S2H C;  1XXC A;  4Y52 C;  3TFJ A;  3T00 A;  4KAW X;  2V6T A;  4XCH A;  4A3E K;  1IS1 A;  3S1R C;  3HXA A;  3EQL A;  2JA6 K;  1PJ5 A;  2XCR B;  1VJE A;  2JA5 C;  3GTK K;  1YNN A;  1USM A;  3A8J A;  5L46 A;  3HOZ K;  4RMF A;  3TTG A;  4Y7N C;  4WJ4 A;  3Q3Q A;  4BY7 C;  4A3C K;  2A6E A;  1WQG A;  5CJ9 A;  2FQT A;  1YX2 A;  4KM9 A;  3ERE D;  4PAA A;  5IOQ A;  4Q4Z A;  2EBB A;  1VRQ C;  3HOW K;  1HQM A;  4KN7 A;  1BGW A;  1R9T C;  4BLA A;  5IP7 C;  3G4A A;  2ZUF A;  4NOI A;  3LAP A;  2GAH C;  2WAQ D;  3BP3 A;  4P9S A;  4A3D C;  4FZB A;  4KAR A;  1TWF C;  1C0A A;  4GZY A;  3GTJ A;  4C2M K;  3S2D K;  1USO A;  2CFA A;  4C3I C;  1Y1W C;  1TWC C;  3ADA C;  1IBA A;  3S1Q C;  3GTJ K;  1TWH C;  2VUM A;  5M5X K;  3PO3 K;  3AD8 C;  3GTQ A;  3H0G K;  1DCO A;  4LK1 A;  3GTO C;  1WIH A;  1XZP A;  4KB4 A;  2VUM K;  1I3Q C;  1KQ4 A;  3GEE A;  4A3J K;  2NVY C;  3GTM K;  3GTG C;  1WOS A;  3H3V D;  3BP8 C;  3M4O C;  2RH6 A;  1TWA C;  1I6H C;  4P5A A;  4MEX A;  3SZZ A;  2E2H A;  3GSI A;  3K7A K;  1UV7 A;  5M5Y K;  3I4M K;  3L4K A;  5C4J C;  4A3M K;  2JA7 A;  3AQP A;  3GIR A;  3HOV C;  5IOS A;  2B63 C;  3CQZ C;  4KMH A;  1IW7 A;  4A3K C;  2A6H A;  4A3F K;  1K83 K;  5E68 A;  4G0U A;  4LOW A;  2WAQ L;  1JOE A;  4YFX A;  1XPP A;  4GTA A;  2V6S A;  2YU9 A;  2NVX C;  4KAT A;  4BLB A;  1F7U A;  4BBS K;  1WOR A;  4LK0 A;  5C44 K;  4GTB A;  3V4G A;  1O2B A;  1WSV A;  1O2A A;  4P5B A;  4WJ3 M;  4XLN A;  2YU9 K;  4WIL A;  2FQO A;  5C3E K;  1GE9 A;  3GTL K;  1DD5 A;  1Y1V A;  3GTP C;  5IP9 C;  1BJT A;  4GTC A;  3T01 A;  4A3D K;  1EI6 A;  2CFA B;  4YG2 A;  2PA8 D;  3S17 C;  4A3L K;  3H3V L;  4OIR A;  3GTK A;  1TWG C;  4C3I K;  2D6F C;  2NVQ K;  3TFH A;  3AD7 C;  2R92 K;  1SFO K;  3FKI C;  1O24 A;  4C3H C;  1BDF A;  1WOP A;  4A93 K;  1I50 C;  2BE5 A;  4LR2 A;  3LPX A;  3RZD C;  3S15 C;  3N0B A;  4QIW D;  4C3J K;  3HOY C;  3GTQ C;  3M4O K;  1WCM A;  4OIN A;  4MEY A;  5FLM K;  4XSZ A;  4A3B K;  5IYC C;  2E2I C;  1WCM K;  4BBR C;  5IYD C;  3S1M C;  2JA7 C;  1O29 A;  4DDQ A;  4OIO A;  2ZUE A;  2GSO A;  4KAS A;  3S1N C;  4A3K K;  3HOU C;  3AQO A;  3S14 K;  2R93 C;  5C4X C;  3LAJ A;  3RZO C;  3HOX K;  4BY1 K;  2R7Z A;  1WSR A;  4MQ9 A;  4X6A K;  2PA8 L;  2E2J C;  2JA8 C;  1PJ7 A;  1VH2 A;  4KDD A;  3PO2 C;  3I4N C;  3H0G A;  2KWA A;  4A3G C;  4A3I C;  1F7V A;  2R7Z K;  1J6V A;  3GTM A;  2NVT K;  2O5I A;  3S16 C;  4YFN A;  1Y1V C;  3AD9 C;  4FM9 A;  3NUH A;  4QIW L;  4BXX K;  1ZYR A;  2RGR A;  1DCH A;  3N3Y A;  2P8T A;  1BS2 A;  1O2F B;  3BUE A;  3S2H K;  4Y52 K;  2JA6 C;  2CW0 A;  4KB2 A;  1K83 A;  4AH6 A;  3S1R K;  3FKI K;  1RU0 A;  3HOZ C;  4GTF A;  2JA5 K;  2Y0S D;  1I50 K;  1YNJ A;  2Y3P A;  1V5V A;  4A3C C;  4ILD A;  4Y7N K;  4OIQ A;  4XLP A;  5M3M K;  4BY7 K;  5M5W K;  3GTL A;  4GFQ A;  4KMA A;  1R9T A;  1IE0 A;  3HOW C;  2O5J A;  4KM8 A;  3VA7 A;  4GTL A;  2WB1 D;  1I6V A;  3GDZ A;  1TWF A;  1R9T K;  2GAG C;  4G0V A;  5IP7 K;  1O26 A;  5IOR A;  3TFI A;  2JH3 A;  1B4A A;  1TWF K;  1TWC A;  3DXJ A;  1SFO A;  5TMC A;  2R92 A;  1VLO A;  1TWH A;  4LQY A;  3GTJ C;  1EFW A;  3PO3 C; 
#chains in the Genus database with same CATH homology
 4QJV B;  3GTJ K;  3S1Q C;  5C4X C;  1TWH C;  2A69 A;  4XSZ A;  3PO2 K;  4A3B K;  5M5X K;  1TWC K;  1WCM K;  3HKZ L;  5IYC C;  1Y1W K;  2E2I C;  2E2H K;  3PO3 K;  3S1Q K;  1TWH K;  4BBR C;  3H0G C;  3WOD A;  5IYD C;  5IYC K;  2E2I K;  3S1M C;  4LJZ A;  2JA7 C;  4BBR K;  3H0G K;  4OIO A;  2VUM C;  3S1M K;  5IYD K;  4LK1 A;  5IYB K;  4A3J C;  2JA7 K;  5TMF A;  3GTO C;  3GTM C;  4A3K K;  4KMU A;  2VUM K;  1I3Q C;  3S1N C;  2Y0S L;  3S14 C;  3GTM K;  4A3J K;  2NVY C;  3GTO K;  3HOU C;  3S1N K;  1I3Q K;  3HOX C;  3GTG C;  3H3V D;  3M4O C;  4BY1 C;  3S2D C;  3M3Y C;  3HOU K;  3S14 K;  2NVY K;  1TWA C;  4ZH4 A;  3K7A C;  2R93 C;  1I6H C;  4AYB L;  4XSX A;  3HOX K;  4MEX A;  3GTG K;  3RZO C;  4BY1 K;  2R93 K;  1TWA K;  4MQ9 A;  2PA8 L;  3K7A K;  5C4X K;  2E2J C;  5M5Y K;  3I4M C;  3RZO K;  1I6H K;  2JA8 C;  4A3M C;  4YFK A;  3I4M K;  3PO2 C;  2E2J K;  5C4J C;  3I4N C;  2JA8 K;  4A3M K;  2E2H C;  2R7Z C;  4A3G C;  2PPB A;  2PMZ L;  4QJV A;  4A3I C;  5C4J K;  3I4N K;  2R7Z K;  4A3G K;  4KN4 A;  3HOV C;  4A3I K;  2B63 C;  2NVT C;  3CQZ C;  1K83 C;  5IYB C;  4A3F C;  4G7Z A;  1IW7 A;  3HOV K;  4A3K C;  2WB1 L;  2A6H A;  2B63 K;  2NVT K;  3CQZ K;  1K83 K;  4A3F K;  4YFN A;  1Y1V C;  2O5I A;  3S16 C;  4BXX C;  2WAQ L;  4QIW L;  3S16 K;  1Y1V K;  4YFX A;  4BXX K;  1XPP A;  1ZYR A;  4BBS C;  2NVX C;  3S2H C;  4G7H A;  5C44 C;  4Y52 C;  4BBS K;  4LK0 A;  2NVX K;  3S2H K;  5C44 K;  4Y52 K;  2JA6 C;  2YU9 C;  3HKZ D;  4A3E K;  5C3E C;  5M3F K;  2CW0 A;  3S1R C;  3GTL C;  3EQL A;  4XLN A;  2YU9 K;  2JA6 K;  5C3E K;  3S1R K;  3FKI K;  3GTL K;  2JA5 C;  4X6A C;  3GTK K;  1YNN A;  3GTP C;  3HOZ C;  5IP9 C;  2JA5 K;  2Y0S D;  1I50 K;  1YNJ A;  3HOZ K;  3GTP K;  5IP9 K;  5D4D A;  4A3D K;  4A3C C;  4Y7N C;  4AYB D;  4A3L C;  4BY7 C;  4YG2 A;  4A3C K;  2A6E A;  2PA8 D;  4Y7N K;  4OIQ A;  4XLP A;  5M3M K;  3S17 C;  3H3V L;  4A3L K;  4BY7 K;  5M5W K;  4OIR A;  3S17 K;  2NVQ C;  4Q5S A;  4JK1 A;  4A3E C;  3PO3 C;  2R92 C;  1SFO C;  1TWG C;  2PMZ D;  4C3I K;  4LLG A;  4Q4Z A;  2NVQ K;  3HOW C;  2O5J A;  2R92 K;  1SFO K;  1TWG K;  3FKI C;  3HOW K;  4A93 C;  3GTK C;  1HQM A;  4KN7 A;  1BDF A;  1R9T C;  4G7O A;  2WB1 D;  2A68 A;  1I6V A;  4A93 K;  1I50 C;  5IP7 C;  2BE5 A;  4NOI A;  4C3H K;  1R9T K;  1SMY A;  3RZD C;  2WAQ D;  3S15 C;  4QIW D;  4C3J K;  5IP7 K;  3HOY C;  4A3D C;  3GTQ C;  3RZD K;  3S15 K;  1TWF C;  3HOY K;  4OIP A;  4GZY A;  3GTQ K;  4X6A K;  4C2M K;  3S2D K;  1TWF K;  3M4O K;  3DXJ A;  4OIN A;  5TMC A;  3M3Y K;  5FLM C;  4MEY A;  3GTJ C;  5FJ8 K;  4A3B C;  5FLM K;  1Y1W C;  1TWC C;  1WCM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...