3CQZK

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3cqzK00
5C3EK 4BBSK 2Y0SD 1WCMC 5C4XK 2PA8L 2BE5A 3FKIC 5IP9C 2A6EA 2R7ZK 1I6HC 3RZDC 5M3FK 1K83C 3PO3C 3GTMC 5IP7C 4XLPA 3S1QC 3FKIK 2R7ZC 2NVTK 2JA6C 4A3LK 4Y7NC 3S16K 4Y52C 2NVQK 4Q5SA 2R93K 2R92K 1R9TK 3HOUC 3M4OC 5C3EC 4KN7A 4BBSC 3S1RK 1I50K 4LK0A 3GTOC 4X6AK 3S2HC 3S14K 2A69A 4XSZA 4OIRA 2PPBA 3S1MC 4XSXA 5C44C 2WAQL 4G7ZA 1K83K 4QJVA 3PO3K 2B63K 4LLGA 1I3QK 3H3VL 4OIPA 4KN4A 2YU9K 2JA5C 2O5IA 3GTQC 4A3DK 1I50C 1SFOC 2JA7C 3GTLK 3S14C 3GTPK 3S1MK 1TWHC 4YFNA 2E2JC 2E2HK 1TWAK 4YFXA 4A3BK 1TWGK 1R9TC 3GTQK 3S15C 3M4OK 2R93C 2PA8D 3H0GK 4AYBD 4C2MK 3S2DK 3EQLA 3HOYC 3S2HK 5TMCA 2E2IC 4MEXA 4XLNA 2WAQD 4A3FK 5IP9K 4OIOA 1ZYRA 4QIWD 3H3VD 3S2DC 5C4XC 1I6HK 3PO2K 1HQMA 3HOXC 4QJVB 1TWGC 3S15K 2JA6K 2NVTC 3S1QK 4A3KK 3CQZK 3HOWK 3S17C 1TWFK 4LK1A 4AYBL 5D4DA 5FLMK 4YFKA 4C3JK 4BY7K 1I3QC 4C3HK 5M5YK 1Y1WK 2PMZD 4A3JC 3GTGC 4A3CK 3CQZC 3HOWC 3S17K 4BXXC 3S1RC 1TWHK 2E2JK 3GTOK 1TWAC 3HOVK 5C4JK 4A3BC 2JA5K 4OIQA 4A3DC 3HOXK 2B63C 3GTJK 2VUMK 4BY1K 2JA8C 2NVYC 3HOZC 1TWFC 3M3YC 3S1NC 5FLMC 3GTMK 1YNNA 3WODA 1TWCC 5IYCK 3I4MK 4QIWL 4A3EK 3GTJC 2VUMC 4A3MC 2NVQC 2NVYK 2PMZL 4Q4ZA 3HOYK 4YG2A 5M5WK 2A6HA 4BBRK 5C4JC 4Y52K 2O5JA 4MQ9A 1YNJA 3HKZD 4A3FC 4A93K 5M5XK 4NOIA 4GZYA 3K7AK 2JA8K 3I4NC 3M3YK 4JK1A 2YU9C 5C44K 3RZOC 1WCMK 4A3GC 4G7HA 4A93C 2WB1D 4A3KC 4G7OA 4C3IK 3HOVC 4BBRC 2E2HC 3GTGK 4A3GK 4BXXK 4ZH4A 2Y0SL 4A3LC 4OINA 4A3JK 3S16C 1XPPA 1SMYA 3GTKK 1Y1VC 4A3IK 5IYDK 5IYBC 1I6VA 2A68A 3S1NK 3K7AC 3I4NK 2E2IK 4X6AC 2R92C 4BY1C 3HOUK 2NVXK 3HOZK 5IYDC 3GTKC 4Y7NK 4LJZA 2CW0A 1IW7A 3HKZL 3PO2C 4A3EC 1TWCK 5IYCC 4A3MK 2NVXC 5TMFA 5M3MK 1SFOK 2JA7K 3GTLC 3I4MC 3GTPC 3RZDK 1Y1VK 5FJ8K 5IP7K 4A3IC 4BY7C 4KMUA 5IYBK 1Y1WC 4MEYA 3H0GC 3RZOK 4A3CC 3DXJA 2WB1L 1BDFA
chains in the Genus database with same CATH superfamily
5C3EK 1TWCA 3S0XA 5IP9C 2A6EA 3GTMC 2FQOA 4FM9A 2YU9A 3S1QC 1J6XA 5IORA 5L46A 2NVTK 2NVQK 1TWGA 2GSNA 1PJ5A 1I50K 4X6AK 4G0WA 3GTJA 4ILDA 4QJVA 4BLAA 2B63K 3TFIA 2YU9K 1J98A 4KARA 1KQ4A 2E2JC 5EGHA 1TWGK 1ZBSA 3GTQK 4KMDA 3AQPA 3T00A 4RMFA 4AYBD 4O2DA 1I50A 1WOSA 3N0BA 4MEXA 2B63A 1ZYRA 3H3VD 3V4GA 3PO2K 4G0VA 1TWGC 1YCLA 3GTGA 3GTQA 3S17C 1V5VA 4KMHA 3HXAA 3GIRA 4C3JK 4YFKA 5M5YK 1YX2A 4A3CK 2PMZD 3GTGC 4P5BA 3CQZC 4BXXC 3A8JA 3S1RC 2JH3A 2E2JK 2R93A 1TWAC 1O2AA 4OIQA 4A3DC 3HOXK 1C0AA 1ISEA 1XZPA 4BY1K 2JA8C 2JA7A 4C3JC 3WODA 1IL2A 2RH6A 3I4MK 2NVQC 4BKWA 4Q4ZA 5M5WK 4BBRK 3L4JA 1YNJA 3BUEA 1VGXA 4GZYA 1XZQB 1F93A 1JOEA 3RZOC 4A3GC 1PJ6A 3LPXA 3FKIA 4C3IK 3ADAC 2XCOA 3HOVC 2JA6A 4BLBA 2R92A 2Y0SL 1SMYA 2A68A 1Y1WA 4GTAA 2R92C 5IYDC 3SZZA 5FJ8K 1Y1VK 1F9NA 4MEYA 2NVYA 2PHCB 1G51A 1BDFA 5C4XK 3FKIC 2R7ZK 1O2BA 3RZDC 5M3FK 1Y1VA 4XLPA 3AH5A 4LQYA 1TWAA 3HOUC 4KN7A 4M1XA 3GTOC 3S1MC 2A69A 5HL8A 2PPBA 4XSXA 2WAQL 2XCRB 2KWAA 3H3VL 4C3HC 4KN4A 1F7VA 2O5IA 2JA7C 3GTLK 3S14C 4YFNA 1TWAK 1WORA 1UV7A 3S15C 3VA7A 2PA8D 3H0GK 3N0CA 4KASA 3S2HK 5TMCA 2E2IC 4KC6A 1I6HK 1WSVA 1AB4A 3HOXC 3S15K 2NVTC 3S1QK 4A3KK 4GT9A 3GDZA 3OPFA 4AYBL 5D4DA 4KDDA 5FLMK 4C3HK 5IOTA 1WQGA 1ZQ1C 3S17K 3HOVK 1J6VA 2JA5K 3GTJK 3GEHA 2V6TA 3NUHA 2NVYC 1SFOA 5FLMC 1TWCC 1DCPA 2VUMC 5IOQA 2PMZL 3HOYK 4PAAA 4YG2A 4MQ9A 1DD5A 3HKZD 3TFJA 4A3FC 2JA5A 5M5XK 2V6SA 2WB1D 1B4BA 1XXAA 4BBRC 3GTGK 4KAWX 4BXXK 3CAGA 3L4KA 4A3IK 5IYBC 1I6VA 5JFEA 3S1NK 2E2IK 4BY1C 1B4AA 1VH2A 1IW7A 3HKZL 4A3EC 5IYCC 4A3MK 2NVXC 5TMFA 2JA7K 3GTLC 2ZUEA 4BY7C 4GTFA 5IYBK 2WB1L 1JVIA 4WILA 3AQOA 1GE9A 1WCMC 2FQTA 3CQZA 1O26A 1K83C 1TWFA 3PO3C 1I3QA 2Y3PA 1RU0A 3FKIK 2JA6C 2R7ZC 4A3LK 4Y7NC 3S16K 2CFAA 2R92K 1R9TK 4KM9A 3M4OC 4BBSC 4LK0A 3S2HC 2VUMA 4G7ZA 1K83K 3G4CA 4KM8A 3PO3K 4LLGA 1I3QK 4OIPA 2GAHC 4A3DK 1I50C 2XCQA 1SFOC 3ERED 3GTPK 1TWHC 1J6WA 4C45A 4YFXA 1R9TC 3M4OK 4C2MK 3S2DK 3EQLA 3HOYC 1PJ7A 4XLNA 1WOPA 2WAQD 5IP9K 5TJ3A 2P5MA 3FHZA 1X31C 4QJVB 1EFWA 3HOWK 1XZPB 4GTCA 4LK1A 4C3IC 1IE0A 4BY7K 1I3QC 4KB4A 4A3JC 3FOFA 2RGRA 1TWHK 4P5AA 4A3BC 5C4JK 1ZVUA 3Q3QA 1VRQC 2B63C 3HOZC 1ZXOA 3M3YC 1L0WA 3S1NC 2V6UA 4KB2A 3G4AA 1O24A 1XXCA 4LOWA 5CJ9A 1IQ0A 1TWHA 1BGWA 2A6HA 5C4JC 4Y52K 3AD7C 4A93K 3GTKA 2GAGC 3I4NC 1WOOA 5C44K 1EH1A 1WCMK 4KMAA 1XZQA 1F7UA 4J3NA 4A3GK 3LAJA 4OINA 1XPPA 3TTGA 3GTKK 2ZFZA 3I4NK 2CFAB 4X6AC 1WCMA 4GTBA 4Y7NK 1XXBA 1SFOK 3I4MC 3AD9C 3GTPC 4P9SA 4A3IC 3N3YA 1Y1WC 3H0GC 3AD8C 4BBSK 5IOSA 2Y0SD 2PA8L 2BE5A 1I6HC 5IP7C 4LR2A 1O28A 3IPJA 2E2HA 4FZBA 4Y52C 4Q5SA 1EQRA 2R93K 5E68A 2GSOA 5C3EC 1VJEA 3S1RK 3S14K 1EK8A 4XSZA 4OIRA 5C44C 1VLOA 2E2IA 3GTQC 2JA5C 3A8KA 1DCOA 3S1MK 4GTEA 2E2HK 3MMLB 4A3BK 2R93C 4PABA 2GSUA 3JSTA 1INNA 4GTLA 1USOA 4OIOA 4A3FK 3S2DC 4QIWD 5C4XC 2EBBA 3GTOA 1HQMA 1WSRA 3BP3A 1IBAA 2JA6K 2P8TA 1DCHA 3CQZK 3TFHA 2W7VA 1TWFK 2ZUFA 1Y1WK 5JVOA 3T01A 3HOWC 4GTDA 3GTOK 1R9TA 3GSIA 3A8IA 2VUMK 1TWFC 1K83A 3GTMK 1YNNA 1BJTA 5IYCK 4WJ3M 4QIWL 4A3EK 1O2FB 1WQFA 3GEEA 3LAPA 3GTJC 4A3MC 2NVYK 3GTPA 3GEIA 2D6FC 2O5JA 3SZYA 3OEPA 3FOEA 2R7ZA 4NOIA 1WIHA 3K7AK 2JA8K 3M3YK 3T02A 4JK1A 2YU9C 4XCHA 3OREA 3GTMA 2NVXA 4G7HA 1USMA 4A93C 4A3KC 4G7OA 1O25A 2E2HC 4DDQA 1IS1A 4G0UA 4ZH4A 4A3LC 4A3JK 3S16C 5IYDK 1Y1VC 4AH6A 5CHPA 3K7AC 3QX3A 3BP8C 3HOUK 2NVXK 3HOZK 5EGEA 3GTKC 3GTLA 4LJZA 2CW0A 3PO2C 1EI6A 1TWCK 5M3MK 1BS2A 1O27A 3H0GA 4GFQA 3RZDK 5IP7K 1JQWA 4WJ4A 4KATA 4KMUA 4A3CC 1O29A 3RZOK 3DXJA 4C2MC 1HI9A 1WQHA
chains in the Genus database with same CATH topology
5C3EK 4BBSK 2Y0SD 1WCMC 5C4XK 2PA8L 2BE5A 3FKIC 5IP9C 2A6EA 2R7ZK 1I6HC 3RZDC 5M3FK 1K83C 3PO3C 3GTMC 5IP7C 4XLPA 3S1QC 3FKIK 2R7ZC 2NVTK 2JA6C 4A3LK 4Y7NC 3S16K 4Y52C 2NVQK 4Q5SA 2R93K 2R92K 1R9TK 3HOUC 3M4OC 5C3EC 4KN7A 4BBSC 3S1RK 1I50K 4LK0A 3GTOC 4X6AK 3S2HC 3S14K 2A69A 4XSZA 4OIRA 2PPBA 3S1MC 4XSXA 5C44C 2WAQL 4G7ZA 1K83K 4QJVA 3PO3K 2B63K 4LLGA 1I3QK 3H3VL 4OIPA 4KN4A 2YU9K 2JA5C 2O5IA 3GTQC 4A3DK 1I50C 1SFOC 2JA7C 3GTLK 3S14C 3GTPK 3S1MK 1TWHC 4YFNA 2E2JC 2E2HK 1TWAK 4YFXA 4A3BK 1TWGK 1R9TC 3GTQK 3S15C 3M4OK 2R93C 2PA8D 3H0GK 4AYBD 4C2MK 3S2DK 3EQLA 3HOYC 3S2HK 5TMCA 2E2IC 4MEXA 4XLNA 2WAQD 4A3FK 5IP9K 4OIOA 1ZYRA 4QIWD 3H3VD 3S2DC 5C4XC 1I6HK 3PO2K 1HQMA 3HOXC 4QJVB 1TWGC 3S15K 2JA6K 2NVTC 3S1QK 4A3KK 3CQZK 3HOWK 3S17C 1TWFK 4LK1A 4AYBL 5D4DA 5FLMK 4YFKA 4C3JK 4BY7K 1I3QC 4C3HK 5M5YK 1Y1WK 2PMZD 4A3JC 3GTGC 4A3CK 3CQZC 3HOWC 3S17K 4BXXC 3S1RC 1TWHK 2E2JK 3GTOK 1TWAC 3HOVK 5C4JK 4A3BC 2JA5K 4OIQA 4A3DC 3HOXK 2B63C 3GTJK 2VUMK 4BY1K 2JA8C 2NVYC 3HOZC 1TWFC 3M3YC 3S1NC 5FLMC 3GTMK 1YNNA 3WODA 1TWCC 5IYCK 3I4MK 4QIWL 4A3EK 3GTJC 2VUMC 4A3MC 2NVQC 2NVYK 2PMZL 4Q4ZA 3HOYK 4YG2A 5M5WK 2A6HA 4BBRK 5C4JC 4Y52K 2O5JA 4MQ9A 1YNJA 3HKZD 4A3FC 4A93K 5M5XK 4NOIA 4GZYA 3K7AK 2JA8K 3I4NC 3M3YK 4JK1A 2YU9C 5C44K 3RZOC 1WCMK 4A3GC 4G7HA 4A93C 2WB1D 4A3KC 4G7OA 4C3IK 3HOVC 4BBRC 2E2HC 3GTGK 4A3GK 4BXXK 4ZH4A 2Y0SL 4A3LC 4OINA 4A3JK 3S16C 1XPPA 1SMYA 3GTKK 1Y1VC 4A3IK 5IYDK 5IYBC 1I6VA 2A68A 3S1NK 3K7AC 3I4NK 2E2IK 4X6AC 2R92C 4BY1C 3HOUK 2NVXK 3HOZK 5IYDC 3GTKC 4Y7NK 4LJZA 2CW0A 1IW7A 3HKZL 3PO2C 4A3EC 1TWCK 5IYCC 4A3MK 2NVXC 5TMFA 5M3MK 1SFOK 2JA7K 3GTLC 3I4MC 3GTPC 3RZDK 1Y1VK 5FJ8K 5IP7K 4A3IC 4BY7C 4KMUA 5IYBK 1Y1WC 4MEYA 3H0GC 3RZOK 4A3CC 3DXJA 2WB1L 1BDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E K;  4BBS K;  2Y0S D;  1WCM C;  5C4X K;  2PA8 L;  2BE5 A;  3FKI C;  5IP9 C;  2A6E A;  2R7Z K;  1I6H C;  3RZD C;  5M3F K;  1K83 C;  3PO3 C;  3GTM C;  5IP7 C;  4XLP A;  3S1Q C;  3FKI K;  2R7Z C;  2NVT K;  2JA6 C;  4A3L K;  4Y7N C;  3S16 K;  4Y52 C;  2NVQ K;  4Q5S A;  2R93 K;  2R92 K;  1R9T K;  3HOU C;  3M4O C;  5C3E C;  4KN7 A;  4BBS C;  3S1R K;  1I50 K;  4LK0 A;  3GTO C;  4X6A K;  3S2H C;  3S14 K;  2A69 A;  4XSZ A;  4OIR A;  2PPB A;  3S1M C;  4XSX A;  5C44 C;  2WAQ L;  4G7Z A;  1K83 K;  4QJV A;  3PO3 K;  2B63 K;  4LLG A;  1I3Q K;  3H3V L;  4OIP A;  4KN4 A;  2YU9 K;  2JA5 C;  2O5I A;  3GTQ C;  4A3D K;  1I50 C;  1SFO C;  2JA7 C;  3GTL K;  3S14 C;  3GTP K;  3S1M K;  1TWH C;  4YFN A;  2E2J C;  2E2H K;  1TWA K;  4YFX A;  4A3B K;  1TWG K;  1R9T C;  3GTQ K;  3S15 C;  3M4O K;  2R93 C;  2PA8 D;  3H0G K;  4AYB D;  4C2M K;  3S2D K;  3EQL A;  3HOY C;  3S2H K;  5TMC A;  2E2I C;  4MEX A;  4XLN A;  2WAQ D;  4A3F K;  5IP9 K;  4OIO A;  1ZYR A;  4QIW D;  3H3V D;  3S2D C;  5C4X C;  1I6H K;  3PO2 K;  1HQM A;  3HOX C;  4QJV B;  1TWG C;  3S15 K;  2JA6 K;  2NVT C;  3S1Q K;  4A3K K;  3CQZ K;  3HOW K;  3S17 C;  1TWF K;  4LK1 A;  4AYB L;  5D4D A;  5FLM K;  4YFK A;  4C3J K;  4BY7 K;  1I3Q C;  4C3H K;  5M5Y K;  1Y1W K;  2PMZ D;  4A3J C;  3GTG C;  4A3C K;  3CQZ C;  3HOW C;  3S17 K;  4BXX C;  3S1R C;  1TWH K;  2E2J K;  3GTO K;  1TWA C;  3HOV K;  5C4J K;  4A3B C;  2JA5 K;  4OIQ A;  4A3D C;  3HOX K;  2B63 C;  3GTJ K;  2VUM K;  4BY1 K;  2JA8 C;  2NVY C;  3HOZ C;  1TWF C;  3M3Y C;  3S1N C;  5FLM C;  3GTM K;  1YNN A;  3WOD A;  1TWC C;  5IYC K;  3I4M K;  4QIW L;  4A3E K;  3GTJ C;  2VUM C;  4A3M C;  2NVQ C;  2NVY K;  2PMZ L;  4Q4Z A;  3HOY K;  4YG2 A;  5M5W K;  2A6H A;  4BBR K;  5C4J C;  4Y52 K;  2O5J A;  4MQ9 A;  1YNJ A;  3HKZ D;  4A3F C;  4A93 K;  5M5X K;  4NOI A;  4GZY A;  3K7A K;  2JA8 K;  3I4N C;  3M3Y K;  4JK1 A;  2YU9 C;  5C44 K;  3RZO C;  1WCM K;  4A3G C;  4G7H A;  4A93 C;  2WB1 D;  4A3K C;  4G7O A;  4C3I K;  3HOV C;  4BBR C;  2E2H C;  3GTG K;  4A3G K;  4BXX K;  4ZH4 A;  2Y0S L;  4A3L C;  4OIN A;  4A3J K;  3S16 C;  1XPP A;  1SMY A;  3GTK K;  1Y1V C;  4A3I K;  5IYD K;  5IYB C;  1I6V A;  2A68 A;  3S1N K;  3K7A C;  3I4N K;  2E2I K;  4X6A C;  2R92 C;  4BY1 C;  3HOU K;  2NVX K;  3HOZ K;  5IYD C;  3GTK C;  4Y7N K;  4LJZ A;  2CW0 A;  1IW7 A;  3HKZ L;  3PO2 C;  4A3E C;  1TWC K;  5IYC C;  4A3M K;  2NVX C;  5TMF A;  5M3M K;  1SFO K;  2JA7 K;  3GTL C;  3I4M C;  3GTP C;  3RZD K;  1Y1V K;  5FJ8 K;  5IP7 K;  4A3I C;  4BY7 C;  4KMU A;  5IYB K;  1Y1W C;  4MEY A;  3H0G C;  3RZO K;  4A3C C;  3DXJ A;  2WB1 L;  1BDF A; 
#chains in the Genus database with same CATH topology
 5C3E K;  1TWC A;  3S0X A;  5IP9 C;  2A6E A;  3GTM C;  2FQO A;  4FM9 A;  2YU9 A;  3S1Q C;  1J6X A;  5IOR A;  5L46 A;  2NVT K;  2NVQ K;  1TWG A;  2GSN A;  1PJ5 A;  1I50 K;  4X6A K;  4G0W A;  3GTJ A;  4ILD A;  4QJV A;  4BLA A;  2B63 K;  3TFI A;  2YU9 K;  1J98 A;  4KAR A;  1KQ4 A;  2E2J C;  5EGH A;  1TWG K;  1ZBS A;  3GTQ K;  4KMD A;  3AQP A;  3T00 A;  4RMF A;  4AYB D;  4O2D A;  1I50 A;  1WOS A;  3N0B A;  4MEX A;  2B63 A;  1ZYR A;  3H3V D;  3V4G A;  3PO2 K;  4G0V A;  1TWG C;  1YCL A;  3GTG A;  3GTQ A;  3S17 C;  1V5V A;  4KMH A;  3HXA A;  3GIR A;  4C3J K;  4YFK A;  5M5Y K;  1YX2 A;  4A3C K;  2PMZ D;  3GTG C;  4P5B A;  3CQZ C;  4BXX C;  3A8J A;  3S1R C;  2JH3 A;  2E2J K;  2R93 A;  1TWA C;  1O2A A;  4OIQ A;  4A3D C;  3HOX K;  1C0A A;  1ISE A;  1XZP A;  4BY1 K;  2JA8 C;  2JA7 A;  4C3J C;  3WOD A;  1IL2 A;  2RH6 A;  3I4M K;  2NVQ C;  4BKW A;  4Q4Z A;  5M5W K;  4BBR K;  3L4J A;  1YNJ A;  3BUE A;  1VGX A;  4GZY A;  1XZQ B;  1F93 A;  1JOE A;  3RZO C;  4A3G C;  1PJ6 A;  3LPX A;  3FKI A;  4C3I K;  3ADA C;  2XCO A;  3HOV C;  2JA6 A;  4BLB A;  2R92 A;  2Y0S L;  1SMY A;  2A68 A;  1Y1W A;  4GTA A;  2R92 C;  5IYD C;  3SZZ A;  5FJ8 K;  1Y1V K;  1F9N A;  4MEY A;  2NVY A;  2PHC B;  1G51 A;  1BDF A;  5C4X K;  3FKI C;  2R7Z K;  1O2B A;  3RZD C;  5M3F K;  1Y1V A;  4XLP A;  3AH5 A;  4LQY A;  1TWA A;  3HOU C;  4KN7 A;  4M1X A;  3GTO C;  3S1M C;  2A69 A;  5HL8 A;  2PPB A;  4XSX A;  2WAQ L;  2XCR B;  2KWA A;  3H3V L;  4C3H C;  4KN4 A;  1F7V A;  2O5I A;  2JA7 C;  3GTL K;  3S14 C;  4YFN A;  1TWA K;  1WOR A;  1UV7 A;  3S15 C;  3VA7 A;  2PA8 D;  3H0G K;  3N0C A;  4KAS A;  3S2H K;  5TMC A;  2E2I C;  4KC6 A;  1I6H K;  1WSV A;  1AB4 A;  3HOX C;  3S15 K;  2NVT C;  3S1Q K;  4A3K K;  4GT9 A;  3GDZ A;  3OPF A;  4AYB L;  5D4D A;  4KDD A;  5FLM K;  4C3H K;  5IOT A;  1WQG A;  1ZQ1 C;  3S17 K;  3HOV K;  1J6V A;  2JA5 K;  3GTJ K;  3GEH A;  2V6T A;  3NUH A;  2NVY C;  1SFO A;  5FLM C;  1TWC C;  1DCP A;  2VUM C;  5IOQ A;  2PMZ L;  3HOY K;  4PAA A;  4YG2 A;  4MQ9 A;  1DD5 A;  3HKZ D;  3TFJ A;  4A3F C;  2JA5 A;  5M5X K;  2V6S A;  2WB1 D;  1B4B A;  1XXA A;  4BBR C;  3GTG K;  4KAW X;  4BXX K;  3CAG A;  3L4K A;  4A3I K;  5IYB C;  1I6V A;  5JFE A;  3S1N K;  2E2I K;  4BY1 C;  1B4A A;  1VH2 A;  1IW7 A;  3HKZ L;  4A3E C;  5IYC C;  4A3M K;  2NVX C;  5TMF A;  2JA7 K;  3GTL C;  2ZUE A;  4BY7 C;  4GTF A;  5IYB K;  2WB1 L;  1JVI A;  4WIL A;  3AQO A;  1GE9 A;  1WCM C;  2FQT A;  3CQZ A;  1O26 A;  1K83 C;  1TWF A;  3PO3 C;  1I3Q A;  2Y3P A;  1RU0 A;  3FKI K;  2JA6 C;  2R7Z C;  4A3L K;  4Y7N C;  3S16 K;  2CFA A;  2R92 K;  1R9T K;  4KM9 A;  3M4O C;  4BBS C;  4LK0 A;  3S2H C;  2VUM A;  4G7Z A;  1K83 K;  3G4C A;  4KM8 A;  3PO3 K;  4LLG A;  1I3Q K;  4OIP A;  2GAH C;  4A3D K;  1I50 C;  2XCQ A;  1SFO C;  3ERE D;  3GTP K;  1TWH C;  1J6W A;  4C45 A;  4YFX A;  1R9T C;  3M4O K;  4C2M K;  3S2D K;  3EQL A;  3HOY C;  1PJ7 A;  4XLN A;  1WOP A;  2WAQ D;  5IP9 K;  5TJ3 A;  2P5M A;  3FHZ A;  1X31 C;  4QJV B;  1EFW A;  3HOW K;  1XZP B;  4GTC A;  4LK1 A;  4C3I C;  1IE0 A;  4BY7 K;  1I3Q C;  4KB4 A;  4A3J C;  3FOF A;  2RGR A;  1TWH K;  4P5A A;  4A3B C;  5C4J K;  1ZVU A;  3Q3Q A;  1VRQ C;  2B63 C;  3HOZ C;  1ZXO A;  3M3Y C;  1L0W A;  3S1N C;  2V6U A;  4KB2 A;  3G4A A;  1O24 A;  1XXC A;  4LOW A;  5CJ9 A;  1IQ0 A;  1TWH A;  1BGW A;  2A6H A;  5C4J C;  4Y52 K;  3AD7 C;  4A93 K;  3GTK A;  2GAG C;  3I4N C;  1WOO A;  5C44 K;  1EH1 A;  1WCM K;  4KMA A;  1XZQ A;  1F7U A;  4J3N A;  4A3G K;  3LAJ A;  4OIN A;  1XPP A;  3TTG A;  3GTK K;  2ZFZ A;  3I4N K;  2CFA B;  4X6A C;  1WCM A;  4GTB A;  4Y7N K;  1XXB A;  1SFO K;  3I4M C;  3AD9 C;  3GTP C;  4P9S A;  4A3I C;  3N3Y A;  1Y1W C;  3H0G C;  3AD8 C;  4BBS K;  5IOS A;  2Y0S D;  2PA8 L;  2BE5 A;  1I6H C;  5IP7 C;  4LR2 A;  1O28 A;  3IPJ A;  2E2H A;  4FZB A;  4Y52 C;  4Q5S A;  1EQR A;  2R93 K;  5E68 A;  2GSO A;  5C3E C;  1VJE A;  3S1R K;  3S14 K;  1EK8 A;  4XSZ A;  4OIR A;  5C44 C;  1VLO A;  2E2I A;  3GTQ C;  2JA5 C;  3A8K A;  1DCO A;  3S1M K;  4GTE A;  2E2H K;  3MML B;  4A3B K;  2R93 C;  4PAB A;  2GSU A;  3JST A;  1INN A;  4GTL A;  1USO A;  4OIO A;  4A3F K;  3S2D C;  4QIW D;  5C4X C;  2EBB A;  3GTO A;  1HQM A;  1WSR A;  3BP3 A;  1IBA A;  2JA6 K;  2P8T A;  1DCH A;  3CQZ K;  3TFH A;  2W7V A;  1TWF K;  2ZUF A;  1Y1W K;  5JVO A;  3T01 A;  3HOW C;  4GTD A;  3GTO K;  1R9T A;  3GSI A;  3A8I A;  2VUM K;  1TWF C;  1K83 A;  3GTM K;  1YNN A;  1BJT A;  5IYC K;  4WJ3 M;  4QIW L;  4A3E K;  1O2F B;  1WQF A;  3GEE A;  3LAP A;  3GTJ C;  4A3M C;  2NVY K;  3GTP A;  3GEI A;  2D6F C;  2O5J A;  3SZY A;  3OEP A;  3FOE A;  2R7Z A;  4NOI A;  1WIH A;  3K7A K;  2JA8 K;  3M3Y K;  3T02 A;  4JK1 A;  2YU9 C;  4XCH A;  3ORE A;  3GTM A;  2NVX A;  4G7H A;  1USM A;  4A93 C;  4A3K C;  4G7O A;  1O25 A;  2E2H C;  4DDQ A;  1IS1 A;  4G0U A;  4ZH4 A;  4A3L C;  4A3J K;  3S16 C;  5IYD K;  1Y1V C;  4AH6 A;  5CHP A;  3K7A C;  3QX3 A;  3BP8 C;  3HOU K;  2NVX K;  3HOZ K;  5EGE A;  3GTK C;  3GTL A;  4LJZ A;  2CW0 A;  3PO2 C;  1EI6 A;  1TWC K;  5M3M K;  1BS2 A;  1O27 A;  3H0G A;  4GFQ A;  3RZD K;  5IP7 K;  1JQW A;  4WJ4 A;  4KAT A;  4KMU A;  4A3C C;  1O29 A;  3RZO K;  3DXJ A;  4C2M C;  1HI9 A;  1WQH A; 
#chains in the Genus database with same CATH homology
 5C3E K;  4BBS K;  2Y0S D;  1WCM C;  5C4X K;  2PA8 L;  2BE5 A;  3FKI C;  5IP9 C;  2A6E A;  2R7Z K;  1I6H C;  3RZD C;  5M3F K;  1K83 C;  3PO3 C;  3GTM C;  5IP7 C;  4XLP A;  3S1Q C;  3FKI K;  2R7Z C;  2NVT K;  2JA6 C;  4A3L K;  4Y7N C;  3S16 K;  4Y52 C;  2NVQ K;  4Q5S A;  2R93 K;  2R92 K;  1R9T K;  3HOU C;  3M4O C;  5C3E C;  4KN7 A;  4BBS C;  3S1R K;  1I50 K;  4LK0 A;  3GTO C;  4X6A K;  3S2H C;  3S14 K;  2A69 A;  4XSZ A;  4OIR A;  2PPB A;  3S1M C;  4XSX A;  5C44 C;  2WAQ L;  4G7Z A;  1K83 K;  4QJV A;  3PO3 K;  2B63 K;  4LLG A;  1I3Q K;  3H3V L;  4OIP A;  4KN4 A;  2YU9 K;  2JA5 C;  2O5I A;  3GTQ C;  4A3D K;  1I50 C;  1SFO C;  2JA7 C;  3GTL K;  3S14 C;  3GTP K;  3S1M K;  1TWH C;  4YFN A;  2E2J C;  2E2H K;  1TWA K;  4YFX A;  4A3B K;  1TWG K;  1R9T C;  3GTQ K;  3S15 C;  3M4O K;  2R93 C;  2PA8 D;  3H0G K;  4AYB D;  4C2M K;  3S2D K;  3EQL A;  3HOY C;  3S2H K;  5TMC A;  2E2I C;  4MEX A;  4XLN A;  2WAQ D;  4A3F K;  5IP9 K;  4OIO A;  1ZYR A;  4QIW D;  3H3V D;  3S2D C;  5C4X C;  1I6H K;  3PO2 K;  1HQM A;  3HOX C;  4QJV B;  1TWG C;  3S15 K;  2JA6 K;  2NVT C;  3S1Q K;  4A3K K;  3CQZ K;  3HOW K;  3S17 C;  1TWF K;  4LK1 A;  4AYB L;  5D4D A;  5FLM K;  4YFK A;  4C3J K;  4BY7 K;  1I3Q C;  4C3H K;  5M5Y K;  1Y1W K;  2PMZ D;  4A3J C;  3GTG C;  4A3C K;  3CQZ C;  3HOW C;  3S17 K;  4BXX C;  3S1R C;  1TWH K;  2E2J K;  3GTO K;  1TWA C;  3HOV K;  5C4J K;  4A3B C;  2JA5 K;  4OIQ A;  4A3D C;  3HOX K;  2B63 C;  3GTJ K;  2VUM K;  4BY1 K;  2JA8 C;  2NVY C;  3HOZ C;  1TWF C;  3M3Y C;  3S1N C;  5FLM C;  3GTM K;  1YNN A;  3WOD A;  1TWC C;  5IYC K;  3I4M K;  4QIW L;  4A3E K;  3GTJ C;  2VUM C;  4A3M C;  2NVQ C;  2NVY K;  2PMZ L;  4Q4Z A;  3HOY K;  4YG2 A;  5M5W K;  2A6H A;  4BBR K;  5C4J C;  4Y52 K;  2O5J A;  4MQ9 A;  1YNJ A;  3HKZ D;  4A3F C;  4A93 K;  5M5X K;  4NOI A;  4GZY A;  3K7A K;  2JA8 K;  3I4N C;  3M3Y K;  4JK1 A;  2YU9 C;  5C44 K;  3RZO C;  1WCM K;  4A3G C;  4G7H A;  4A93 C;  2WB1 D;  4A3K C;  4G7O A;  4C3I K;  3HOV C;  4BBR C;  2E2H C;  3GTG K;  4A3G K;  4BXX K;  4ZH4 A;  2Y0S L;  4A3L C;  4OIN A;  4A3J K;  3S16 C;  1XPP A;  1SMY A;  3GTK K;  1Y1V C;  4A3I K;  5IYD K;  5IYB C;  1I6V A;  2A68 A;  3S1N K;  3K7A C;  3I4N K;  2E2I K;  4X6A C;  2R92 C;  4BY1 C;  3HOU K;  2NVX K;  3HOZ K;  5IYD C;  3GTK C;  4Y7N K;  4LJZ A;  2CW0 A;  1IW7 A;  3HKZ L;  3PO2 C;  4A3E C;  1TWC K;  5IYC C;  4A3M K;  2NVX C;  5TMF A;  5M3M K;  1SFO K;  2JA7 K;  3GTL C;  3I4M C;  3GTP C;  3RZD K;  1Y1V K;  5FJ8 K;  5IP7 K;  4A3I C;  4BY7 C;  4KMU A;  5IYB K;  1Y1W C;  4MEY A;  3H0G C;  3RZO K;  4A3C C;  3DXJ A;  2WB1 L;  1BDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...