3CQZK

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3cqzK00
4MEYA 4KN4A 3I4MC 3FKIK 4MQ9A 2VUMK 2R92C 3PO2C 4X6AK 4C2MK 3S1QC 2PA8L 3HOYK 4BBRC 2E2IC 4G7HA 4A3CK 1I3QC 4Y52K 2E2JC 4QJVB 4Y52C 2NVTC 3S2DK 4Y7NC 4LK1A 2R7ZK 4LLGA 5IP7K 4XLPA 4OIRA 1YNJA 4X6AC 2WB1L 3S2HK 4C3JK 2E2HK 4BY7C 3PO2K 1XPPA 3FKIC 4XSZA 2VUMC 1TWFK 2NVQC 5IYDC 1R9TC 3GTPK 4A3KK 1YNNA 2A68A 5IYCC 4A3FC 4A3DC 3GTQK 1IW7A 2JA6C 2JA5K 2PPBA 4G7OA 2A6HA 1Y1WC 3GTMC 4A3IC 3HOUK 1Y1VK 2O5IA 3K7AK 4BY1C 4A93C 3S1NK 4OIPA 4A3JC 4A3LC 3M4OC 2WAQD 4YFNA 4A3EK 2YU9K 3K7AC 3S16C 5M5YK 4Q5SA 3S1RK 1K83C 5FLMC 1SMYA 1HQMA 2NVYC 3HOWK 1SFOC 5D4DA 4ZH4A 3GTGC 5C4JC 2JA6K 4Q4ZA 4KMUA 3H0GC 4AYBL 4A3FK 5IYCK 5TMFA 2NVXK 3RZOC 1R9TK 3GTPC 5FJ8K 3S1MC 5IYBK 1TWHC 3S15K 1TWFC 3HOXC 1TWHK 5IP9K 5C4XK 2BE5A 3PO3K 2E2HC 2A69A 3WODA 1TWCK 3H0GK 4BXXC 3HKZD 4C3IK 5IP7C 1TWAC 5C4JK 1SFOK 2NVYK 2E2JK 2NVTK 1I3QK 3HOWC 3I4NK 4A3GK 2E2IK 4BBRK 1K83K 5FLMK 3S1RC 3HOYC 5IYDK 2R93K 2PA8D 2YU9C 5C3EK 4OIQA 4BBSK 2R92K 2PMZD 3HOVC 1I6HK 1Y1VC 3S14K 4YFKA 2Y0SD 3CQZK 3RZDK 3GTMK 2WB1D 5C44K 4A3BK 1WCMC 4LK0A 2JA5C 5M5XK 1WCMK 3GTOK 3GTQC 4LJZA 2Y0SL 4A3KC 4A3DK 4XSXA 3S17C 4A3MK 3RZDC 2NVQK 3S14C 4A3BC 2PMZL 4XLNA 4OINA 1I6HC 3HOVK 4BY7K 4QIWL 2B63K 3S2HC 4BBSC 3GTLC 4GZYA 5C3EC 2R93C 2R7ZC 4Y7NK 4KN7A 3GTKK 3I4NC 3S2DC 4A3CC 4A3GC 4YG2A 3S1QK 1TWAK 4G7ZA 4MEXA 1TWCC 3GTJK 2A6EA 3M3YC 3HKZL 5M5WK 5IP9C 3PO3C 4C3HK 5C4XC 3HOXK 3I4MK 2WAQL 3S15C 5IYBC 4AYBD 2NVXC 3M3YK 3RZOK 1ZYRA 3S1MK 3GTJC 5M3FK 4JK1A 3GTGK 1TWGK 3H3VD 2JA7C 3HOZK 5M3MK 3DXJA 1I50C 1I6VA 3GTKC 2CW0A 2JA8C 4YFXA 3S16K 5TMCA 3GTLK 3EQLA 4A3EC 3M4OK 4A3JK 2B63C 4A3LK 4QIWD 3S1NC 4BY1K 4A93K 4A3IK 3HOUC 4A3MC 2JA8K 4QJVA 3S17K 1Y1WK 4NOIA 4OIOA 1I50K 3H3VL 2O5JA 2JA7K 3HOZC 1TWGC 3GTOC 1BDFA 5C44C 4BXXK 3CQZC
chains in the Genus database with same CATH superfamily
4MEYA 3AD9C 3FKIK 4MQ9A 4X6AK 4GTEA 1XZPB 3AQPA 3GTGA 4Y52K 2E2JC 4GTLA 1J6WA 4OIRA 1YNJA 3GDZA 4GTAA 1WSRA 1TWGA 1YNNA 2A68A 1WIHA 3GTQK 1IW7A 1XZPA 2PPBA 2A6HA 4GTCA 1Y1WC 4XCHA 4A3IC 3K7AK 3S1NK 2WAQD 4YFNA 3GSIA 2YU9K 1K83C 5FLMC 3CQZA 2NVYC 3HOWK 2JA6K 4KMUA 3H0GC 4AYBL 2NVXK 5IYCK 1TWFC 1XXBA 5IP9K 5C4XK 3PO3K 4BXXC 4C3IK 3A8KA 1SFOK 3T02A 3GEHA 2E2IK 4BBRK 1K83A 2R93K 1UV7A 1J6XA 1IL2A 2NVXA 2PMZD 2JA6A 1IE0A 3S14K 4YFKA 2WB1D 2JA5C 2Y0SL 4A3DK 1DCHA 2XCQA 4KM8A 2NVQK 3HOVK 4BY7K 4AH6A 3A8JA 4KMAA 2R7ZC 4Y7NK 3GTKK 3I4NC 2P8TA 2ZUEA 3ADAC 4MEXA 1XXAA 4C2MC 4KASA 2A6EA 3HKZL 5M5WK 2GSNA 1INNA 5IYBC 3RZOK 3M3YK 3GTGK 4KDDA 1BGWA 3OREA 2JA7C 3H3VD 3DXJA 1O2BA 4GT9A 3HOZK 1O28A 1DCOA 3S16K 3M4OK 4A3JK 2B63C 4LOWA 1G51A 4A3MC 4QJVA 1Y1WA 1XZQA 1TWGC 2XCOA 4RMFA 3CAGA 5JFEA 4C3HC 2R92C 2JA7A 3S1QC 2PA8L 4KB2A 4A3CK 1XXCA 3S2DK 4LK1A 5IP7K 3S2HK 1AB4A 4XSZA 5EGEA 3GTPK 4KMDA 4A3FC 1O27A 1ZBSA 4LR2A 3GTMC 3VA7A 1Y1VA 3GTQA 1RU0A 3ERED 1XZQB 2JA5A 4BLAA 5TJ3A 5C4JC 1EK8A 4A3FK 3GTPC 3JSTA 1EH1A 1TWHC 5IYBK 2ZUFA 3HOXC 1TWHK 2XCRB 4GTDA 3IPJA 3HKZD 2ZFZA 5IP7C 3TFJA 5C4JK 4WILA 2PA8D 1EI6A 1VH2A 1EQRA 2R92K 1BS2A 1JQWA 1I6HK 5L46A 4KB4A 1SFOA 3GTMK 1TWHA 1O2FB 2GAGC 5IORA 3TFIA 4XSXA 4A3MK 3S14C 1I6HC 4OINA 4XLNA 3GTKA 2B63K 3S2HC 4GZYA 2YU9A 4GFQA 4KN7A 3S2DC 4BKWA 5HL8A 4A3CC 4YG2A 3S1QK 4KATA 3M3YC 3QX3A 2E2HA 1HI9A 3PO3C 4C3HK 2Y3PA 1WOPA 3HOXK 1L0WA 2GAHC 1ZVUA 1TWGK 1IQ0A 5M3MK 1I6VA 3GTKC 1V5VA 4M1XA 4GTBA 1WQFA 3T00A 1ISEA 3S1NC 1VRQC 4NOIA 4OIOA 3H3VL 2O5JA 2JA7K 3HOZC 1BDFA 4OIQA 1VJEA 4G0VA 3SZYA 4BLBA 4PABA 4C2MK 5IOTA 4BBRC 2E2IC 3A8IA 4WJ3M 4QJVB 4Y52C 1USMA 2RH6A 4Y7NC 2R7ZK 4XLPA 4BY7C 1XPPA 2RGRA 1TWFK 1YCLA 2JH3A 2NVQC 3N0BA 4ILDA 1WOOA 4A3DC 5IYCC 1ZQ1C 2JA6C 2JA5K 3Q3QA 1KQ4A 1BJTA 3FOEA 3MMLB 3GTOA 3TTGA 4A93C 1DCPA 4OIPA 4A3JC 4A3LC 3M4OC 2V6TA 1J6VA 2V6SA 4A3EK 3S16C 3K7AC 2GSUA 4WJ4A 5M5YK 1O24A 1SFOC 1EFWA 4ZH4A 3OPFA 3GTGC 4C3IC 4P9SA 4BXXK 3V4GA 2P5MA 3FKIA 3RZOC 1YX2A 1I3QA 4KM9A 3S15K 2R7ZA 2BE5A 3H0GK 2NVYK 2E2JK 4KAWX 3FOFA 1R9TA 3HOWC 3I4NK 1K83K 5FLMK 2YU9C 5C3EK 1VGXA 4BBSK 4C45A 3HOVC 3FHZA 3N0CA 3LAPA 3GIRA 2Y0SD 3RZDK 2V6UA 4LK0A 5M5XK 3GTOK 3GTQC 2EBBA 4PAAA 4A3BC 2PMZL 3L4KA 4P5AA 2R93C 1F7VA 3L4JA 2CFAA 3GTPA 5JVOA 4G0WA 2GSOA 1TWAA 1TWAK 4G7ZA 3GTJK 1WQGA 5IP9C 5C4XC 1F93A 3G4CA 4G0UA 4AYBD 3N3YA 2NVXC 3S1MK 3BP3A 2R93A 1I50C 2CW0A 3LPXA 5CHPA 1B4BA 4YFXA 3GTLK 1WOSA 4QIWD 4BY1K 4KMHA 4A3IK 4GTFA 3HOUC 2JA8K 5EGHA 3S17K 1Y1WK 2PHCB 2FQOA 5C44C 4DDQA 3CQZC 1USOA 4KN4A 1I50A 3I4MC 3AH5A 2VUMK 3PO2C 1IS1A 4C3JC 1PJ5A 1JVIA 3HOYK 4G7HA 1I3QC 2NVTC 2D6FC 4FZBA 1B4AA 4LLGA 4X6AC 2WB1L 4C3JK 2E2HK 1O2AA 4FM9A 3PO2K 3FKIC 3G4AA 1PJ7A 2VUMC 5IYDC 2B63A 1R9TC 2FQTA 4LQYA 4A3KK 3AD7C 4G7OA 3AQOA 1WORA 3HXAA 3HOUK 1Y1VK 2O5IA 4BY1C 1C0AA 4Q5SA 3S1RK 4P5BA 3S0XA 1DD5A 1SMYA 4KC6A 1HQMA 5D4DA 1O29A 1O26A 3BUEA 4Q4ZA 1WSVA 2R92A 5TMFA 3S1MC 1R9TK 5FJ8K 3BP8C 3LAJA 2E2IA 2E2HC 2A69A 3WODA 1TWCK 3SZZA 1TWAC 3AD8C 2NVTK 4A3GK 1I3QK 5CJ9A 1J98A 3S1RC 3HOYC 3T01A 4KARA 3GTLA 2NVYA 3OEPA 3H0GA 1PJ6A 1Y1VC 4A3BK 3NUHA 3CQZK 5C44K 1WCMC 4O2DA 1WCMK 4LJZA 4A3KC 5IOSA 1ZXOA 3S17C 2KWAA 3GEEA 3RZDC 3GTJA 4QIWL 4BBSC 3GTLC 5C3EC 1TWFA 4A3GC 5IOQA 2W7VA 1GE9A 1F7UA 1TWCC 1F9NA 1WCMA 3I4MK 2WAQL 3TFHA 3S15C 1O25A 3GEIA 1VLOA 1ZYRA 3GTJC 5M3FK 4JK1A 2CFAB 2JA8C 1WQHA 5TMCA 3EQLA 4A3EC 5E68A 1JOEA 4A3LK 1TWCA 3GTMA 1IBAA 4A93K 1X31C 1I50K 4J3NA 3GTOC 2VUMA 5IYDK
chains in the Genus database with same CATH topology
4MEYA 4KN4A 3I4MC 3FKIK 4MQ9A 2VUMK 2R92C 3PO2C 4X6AK 4C2MK 3S1QC 2PA8L 3HOYK 4BBRC 2E2IC 4G7HA 4A3CK 1I3QC 4Y52K 2E2JC 4QJVB 4Y52C 2NVTC 3S2DK 4Y7NC 4LK1A 2R7ZK 4LLGA 5IP7K 4XLPA 4OIRA 1YNJA 4X6AC 2WB1L 3S2HK 4C3JK 2E2HK 4BY7C 3PO2K 1XPPA 3FKIC 4XSZA 2VUMC 1TWFK 2NVQC 5IYDC 1R9TC 3GTPK 4A3KK 1YNNA 2A68A 5IYCC 4A3FC 4A3DC 3GTQK 1IW7A 2JA6C 2JA5K 2PPBA 4G7OA 2A6HA 1Y1WC 3GTMC 4A3IC 3HOUK 1Y1VK 2O5IA 3K7AK 4BY1C 4A93C 3S1NK 4OIPA 4A3JC 4A3LC 3M4OC 2WAQD 4YFNA 4A3EK 2YU9K 3K7AC 3S16C 5M5YK 4Q5SA 3S1RK 1K83C 5FLMC 1SMYA 1HQMA 2NVYC 3HOWK 1SFOC 5D4DA 4ZH4A 3GTGC 5C4JC 2JA6K 4Q4ZA 4KMUA 3H0GC 4AYBL 4A3FK 5IYCK 5TMFA 2NVXK 3RZOC 1R9TK 3GTPC 5FJ8K 3S1MC 5IYBK 1TWHC 3S15K 1TWFC 3HOXC 1TWHK 5IP9K 5C4XK 2BE5A 3PO3K 2E2HC 2A69A 3WODA 1TWCK 3H0GK 4BXXC 3HKZD 4C3IK 5IP7C 1TWAC 5C4JK 1SFOK 2NVYK 2E2JK 2NVTK 1I3QK 3HOWC 3I4NK 4A3GK 2E2IK 4BBRK 1K83K 5FLMK 3S1RC 3HOYC 5IYDK 2R93K 2PA8D 2YU9C 5C3EK 4OIQA 4BBSK 2R92K 2PMZD 3HOVC 1I6HK 1Y1VC 3S14K 4YFKA 2Y0SD 3CQZK 3RZDK 3GTMK 2WB1D 5C44K 4A3BK 1WCMC 4LK0A 2JA5C 5M5XK 1WCMK 3GTOK 3GTQC 4LJZA 2Y0SL 4A3KC 4A3DK 4XSXA 3S17C 4A3MK 3RZDC 2NVQK 3S14C 4A3BC 2PMZL 4XLNA 4OINA 1I6HC 3HOVK 4BY7K 4QIWL 2B63K 3S2HC 4BBSC 3GTLC 4GZYA 5C3EC 2R93C 2R7ZC 4Y7NK 4KN7A 3GTKK 3I4NC 3S2DC 4A3CC 4A3GC 4YG2A 3S1QK 1TWAK 4G7ZA 4MEXA 1TWCC 3GTJK 2A6EA 3M3YC 3HKZL 5M5WK 5IP9C 3PO3C 4C3HK 5C4XC 3HOXK 3I4MK 2WAQL 3S15C 5IYBC 4AYBD 2NVXC 3M3YK 3RZOK 1ZYRA 3S1MK 3GTJC 5M3FK 4JK1A 3GTGK 1TWGK 3H3VD 2JA7C 3HOZK 5M3MK 3DXJA 1I50C 1I6VA 3GTKC 2CW0A 2JA8C 4YFXA 3S16K 5TMCA 3GTLK 3EQLA 4A3EC 3M4OK 4A3JK 2B63C 4A3LK 4QIWD 3S1NC 4BY1K 4A93K 4A3IK 3HOUC 4A3MC 2JA8K 4QJVA 3S17K 1Y1WK 4NOIA 4OIOA 1I50K 3H3VL 2O5JA 2JA7K 3HOZC 1TWGC 3GTOC 1BDFA 5C44C 4BXXK 3CQZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEY A;  4KN4 A;  3I4M C;  3FKI K;  4MQ9 A;  2VUM K;  2R92 C;  3PO2 C;  4X6A K;  4C2M K;  3S1Q C;  2PA8 L;  3HOY K;  4BBR C;  2E2I C;  4G7H A;  4A3C K;  1I3Q C;  4Y52 K;  2E2J C;  4QJV B;  4Y52 C;  2NVT C;  3S2D K;  4Y7N C;  4LK1 A;  2R7Z K;  4LLG A;  5IP7 K;  4XLP A;  4OIR A;  1YNJ A;  4X6A C;  2WB1 L;  3S2H K;  4C3J K;  2E2H K;  4BY7 C;  3PO2 K;  1XPP A;  3FKI C;  4XSZ A;  2VUM C;  1TWF K;  2NVQ C;  5IYD C;  1R9T C;  3GTP K;  4A3K K;  1YNN A;  2A68 A;  5IYC C;  4A3F C;  4A3D C;  3GTQ K;  1IW7 A;  2JA6 C;  2JA5 K;  2PPB A;  4G7O A;  2A6H A;  1Y1W C;  3GTM C;  4A3I C;  3HOU K;  1Y1V K;  2O5I A;  3K7A K;  4BY1 C;  4A93 C;  3S1N K;  4OIP A;  4A3J C;  4A3L C;  3M4O C;  2WAQ D;  4YFN A;  4A3E K;  2YU9 K;  3K7A C;  3S16 C;  5M5Y K;  4Q5S A;  3S1R K;  1K83 C;  5FLM C;  1SMY A;  1HQM A;  2NVY C;  3HOW K;  1SFO C;  5D4D A;  4ZH4 A;  3GTG C;  5C4J C;  2JA6 K;  4Q4Z A;  4KMU A;  3H0G C;  4AYB L;  4A3F K;  5IYC K;  5TMF A;  2NVX K;  3RZO C;  1R9T K;  3GTP C;  5FJ8 K;  3S1M C;  5IYB K;  1TWH C;  3S15 K;  1TWF C;  3HOX C;  1TWH K;  5IP9 K;  5C4X K;  2BE5 A;  3PO3 K;  2E2H C;  2A69 A;  3WOD A;  1TWC K;  3H0G K;  4BXX C;  3HKZ D;  4C3I K;  5IP7 C;  1TWA C;  5C4J K;  1SFO K;  2NVY K;  2E2J K;  2NVT K;  1I3Q K;  3HOW C;  3I4N K;  4A3G K;  2E2I K;  4BBR K;  1K83 K;  5FLM K;  3S1R C;  3HOY C;  5IYD K;  2R93 K;  2PA8 D;  2YU9 C;  5C3E K;  4OIQ A;  4BBS K;  2R92 K;  2PMZ D;  3HOV C;  1I6H K;  1Y1V C;  3S14 K;  4YFK A;  2Y0S D;  3CQZ K;  3RZD K;  3GTM K;  2WB1 D;  5C44 K;  4A3B K;  1WCM C;  4LK0 A;  2JA5 C;  5M5X K;  1WCM K;  3GTO K;  3GTQ C;  4LJZ A;  2Y0S L;  4A3K C;  4A3D K;  4XSX A;  3S17 C;  4A3M K;  3RZD C;  2NVQ K;  3S14 C;  4A3B C;  2PMZ L;  4XLN A;  4OIN A;  1I6H C;  3HOV K;  4BY7 K;  4QIW L;  2B63 K;  3S2H C;  4BBS C;  3GTL C;  4GZY A;  5C3E C;  2R93 C;  2R7Z C;  4Y7N K;  4KN7 A;  3GTK K;  3I4N C;  3S2D C;  4A3C C;  4A3G C;  4YG2 A;  3S1Q K;  1TWA K;  4G7Z A;  4MEX A;  1TWC C;  3GTJ K;  2A6E A;  3M3Y C;  3HKZ L;  5M5W K;  5IP9 C;  3PO3 C;  4C3H K;  5C4X C;  3HOX K;  3I4M K;  2WAQ L;  3S15 C;  5IYB C;  4AYB D;  2NVX C;  3M3Y K;  3RZO K;  1ZYR A;  3S1M K;  3GTJ C;  5M3F K;  4JK1 A;  3GTG K;  1TWG K;  3H3V D;  2JA7 C;  3HOZ K;  5M3M K;  3DXJ A;  1I50 C;  1I6V A;  3GTK C;  2CW0 A;  2JA8 C;  4YFX A;  3S16 K;  5TMC A;  3GTL K;  3EQL A;  4A3E C;  3M4O K;  4A3J K;  2B63 C;  4A3L K;  4QIW D;  3S1N C;  4BY1 K;  4A93 K;  4A3I K;  3HOU C;  4A3M C;  2JA8 K;  4QJV A;  3S17 K;  1Y1W K;  4NOI A;  4OIO A;  1I50 K;  3H3V L;  2O5J A;  2JA7 K;  3HOZ C;  1TWG C;  3GTO C;  1BDF A;  5C44 C;  4BXX K;  3CQZ C; 
#chains in the Genus database with same CATH topology
 4MEY A;  3AD9 C;  3FKI K;  4MQ9 A;  4X6A K;  4GTE A;  1XZP B;  3AQP A;  3GTG A;  4Y52 K;  2E2J C;  4GTL A;  1J6W A;  4OIR A;  1YNJ A;  3GDZ A;  4GTA A;  1WSR A;  1TWG A;  1YNN A;  2A68 A;  1WIH A;  3GTQ K;  1IW7 A;  1XZP A;  2PPB A;  2A6H A;  4GTC A;  1Y1W C;  4XCH A;  4A3I C;  3K7A K;  3S1N K;  2WAQ D;  4YFN A;  3GSI A;  2YU9 K;  1K83 C;  5FLM C;  3CQZ A;  2NVY C;  3HOW K;  2JA6 K;  4KMU A;  3H0G C;  4AYB L;  2NVX K;  5IYC K;  1TWF C;  1XXB A;  5IP9 K;  5C4X K;  3PO3 K;  4BXX C;  4C3I K;  3A8K A;  1SFO K;  3T02 A;  3GEH A;  2E2I K;  4BBR K;  1K83 A;  2R93 K;  1UV7 A;  1J6X A;  1IL2 A;  2NVX A;  2PMZ D;  2JA6 A;  1IE0 A;  3S14 K;  4YFK A;  2WB1 D;  2JA5 C;  2Y0S L;  4A3D K;  1DCH A;  2XCQ A;  4KM8 A;  2NVQ K;  3HOV K;  4BY7 K;  4AH6 A;  3A8J A;  4KMA A;  2R7Z C;  4Y7N K;  3GTK K;  3I4N C;  2P8T A;  2ZUE A;  3ADA C;  4MEX A;  1XXA A;  4C2M C;  4KAS A;  2A6E A;  3HKZ L;  5M5W K;  2GSN A;  1INN A;  5IYB C;  3RZO K;  3M3Y K;  3GTG K;  4KDD A;  1BGW A;  3ORE A;  2JA7 C;  3H3V D;  3DXJ A;  1O2B A;  4GT9 A;  3HOZ K;  1O28 A;  1DCO A;  3S16 K;  3M4O K;  4A3J K;  2B63 C;  4LOW A;  1G51 A;  4A3M C;  4QJV A;  1Y1W A;  1XZQ A;  1TWG C;  2XCO A;  4RMF A;  3CAG A;  5JFE A;  4C3H C;  2R92 C;  2JA7 A;  3S1Q C;  2PA8 L;  4KB2 A;  4A3C K;  1XXC A;  3S2D K;  4LK1 A;  5IP7 K;  3S2H K;  1AB4 A;  4XSZ A;  5EGE A;  3GTP K;  4KMD A;  4A3F C;  1O27 A;  1ZBS A;  4LR2 A;  3GTM C;  3VA7 A;  1Y1V A;  3GTQ A;  1RU0 A;  3ERE D;  1XZQ B;  2JA5 A;  4BLA A;  5TJ3 A;  5C4J C;  1EK8 A;  4A3F K;  3GTP C;  3JST A;  1EH1 A;  1TWH C;  5IYB K;  2ZUF A;  3HOX C;  1TWH K;  2XCR B;  4GTD A;  3IPJ A;  3HKZ D;  2ZFZ A;  5IP7 C;  3TFJ A;  5C4J K;  4WIL A;  2PA8 D;  1EI6 A;  1VH2 A;  1EQR A;  2R92 K;  1BS2 A;  1JQW A;  1I6H K;  5L46 A;  4KB4 A;  1SFO A;  3GTM K;  1TWH A;  1O2F B;  2GAG C;  5IOR A;  3TFI A;  4XSX A;  4A3M K;  3S14 C;  1I6H C;  4OIN A;  4XLN A;  3GTK A;  2B63 K;  3S2H C;  4GZY A;  2YU9 A;  4GFQ A;  4KN7 A;  3S2D C;  4BKW A;  5HL8 A;  4A3C C;  4YG2 A;  3S1Q K;  4KAT A;  3M3Y C;  3QX3 A;  2E2H A;  1HI9 A;  3PO3 C;  4C3H K;  2Y3P A;  1WOP A;  3HOX K;  1L0W A;  2GAH C;  1ZVU A;  1TWG K;  1IQ0 A;  5M3M K;  1I6V A;  3GTK C;  1V5V A;  4M1X A;  4GTB A;  1WQF A;  3T00 A;  1ISE A;  3S1N C;  1VRQ C;  4NOI A;  4OIO A;  3H3V L;  2O5J A;  2JA7 K;  3HOZ C;  1BDF A;  4OIQ A;  1VJE A;  4G0V A;  3SZY A;  4BLB A;  4PAB A;  4C2M K;  5IOT A;  4BBR C;  2E2I C;  3A8I A;  4WJ3 M;  4QJV B;  4Y52 C;  1USM A;  2RH6 A;  4Y7N C;  2R7Z K;  4XLP A;  4BY7 C;  1XPP A;  2RGR A;  1TWF K;  1YCL A;  2JH3 A;  2NVQ C;  3N0B A;  4ILD A;  1WOO A;  4A3D C;  5IYC C;  1ZQ1 C;  2JA6 C;  2JA5 K;  3Q3Q A;  1KQ4 A;  1BJT A;  3FOE A;  3MML B;  3GTO A;  3TTG A;  4A93 C;  1DCP A;  4OIP A;  4A3J C;  4A3L C;  3M4O C;  2V6T A;  1J6V A;  2V6S A;  4A3E K;  3S16 C;  3K7A C;  2GSU A;  4WJ4 A;  5M5Y K;  1O24 A;  1SFO C;  1EFW A;  4ZH4 A;  3OPF A;  3GTG C;  4C3I C;  4P9S A;  4BXX K;  3V4G A;  2P5M A;  3FKI A;  3RZO C;  1YX2 A;  1I3Q A;  4KM9 A;  3S15 K;  2R7Z A;  2BE5 A;  3H0G K;  2NVY K;  2E2J K;  4KAW X;  3FOF A;  1R9T A;  3HOW C;  3I4N K;  1K83 K;  5FLM K;  2YU9 C;  5C3E K;  1VGX A;  4BBS K;  4C45 A;  3HOV C;  3FHZ A;  3N0C A;  3LAP A;  3GIR A;  2Y0S D;  3RZD K;  2V6U A;  4LK0 A;  5M5X K;  3GTO K;  3GTQ C;  2EBB A;  4PAA A;  4A3B C;  2PMZ L;  3L4K A;  4P5A A;  2R93 C;  1F7V A;  3L4J A;  2CFA A;  3GTP A;  5JVO A;  4G0W A;  2GSO A;  1TWA A;  1TWA K;  4G7Z A;  3GTJ K;  1WQG A;  5IP9 C;  5C4X C;  1F93 A;  3G4C A;  4G0U A;  4AYB D;  3N3Y A;  2NVX C;  3S1M K;  3BP3 A;  2R93 A;  1I50 C;  2CW0 A;  3LPX A;  5CHP A;  1B4B A;  4YFX A;  3GTL K;  1WOS A;  4QIW D;  4BY1 K;  4KMH A;  4A3I K;  4GTF A;  3HOU C;  2JA8 K;  5EGH A;  3S17 K;  1Y1W K;  2PHC B;  2FQO A;  5C44 C;  4DDQ A;  3CQZ C;  1USO A;  4KN4 A;  1I50 A;  3I4M C;  3AH5 A;  2VUM K;  3PO2 C;  1IS1 A;  4C3J C;  1PJ5 A;  1JVI A;  3HOY K;  4G7H A;  1I3Q C;  2NVT C;  2D6F C;  4FZB A;  1B4A A;  4LLG A;  4X6A C;  2WB1 L;  4C3J K;  2E2H K;  1O2A A;  4FM9 A;  3PO2 K;  3FKI C;  3G4A A;  1PJ7 A;  2VUM C;  5IYD C;  2B63 A;  1R9T C;  2FQT A;  4LQY A;  4A3K K;  3AD7 C;  4G7O A;  3AQO A;  1WOR A;  3HXA A;  3HOU K;  1Y1V K;  2O5I A;  4BY1 C;  1C0A A;  4Q5S A;  3S1R K;  4P5B A;  3S0X A;  1DD5 A;  1SMY A;  4KC6 A;  1HQM A;  5D4D A;  1O29 A;  1O26 A;  3BUE A;  4Q4Z A;  1WSV A;  2R92 A;  5TMF A;  3S1M C;  1R9T K;  5FJ8 K;  3BP8 C;  3LAJ A;  2E2I A;  2E2H C;  2A69 A;  3WOD A;  1TWC K;  3SZZ A;  1TWA C;  3AD8 C;  2NVT K;  4A3G K;  1I3Q K;  5CJ9 A;  1J98 A;  3S1R C;  3HOY C;  3T01 A;  4KAR A;  3GTL A;  2NVY A;  3OEP A;  3H0G A;  1PJ6 A;  1Y1V C;  4A3B K;  3NUH A;  3CQZ K;  5C44 K;  1WCM C;  4O2D A;  1WCM K;  4LJZ A;  4A3K C;  5IOS A;  1ZXO A;  3S17 C;  2KWA A;  3GEE A;  3RZD C;  3GTJ A;  4QIW L;  4BBS C;  3GTL C;  5C3E C;  1TWF A;  4A3G C;  5IOQ A;  2W7V A;  1GE9 A;  1F7U A;  1TWC C;  1F9N A;  1WCM A;  3I4M K;  2WAQ L;  3TFH A;  3S15 C;  1O25 A;  3GEI A;  1VLO A;  1ZYR A;  3GTJ C;  5M3F K;  4JK1 A;  2CFA B;  2JA8 C;  1WQH A;  5TMC A;  3EQL A;  4A3E C;  5E68 A;  1JOE A;  4A3L K;  1TWC A;  3GTM A;  1IBA A;  4A93 K;  1X31 C;  1I50 K;  4J3N A;  3GTO C;  2VUM A;  5IYD K; 
#chains in the Genus database with same CATH homology
 4MEY A;  4KN4 A;  3I4M C;  3FKI K;  4MQ9 A;  2VUM K;  2R92 C;  3PO2 C;  4X6A K;  4C2M K;  3S1Q C;  2PA8 L;  3HOY K;  4BBR C;  2E2I C;  4G7H A;  4A3C K;  1I3Q C;  4Y52 K;  2E2J C;  4QJV B;  4Y52 C;  2NVT C;  3S2D K;  4Y7N C;  4LK1 A;  2R7Z K;  4LLG A;  5IP7 K;  4XLP A;  4OIR A;  1YNJ A;  4X6A C;  2WB1 L;  3S2H K;  4C3J K;  2E2H K;  4BY7 C;  3PO2 K;  1XPP A;  3FKI C;  4XSZ A;  2VUM C;  1TWF K;  2NVQ C;  5IYD C;  1R9T C;  3GTP K;  4A3K K;  1YNN A;  2A68 A;  5IYC C;  4A3F C;  4A3D C;  3GTQ K;  1IW7 A;  2JA6 C;  2JA5 K;  2PPB A;  4G7O A;  2A6H A;  1Y1W C;  3GTM C;  4A3I C;  3HOU K;  1Y1V K;  2O5I A;  3K7A K;  4BY1 C;  4A93 C;  3S1N K;  4OIP A;  4A3J C;  4A3L C;  3M4O C;  2WAQ D;  4YFN A;  4A3E K;  2YU9 K;  3K7A C;  3S16 C;  5M5Y K;  4Q5S A;  3S1R K;  1K83 C;  5FLM C;  1SMY A;  1HQM A;  2NVY C;  3HOW K;  1SFO C;  5D4D A;  4ZH4 A;  3GTG C;  5C4J C;  2JA6 K;  4Q4Z A;  4KMU A;  3H0G C;  4AYB L;  4A3F K;  5IYC K;  5TMF A;  2NVX K;  3RZO C;  1R9T K;  3GTP C;  5FJ8 K;  3S1M C;  5IYB K;  1TWH C;  3S15 K;  1TWF C;  3HOX C;  1TWH K;  5IP9 K;  5C4X K;  2BE5 A;  3PO3 K;  2E2H C;  2A69 A;  3WOD A;  1TWC K;  3H0G K;  4BXX C;  3HKZ D;  4C3I K;  5IP7 C;  1TWA C;  5C4J K;  1SFO K;  2NVY K;  2E2J K;  2NVT K;  1I3Q K;  3HOW C;  3I4N K;  4A3G K;  2E2I K;  4BBR K;  1K83 K;  5FLM K;  3S1R C;  3HOY C;  5IYD K;  2R93 K;  2PA8 D;  2YU9 C;  5C3E K;  4OIQ A;  4BBS K;  2R92 K;  2PMZ D;  3HOV C;  1I6H K;  1Y1V C;  3S14 K;  4YFK A;  2Y0S D;  3CQZ K;  3RZD K;  3GTM K;  2WB1 D;  5C44 K;  4A3B K;  1WCM C;  4LK0 A;  2JA5 C;  5M5X K;  1WCM K;  3GTO K;  3GTQ C;  4LJZ A;  2Y0S L;  4A3K C;  4A3D K;  4XSX A;  3S17 C;  4A3M K;  3RZD C;  2NVQ K;  3S14 C;  4A3B C;  2PMZ L;  4XLN A;  4OIN A;  1I6H C;  3HOV K;  4BY7 K;  4QIW L;  2B63 K;  3S2H C;  4BBS C;  3GTL C;  4GZY A;  5C3E C;  2R93 C;  2R7Z C;  4Y7N K;  4KN7 A;  3GTK K;  3I4N C;  3S2D C;  4A3C C;  4A3G C;  4YG2 A;  3S1Q K;  1TWA K;  4G7Z A;  4MEX A;  1TWC C;  3GTJ K;  2A6E A;  3M3Y C;  3HKZ L;  5M5W K;  5IP9 C;  3PO3 C;  4C3H K;  5C4X C;  3HOX K;  3I4M K;  2WAQ L;  3S15 C;  5IYB C;  4AYB D;  2NVX C;  3M3Y K;  3RZO K;  1ZYR A;  3S1M K;  3GTJ C;  5M3F K;  4JK1 A;  3GTG K;  1TWG K;  3H3V D;  2JA7 C;  3HOZ K;  5M3M K;  3DXJ A;  1I50 C;  1I6V A;  3GTK C;  2CW0 A;  2JA8 C;  4YFX A;  3S16 K;  5TMC A;  3GTL K;  3EQL A;  4A3E C;  3M4O K;  4A3J K;  2B63 C;  4A3L K;  4QIW D;  3S1N C;  4BY1 K;  4A93 K;  4A3I K;  3HOU C;  4A3M C;  2JA8 K;  4QJV A;  3S17 K;  1Y1W K;  4NOI A;  4OIO A;  1I50 K;  3H3V L;  2O5J A;  2JA7 K;  3HOZ C;  1TWG C;  3GTO C;  1BDF A;  5C44 C;  4BXX K;  3CQZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...