3CQZK

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3cqzK00
2E2IC 2PMZL 2WB1D 5IYDK 5M5XK 2NVXC 4C3HK 3S17K 4A3GK 5IP9C 4A3LK 3I4NC 3RZDK 3GTGK 3RZOK 1TWHK 2JA6K 1TWFC 2O5IA 1Y1VC 2E2JC 4A3KC 3H0GC 4YFXA 3S1RC 4QIWD 4A3IC 4BY7K 3S16K 3WODA 3GTMK 3M3YK 4XSZA 3S2DC 5C44C 3GTJK 4G7HA 3GTLC 4G7OA 4Y52K 4BBRK 4A3EK 2YU9K 3CQZC 4BBSC 2E2HK 2R93K 2R92C 2E2IK 3PO3K 4A93C 5IYBC 2NVXK 4KN4A 2WB1L 3HOUC 5IP9K 5IP7C 3FKIC 3I4NK 2PPBA 1I6VA 2VUMC 5M3FK 1TWFK 2A6EA 1Y1VK 2E2JK 4A3KK 3H0GK 1XPPA 4LK0A 3S1RK 3HOYC 4A3IK 3S1QK 3M4OC 2PA8D 4QIWL 3S2DK 5C44K 5C3EC 3S2HC 4A3BC 3GTLK 3CQZK 1TWCK 4BY1C 3S15C 4A3FC 4MEXA 1Y1WK 2R92K 4KMUA 2JA8C 4A93K 4Y7NC 5C4XC 4AYBD 4ZH4A 4YFKA 5IYBK 3HOWC 5IP7K 3FKIK 2VUMK 4A3MC 4YG2A 5IYCC 5FLMC 3HKZD 4OINA 4A3DC 4LK1A 4QJVB 4XSXA 2A6HA 3M4OK 1YNNA 2A68A 3GTPC 5C3EK 2NVQC 3HOZC 2PA8L 3HOXC 3K7AC 3S2HK 4A3BK 4XLNA 3GTKC 3S15K 4A3FK 1ZYRA 4MEYA 4OIQA 3PO2C 4C2MK 2JA8K 4A3JC 4Y7NK 5C4XK 5TMCA 3HOWK 1I50C 2BE5A 4AYBL 1SFOC 3S1MC 1TWAC 4BY7C 4A3CC 4OIPA 5IYCK 3EQLA 4YFNA 3DXJA 4A3MK 4BXXC 4A3DK 5M5YK 2JA5C 1K83C 2JA7C 4G7ZA 3HKZL 2R7ZC 2B63C 4BBSK 5D4DA 1HQMA 1I6HC 4QJVA 4XLPA 3GTPK 3S14C 2NVTC 2NVQK 3HOXK 3HOZK 2A69A 3K7AK 3HOUK 4Q4ZA 3HOVC 3GTKK 4X6AC 3I4MC 4LLGA 1R9TC 4MQ9A 4C3IK 5TMFA 2O5JA 2WAQD 4A3JK 3HOYK 4JK1A 1I50K 1SFOK 3S1MK 1TWAK 1SMYA 4A3CK 5M5WK 3S1NC 3H3VD 1WCMC 4OIOA 3PO3C 4BXXK 2Y0SD 2R7ZK 2JA5K 1K83K 4BY1K 2JA7K 1I6HK 5M3MK 2B63K 1I3QC 3S14K 2NVTK 1TWGC 3GTOC 3GTQC 3HOVK 2CW0A 2NVYC 5C4JC 4X6AK 4LJZA 3I4MK 4OIRA 1BDFA 1R9TK 5FLMK 2PMZD 3S1QC 4Q5SA 4C3JK 5IYDC 3S17C 4A3GC 1YNJA 2WAQL 4A3LC 3RZDC 3GTGC 1TWCC 3RZOC 1TWHC 2JA6C 1Y1WC 3S1NK 1WCMK 4NOIA 5FJ8K 3H3VL 2Y0SL 3PO2K 3S16C 1I3QK 3GTMC 3M3YC 3GTJC 4GZYA 3GTOK 1TWGK 1IW7A 4Y52C 3GTQK 4BBRC 2NVYK 4A3EC 2YU9C 5C4JK 2R93C 4KN7A 2E2HC
chains in the Genus database with same CATH superfamily
2WB1D 1O24A 5IP9C 3N0BA 4G0VA 1JQWA 4KARA 4G0UA 3Q3QA 2O5IA 3H0GC 4QIWD 3S2DC 3M3YK 1EI6A 1O2AA 3GTJK 2ZFZA 1VGXA 3GTLC 4G7OA 1EH1A 1XXAA 2YU9K 2E2HA 2R93A 1WQGA 2NVXK 5IP7C 4GFQA 4WJ4A 2V6SA 1VH2A 1TWFK 4P5AA 2A6EA 2E2JK 4LK0A 1GE9A 1J6XA 4A3IK 3S1QK 3M4OC 1UV7A 2FQTA 4G0WA 3CQZK 4BY1C 4MEXA 2R92K 1VRQC 3AQPA 2Y3PA 2P8TA 4C2MC 2JA8C 4Y7NC 5C4XC 4ZH4A 5FLMC 4A3DC 4OINA 2EBBA 3A8JA 3GTPC 2PA8L 4PABA 1XZPB 4XLNA 1O2FB 4A3FK 1WQFA 3TFJA 4C3IC 3VA7A 4FZBA 3HOWK 3S1MC 2XCQA 1TWAC 3EQLA 3DXJA 2R7ZC 2JA7C 2B63C 4C3HC 2CFAB 4KMHA 2A69A 3K7AK 3HOVC 4Q4ZA 2GAHC 3GTKK 4LLGA 5EGHA 1KQ4A 3H3VD 4BXXK 1IQ0A 4WJ3M 1K83K 2FQOA 3A8KA 2JA5A 1PJ7A 2KWAA 3GEHA 4GTEA 3GSIA 1BDFA 3GEIA 2PMZD 5JVOA 1R9TA 4Q5SA 1IL2A 2WAQL 3T01A 3AH5A 1WCMA 3S16C 3GTMC 1JVIA 1I3QA 1TWGK 4LQYA 2NVYA 1ZBSA 2E2IC 4A3GK 4A3LK 3GTGK 1TWHK 2JA6K 4LR2A 1Y1VC 4A3KC 1J98A 4GT9A 5C44C 2GSUA 4G7HA 4BBSC 2YU9A 1B4BA 3PO3K 1C0AA 5IP9K 5CHPA 2NVXA 3OEPA 1TWFA 3H0GK 1XPPA 5EGEA 4PAAA 1WOSA 3G4CA 3OPFA 1WIHA 1EFWA 1PJ5A 3S2DK 2XCOA 4KMDA 3GTLK 2XCRB 4A3BC 1EQRA 1USOA 4LOWA 1TWCK 3CQZA 2R92A 3L4KA 3SZZA 5IP7K 4A3MC 1WORA 3M4OK 2A68A 2NVQC 3HOZC 3PO2C 4C2MK 2JA8K 4GTLA 4Y7NK 5C4XK 1I50C 1O26A 2BE5A 4AYBL 1SFOC 1INNA 4BY7C 4YFNA 4A3DK 4G7ZA 3HKZL 1I6HC 1HQMA 1VLOA 4XLPA 3FOEA 1J6WA 3GTPK 3HOUK 3I4MC 1BGWA 3FKIA 3GIRA 4KB2A 2VUMA 4C3IK 3HOYK 4JK1A 3T00A 4ILDA 3S1MK 1TWAK 4AH6A 5M5WK 5IORA 2Y0SD 2R7ZK 2JA7K 2B63K 3L4JA 4KASA 1J6VA 1XZQA 4GTAA 3GTOC 3GTQC 3HOVK 5C4JC 1F93A 4GTCA 1WQHA 3S1QC 5IYDC 1IE0A 3S17C 1YNJA 4KATA 3RZDC 3RZOC 5IOTA 3LAPA 4Y52C 1IW7A 4BBRC 4A3EC 2GAGC 2D6FC 1TWGA 2E2HC 3AD9C 2R93C 4WILA 1USMA 2ZUEA 1ZXOA 1BJTA 1V5VA 5M5XK 4KM9A 3I4NC 2RGRA 4KB4A 1TWHA 2JA6A 3S1RC 2PHCB 3AD8C 3S16K 5HL8A 4GTBA 3GTMK 4XSZA 1IBAA 1ISEA 4KDDA 1AB4A 2E2IK 3BUEA 4FM9A 4A93C 5IYBC 2WB1L 3FKIC 2PPBA 2V6UA 2VUMC 3FHZA 5IOSA 1Y1VK 3LAJA 4A3KK 2PA8D 4QIWL 3TTGA 5C44K 3N0CA 5C3EC 3S2HC 4BKWA 3MMLB 3GTLA 1JOEA 3S15C 1WOPA 1TWCA 1Y1WK 4KMUA 4KMAA 1DD5A 5CJ9A 1XXCA 1XZPA 5E68A 1HI9A 4YG2A 5IYCC 3GTJA 4LK1A 4BLBA 2A6HA 4DDQA 1YNNA 3HOXC 4A3BK 1ZYRA 4OIQA 2CFAA 4A3JC 1DCOA 5TMCA 1DCPA 1O28A 4A3CC 4OIPA 4A3MK 2RH6A 2JA5C 4QJVA 5TJ3A 1RU0A 2NVTC 2NVQK 3HOZK 3S14C 3GTPA 3CAGA 4X6AC 1WSRA 3N3YA 1R9TC 2O5JA 2WAQD 4C3JC 1I50K 1SFOK 4BY7K 3S1NC 1WCMC 4OIOA 1TWAA 3PO3C 4BY1K 3GDZA 3TFHA 1I6HK 2R7ZA 2JA7A 1I3QC 3TFIA 2B63A 4XCHA 1L0WA 4GTDA 2NVYC 1PJ6A 4LJZA 3I4MK 5FLMK 1TWCC 5JFEA 3H3VL 3IPJA 3GTKA 1YCLA 3M3YC 3GTJC 4GZYA 3GTOK 1O29A 1O25A 3GTQK 2YU9C 5C4JK 2W7VA 3T02A 3AD7C 4O2DA 2PMZL 5IYDK 5IOQA 1K83A 4C3HK 2NVXC 3S17K 3RZDK 1F7VA 1B4AA 3RZOK 3SZYA 1IS1A 1TWFC 2E2JC 4YFXA 4A3IC 3WODA 3GTMA 3AQOA 4Y52K 4BBRK 4A3EK 3CQZC 2GSNA 2E2HK 2R93K 2R92C 2E2IA 3HXAA 4KN4A 3HOUC 4J3NA 3I4NK 1I6VA 5M3FK 1X31C 3NUHA 4P5BA 3S1RK 1VJEA 1Y1VA 3HOYC 3S0XA 4P9SA 3JSTA 3A8IA 4A3FC 3GTGA 3QX3A 3ADAC 1WSVA 1Y1WA 4A93K 4AYBD 4YFKA 5IYBK 3HOWC 3FOFA 5L46A 3FKIK 2VUMK 3HKZD 4QJVB 4XSXA 2V6TA 5C3EK 3S2HK 3K7AC 3GTKC 3S15K 1WOOA 3LPXA 4MEYA 4RMFA 3H0GA 2GSOA 2JH3A 1ZQ1C 5IYCK 1F7UA 4BXXC 5M5YK 4BBSK 1K83C 1O27A 5D4DA 4KC6A 4KAWX 4KM8A 3HOXK 4GTFA 1YX2A 4MQ9A 5TMFA 4A3JK 1DCHA 1I50A 1SMYA 1SFOA 4A3CK 1O2BA 4BLAA 4C45A 2JA5K 5M3MK 3BP8C 3ERED 3S14K 2NVTK 1TWGC 1EK8A 1F9NA 2CW0A 4X6AK 4OIRA 4M1XA 2P5MA 1R9TK 3BP3A 1XXBA 4C3JK 4A3GC 1XZQB 4A3LC 3GTGC 2ZUFA 1TWHC 3GEEA 2JA6C 1Y1WC 3S1NK 1WCMK 4NOIA 5FJ8K 3V4GA 2Y0SL 1G51A 3G4AA 3PO2K 1I3QK 1BS2A 1ZVUA 2NVYK 3OREA 3GTOA 3GTQA 4KN7A
chains in the Genus database with same CATH topology
2E2IC 2PMZL 2WB1D 5IYDK 5M5XK 2NVXC 4C3HK 3S17K 4A3GK 5IP9C 4A3LK 3I4NC 3RZDK 3GTGK 3RZOK 1TWHK 2JA6K 1TWFC 2O5IA 1Y1VC 2E2JC 4A3KC 3H0GC 4YFXA 3S1RC 4QIWD 4A3IC 4BY7K 3S16K 3WODA 3GTMK 3M3YK 4XSZA 3S2DC 5C44C 3GTJK 4G7HA 3GTLC 4G7OA 4Y52K 4BBRK 4A3EK 2YU9K 3CQZC 4BBSC 2E2HK 2R93K 2R92C 2E2IK 3PO3K 4A93C 5IYBC 2NVXK 4KN4A 2WB1L 3HOUC 5IP9K 5IP7C 3FKIC 3I4NK 2PPBA 1I6VA 2VUMC 5M3FK 1TWFK 2A6EA 1Y1VK 2E2JK 4A3KK 3H0GK 1XPPA 4LK0A 3S1RK 3HOYC 4A3IK 3S1QK 3M4OC 2PA8D 4QIWL 3S2DK 5C44K 5C3EC 3S2HC 4A3BC 3GTLK 3CQZK 1TWCK 4BY1C 3S15C 4A3FC 4MEXA 1Y1WK 2R92K 4KMUA 2JA8C 4A93K 4Y7NC 5C4XC 4AYBD 4ZH4A 4YFKA 5IYBK 3HOWC 5IP7K 3FKIK 2VUMK 4A3MC 4YG2A 5IYCC 5FLMC 3HKZD 4OINA 4A3DC 4LK1A 4QJVB 4XSXA 2A6HA 3M4OK 1YNNA 2A68A 3GTPC 5C3EK 2NVQC 3HOZC 2PA8L 3HOXC 3K7AC 3S2HK 4A3BK 4XLNA 3GTKC 3S15K 4A3FK 1ZYRA 4MEYA 4OIQA 3PO2C 4C2MK 2JA8K 4A3JC 4Y7NK 5C4XK 5TMCA 3HOWK 1I50C 2BE5A 4AYBL 1SFOC 3S1MC 1TWAC 4BY7C 4A3CC 4OIPA 5IYCK 3EQLA 4YFNA 3DXJA 4A3MK 4BXXC 4A3DK 5M5YK 2JA5C 1K83C 2JA7C 4G7ZA 3HKZL 2R7ZC 2B63C 4BBSK 5D4DA 1HQMA 1I6HC 4QJVA 4XLPA 3GTPK 3S14C 2NVTC 2NVQK 3HOXK 3HOZK 2A69A 3K7AK 3HOUK 4Q4ZA 3HOVC 3GTKK 4X6AC 3I4MC 4LLGA 1R9TC 4MQ9A 4C3IK 5TMFA 2O5JA 2WAQD 4A3JK 3HOYK 4JK1A 1I50K 1SFOK 3S1MK 1TWAK 1SMYA 4A3CK 5M5WK 3S1NC 3H3VD 1WCMC 4OIOA 3PO3C 4BXXK 2Y0SD 2R7ZK 2JA5K 1K83K 4BY1K 2JA7K 1I6HK 5M3MK 2B63K 1I3QC 3S14K 2NVTK 1TWGC 3GTOC 3GTQC 3HOVK 2CW0A 2NVYC 5C4JC 4X6AK 4LJZA 3I4MK 4OIRA 1BDFA 1R9TK 5FLMK 2PMZD 3S1QC 4Q5SA 4C3JK 5IYDC 3S17C 4A3GC 1YNJA 2WAQL 4A3LC 3RZDC 3GTGC 1TWCC 3RZOC 1TWHC 2JA6C 1Y1WC 3S1NK 1WCMK 4NOIA 5FJ8K 3H3VL 2Y0SL 3PO2K 3S16C 1I3QK 3GTMC 3M3YC 3GTJC 4GZYA 3GTOK 1TWGK 1IW7A 4Y52C 3GTQK 4BBRC 2NVYK 4A3EC 2YU9C 5C4JK 2R93C 4KN7A 2E2HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I C;  2PMZ L;  2WB1 D;  5IYD K;  5M5X K;  2NVX C;  4C3H K;  3S17 K;  4A3G K;  5IP9 C;  4A3L K;  3I4N C;  3RZD K;  3GTG K;  3RZO K;  1TWH K;  2JA6 K;  1TWF C;  2O5I A;  1Y1V C;  2E2J C;  4A3K C;  3H0G C;  4YFX A;  3S1R C;  4QIW D;  4A3I C;  4BY7 K;  3S16 K;  3WOD A;  3GTM K;  3M3Y K;  4XSZ A;  3S2D C;  5C44 C;  3GTJ K;  4G7H A;  3GTL C;  4G7O A;  4Y52 K;  4BBR K;  4A3E K;  2YU9 K;  3CQZ C;  4BBS C;  2E2H K;  2R93 K;  2R92 C;  2E2I K;  3PO3 K;  4A93 C;  5IYB C;  2NVX K;  4KN4 A;  2WB1 L;  3HOU C;  5IP9 K;  5IP7 C;  3FKI C;  3I4N K;  2PPB A;  1I6V A;  2VUM C;  5M3F K;  1TWF K;  2A6E A;  1Y1V K;  2E2J K;  4A3K K;  3H0G K;  1XPP A;  4LK0 A;  3S1R K;  3HOY C;  4A3I K;  3S1Q K;  3M4O C;  2PA8 D;  4QIW L;  3S2D K;  5C44 K;  5C3E C;  3S2H C;  4A3B C;  3GTL K;  3CQZ K;  1TWC K;  4BY1 C;  3S15 C;  4A3F C;  4MEX A;  1Y1W K;  2R92 K;  4KMU A;  2JA8 C;  4A93 K;  4Y7N C;  5C4X C;  4AYB D;  4ZH4 A;  4YFK A;  5IYB K;  3HOW C;  5IP7 K;  3FKI K;  2VUM K;  4A3M C;  4YG2 A;  5IYC C;  5FLM C;  3HKZ D;  4OIN A;  4A3D C;  4LK1 A;  4QJV B;  4XSX A;  2A6H A;  3M4O K;  1YNN A;  2A68 A;  3GTP C;  5C3E K;  2NVQ C;  3HOZ C;  2PA8 L;  3HOX C;  3K7A C;  3S2H K;  4A3B K;  4XLN A;  3GTK C;  3S15 K;  4A3F K;  1ZYR A;  4MEY A;  4OIQ A;  3PO2 C;  4C2M K;  2JA8 K;  4A3J C;  4Y7N K;  5C4X K;  5TMC A;  3HOW K;  1I50 C;  2BE5 A;  4AYB L;  1SFO C;  3S1M C;  1TWA C;  4BY7 C;  4A3C C;  4OIP A;  5IYC K;  3EQL A;  4YFN A;  3DXJ A;  4A3M K;  4BXX C;  4A3D K;  5M5Y K;  2JA5 C;  1K83 C;  2JA7 C;  4G7Z A;  3HKZ L;  2R7Z C;  2B63 C;  4BBS K;  5D4D A;  1HQM A;  1I6H C;  4QJV A;  4XLP A;  3GTP K;  3S14 C;  2NVT C;  2NVQ K;  3HOX K;  3HOZ K;  2A69 A;  3K7A K;  3HOU K;  4Q4Z A;  3HOV C;  3GTK K;  4X6A C;  3I4M C;  4LLG A;  1R9T C;  4MQ9 A;  4C3I K;  5TMF A;  2O5J A;  2WAQ D;  4A3J K;  3HOY K;  4JK1 A;  1I50 K;  1SFO K;  3S1M K;  1TWA K;  1SMY A;  4A3C K;  5M5W K;  3S1N C;  3H3V D;  1WCM C;  4OIO A;  3PO3 C;  4BXX K;  2Y0S D;  2R7Z K;  2JA5 K;  1K83 K;  4BY1 K;  2JA7 K;  1I6H K;  5M3M K;  2B63 K;  1I3Q C;  3S14 K;  2NVT K;  1TWG C;  3GTO C;  3GTQ C;  3HOV K;  2CW0 A;  2NVY C;  5C4J C;  4X6A K;  4LJZ A;  3I4M K;  4OIR A;  1BDF A;  1R9T K;  5FLM K;  2PMZ D;  3S1Q C;  4Q5S A;  4C3J K;  5IYD C;  3S17 C;  4A3G C;  1YNJ A;  2WAQ L;  4A3L C;  3RZD C;  3GTG C;  1TWC C;  3RZO C;  1TWH C;  2JA6 C;  1Y1W C;  3S1N K;  1WCM K;  4NOI A;  5FJ8 K;  3H3V L;  2Y0S L;  3PO2 K;  3S16 C;  1I3Q K;  3GTM C;  3M3Y C;  3GTJ C;  4GZY A;  3GTO K;  1TWG K;  1IW7 A;  4Y52 C;  3GTQ K;  4BBR C;  2NVY K;  4A3E C;  2YU9 C;  5C4J K;  2R93 C;  4KN7 A;  2E2H C; 
#chains in the Genus database with same CATH topology
 2WB1 D;  1O24 A;  5IP9 C;  3N0B A;  4G0V A;  1JQW A;  4KAR A;  4G0U A;  3Q3Q A;  2O5I A;  3H0G C;  4QIW D;  3S2D C;  3M3Y K;  1EI6 A;  1O2A A;  3GTJ K;  2ZFZ A;  1VGX A;  3GTL C;  4G7O A;  1EH1 A;  1XXA A;  2YU9 K;  2E2H A;  2R93 A;  1WQG A;  2NVX K;  5IP7 C;  4GFQ A;  4WJ4 A;  2V6S A;  1VH2 A;  1TWF K;  4P5A A;  2A6E A;  2E2J K;  4LK0 A;  1GE9 A;  1J6X A;  4A3I K;  3S1Q K;  3M4O C;  1UV7 A;  2FQT A;  4G0W A;  3CQZ K;  4BY1 C;  4MEX A;  2R92 K;  1VRQ C;  3AQP A;  2Y3P A;  2P8T A;  4C2M C;  2JA8 C;  4Y7N C;  5C4X C;  4ZH4 A;  5FLM C;  4A3D C;  4OIN A;  2EBB A;  3A8J A;  3GTP C;  2PA8 L;  4PAB A;  1XZP B;  4XLN A;  1O2F B;  4A3F K;  1WQF A;  3TFJ A;  4C3I C;  3VA7 A;  4FZB A;  3HOW K;  3S1M C;  2XCQ A;  1TWA C;  3EQL A;  3DXJ A;  2R7Z C;  2JA7 C;  2B63 C;  4C3H C;  2CFA B;  4KMH A;  2A69 A;  3K7A K;  3HOV C;  4Q4Z A;  2GAH C;  3GTK K;  4LLG A;  5EGH A;  1KQ4 A;  3H3V D;  4BXX K;  1IQ0 A;  4WJ3 M;  1K83 K;  2FQO A;  3A8K A;  2JA5 A;  1PJ7 A;  2KWA A;  3GEH A;  4GTE A;  3GSI A;  1BDF A;  3GEI A;  2PMZ D;  5JVO A;  1R9T A;  4Q5S A;  1IL2 A;  2WAQ L;  3T01 A;  3AH5 A;  1WCM A;  3S16 C;  3GTM C;  1JVI A;  1I3Q A;  1TWG K;  4LQY A;  2NVY A;  1ZBS A;  2E2I C;  4A3G K;  4A3L K;  3GTG K;  1TWH K;  2JA6 K;  4LR2 A;  1Y1V C;  4A3K C;  1J98 A;  4GT9 A;  5C44 C;  2GSU A;  4G7H A;  4BBS C;  2YU9 A;  1B4B A;  3PO3 K;  1C0A A;  5IP9 K;  5CHP A;  2NVX A;  3OEP A;  1TWF A;  3H0G K;  1XPP A;  5EGE A;  4PAA A;  1WOS A;  3G4C A;  3OPF A;  1WIH A;  1EFW A;  1PJ5 A;  3S2D K;  2XCO A;  4KMD A;  3GTL K;  2XCR B;  4A3B C;  1EQR A;  1USO A;  4LOW A;  1TWC K;  3CQZ A;  2R92 A;  3L4K A;  3SZZ A;  5IP7 K;  4A3M C;  1WOR A;  3M4O K;  2A68 A;  2NVQ C;  3HOZ C;  3PO2 C;  4C2M K;  2JA8 K;  4GTL A;  4Y7N K;  5C4X K;  1I50 C;  1O26 A;  2BE5 A;  4AYB L;  1SFO C;  1INN A;  4BY7 C;  4YFN A;  4A3D K;  4G7Z A;  3HKZ L;  1I6H C;  1HQM A;  1VLO A;  4XLP A;  3FOE A;  1J6W A;  3GTP K;  3HOU K;  3I4M C;  1BGW A;  3FKI A;  3GIR A;  4KB2 A;  2VUM A;  4C3I K;  3HOY K;  4JK1 A;  3T00 A;  4ILD A;  3S1M K;  1TWA K;  4AH6 A;  5M5W K;  5IOR A;  2Y0S D;  2R7Z K;  2JA7 K;  2B63 K;  3L4J A;  4KAS A;  1J6V A;  1XZQ A;  4GTA A;  3GTO C;  3GTQ C;  3HOV K;  5C4J C;  1F93 A;  4GTC A;  1WQH A;  3S1Q C;  5IYD C;  1IE0 A;  3S17 C;  1YNJ A;  4KAT A;  3RZD C;  3RZO C;  5IOT A;  3LAP A;  4Y52 C;  1IW7 A;  4BBR C;  4A3E C;  2GAG C;  2D6F C;  1TWG A;  2E2H C;  3AD9 C;  2R93 C;  4WIL A;  1USM A;  2ZUE A;  1ZXO A;  1BJT A;  1V5V A;  5M5X K;  4KM9 A;  3I4N C;  2RGR A;  4KB4 A;  1TWH A;  2JA6 A;  3S1R C;  2PHC B;  3AD8 C;  3S16 K;  5HL8 A;  4GTB A;  3GTM K;  4XSZ A;  1IBA A;  1ISE A;  4KDD A;  1AB4 A;  2E2I K;  3BUE A;  4FM9 A;  4A93 C;  5IYB C;  2WB1 L;  3FKI C;  2PPB A;  2V6U A;  2VUM C;  3FHZ A;  5IOS A;  1Y1V K;  3LAJ A;  4A3K K;  2PA8 D;  4QIW L;  3TTG A;  5C44 K;  3N0C A;  5C3E C;  3S2H C;  4BKW A;  3MML B;  3GTL A;  1JOE A;  3S15 C;  1WOP A;  1TWC A;  1Y1W K;  4KMU A;  4KMA A;  1DD5 A;  5CJ9 A;  1XXC A;  1XZP A;  5E68 A;  1HI9 A;  4YG2 A;  5IYC C;  3GTJ A;  4LK1 A;  4BLB A;  2A6H A;  4DDQ A;  1YNN A;  3HOX C;  4A3B K;  1ZYR A;  4OIQ A;  2CFA A;  4A3J C;  1DCO A;  5TMC A;  1DCP A;  1O28 A;  4A3C C;  4OIP A;  4A3M K;  2RH6 A;  2JA5 C;  4QJV A;  5TJ3 A;  1RU0 A;  2NVT C;  2NVQ K;  3HOZ K;  3S14 C;  3GTP A;  3CAG A;  4X6A C;  1WSR A;  3N3Y A;  1R9T C;  2O5J A;  2WAQ D;  4C3J C;  1I50 K;  1SFO K;  4BY7 K;  3S1N C;  1WCM C;  4OIO A;  1TWA A;  3PO3 C;  4BY1 K;  3GDZ A;  3TFH A;  1I6H K;  2R7Z A;  2JA7 A;  1I3Q C;  3TFI A;  2B63 A;  4XCH A;  1L0W A;  4GTD A;  2NVY C;  1PJ6 A;  4LJZ A;  3I4M K;  5FLM K;  1TWC C;  5JFE A;  3H3V L;  3IPJ A;  3GTK A;  1YCL A;  3M3Y C;  3GTJ C;  4GZY A;  3GTO K;  1O29 A;  1O25 A;  3GTQ K;  2YU9 C;  5C4J K;  2W7V A;  3T02 A;  3AD7 C;  4O2D A;  2PMZ L;  5IYD K;  5IOQ A;  1K83 A;  4C3H K;  2NVX C;  3S17 K;  3RZD K;  1F7V A;  1B4A A;  3RZO K;  3SZY A;  1IS1 A;  1TWF C;  2E2J C;  4YFX A;  4A3I C;  3WOD A;  3GTM A;  3AQO A;  4Y52 K;  4BBR K;  4A3E K;  3CQZ C;  2GSN A;  2E2H K;  2R93 K;  2R92 C;  2E2I A;  3HXA A;  4KN4 A;  3HOU C;  4J3N A;  3I4N K;  1I6V A;  5M3F K;  1X31 C;  3NUH A;  4P5B A;  3S1R K;  1VJE A;  1Y1V A;  3HOY C;  3S0X A;  4P9S A;  3JST A;  3A8I A;  4A3F C;  3GTG A;  3QX3 A;  3ADA C;  1WSV A;  1Y1W A;  4A93 K;  4AYB D;  4YFK A;  5IYB K;  3HOW C;  3FOF A;  5L46 A;  3FKI K;  2VUM K;  3HKZ D;  4QJV B;  4XSX A;  2V6T A;  5C3E K;  3S2H K;  3K7A C;  3GTK C;  3S15 K;  1WOO A;  3LPX A;  4MEY A;  4RMF A;  3H0G A;  2GSO A;  2JH3 A;  1ZQ1 C;  5IYC K;  1F7U A;  4BXX C;  5M5Y K;  4BBS K;  1K83 C;  1O27 A;  5D4D A;  4KC6 A;  4KAW X;  4KM8 A;  3HOX K;  4GTF A;  1YX2 A;  4MQ9 A;  5TMF A;  4A3J K;  1DCH A;  1I50 A;  1SMY A;  1SFO A;  4A3C K;  1O2B A;  4BLA A;  4C45 A;  2JA5 K;  5M3M K;  3BP8 C;  3ERE D;  3S14 K;  2NVT K;  1TWG C;  1EK8 A;  1F9N A;  2CW0 A;  4X6A K;  4OIR A;  4M1X A;  2P5M A;  1R9T K;  3BP3 A;  1XXB A;  4C3J K;  4A3G C;  1XZQ B;  4A3L C;  3GTG C;  2ZUF A;  1TWH C;  3GEE A;  2JA6 C;  1Y1W C;  3S1N K;  1WCM K;  4NOI A;  5FJ8 K;  3V4G A;  2Y0S L;  1G51 A;  3G4A A;  3PO2 K;  1I3Q K;  1BS2 A;  1ZVU A;  2NVY K;  3ORE A;  3GTO A;  3GTQ A;  4KN7 A; 
#chains in the Genus database with same CATH homology
 2E2I C;  2PMZ L;  2WB1 D;  5IYD K;  5M5X K;  2NVX C;  4C3H K;  3S17 K;  4A3G K;  5IP9 C;  4A3L K;  3I4N C;  3RZD K;  3GTG K;  3RZO K;  1TWH K;  2JA6 K;  1TWF C;  2O5I A;  1Y1V C;  2E2J C;  4A3K C;  3H0G C;  4YFX A;  3S1R C;  4QIW D;  4A3I C;  4BY7 K;  3S16 K;  3WOD A;  3GTM K;  3M3Y K;  4XSZ A;  3S2D C;  5C44 C;  3GTJ K;  4G7H A;  3GTL C;  4G7O A;  4Y52 K;  4BBR K;  4A3E K;  2YU9 K;  3CQZ C;  4BBS C;  2E2H K;  2R93 K;  2R92 C;  2E2I K;  3PO3 K;  4A93 C;  5IYB C;  2NVX K;  4KN4 A;  2WB1 L;  3HOU C;  5IP9 K;  5IP7 C;  3FKI C;  3I4N K;  2PPB A;  1I6V A;  2VUM C;  5M3F K;  1TWF K;  2A6E A;  1Y1V K;  2E2J K;  4A3K K;  3H0G K;  1XPP A;  4LK0 A;  3S1R K;  3HOY C;  4A3I K;  3S1Q K;  3M4O C;  2PA8 D;  4QIW L;  3S2D K;  5C44 K;  5C3E C;  3S2H C;  4A3B C;  3GTL K;  3CQZ K;  1TWC K;  4BY1 C;  3S15 C;  4A3F C;  4MEX A;  1Y1W K;  2R92 K;  4KMU A;  2JA8 C;  4A93 K;  4Y7N C;  5C4X C;  4AYB D;  4ZH4 A;  4YFK A;  5IYB K;  3HOW C;  5IP7 K;  3FKI K;  2VUM K;  4A3M C;  4YG2 A;  5IYC C;  5FLM C;  3HKZ D;  4OIN A;  4A3D C;  4LK1 A;  4QJV B;  4XSX A;  2A6H A;  3M4O K;  1YNN A;  2A68 A;  3GTP C;  5C3E K;  2NVQ C;  3HOZ C;  2PA8 L;  3HOX C;  3K7A C;  3S2H K;  4A3B K;  4XLN A;  3GTK C;  3S15 K;  4A3F K;  1ZYR A;  4MEY A;  4OIQ A;  3PO2 C;  4C2M K;  2JA8 K;  4A3J C;  4Y7N K;  5C4X K;  5TMC A;  3HOW K;  1I50 C;  2BE5 A;  4AYB L;  1SFO C;  3S1M C;  1TWA C;  4BY7 C;  4A3C C;  4OIP A;  5IYC K;  3EQL A;  4YFN A;  3DXJ A;  4A3M K;  4BXX C;  4A3D K;  5M5Y K;  2JA5 C;  1K83 C;  2JA7 C;  4G7Z A;  3HKZ L;  2R7Z C;  2B63 C;  4BBS K;  5D4D A;  1HQM A;  1I6H C;  4QJV A;  4XLP A;  3GTP K;  3S14 C;  2NVT C;  2NVQ K;  3HOX K;  3HOZ K;  2A69 A;  3K7A K;  3HOU K;  4Q4Z A;  3HOV C;  3GTK K;  4X6A C;  3I4M C;  4LLG A;  1R9T C;  4MQ9 A;  4C3I K;  5TMF A;  2O5J A;  2WAQ D;  4A3J K;  3HOY K;  4JK1 A;  1I50 K;  1SFO K;  3S1M K;  1TWA K;  1SMY A;  4A3C K;  5M5W K;  3S1N C;  3H3V D;  1WCM C;  4OIO A;  3PO3 C;  4BXX K;  2Y0S D;  2R7Z K;  2JA5 K;  1K83 K;  4BY1 K;  2JA7 K;  1I6H K;  5M3M K;  2B63 K;  1I3Q C;  3S14 K;  2NVT K;  1TWG C;  3GTO C;  3GTQ C;  3HOV K;  2CW0 A;  2NVY C;  5C4J C;  4X6A K;  4LJZ A;  3I4M K;  4OIR A;  1BDF A;  1R9T K;  5FLM K;  2PMZ D;  3S1Q C;  4Q5S A;  4C3J K;  5IYD C;  3S17 C;  4A3G C;  1YNJ A;  2WAQ L;  4A3L C;  3RZD C;  3GTG C;  1TWC C;  3RZO C;  1TWH C;  2JA6 C;  1Y1W C;  3S1N K;  1WCM K;  4NOI A;  5FJ8 K;  3H3V L;  2Y0S L;  3PO2 K;  3S16 C;  1I3Q K;  3GTM C;  3M3Y C;  3GTJ C;  4GZY A;  3GTO K;  1TWG K;  1IW7 A;  4Y52 C;  3GTQ K;  4BBR C;  2NVY K;  4A3E C;  2YU9 C;  5C4J K;  2R93 C;  4KN7 A;  2E2H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...