3CQZK

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
b'NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3cqzK00
3PO3K 3S1RC 4A3LC 2A68A 4LLGA 5C4JK 3S15C 3S1QK 4A3DK 2NVYK 2JA6K 2Y0SL 1I6HK 4C3IK 4BY1C 1HQMA 4OIPA 4A3KC 4Y52C 3S1NK 1BDFA 4BBRC 4XLNA 1SMYA 2VUMC 4Y7NC 5IP9K 4A93C 3RZOK 1SFOK 5M5XK 5IYBC 2E2HK 4BY7K 3I4MK 3GTMK 4X6AC 3HOWC 3S2DK 4A3GC 5IP7K 3GTLC 3HOXK 4YG2A 3EQLA 4A3EC 4OIRA 1TWHK 5IYDC 3HOVC 2R93K 5M5YK 4MQ9A 4A3MK 2NVXK 2R92C 1TWCK 3S1QC 2CW0A 4MEYA 2YU9K 4A3CK 1I6HC 4LK1A 3FKIK 4AYBD 4A3FK 4XSXA 3S1MK 1XPPA 3K7AK 5FLMK 2Y0SD 1I6VA 2JA8K 3GTJK 4QIWD 1Y1WC 5IP9C 2E2JK 3RZOC 1SFOC 1I50K 4AYBL 4BY7C 2E2HC 3GTMC 5C3EK 3GTPK 1WCMK 3GTQK 4QIWL 5IP7C 4C3HK 5IYCC 3HOXC 2JA7K 3M3YK 1TWHC 1YNJA 5C4XK 1TWAK 4OIOA 3S2HK 4A3MC 5IYDK 4OINA 3HOYK 2NVXC 4BXXC 2PPBA 1TWCC 1YNNA 2YU9C 4LJZA 4A3CC 5M3MK 4YFNA 4YFKA 3DXJA 4A3FC 2JA5K 3S1MC 4C2MK 5TMCA 3GTKK 2O5JA 3GTPC 5TMFA 2PA8L 2JA8C 3GTJC 4A3JK 3WODA 3H0GK 3PO3C 2E2JC 4BBSK 1I3QK 1I50C 3RZDK 3H3VD 5C4JC 4LK0A 4A3DC 4QJVA 2NVYC 4KN7A 5C3EC 4A3IK 2JA6C 3M4OK 1WCMC 3GTQC 3S14K 3S1NC 3M3YC 3HKZL 4C3JK 3H3VL 1TWAC 5C4XC 3S2HC 3PO2K 4ZH4A 3HOYC 4XSZA 2NVQK 1IW7A 3I4MC 3S2DC 1TWFK 5M3FK 2JA5C 1ZYRA 2E2IK 5C44K 4BY1K 3GTKC 2R93C 4BBSC 4A3JC 2B63K 3H0GC 4YFXA 1R9TK 4Y52K 3HOUK 1I3QC 3RZDC 3I4NK 2PA8D 2NVTK 4G7HA 2O5IA 4A3IC 2A6HA 3M4OC 3CQZK 3FKIC 3GTGK 3S14C 3K7AC 5FLMC 4MEXA 3HOVK 3HKZD 2A6EA 1TWGK 2NVQC 4XLPA 1TWFC 2WB1D 4KN4A 2R92K 2JA7C 3GTOK 5M5WK 2E2IC 2R7ZK 1Y1VK 5C44C 5D4DA 4QJVB 2B63C 2WB1L 1R9TC 3S16K 3S17K 3HOUC 1K83K 4JK1A 4G7ZA 3HOZK 4A3BK 3I4NC 3S1RK 2NVTC 1Y1WK 4A3LK 2WAQD 3CQZC 3S15K 3GTGC 4OIQA 2PMZD 5IYCK 4A3KK 2WAQL 4BBRK 4GZYA 4G7OA 1TWGC 4Y7NK 2VUMK 4A93K 2BE5A 2PMZL 5IYBK 4BXXK 4Q5SA 4X6AK 3HOWK 4NOIA 5FJ8K 3GTOC 4A3GK 2R7ZC 1Y1VC 2A69A 3GTLK 4KMUA 4A3EK 3S16C 3PO2C 4A3BC 3S17C 4Q4ZA 3HOZC 1K83C
chains in the Genus database with same CATH superfamily
4GTLA 3S1RC 2A68A 5C4JK 2JA6K 4BY1C 4PAAA 3GTKA 2ZFZA 4A3KC 3S1NK 1F7VA 3L4KA 4XLNA 3QX3A 3T02A 3RZOK 5IYBC 4P5AA 3GTMK 4GTCA 1USMA 4A3GC 1WSRA 2JH3A 1TWHK 5IYDC 3HOVC 4BLBA 4A3MK 3GEHA 1I6HC 3S1MK 4AYBD 2Y0SD 1I6VA 1R9TA 2JA8K 1Y1WC 1I50K 4BY7C 4KB2A 5C3EK 3CQZA 4QIWL 3HOXC 5IYCC 2JA7K 1ZVUA 3M3YK 1YNJA 1WORA 1ZQ1C 3S2HK 4GTBA 4OINA 3BP3A 1YNNA 2YU9C 4YFNA 2JA5K 2FQTA 3GTKK 2O5JA 5TMFA 3GTJC 4A3JK 3WODA 1K83A 3PO3C 2E2JC 1Y1WA 3RZDK 4QJVA 4A3IK 1EQRA 3SZZA 1BGWA 2FQOA 4KMDA 3H3VL 1WQGA 3PO2K 1IW7A 3S2DC 5IORA 3GSIA 1J98A 1EFWA 2EBBA 4BY1K 2R93C 4DDQA 1R9TK 3GTJA 3HXAA 4RMFA 4ILDA 2NVTK 2PHCB 2O5IA 2A6HA 3M4OC 3CQZK 4KB4A 3K7AC 1DCHA 3HOVK 1SFOA 2NVQC 3SZYA 2RGRA 1USOA 5M5WK 3G4CA 2W7VA 5C44C 5D4DA 2B63C 3S16K 2WB1L 2R93A 1K83K 3I4NC 4KC6A 3TTGA 4FM9A 1Y1WK 2NVXA 2WAQD 5IYCK 1AB4A 3ERED 4BBRK 1IQ0A 1TWGC 1X31C 4Y7NK 1O24A 4Q5SA 4NOIA 4KATA 3GTLK 1TWAA 4Q4ZA 5CHPA 2XCQA 3PO3K 3TFHA 3S15C 3FOEA 2Y0SL 5L46A 1HQMA 1WIHA 2GSUA 2VUMC 5IP9K 1TWGA 1SFOK 2V6SA 2E2HK 4X6AC 3S2DK 1VLOA 2R93K 1ISEA 4WILA 2NVXK 1WQFA 2R92C 1O28A 3S1QC 4C3IC 4LK1A 4XSXA 1VGXA 3ADAC 3K7AK 5EGHA 4BKWA 1O2AA 2CFAA 1WCMK 3GTQK 2GAHC 5IP7C 4C3HK 4GT9A 1TWAK 1TWCC 2R92A 1V5VA 4A3CC 3GTOA 4A3FC 1O27A 3IPJA 4M1XA 4KN7A 1IL2A 3AQOA 5C4XC 1WQHA 3HOYC 4LQYA 4AH6A 1KQ4A 2D6FC 1TWCA 1J6VA 4KASA 3JSTA 1XZPB 2E2IK 4BBSC 3H0GC 3HOUK 1I3QC 2PA8D 4G7HA 3S14C 3CAGA 3A8IA 4KARA 4C3JC 1GE9A 3BP8C 5IOTA 4BLAA 2A6EA 4J3NA 1TWFC 1WSVA 3OREA 4KN4A 2R92K 3GTOK 1INNA 4KMHA 1DCPA 3S17K 4G7ZA 3H0GA 4JK1A 3GEIA 3S1RK 4LOWA 1PJ5A 2YU9A 3GTGC 4OIQA 4C2MC 4A3KK 2CFAB 3N3YA 2P8TA 2V6TA 2BE5A 2PMZL 5IYBK 1EH1A 1XXAA 1TWFA 4FZBA 2ZUEA 4A3GK 2R7ZC 1Y1VC 4KMUA 5IYDK 4A3BC 3HOZC 4GFQA 2RH6A 4A3LC 1B4BA 1HI9A 4P9SA 3GTGA 1I6HK 4Y52C 1JQWA 4KMAA 4KAWX 4A93C 3MMLB 4KDDA 1UV7A 5M5XK 4BY7K 4LR2A 3HOWC 1IBAA 3HOXK 5CJ9A 4A3EC 1F7UA 4GTAA 4PABA 2CW0A 2YU9K 2GAGC 2B63A 3FOFA 3GTJK 4QIWD 2E2JK 3RZOC 1ZXOA 1XZPA 4AYBL 3GTMC 3G4AA 1WOOA 2V6UA 1ZBSA 1TWHC 4G0UA 4OIOA 4A3MC 4XCHA 3GEEA 4LJZA 3S1MC 4C2MK 5TMCA 3GTPC 2PA8L 2JA8C 1I50C 3H3VD 4LK0A 4A3DC 2NVYC 5C3EC 3M4OK 3OPFA 1O26A 5EGEA 3M3YC 1TWHA 3S2HC 4KM8A 5IOQA 2VUMA 2GSOA 4XSZA 2NVQK 3I4MC 1PJ7A 2KWAA 1EI6A 2JA5C 1ZYRA 3GIRA 5C44K 3GTKC 5JFEA 4A3JC 2B63K 3GTPA 4YFXA 4Y52K 1VRQC 3RZDC 3I4NK 4WJ3M 1JVIA 4A3IC 1YCLA 2NVYA 1VH2A 3FKIC 5FLMC 3HKZD 3N0BA 1TWGK 2WB1D 1O2FB 2JA5A 1O25A 1R9TC 1DD5A 2NVTC 1VJEA 1C0AA 4GTEA 1YX2A 4GTDA 3CQZC 1G51A 1DCOA 3S15K 3FKIA 1BJTA 3NUHA 2WAQL 4GZYA 2VUMK 2ZUFA 3V4GA 1O2BA 4X6AK 4GTFA 5FJ8K 2A69A 3S16C 1K83C 1F93A 3GTPK 4LLGA 3AD9C 3S1QK 4A3DK 2NVYK 4C3IK 3S0XA 4OIPA 2XCRB 3A8JA 1BDFA 4BBRC 1SMYA 1I3QA 4Y7NC 4G0WA 3AD7C 4C45A 3L4JA 3I4MK 5TJ3A 3Q3QA 1XXBA 5IP7K 3TFIA 3GTLC 4YG2A 1WOPA 2P5MA 3AH5A 3EQLA 4OIRA 4WJ4A 1IS1A 5M5YK 4MQ9A 3BUEA 1O29A 1TWCK 4MEYA 4A3CK 1XXCA 3FKIK 4A3FK 1XPPA 5FLMK 1EK8A 5IP9C 3AD8C 1SFOC 2E2HC 3AQPA 3LAJA 3GTLA 5C4XK 3HOYK 2NVXC 4BXXC 1B4AA 2PPBA 1F9NA 1XZQA 5M3MK 4YFKA 2XCOA 1Y1VA 3DXJA 2R7ZA 4BBSK 3H0GK 2Y3PA 1J6XA 1I3QK 5C4JC 3T00A 2JA6C 2E2HA 1WCMC 3GTQC 4P5BA 5E68A 3S14K 4C3HC 5IOSA 3S1NC 3HKZL 4C3JK 1TWAC 1BS2A 1J6WA 4ZH4A 3OEPA 2GSNA 3A8KA 1TWFK 5M3FK 5JVOA 3N0CA 3FHZA 3T01A 2JA6A 3GTGK 1WCMA 3GTQA 3GDZA 4KM9A 4G0VA 1JOEA 4MEXA 4XLPA 3GTMA 2JA7C 2E2IC 2R7ZK 1Y1VK 1WOSA 4QJVB 3VA7A 4A3BK 3HOUC 3HOZK 4A3LK 1L0WA 1IE0A 2PMZD 5HL8A 1PJ6A 1RU0A 3LPXA 3LAPA 4G7OA 1I50A 4A93K 4BXXK 3HOWK 3GTOC 2JA7A 3TFJA 4O2DA 4A3EK 2E2IA 3PO2C 1XZQB 3S17C
chains in the Genus database with same CATH topology
3PO3K 3S1RC 4A3LC 2A68A 4LLGA 5C4JK 3S15C 3S1QK 4A3DK 2NVYK 2JA6K 2Y0SL 1I6HK 4C3IK 4BY1C 1HQMA 4OIPA 4A3KC 4Y52C 3S1NK 1BDFA 4BBRC 4XLNA 1SMYA 2VUMC 4Y7NC 5IP9K 4A93C 3RZOK 1SFOK 5M5XK 5IYBC 2E2HK 4BY7K 3I4MK 3GTMK 4X6AC 3HOWC 3S2DK 4A3GC 5IP7K 3GTLC 3HOXK 4YG2A 3EQLA 4A3EC 4OIRA 1TWHK 5IYDC 3HOVC 2R93K 5M5YK 4MQ9A 4A3MK 2NVXK 2R92C 1TWCK 3S1QC 2CW0A 4MEYA 2YU9K 4A3CK 1I6HC 4LK1A 3FKIK 4AYBD 4A3FK 4XSXA 3S1MK 1XPPA 3K7AK 5FLMK 2Y0SD 1I6VA 2JA8K 3GTJK 4QIWD 1Y1WC 5IP9C 2E2JK 3RZOC 1SFOC 1I50K 4AYBL 4BY7C 2E2HC 3GTMC 5C3EK 3GTPK 1WCMK 3GTQK 4QIWL 5IP7C 4C3HK 5IYCC 3HOXC 2JA7K 3M3YK 1TWHC 1YNJA 5C4XK 1TWAK 4OIOA 3S2HK 4A3MC 5IYDK 4OINA 3HOYK 2NVXC 4BXXC 2PPBA 1TWCC 1YNNA 2YU9C 4LJZA 4A3CC 5M3MK 4YFNA 4YFKA 3DXJA 4A3FC 2JA5K 3S1MC 4C2MK 5TMCA 3GTKK 2O5JA 3GTPC 5TMFA 2PA8L 2JA8C 3GTJC 4A3JK 3WODA 3H0GK 3PO3C 2E2JC 4BBSK 1I3QK 1I50C 3RZDK 3H3VD 5C4JC 4LK0A 4A3DC 4QJVA 2NVYC 4KN7A 5C3EC 4A3IK 2JA6C 3M4OK 1WCMC 3GTQC 3S14K 3S1NC 3M3YC 3HKZL 4C3JK 3H3VL 1TWAC 5C4XC 3S2HC 3PO2K 4ZH4A 3HOYC 4XSZA 2NVQK 1IW7A 3I4MC 3S2DC 1TWFK 5M3FK 2JA5C 1ZYRA 2E2IK 5C44K 4BY1K 3GTKC 2R93C 4BBSC 4A3JC 2B63K 3H0GC 4YFXA 1R9TK 4Y52K 3HOUK 1I3QC 3RZDC 3I4NK 2PA8D 2NVTK 4G7HA 2O5IA 4A3IC 2A6HA 3M4OC 3CQZK 3FKIC 3GTGK 3S14C 3K7AC 5FLMC 4MEXA 3HOVK 3HKZD 2A6EA 1TWGK 2NVQC 4XLPA 1TWFC 2WB1D 4KN4A 2R92K 2JA7C 3GTOK 5M5WK 2E2IC 2R7ZK 1Y1VK 5C44C 5D4DA 4QJVB 2B63C 2WB1L 1R9TC 3S16K 3S17K 3HOUC 1K83K 4JK1A 4G7ZA 3HOZK 4A3BK 3I4NC 3S1RK 2NVTC 1Y1WK 4A3LK 2WAQD 3CQZC 3S15K 3GTGC 4OIQA 2PMZD 5IYCK 4A3KK 2WAQL 4BBRK 4GZYA 4G7OA 1TWGC 4Y7NK 2VUMK 4A93K 2BE5A 2PMZL 5IYBK 4BXXK 4Q5SA 4X6AK 3HOWK 4NOIA 5FJ8K 3GTOC 4A3GK 2R7ZC 1Y1VC 2A69A 3GTLK 4KMUA 4A3EK 3S16C 3PO2C 4A3BC 3S17C 4Q4ZA 3HOZC 1K83C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 K;  3S1R C;  4A3L C;  2A68 A;  4LLG A;  5C4J K;  3S15 C;  3S1Q K;  4A3D K;  2NVY K;  2JA6 K;  2Y0S L;  1I6H K;  4C3I K;  4BY1 C;  1HQM A;  4OIP A;  4A3K C;  4Y52 C;  3S1N K;  1BDF A;  4BBR C;  4XLN A;  1SMY A;  2VUM C;  4Y7N C;  5IP9 K;  4A93 C;  3RZO K;  1SFO K;  5M5X K;  5IYB C;  2E2H K;  4BY7 K;  3I4M K;  3GTM K;  4X6A C;  3HOW C;  3S2D K;  4A3G C;  5IP7 K;  3GTL C;  3HOX K;  4YG2 A;  3EQL A;  4A3E C;  4OIR A;  1TWH K;  5IYD C;  3HOV C;  2R93 K;  5M5Y K;  4MQ9 A;  4A3M K;  2NVX K;  2R92 C;  1TWC K;  3S1Q C;  2CW0 A;  4MEY A;  2YU9 K;  4A3C K;  1I6H C;  4LK1 A;  3FKI K;  4AYB D;  4A3F K;  4XSX A;  3S1M K;  1XPP A;  3K7A K;  5FLM K;  2Y0S D;  1I6V A;  2JA8 K;  3GTJ K;  4QIW D;  1Y1W C;  5IP9 C;  2E2J K;  3RZO C;  1SFO C;  1I50 K;  4AYB L;  4BY7 C;  2E2H C;  3GTM C;  5C3E K;  3GTP K;  1WCM K;  3GTQ K;  4QIW L;  5IP7 C;  4C3H K;  5IYC C;  3HOX C;  2JA7 K;  3M3Y K;  1TWH C;  1YNJ A;  5C4X K;  1TWA K;  4OIO A;  3S2H K;  4A3M C;  5IYD K;  4OIN A;  3HOY K;  2NVX C;  4BXX C;  2PPB A;  1TWC C;  1YNN A;  2YU9 C;  4LJZ A;  4A3C C;  5M3M K;  4YFN A;  4YFK A;  3DXJ A;  4A3F C;  2JA5 K;  3S1M C;  4C2M K;  5TMC A;  3GTK K;  2O5J A;  3GTP C;  5TMF A;  2PA8 L;  2JA8 C;  3GTJ C;  4A3J K;  3WOD A;  3H0G K;  3PO3 C;  2E2J C;  4BBS K;  1I3Q K;  1I50 C;  3RZD K;  3H3V D;  5C4J C;  4LK0 A;  4A3D C;  4QJV A;  2NVY C;  4KN7 A;  5C3E C;  4A3I K;  2JA6 C;  3M4O K;  1WCM C;  3GTQ C;  3S14 K;  3S1N C;  3M3Y C;  3HKZ L;  4C3J K;  3H3V L;  1TWA C;  5C4X C;  3S2H C;  3PO2 K;  4ZH4 A;  3HOY C;  4XSZ A;  2NVQ K;  1IW7 A;  3I4M C;  3S2D C;  1TWF K;  5M3F K;  2JA5 C;  1ZYR A;  2E2I K;  5C44 K;  4BY1 K;  3GTK C;  2R93 C;  4BBS C;  4A3J C;  2B63 K;  3H0G C;  4YFX A;  1R9T K;  4Y52 K;  3HOU K;  1I3Q C;  3RZD C;  3I4N K;  2PA8 D;  2NVT K;  4G7H A;  2O5I A;  4A3I C;  2A6H A;  3M4O C;  3CQZ K;  3FKI C;  3GTG K;  3S14 C;  3K7A C;  5FLM C;  4MEX A;  3HOV K;  3HKZ D;  2A6E A;  1TWG K;  2NVQ C;  4XLP A;  1TWF C;  2WB1 D;  4KN4 A;  2R92 K;  2JA7 C;  3GTO K;  5M5W K;  2E2I C;  2R7Z K;  1Y1V K;  5C44 C;  5D4D A;  4QJV B;  2B63 C;  2WB1 L;  1R9T C;  3S16 K;  3S17 K;  3HOU C;  1K83 K;  4JK1 A;  4G7Z A;  3HOZ K;  4A3B K;  3I4N C;  3S1R K;  2NVT C;  1Y1W K;  4A3L K;  2WAQ D;  3CQZ C;  3S15 K;  3GTG C;  4OIQ A;  2PMZ D;  5IYC K;  4A3K K;  2WAQ L;  4BBR K;  4GZY A;  4G7O A;  1TWG C;  4Y7N K;  2VUM K;  4A93 K;  2BE5 A;  2PMZ L;  5IYB K;  4BXX K;  4Q5S A;  4X6A K;  3HOW K;  4NOI A;  5FJ8 K;  3GTO C;  4A3G K;  2R7Z C;  1Y1V C;  2A69 A;  3GTL K;  4KMU A;  4A3E K;  3S16 C;  3PO2 C;  4A3B C;  3S17 C;  4Q4Z A;  3HOZ C;  1K83 C; 
#chains in the Genus database with same CATH topology
 4GTL A;  3S1R C;  2A68 A;  5C4J K;  2JA6 K;  4BY1 C;  4PAA A;  3GTK A;  2ZFZ A;  4A3K C;  3S1N K;  1F7V A;  3L4K A;  4XLN A;  3QX3 A;  3T02 A;  3RZO K;  5IYB C;  4P5A A;  3GTM K;  4GTC A;  1USM A;  4A3G C;  1WSR A;  2JH3 A;  1TWH K;  5IYD C;  3HOV C;  4BLB A;  4A3M K;  3GEH A;  1I6H C;  3S1M K;  4AYB D;  2Y0S D;  1I6V A;  1R9T A;  2JA8 K;  1Y1W C;  1I50 K;  4BY7 C;  4KB2 A;  5C3E K;  3CQZ A;  4QIW L;  3HOX C;  5IYC C;  2JA7 K;  1ZVU A;  3M3Y K;  1YNJ A;  1WOR A;  1ZQ1 C;  3S2H K;  4GTB A;  4OIN A;  3BP3 A;  1YNN A;  2YU9 C;  4YFN A;  2JA5 K;  2FQT A;  3GTK K;  2O5J A;  5TMF A;  3GTJ C;  4A3J K;  3WOD A;  1K83 A;  3PO3 C;  2E2J C;  1Y1W A;  3RZD K;  4QJV A;  4A3I K;  1EQR A;  3SZZ A;  1BGW A;  2FQO A;  4KMD A;  3H3V L;  1WQG A;  3PO2 K;  1IW7 A;  3S2D C;  5IOR A;  3GSI A;  1J98 A;  1EFW A;  2EBB A;  4BY1 K;  2R93 C;  4DDQ A;  1R9T K;  3GTJ A;  3HXA A;  4RMF A;  4ILD A;  2NVT K;  2PHC B;  2O5I A;  2A6H A;  3M4O C;  3CQZ K;  4KB4 A;  3K7A C;  1DCH A;  3HOV K;  1SFO A;  2NVQ C;  3SZY A;  2RGR A;  1USO A;  5M5W K;  3G4C A;  2W7V A;  5C44 C;  5D4D A;  2B63 C;  3S16 K;  2WB1 L;  2R93 A;  1K83 K;  3I4N C;  4KC6 A;  3TTG A;  4FM9 A;  1Y1W K;  2NVX A;  2WAQ D;  5IYC K;  1AB4 A;  3ERE D;  4BBR K;  1IQ0 A;  1TWG C;  1X31 C;  4Y7N K;  1O24 A;  4Q5S A;  4NOI A;  4KAT A;  3GTL K;  1TWA A;  4Q4Z A;  5CHP A;  2XCQ A;  3PO3 K;  3TFH A;  3S15 C;  3FOE A;  2Y0S L;  5L46 A;  1HQM A;  1WIH A;  2GSU A;  2VUM C;  5IP9 K;  1TWG A;  1SFO K;  2V6S A;  2E2H K;  4X6A C;  3S2D K;  1VLO A;  2R93 K;  1ISE A;  4WIL A;  2NVX K;  1WQF A;  2R92 C;  1O28 A;  3S1Q C;  4C3I C;  4LK1 A;  4XSX A;  1VGX A;  3ADA C;  3K7A K;  5EGH A;  4BKW A;  1O2A A;  2CFA A;  1WCM K;  3GTQ K;  2GAH C;  5IP7 C;  4C3H K;  4GT9 A;  1TWA K;  1TWC C;  2R92 A;  1V5V A;  4A3C C;  3GTO A;  4A3F C;  1O27 A;  3IPJ A;  4M1X A;  4KN7 A;  1IL2 A;  3AQO A;  5C4X C;  1WQH A;  3HOY C;  4LQY A;  4AH6 A;  1KQ4 A;  2D6F C;  1TWC A;  1J6V A;  4KAS A;  3JST A;  1XZP B;  2E2I K;  4BBS C;  3H0G C;  3HOU K;  1I3Q C;  2PA8 D;  4G7H A;  3S14 C;  3CAG A;  3A8I A;  4KAR A;  4C3J C;  1GE9 A;  3BP8 C;  5IOT A;  4BLA A;  2A6E A;  4J3N A;  1TWF C;  1WSV A;  3ORE A;  4KN4 A;  2R92 K;  3GTO K;  1INN A;  4KMH A;  1DCP A;  3S17 K;  4G7Z A;  3H0G A;  4JK1 A;  3GEI A;  3S1R K;  4LOW A;  1PJ5 A;  2YU9 A;  3GTG C;  4OIQ A;  4C2M C;  4A3K K;  2CFA B;  3N3Y A;  2P8T A;  2V6T A;  2BE5 A;  2PMZ L;  5IYB K;  1EH1 A;  1XXA A;  1TWF A;  4FZB A;  2ZUE A;  4A3G K;  2R7Z C;  1Y1V C;  4KMU A;  5IYD K;  4A3B C;  3HOZ C;  4GFQ A;  2RH6 A;  4A3L C;  1B4B A;  1HI9 A;  4P9S A;  3GTG A;  1I6H K;  4Y52 C;  1JQW A;  4KMA A;  4KAW X;  4A93 C;  3MML B;  4KDD A;  1UV7 A;  5M5X K;  4BY7 K;  4LR2 A;  3HOW C;  1IBA A;  3HOX K;  5CJ9 A;  4A3E C;  1F7U A;  4GTA A;  4PAB A;  2CW0 A;  2YU9 K;  2GAG C;  2B63 A;  3FOF A;  3GTJ K;  4QIW D;  2E2J K;  3RZO C;  1ZXO A;  1XZP A;  4AYB L;  3GTM C;  3G4A A;  1WOO A;  2V6U A;  1ZBS A;  1TWH C;  4G0U A;  4OIO A;  4A3M C;  4XCH A;  3GEE A;  4LJZ A;  3S1M C;  4C2M K;  5TMC A;  3GTP C;  2PA8 L;  2JA8 C;  1I50 C;  3H3V D;  4LK0 A;  4A3D C;  2NVY C;  5C3E C;  3M4O K;  3OPF A;  1O26 A;  5EGE A;  3M3Y C;  1TWH A;  3S2H C;  4KM8 A;  5IOQ A;  2VUM A;  2GSO A;  4XSZ A;  2NVQ K;  3I4M C;  1PJ7 A;  2KWA A;  1EI6 A;  2JA5 C;  1ZYR A;  3GIR A;  5C44 K;  3GTK C;  5JFE A;  4A3J C;  2B63 K;  3GTP A;  4YFX A;  4Y52 K;  1VRQ C;  3RZD C;  3I4N K;  4WJ3 M;  1JVI A;  4A3I C;  1YCL A;  2NVY A;  1VH2 A;  3FKI C;  5FLM C;  3HKZ D;  3N0B A;  1TWG K;  2WB1 D;  1O2F B;  2JA5 A;  1O25 A;  1R9T C;  1DD5 A;  2NVT C;  1VJE A;  1C0A A;  4GTE A;  1YX2 A;  4GTD A;  3CQZ C;  1G51 A;  1DCO A;  3S15 K;  3FKI A;  1BJT A;  3NUH A;  2WAQ L;  4GZY A;  2VUM K;  2ZUF A;  3V4G A;  1O2B A;  4X6A K;  4GTF A;  5FJ8 K;  2A69 A;  3S16 C;  1K83 C;  1F93 A;  3GTP K;  4LLG A;  3AD9 C;  3S1Q K;  4A3D K;  2NVY K;  4C3I K;  3S0X A;  4OIP A;  2XCR B;  3A8J A;  1BDF A;  4BBR C;  1SMY A;  1I3Q A;  4Y7N C;  4G0W A;  3AD7 C;  4C45 A;  3L4J A;  3I4M K;  5TJ3 A;  3Q3Q A;  1XXB A;  5IP7 K;  3TFI A;  3GTL C;  4YG2 A;  1WOP A;  2P5M A;  3AH5 A;  3EQL A;  4OIR A;  4WJ4 A;  1IS1 A;  5M5Y K;  4MQ9 A;  3BUE A;  1O29 A;  1TWC K;  4MEY A;  4A3C K;  1XXC A;  3FKI K;  4A3F K;  1XPP A;  5FLM K;  1EK8 A;  5IP9 C;  3AD8 C;  1SFO C;  2E2H C;  3AQP A;  3LAJ A;  3GTL A;  5C4X K;  3HOY K;  2NVX C;  4BXX C;  1B4A A;  2PPB A;  1F9N A;  1XZQ A;  5M3M K;  4YFK A;  2XCO A;  1Y1V A;  3DXJ A;  2R7Z A;  4BBS K;  3H0G K;  2Y3P A;  1J6X A;  1I3Q K;  5C4J C;  3T00 A;  2JA6 C;  2E2H A;  1WCM C;  3GTQ C;  4P5B A;  5E68 A;  3S14 K;  4C3H C;  5IOS A;  3S1N C;  3HKZ L;  4C3J K;  1TWA C;  1BS2 A;  1J6W A;  4ZH4 A;  3OEP A;  2GSN A;  3A8K A;  1TWF K;  5M3F K;  5JVO A;  3N0C A;  3FHZ A;  3T01 A;  2JA6 A;  3GTG K;  1WCM A;  3GTQ A;  3GDZ A;  4KM9 A;  4G0V A;  1JOE A;  4MEX A;  4XLP A;  3GTM A;  2JA7 C;  2E2I C;  2R7Z K;  1Y1V K;  1WOS A;  4QJV B;  3VA7 A;  4A3B K;  3HOU C;  3HOZ K;  4A3L K;  1L0W A;  1IE0 A;  2PMZ D;  5HL8 A;  1PJ6 A;  1RU0 A;  3LPX A;  3LAP A;  4G7O A;  1I50 A;  4A93 K;  4BXX K;  3HOW K;  3GTO C;  2JA7 A;  3TFJ A;  4O2D A;  4A3E K;  2E2I A;  3PO2 C;  1XZQ B;  3S17 C; 
#chains in the Genus database with same CATH homology
 3PO3 K;  3S1R C;  4A3L C;  2A68 A;  4LLG A;  5C4J K;  3S15 C;  3S1Q K;  4A3D K;  2NVY K;  2JA6 K;  2Y0S L;  1I6H K;  4C3I K;  4BY1 C;  1HQM A;  4OIP A;  4A3K C;  4Y52 C;  3S1N K;  1BDF A;  4BBR C;  4XLN A;  1SMY A;  2VUM C;  4Y7N C;  5IP9 K;  4A93 C;  3RZO K;  1SFO K;  5M5X K;  5IYB C;  2E2H K;  4BY7 K;  3I4M K;  3GTM K;  4X6A C;  3HOW C;  3S2D K;  4A3G C;  5IP7 K;  3GTL C;  3HOX K;  4YG2 A;  3EQL A;  4A3E C;  4OIR A;  1TWH K;  5IYD C;  3HOV C;  2R93 K;  5M5Y K;  4MQ9 A;  4A3M K;  2NVX K;  2R92 C;  1TWC K;  3S1Q C;  2CW0 A;  4MEY A;  2YU9 K;  4A3C K;  1I6H C;  4LK1 A;  3FKI K;  4AYB D;  4A3F K;  4XSX A;  3S1M K;  1XPP A;  3K7A K;  5FLM K;  2Y0S D;  1I6V A;  2JA8 K;  3GTJ K;  4QIW D;  1Y1W C;  5IP9 C;  2E2J K;  3RZO C;  1SFO C;  1I50 K;  4AYB L;  4BY7 C;  2E2H C;  3GTM C;  5C3E K;  3GTP K;  1WCM K;  3GTQ K;  4QIW L;  5IP7 C;  4C3H K;  5IYC C;  3HOX C;  2JA7 K;  3M3Y K;  1TWH C;  1YNJ A;  5C4X K;  1TWA K;  4OIO A;  3S2H K;  4A3M C;  5IYD K;  4OIN A;  3HOY K;  2NVX C;  4BXX C;  2PPB A;  1TWC C;  1YNN A;  2YU9 C;  4LJZ A;  4A3C C;  5M3M K;  4YFN A;  4YFK A;  3DXJ A;  4A3F C;  2JA5 K;  3S1M C;  4C2M K;  5TMC A;  3GTK K;  2O5J A;  3GTP C;  5TMF A;  2PA8 L;  2JA8 C;  3GTJ C;  4A3J K;  3WOD A;  3H0G K;  3PO3 C;  2E2J C;  4BBS K;  1I3Q K;  1I50 C;  3RZD K;  3H3V D;  5C4J C;  4LK0 A;  4A3D C;  4QJV A;  2NVY C;  4KN7 A;  5C3E C;  4A3I K;  2JA6 C;  3M4O K;  1WCM C;  3GTQ C;  3S14 K;  3S1N C;  3M3Y C;  3HKZ L;  4C3J K;  3H3V L;  1TWA C;  5C4X C;  3S2H C;  3PO2 K;  4ZH4 A;  3HOY C;  4XSZ A;  2NVQ K;  1IW7 A;  3I4M C;  3S2D C;  1TWF K;  5M3F K;  2JA5 C;  1ZYR A;  2E2I K;  5C44 K;  4BY1 K;  3GTK C;  2R93 C;  4BBS C;  4A3J C;  2B63 K;  3H0G C;  4YFX A;  1R9T K;  4Y52 K;  3HOU K;  1I3Q C;  3RZD C;  3I4N K;  2PA8 D;  2NVT K;  4G7H A;  2O5I A;  4A3I C;  2A6H A;  3M4O C;  3CQZ K;  3FKI C;  3GTG K;  3S14 C;  3K7A C;  5FLM C;  4MEX A;  3HOV K;  3HKZ D;  2A6E A;  1TWG K;  2NVQ C;  4XLP A;  1TWF C;  2WB1 D;  4KN4 A;  2R92 K;  2JA7 C;  3GTO K;  5M5W K;  2E2I C;  2R7Z K;  1Y1V K;  5C44 C;  5D4D A;  4QJV B;  2B63 C;  2WB1 L;  1R9T C;  3S16 K;  3S17 K;  3HOU C;  1K83 K;  4JK1 A;  4G7Z A;  3HOZ K;  4A3B K;  3I4N C;  3S1R K;  2NVT C;  1Y1W K;  4A3L K;  2WAQ D;  3CQZ C;  3S15 K;  3GTG C;  4OIQ A;  2PMZ D;  5IYC K;  4A3K K;  2WAQ L;  4BBR K;  4GZY A;  4G7O A;  1TWG C;  4Y7N K;  2VUM K;  4A93 K;  2BE5 A;  2PMZ L;  5IYB K;  4BXX K;  4Q5S A;  4X6A K;  3HOW K;  4NOI A;  5FJ8 K;  3GTO C;  4A3G K;  2R7Z C;  1Y1V C;  2A69 A;  3GTL K;  4KMU A;  4A3E K;  3S16 C;  3PO2 C;  4A3B C;  3S17 C;  4Q4Z A;  3HOZ C;  1K83 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...