4QJVB

The x-ray crystal structure of rpo3/rpo11 heterodimer of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit D
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qjvB00
2B63K 4YFXA 3H3VD 2A6EA 4LLGA 3S1NK 4BBRC 2YU9K 5C3EK 3S17C 3H3VL 1I50C 3EQLA 4LJZA 3RZOK 5IYCK 5M5XK 4Q4ZA 2NVQK 1I6VA 3GTMK 2BE5A 2R7ZK 5TMCA 2VUMK 4G7HA 3HOUK 3S1RK 1TWFC 2E2IK 3GTLK 4A3KC 4A93K 2A6HA 3I4NK 3I4MC 1Y1VK 5D4DA 4BXXK 4A3IC 4BBSC 3WODA 2JA6C 3S16C 3HOXK 4BY7K 4A3JC 3GTGK 3HOVC 4A3DK 1TWHK 4KN4A 3S1NC 3CQZC 1R9TK 5C3EC 2JA8C 3S17K 3HOYC 4QIWL 2Y0SL 4A3EK 1YNNA 3GTKC 3GTMC 2WB1L 1YNJA 1ZYRA 1WCMC 4C3JK 2JA5C 4QIWD 2Y0SD 3S2DC 5M3FK 5IYBK 1K83C 5IP7C 3K7AK 2WB1D 1TWGC 2E2HC 5IP9K 2PMZD 3GTOC 3GTPK 1BDFA 3PO2K 3HOWK 3S14K 4Y52K 5IYDK 3FKIK 4MEXA 4YFNA 3M3YC 5FLMC 3PO3C 3S1MC 4LK0A 2R93K 2E2JK 2PMZL 4X6AC 3H0GC 3S15C 3GTQK 4A3BC 5C4XC 4A3CC 1I3QC 2PPBA 3S1QC 2PA8L 4A3GC 4OINA 3RZDK 4BY1C 4Q5SA 4QJVA 4Y7NK 2A69A 5M3MK 4XSZA 2JA5K 1TWAC 3HOZK 3S2DK 4A3LC 2PA8D 2VUMC 4A3MK 1K83K 5IP7K 5C44C 4A3FC 4OIQA 1TWFK 3GTLC 3GTOK 3M4OK 4JK1A 4ZH4A 1Y1VC 3PO3K 2R93C 2R7ZC 3DXJA 4A3IK 4A93C 5C4JC 3HOUC 1Y1WC 3I4MK 3S1RC 4A3JK 4A3DC 5M5YK 2E2IC 1TWHC 4BXXC 4XLNA 4AYBL 3CQZK 1R9TC 2NVXC 4KN7A 1XPPA 2JA7K 2JA8K 3GTGC 3HOVK 4BBSK 3GTJC 3S16K 2NVTC 4AYBD 1SFOC 3HOYK 2O5JA 2WAQL 5C44K 4MQ9A 4OIOA 1TWCK 3M4OC 5IYCC 2B63C 4YFKA 2NVTK 2A68A 3RZOC 2WAQD 2NVQC 4BBRK 4XLPA 2YU9C 4MEYA 5C4JK 1Y1WK 1TWGK 1I50K 4A3KK 4QJVB 3FKIC 2NVXK 1I6HK 2R92C 3GTJK 4X6AK 4G7OA 3H0GK 1SMYA 2CW0A 3GTQC 4YG2A 1SFOK 1I3QK 4G7ZA 4Y7NC 5C4XK 3S15K 1TWAK 4A3GK 2NVYC 4C2MK 3S2HC 3HKZL 4A3EC 3S1QK 4A3FK 3HOZC 3RZDC 4BY1K 4GZYA 3GTKK 4OIRA 4A3LK 5M5WK 4C3IK 3HKZD 4A3MC 4C3HK 4NOIA 1IW7A 4BY7C 1I6HC 5IYDC 3HOWC 1WCMK 5FJ8K 5IP9C 4Y52C 2R92K 5FLMK 3S1MK 3PO2C 5TMFA 2JA7C 5IYBC 2E2JC 3M3YK 1HQMA 3K7AC 2E2HK 3S14C 3GTPC 4A3BK 4LK1A 3I4NC 2O5IA 2NVYK 3S2HK 4OIPA 4A3CK 4KMUA 2JA6K 1TWCC 4XSXA 3HOXC
chains in the Genus database with same CATH superfamily
2B63K 3FOEA 1TWCA 1XZPA 2FQOA 3S17C 1DD5A 5IYCK 1I6VA 3GTMK 3GDZA 2VUMK 2E2IK 4A3KC 3SZYA 1Y1VK 4GTEA 2R92A 1YX2A 4A3CK 4A3DK 3S1NC 2JA8C 4KATA 4KDDA 1YNNA 2B63A 4KB2A 4G0WA 2XCQA 3FOFA 3GTQA 2JA5C 4AH6A 3AD7C 5IP7C 2CFAA 3GSIA 4C3HC 5IP9K 3FKIA 5IORA 2RGRA 4MEXA 2NVXA 2E2HA 3TTGA 2E2JK 4FZBA 3H0GC 1USMA 3H0GA 4WJ3M 1EI6A 3AD8C 3BUEA 3RZDK 4P5BA 4QJVA 4Q5SA 2A69A 5M3MK 4C3JC 2ZUFA 2VUMC 1K83K 5C44C 1WSVA 1L0WA 4A3IK 3IPJA 1PJ5A 4KMHA 5EGHA 1WIHA 3I4MK 3S1RC 5M5YK 1TWHC 1TWHA 5L46A 2JA7A 3CQZK 1KQ4A 3N3YA 2JA8K 4O2DA 2JA7K 4BBSK 2P5MA 3G4CA 2GSOA 4AYBD 5TJ3A 3FHZA 4MQ9A 3M4OC 1Y1WK 4A3KK 3T02A 1I6HK 1EFWA 2V6SA 3H0GK 2CW0A 2W7VA 4YG2A 1SFOK 4GTLA 1I3QK 2FQTA 1TWAK 4A3FK 1ZVUA 4GZYA 1PJ6A 4A3LK 5M5WK 4NOIA 1IW7A 5IYDC 1WCMK 3AQOA 3PO2C 2JA7C 3AD9C 1HQMA 1XXBA 3GTPC 4A3BK 1GE9A 3S0XA 4LQYA 2NVYK 4C2MC 3S2HK 4RMFA 2XCOA 1Y1VA 1TWCC 3HOXC 4YFXA 4LLGA 1ZXOA 1HI9A 1YCLA 4GTDA 4DDQA 1BS2A 3TFJA 1IQ0A 1IE0A 3GTGA 2NVQK 2NVYA 5TMCA 3NUHA 4G7HA 1TWFC 4A93K 3VA7A 2KWAA 1ZQ1C 2RH6A 3AH5A 4BBSC 3WODA 2JA6C 3S16C 4A3JC 3HOVC 1TWHK 4PAAA 1F7UA 1VRQC 3CQZC 2R7ZA 4A3EK 1XZPB 1YNJA 1ZYRA 2GSNA 4QIWD 1SFOA 3K7AK 2WB1D 2E2HC 3S14K 4Y52K 1BJTA 3HOWK 4WILA 1O24A 3GTPA 3M3YC 4YFNA 3PO3C 1V5VA 2PMZL 2E2IA 5C4XC 4A3BC 2JH3A 3S1QC 1JVIA 3A8IA 1O2FB 3HOZK 1TWGA 4Y7NK 4KARA 1EQRA 1DCPA 5CHPA 3M4OK 3GTLC 3BP8C 2JA6A 4JK1A 4ZH4A 3GEIA 4GTAA 1O2BA 4A3JK 4A3DC 4G0VA 3T00A 4AYBL 2NVXC 3HOVK 3S16K 2R93A 2NVTC 1K83A 1SFOC 3HOYK 5C44K 4OIOA 4LOWA 5IYCC 4YFKA 1F9NA 2NVQC 4MEYA 4QJVB 2NVXK 1J6XA 3GIRA 2R92C 3SZZA 1WOSA 3GTJA 1WCMA 5CJ9A 4J3NA 1IS1A 1F7VA 2EBBA 4G0UA 4A3EC 3QX3A 3V4GA 2ZFZA 1I3QA 3OPFA 4KB4A 1I6HC 1VLOA 1JOEA 1TWAA 5FJ8K 2R92K 5HL8A 2Y3PA 5FLMK 3S1MK 5TMFA 5IYBC 3M3YK 3K7AC 1G51A 4BY7C 1BGWA 3H3VD 3GTLA 2A6EA 1AB4A 4P5AA 1O25A 5C3EK 2V6UA 3H3VL 1I50C 1XZQA 3LPXA 1WSRA 2JA5A 2BE5A 2R7ZK 1VJEA 2A6HA 4C45A 5D4DA 4A3IC 4GT9A 1VGXA 3TFHA 3T01A 4KN4A 4P9SA 4M1XA 5C3EC 4KM8A 4GTFA 4QIWL 4BLBA 3GTKA 3GTKC 3GTMC 3Q3QA 4C3IC 2WB1L 1WORA 4C3JK 2Y0SD 5M3FK 5IYBK 1K83C 2PMZD 3GTOC 3GTPK 1BDFA 4GTCA 3PO2K 2PHCB 2R93K 5FLMC 3S1MC 4LK0A 3CAGA 4KC6A 4X6AC 3S15C 4A3CC 4A3GC 1VH2A 1O28A 2V6TA 4A3LC 4XSZA 2JA5K 1TWAC 3GEHA 2XCRB 3S2DK 2PA8D 3ADAC 5IP7K 4A3FC 4OIQA 3GTOK 1Y1VC 2R93C 2R7ZC 3DXJA 4A93C 5C4JC 1XXCA 4XLNA 1R9TC 2GSUA 1XPPA 2VUMA 1F93A 1TWFA 1O2AA 2D6FC 1TWCK 1WQFA 3RZOC 2WAQD 4BBRK 2YU9C 5C4JK 5JFEA 3GTJK 4BKWA 1SMYA 3GTQC 3OEPA 4Y7NC 3S15K 4A3GK 5EGEA 1WQHA 3S1QK 3MMLB 3HOZC 3A8KA 3RZDC 4OIRA 3HKZD 1DCOA 4A3MC 5IOTA 1B4AA 1XZQB 3HOWC 4LR2A 4Y52C 1IBAA 2E2JC 2E2HK 3S14C 4LK1A 3I4NC 1I50A 4OIPA 1B4BA 4KMUA 2NVTK 4XSXA 3N0BA 3S1NK 4BBRC 2YU9K 3LAJA 2YU9A 3EQLA 4LJZA 3BP3A 3RZOK 5M5XK 4Q4ZA 3CQZA 4KAWX 1O27A 1O26A 1USOA 3HOUK 3S1RK 4KASA 3GTLK 3OREA 1WOOA 3I4NK 1J6VA 3I4MC 4BXXK 4BY7K 3HOXK 3GTGK 3GEEA 3LAPA 1R9TK 1Y1WA 1WQGA 4GTBA 3S17K 3HOYC 1X31C 2Y0SL 1O29A 2GAHC 1WCMC 4KMDA 3S2DC 4WJ4A 4GFQA 1TWGC 5IYDK 3FKIK 1RU0A 5IOSA 2ZUEA 3GTQK 4BLAA 1PJ7A 1I3QC 2PPBA 2PA8L 5E68A 1IL2A 2P8TA 4OINA 4BY1C 4A3MK 1R9TA 1TWFK 4KM9A 3PO3K 1C0AA 1ISEA 3HOUC 1Y1WC 4XCHA 1UV7A 2E2IC 4BXXC 4KN7A 1WOPA 1ZBSA 3GTGC 1JQWA 3GTJC 3GTOA 1DCHA 1J98A 1J6WA 2O5JA 2WAQL 5JVOA 4KMAA 3ERED 2B63C 2A68A 4XLPA 1TWGK 1I50K 3FKIC 3JSTA 1EK8A 3G4AA 4X6AK 4G7OA 4G7ZA 5C4XK 3L4KA 2NVYC 4C2MK 3S2HC 3HKZL 4BY1K 3N0CA 3GTMA 3GTKK 4C3IK 5IOQA 3A8JA 4C3HK 3TFIA 3HXAA 5IP9C 4ILDA 1INNA 4FM9A 1XXAA 2GAGC 2CFAB 4PABA 2O5IA 3L4JA 1EH1A 2JA6K 3AQPA
chains in the Genus database with same CATH topology
2B63K 4YFXA 3H3VD 2A6EA 4LLGA 3S1NK 4BBRC 2YU9K 5C3EK 3S17C 3H3VL 1I50C 3EQLA 4LJZA 3RZOK 5IYCK 5M5XK 4Q4ZA 2NVQK 1I6VA 3GTMK 2BE5A 2R7ZK 5TMCA 2VUMK 4G7HA 3HOUK 3S1RK 1TWFC 2E2IK 3GTLK 4A3KC 4A93K 2A6HA 3I4NK 3I4MC 1Y1VK 5D4DA 4BXXK 4A3IC 4BBSC 3WODA 2JA6C 3S16C 3HOXK 4BY7K 4A3JC 3GTGK 3HOVC 4A3DK 1TWHK 4KN4A 3S1NC 3CQZC 1R9TK 5C3EC 2JA8C 3S17K 3HOYC 4QIWL 2Y0SL 4A3EK 1YNNA 3GTKC 3GTMC 2WB1L 1YNJA 1ZYRA 1WCMC 4C3JK 2JA5C 4QIWD 2Y0SD 3S2DC 5M3FK 5IYBK 1K83C 5IP7C 3K7AK 2WB1D 1TWGC 2E2HC 5IP9K 2PMZD 3GTOC 3GTPK 1BDFA 3PO2K 3HOWK 3S14K 4Y52K 5IYDK 3FKIK 4MEXA 4YFNA 3M3YC 5FLMC 3PO3C 3S1MC 4LK0A 2R93K 2E2JK 2PMZL 4X6AC 3H0GC 3S15C 3GTQK 4A3BC 5C4XC 4A3CC 1I3QC 2PPBA 3S1QC 2PA8L 4A3GC 4OINA 3RZDK 4BY1C 4Q5SA 4QJVA 4Y7NK 2A69A 5M3MK 4XSZA 2JA5K 1TWAC 3HOZK 3S2DK 4A3LC 2PA8D 2VUMC 4A3MK 1K83K 5IP7K 5C44C 4A3FC 4OIQA 1TWFK 3GTLC 3GTOK 3M4OK 4JK1A 4ZH4A 1Y1VC 3PO3K 2R93C 2R7ZC 3DXJA 4A3IK 4A93C 5C4JC 3HOUC 1Y1WC 3I4MK 3S1RC 4A3JK 4A3DC 5M5YK 2E2IC 1TWHC 4BXXC 4XLNA 4AYBL 3CQZK 1R9TC 2NVXC 4KN7A 1XPPA 2JA7K 2JA8K 3GTGC 3HOVK 4BBSK 3GTJC 3S16K 2NVTC 4AYBD 1SFOC 3HOYK 2O5JA 2WAQL 5C44K 4MQ9A 4OIOA 1TWCK 3M4OC 5IYCC 2B63C 4YFKA 2NVTK 2A68A 3RZOC 2WAQD 2NVQC 4BBRK 4XLPA 2YU9C 4MEYA 5C4JK 1Y1WK 1TWGK 1I50K 4A3KK 4QJVB 3FKIC 2NVXK 1I6HK 2R92C 3GTJK 4X6AK 4G7OA 3H0GK 1SMYA 2CW0A 3GTQC 4YG2A 1SFOK 1I3QK 4G7ZA 4Y7NC 5C4XK 3S15K 1TWAK 4A3GK 2NVYC 4C2MK 3S2HC 3HKZL 4A3EC 3S1QK 4A3FK 3HOZC 3RZDC 4BY1K 4GZYA 3GTKK 4OIRA 4A3LK 5M5WK 4C3IK 3HKZD 4A3MC 4C3HK 4NOIA 1IW7A 4BY7C 1I6HC 5IYDC 3HOWC 1WCMK 5FJ8K 5IP9C 4Y52C 2R92K 5FLMK 3S1MK 3PO2C 5TMFA 2JA7C 5IYBC 2E2JC 3M3YK 1HQMA 3K7AC 2E2HK 3S14C 3GTPC 4A3BK 4LK1A 3I4NC 2O5IA 2NVYK 3S2HK 4OIPA 4A3CK 4KMUA 2JA6K 1TWCC 4XSXA 3HOXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 K;  4YFX A;  3H3V D;  2A6E A;  4LLG A;  3S1N K;  4BBR C;  2YU9 K;  5C3E K;  3S17 C;  3H3V L;  1I50 C;  3EQL A;  4LJZ A;  3RZO K;  5IYC K;  5M5X K;  4Q4Z A;  2NVQ K;  1I6V A;  3GTM K;  2BE5 A;  2R7Z K;  5TMC A;  2VUM K;  4G7H A;  3HOU K;  3S1R K;  1TWF C;  2E2I K;  3GTL K;  4A3K C;  4A93 K;  2A6H A;  3I4N K;  3I4M C;  1Y1V K;  5D4D A;  4BXX K;  4A3I C;  4BBS C;  3WOD A;  2JA6 C;  3S16 C;  3HOX K;  4BY7 K;  4A3J C;  3GTG K;  3HOV C;  4A3D K;  1TWH K;  4KN4 A;  3S1N C;  3CQZ C;  1R9T K;  5C3E C;  2JA8 C;  3S17 K;  3HOY C;  4QIW L;  2Y0S L;  4A3E K;  1YNN A;  3GTK C;  3GTM C;  2WB1 L;  1YNJ A;  1ZYR A;  1WCM C;  4C3J K;  2JA5 C;  4QIW D;  2Y0S D;  3S2D C;  5M3F K;  5IYB K;  1K83 C;  5IP7 C;  3K7A K;  2WB1 D;  1TWG C;  2E2H C;  5IP9 K;  2PMZ D;  3GTO C;  3GTP K;  1BDF A;  3PO2 K;  3HOW K;  3S14 K;  4Y52 K;  5IYD K;  3FKI K;  4MEX A;  4YFN A;  3M3Y C;  5FLM C;  3PO3 C;  3S1M C;  4LK0 A;  2R93 K;  2E2J K;  2PMZ L;  4X6A C;  3H0G C;  3S15 C;  3GTQ K;  4A3B C;  5C4X C;  4A3C C;  1I3Q C;  2PPB A;  3S1Q C;  2PA8 L;  4A3G C;  4OIN A;  3RZD K;  4BY1 C;  4Q5S A;  4QJV A;  4Y7N K;  2A69 A;  5M3M K;  4XSZ A;  2JA5 K;  1TWA C;  3HOZ K;  3S2D K;  4A3L C;  2PA8 D;  2VUM C;  4A3M K;  1K83 K;  5IP7 K;  5C44 C;  4A3F C;  4OIQ A;  1TWF K;  3GTL C;  3GTO K;  3M4O K;  4JK1 A;  4ZH4 A;  1Y1V C;  3PO3 K;  2R93 C;  2R7Z C;  3DXJ A;  4A3I K;  4A93 C;  5C4J C;  3HOU C;  1Y1W C;  3I4M K;  3S1R C;  4A3J K;  4A3D C;  5M5Y K;  2E2I C;  1TWH C;  4BXX C;  4XLN A;  4AYB L;  3CQZ K;  1R9T C;  2NVX C;  4KN7 A;  1XPP A;  2JA7 K;  2JA8 K;  3GTG C;  3HOV K;  4BBS K;  3GTJ C;  3S16 K;  2NVT C;  4AYB D;  1SFO C;  3HOY K;  2O5J A;  2WAQ L;  5C44 K;  4MQ9 A;  4OIO A;  1TWC K;  3M4O C;  5IYC C;  2B63 C;  4YFK A;  2NVT K;  2A68 A;  3RZO C;  2WAQ D;  2NVQ C;  4BBR K;  4XLP A;  2YU9 C;  4MEY A;  5C4J K;  1Y1W K;  1TWG K;  1I50 K;  4A3K K;  4QJV B;  3FKI C;  2NVX K;  1I6H K;  2R92 C;  3GTJ K;  4X6A K;  4G7O A;  3H0G K;  1SMY A;  2CW0 A;  3GTQ C;  4YG2 A;  1SFO K;  1I3Q K;  4G7Z A;  4Y7N C;  5C4X K;  3S15 K;  1TWA K;  4A3G K;  2NVY C;  4C2M K;  3S2H C;  3HKZ L;  4A3E C;  3S1Q K;  4A3F K;  3HOZ C;  3RZD C;  4BY1 K;  4GZY A;  3GTK K;  4OIR A;  4A3L K;  5M5W K;  4C3I K;  3HKZ D;  4A3M C;  4C3H K;  4NOI A;  1IW7 A;  4BY7 C;  1I6H C;  5IYD C;  3HOW C;  1WCM K;  5FJ8 K;  5IP9 C;  4Y52 C;  2R92 K;  5FLM K;  3S1M K;  3PO2 C;  5TMF A;  2JA7 C;  5IYB C;  2E2J C;  3M3Y K;  1HQM A;  3K7A C;  2E2H K;  3S14 C;  3GTP C;  4A3B K;  4LK1 A;  3I4N C;  2O5I A;  2NVY K;  3S2H K;  4OIP A;  4A3C K;  4KMU A;  2JA6 K;  1TWC C;  4XSX A;  3HOX C; 
#chains in the Genus database with same CATH topology
 2B63 K;  3FOE A;  1TWC A;  1XZP A;  2FQO A;  3S17 C;  1DD5 A;  5IYC K;  1I6V A;  3GTM K;  3GDZ A;  2VUM K;  2E2I K;  4A3K C;  3SZY A;  1Y1V K;  4GTE A;  2R92 A;  1YX2 A;  4A3C K;  4A3D K;  3S1N C;  2JA8 C;  4KAT A;  4KDD A;  1YNN A;  2B63 A;  4KB2 A;  4G0W A;  2XCQ A;  3FOF A;  3GTQ A;  2JA5 C;  4AH6 A;  3AD7 C;  5IP7 C;  2CFA A;  3GSI A;  4C3H C;  5IP9 K;  3FKI A;  5IOR A;  2RGR A;  4MEX A;  2NVX A;  2E2H A;  3TTG A;  2E2J K;  4FZB A;  3H0G C;  1USM A;  3H0G A;  4WJ3 M;  1EI6 A;  3AD8 C;  3BUE A;  3RZD K;  4P5B A;  4QJV A;  4Q5S A;  2A69 A;  5M3M K;  4C3J C;  2ZUF A;  2VUM C;  1K83 K;  5C44 C;  1WSV A;  1L0W A;  4A3I K;  3IPJ A;  1PJ5 A;  4KMH A;  5EGH A;  1WIH A;  3I4M K;  3S1R C;  5M5Y K;  1TWH C;  1TWH A;  5L46 A;  2JA7 A;  3CQZ K;  1KQ4 A;  3N3Y A;  2JA8 K;  4O2D A;  2JA7 K;  4BBS K;  2P5M A;  3G4C A;  2GSO A;  4AYB D;  5TJ3 A;  3FHZ A;  4MQ9 A;  3M4O C;  1Y1W K;  4A3K K;  3T02 A;  1I6H K;  1EFW A;  2V6S A;  3H0G K;  2CW0 A;  2W7V A;  4YG2 A;  1SFO K;  4GTL A;  1I3Q K;  2FQT A;  1TWA K;  4A3F K;  1ZVU A;  4GZY A;  1PJ6 A;  4A3L K;  5M5W K;  4NOI A;  1IW7 A;  5IYD C;  1WCM K;  3AQO A;  3PO2 C;  2JA7 C;  3AD9 C;  1HQM A;  1XXB A;  3GTP C;  4A3B K;  1GE9 A;  3S0X A;  4LQY A;  2NVY K;  4C2M C;  3S2H K;  4RMF A;  2XCO A;  1Y1V A;  1TWC C;  3HOX C;  4YFX A;  4LLG A;  1ZXO A;  1HI9 A;  1YCL A;  4GTD A;  4DDQ A;  1BS2 A;  3TFJ A;  1IQ0 A;  1IE0 A;  3GTG A;  2NVQ K;  2NVY A;  5TMC A;  3NUH A;  4G7H A;  1TWF C;  4A93 K;  3VA7 A;  2KWA A;  1ZQ1 C;  2RH6 A;  3AH5 A;  4BBS C;  3WOD A;  2JA6 C;  3S16 C;  4A3J C;  3HOV C;  1TWH K;  4PAA A;  1F7U A;  1VRQ C;  3CQZ C;  2R7Z A;  4A3E K;  1XZP B;  1YNJ A;  1ZYR A;  2GSN A;  4QIW D;  1SFO A;  3K7A K;  2WB1 D;  2E2H C;  3S14 K;  4Y52 K;  1BJT A;  3HOW K;  4WIL A;  1O24 A;  3GTP A;  3M3Y C;  4YFN A;  3PO3 C;  1V5V A;  2PMZ L;  2E2I A;  5C4X C;  4A3B C;  2JH3 A;  3S1Q C;  1JVI A;  3A8I A;  1O2F B;  3HOZ K;  1TWG A;  4Y7N K;  4KAR A;  1EQR A;  1DCP A;  5CHP A;  3M4O K;  3GTL C;  3BP8 C;  2JA6 A;  4JK1 A;  4ZH4 A;  3GEI A;  4GTA A;  1O2B A;  4A3J K;  4A3D C;  4G0V A;  3T00 A;  4AYB L;  2NVX C;  3HOV K;  3S16 K;  2R93 A;  2NVT C;  1K83 A;  1SFO C;  3HOY K;  5C44 K;  4OIO A;  4LOW A;  5IYC C;  4YFK A;  1F9N A;  2NVQ C;  4MEY A;  4QJV B;  2NVX K;  1J6X A;  3GIR A;  2R92 C;  3SZZ A;  1WOS A;  3GTJ A;  1WCM A;  5CJ9 A;  4J3N A;  1IS1 A;  1F7V A;  2EBB A;  4G0U A;  4A3E C;  3QX3 A;  3V4G A;  2ZFZ A;  1I3Q A;  3OPF A;  4KB4 A;  1I6H C;  1VLO A;  1JOE A;  1TWA A;  5FJ8 K;  2R92 K;  5HL8 A;  2Y3P A;  5FLM K;  3S1M K;  5TMF A;  5IYB C;  3M3Y K;  3K7A C;  1G51 A;  4BY7 C;  1BGW A;  3H3V D;  3GTL A;  2A6E A;  1AB4 A;  4P5A A;  1O25 A;  5C3E K;  2V6U A;  3H3V L;  1I50 C;  1XZQ A;  3LPX A;  1WSR A;  2JA5 A;  2BE5 A;  2R7Z K;  1VJE A;  2A6H A;  4C45 A;  5D4D A;  4A3I C;  4GT9 A;  1VGX A;  3TFH A;  3T01 A;  4KN4 A;  4P9S A;  4M1X A;  5C3E C;  4KM8 A;  4GTF A;  4QIW L;  4BLB A;  3GTK A;  3GTK C;  3GTM C;  3Q3Q A;  4C3I C;  2WB1 L;  1WOR A;  4C3J K;  2Y0S D;  5M3F K;  5IYB K;  1K83 C;  2PMZ D;  3GTO C;  3GTP K;  1BDF A;  4GTC A;  3PO2 K;  2PHC B;  2R93 K;  5FLM C;  3S1M C;  4LK0 A;  3CAG A;  4KC6 A;  4X6A C;  3S15 C;  4A3C C;  4A3G C;  1VH2 A;  1O28 A;  2V6T A;  4A3L C;  4XSZ A;  2JA5 K;  1TWA C;  3GEH A;  2XCR B;  3S2D K;  2PA8 D;  3ADA C;  5IP7 K;  4A3F C;  4OIQ A;  3GTO K;  1Y1V C;  2R93 C;  2R7Z C;  3DXJ A;  4A93 C;  5C4J C;  1XXC A;  4XLN A;  1R9T C;  2GSU A;  1XPP A;  2VUM A;  1F93 A;  1TWF A;  1O2A A;  2D6F C;  1TWC K;  1WQF A;  3RZO C;  2WAQ D;  4BBR K;  2YU9 C;  5C4J K;  5JFE A;  3GTJ K;  4BKW A;  1SMY A;  3GTQ C;  3OEP A;  4Y7N C;  3S15 K;  4A3G K;  5EGE A;  1WQH A;  3S1Q K;  3MML B;  3HOZ C;  3A8K A;  3RZD C;  4OIR A;  3HKZ D;  1DCO A;  4A3M C;  5IOT A;  1B4A A;  1XZQ B;  3HOW C;  4LR2 A;  4Y52 C;  1IBA A;  2E2J C;  2E2H K;  3S14 C;  4LK1 A;  3I4N C;  1I50 A;  4OIP A;  1B4B A;  4KMU A;  2NVT K;  4XSX A;  3N0B A;  3S1N K;  4BBR C;  2YU9 K;  3LAJ A;  2YU9 A;  3EQL A;  4LJZ A;  3BP3 A;  3RZO K;  5M5X K;  4Q4Z A;  3CQZ A;  4KAW X;  1O27 A;  1O26 A;  1USO A;  3HOU K;  3S1R K;  4KAS A;  3GTL K;  3ORE A;  1WOO A;  3I4N K;  1J6V A;  3I4M C;  4BXX K;  4BY7 K;  3HOX K;  3GTG K;  3GEE A;  3LAP A;  1R9T K;  1Y1W A;  1WQG A;  4GTB A;  3S17 K;  3HOY C;  1X31 C;  2Y0S L;  1O29 A;  2GAH C;  1WCM C;  4KMD A;  3S2D C;  4WJ4 A;  4GFQ A;  1TWG C;  5IYD K;  3FKI K;  1RU0 A;  5IOS A;  2ZUE A;  3GTQ K;  4BLA A;  1PJ7 A;  1I3Q C;  2PPB A;  2PA8 L;  5E68 A;  1IL2 A;  2P8T A;  4OIN A;  4BY1 C;  4A3M K;  1R9T A;  1TWF K;  4KM9 A;  3PO3 K;  1C0A A;  1ISE A;  3HOU C;  1Y1W C;  4XCH A;  1UV7 A;  2E2I C;  4BXX C;  4KN7 A;  1WOP A;  1ZBS A;  3GTG C;  1JQW A;  3GTJ C;  3GTO A;  1DCH A;  1J98 A;  1J6W A;  2O5J A;  2WAQ L;  5JVO A;  4KMA A;  3ERE D;  2B63 C;  2A68 A;  4XLP A;  1TWG K;  1I50 K;  3FKI C;  3JST A;  1EK8 A;  3G4A A;  4X6A K;  4G7O A;  4G7Z A;  5C4X K;  3L4K A;  2NVY C;  4C2M K;  3S2H C;  3HKZ L;  4BY1 K;  3N0C A;  3GTM A;  3GTK K;  4C3I K;  5IOQ A;  3A8J A;  4C3H K;  3TFI A;  3HXA A;  5IP9 C;  4ILD A;  1INN A;  4FM9 A;  1XXA A;  2GAG C;  2CFA B;  4PAB A;  2O5I A;  3L4J A;  1EH1 A;  2JA6 K;  3AQP A; 
#chains in the Genus database with same CATH homology
 2B63 K;  4YFX A;  3H3V D;  2A6E A;  4LLG A;  3S1N K;  4BBR C;  2YU9 K;  5C3E K;  3S17 C;  3H3V L;  1I50 C;  3EQL A;  4LJZ A;  3RZO K;  5IYC K;  5M5X K;  4Q4Z A;  2NVQ K;  1I6V A;  3GTM K;  2BE5 A;  2R7Z K;  5TMC A;  2VUM K;  4G7H A;  3HOU K;  3S1R K;  1TWF C;  2E2I K;  3GTL K;  4A3K C;  4A93 K;  2A6H A;  3I4N K;  3I4M C;  1Y1V K;  5D4D A;  4BXX K;  4A3I C;  4BBS C;  3WOD A;  2JA6 C;  3S16 C;  3HOX K;  4BY7 K;  4A3J C;  3GTG K;  3HOV C;  4A3D K;  1TWH K;  4KN4 A;  3S1N C;  3CQZ C;  1R9T K;  5C3E C;  2JA8 C;  3S17 K;  3HOY C;  4QIW L;  2Y0S L;  4A3E K;  1YNN A;  3GTK C;  3GTM C;  2WB1 L;  1YNJ A;  1ZYR A;  1WCM C;  4C3J K;  2JA5 C;  4QIW D;  2Y0S D;  3S2D C;  5M3F K;  5IYB K;  1K83 C;  5IP7 C;  3K7A K;  2WB1 D;  1TWG C;  2E2H C;  5IP9 K;  2PMZ D;  3GTO C;  3GTP K;  1BDF A;  3PO2 K;  3HOW K;  3S14 K;  4Y52 K;  5IYD K;  3FKI K;  4MEX A;  4YFN A;  3M3Y C;  5FLM C;  3PO3 C;  3S1M C;  4LK0 A;  2R93 K;  2E2J K;  2PMZ L;  4X6A C;  3H0G C;  3S15 C;  3GTQ K;  4A3B C;  5C4X C;  4A3C C;  1I3Q C;  2PPB A;  3S1Q C;  2PA8 L;  4A3G C;  4OIN A;  3RZD K;  4BY1 C;  4Q5S A;  4QJV A;  4Y7N K;  2A69 A;  5M3M K;  4XSZ A;  2JA5 K;  1TWA C;  3HOZ K;  3S2D K;  4A3L C;  2PA8 D;  2VUM C;  4A3M K;  1K83 K;  5IP7 K;  5C44 C;  4A3F C;  4OIQ A;  1TWF K;  3GTL C;  3GTO K;  3M4O K;  4JK1 A;  4ZH4 A;  1Y1V C;  3PO3 K;  2R93 C;  2R7Z C;  3DXJ A;  4A3I K;  4A93 C;  5C4J C;  3HOU C;  1Y1W C;  3I4M K;  3S1R C;  4A3J K;  4A3D C;  5M5Y K;  2E2I C;  1TWH C;  4BXX C;  4XLN A;  4AYB L;  3CQZ K;  1R9T C;  2NVX C;  4KN7 A;  1XPP A;  2JA7 K;  2JA8 K;  3GTG C;  3HOV K;  4BBS K;  3GTJ C;  3S16 K;  2NVT C;  4AYB D;  1SFO C;  3HOY K;  2O5J A;  2WAQ L;  5C44 K;  4MQ9 A;  4OIO A;  1TWC K;  3M4O C;  5IYC C;  2B63 C;  4YFK A;  2NVT K;  2A68 A;  3RZO C;  2WAQ D;  2NVQ C;  4BBR K;  4XLP A;  2YU9 C;  4MEY A;  5C4J K;  1Y1W K;  1TWG K;  1I50 K;  4A3K K;  4QJV B;  3FKI C;  2NVX K;  1I6H K;  2R92 C;  3GTJ K;  4X6A K;  4G7O A;  3H0G K;  1SMY A;  2CW0 A;  3GTQ C;  4YG2 A;  1SFO K;  1I3Q K;  4G7Z A;  4Y7N C;  5C4X K;  3S15 K;  1TWA K;  4A3G K;  2NVY C;  4C2M K;  3S2H C;  3HKZ L;  4A3E C;  3S1Q K;  4A3F K;  3HOZ C;  3RZD C;  4BY1 K;  4GZY A;  3GTK K;  4OIR A;  4A3L K;  5M5W K;  4C3I K;  3HKZ D;  4A3M C;  4C3H K;  4NOI A;  1IW7 A;  4BY7 C;  1I6H C;  5IYD C;  3HOW C;  1WCM K;  5FJ8 K;  5IP9 C;  4Y52 C;  2R92 K;  5FLM K;  3S1M K;  3PO2 C;  5TMF A;  2JA7 C;  5IYB C;  2E2J C;  3M3Y K;  1HQM A;  3K7A C;  2E2H K;  3S14 C;  3GTP C;  4A3B K;  4LK1 A;  3I4N C;  2O5I A;  2NVY K;  3S2H K;  4OIP A;  4A3C K;  4KMU A;  2JA6 K;  1TWC C;  4XSX A;  3HOX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...