4QJVB

The x-ray crystal structure of rpo3/rpo11 heterodimer of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qjvB00
5M3MK 3HOXK 1SFOK 3HOUK 1WCMC 2R7ZC 3GTGC 3I4MK 4LJZA 4A3JK 4Y52C 5M5WK 3M3YK 3S1MK 3RZDK 3HOYC 3PO2C 1SMYA 3S17K 4A3MK 2CW0A 5IYCC 3WODA 4Q4ZA 3GTLK 1I6HK 2WAQL 2PMZL 2O5IA 2JA7C 4BY1C 1YNJA 4YFXA 3GTPC 3CQZK 1I50C 3GTMK 5IP7C 3FKIC 1R9TC 2YU9C 4BBSC 2E2JK 3H3VL 3EQLA 5C4JK 2E2IC 5C4XC 2R92C 1Y1VC 1TWGK 1Y1WC 4A3IC 3S14K 2NVYK 5C44K 4A3CC 4MEYA 3HOWC 3S1RK 4Y7NK 3HOVC 1YNNA 2A6HA 4XSXA 2JA5C 5IYBK 4OIRA 3HKZL 2JA6C 1I3QC 5IP9K 4BBRK 3I4NK 2E2HK 2NVTC 3PO3K 1TWFC 3K7AK 3M4OC 4KMUA 4A3FK 1TWHC 2PA8L 5TMFA 3HOXC 3HOUC 4X6AC 3S1MC 2WB1L 3S2HC 4A3JC 4QIWD 5M3FK 3M3YC 3RZDC 2JA8K 4A3BK 3GTQK 5M5YK 4C3JK 3HOZK 3S17C 4A3MC 4GZYA 3DXJA 3GTLC 1I6HC 1TWCK 5C3EK 4OINA 2VUMK 4A93C 3S1QK 3H0GK 2NVXK 4AYBD 3GTOK 1HQMA 4A3EK 3CQZC 3GTMC 1ZYRA 4Q5SA 4G7OA 4JK1A 3GTKK 5TMCA 4G7ZA 3S1NC 2Y0SD 5C4JC 3S14C 2NVYC 4MEXA 4A3LK 5C44C 4C3IK 4C2MK 3S1RC 4A3DK 4QJVA 4XLPA 3S2DK 5D4DA 5IYBC 5IP9C 5IYCK 2E2HC 3PO3C 4OIPA 4A3GC 4LLGA 3GTJK 4QJVB 4ZH4A 4BXXK 2B63K 2JA7K 1SFOC 5IYDK 1TWAK 1BDFA 1I50K 3I4MC 2R93K 3FKIK 1R9TK 4BBSK 2BE5A 2A6EA 3S15K 4A3KK 4BY7C 4OIOA 4KN7A 5FLMK 1Y1WK 1K83K 4KN4A 4A3IK 4YFKA 2JA8C 4XSZA 4LK0A 2NVQK 3GTQC 3HOZC 4A3BC 3RZOK 2WAQD 4YG2A 2JA5K 2A69A 2NVXC 4NOIA 2PMZD 3S1QC 2E2JC 2NVTK 3S16K 1TWFK 3GTKC 1TWGC 3H3VD 2A68A 1IW7A 1WCMK 2R7ZK 3GTGK 4BY7K 4QIWL 4Y7NC 4A3LC 4Y52K 3HOYK 3PO2K 4X6AK 2O5JA 4A3DC 4LK1A 4MQ9A 3I4NC 4BBRC 3S2DC 3HKZD 4XLNA 3K7AC 4AYBL 3GTPK 4A3FC 4BY1K 3S2HK 3GTJC 5M5XK 4A93K 4BXXC 5IP7K 5IYDC 2YU9K 1XPPA 1TWAC 2B63C 1I6VA 2PA8D 2R93C 2Y0SL 5C4XK 2E2IK 2R92K 4C3HK 1Y1VK 3S1NK 3S15C 2WB1D 4A3KC 4OIQA 5FJ8K 5FLMC 1K83C 2NVQC 4G7HA 4A3CK 3HOWK 3HOVK 1TWCC 5C3EC 3RZOC 2VUMC 4YFNA 3H0GC 2PPBA 3GTOC 2JA6K 1I3QK 4A3EC 3S16C 4A3GK 3M4OK 1TWHK
chains in the Genus database with same CATH superfamily
1WOOA 1TWGA 2ZUEA 1WCMC 4C2MC 4Y52C 3RZDK 5IOSA 3HOYC 3PO2C 1L0WA 3GSIA 3A8KA 5IYCC 1JQWA 1I6HK 2P8TA 4GT9A 1VRQC 1TWGK 1Y1WC 4BLAA 3FHZA 1XZPA 4G0UA 1TWCA 3HKZL 3I4NK 4AH6A 3H0GA 1J6VA 2E2HK 3M4OC 4A3FK 2PA8L 3AD7C 3TFIA 3T02A 4A3JC 1DCOA 3M3YC 2JA8K 5M5YK 4A3MC 3T00A 4KDDA 1TWCK 4GTCA 3AQPA 3H0GK 3GTJA 3GTMC 1TWAA 3IPJA 4G7ZA 3FKIA 3GTKK 2R93A 3QX3A 5EGEA 2FQOA 1DCHA 1EH1A 3S1RC 4XLPA 1XZQA 3GIRA 3GEEA 4A3GC 1WQFA 3GTJK 4QJVB 1TWFA 4BXXK 5IYDK 1BDFA 1TWAK 2CFAB 1USOA 2R93K 3FKIK 5L46A 1WCMA 4OIOA 1EQRA 1F7UA 4A3BC 5IOQA 2A69A 1O27A 1TWFK 1TWGC 1O2AA 2JH3A 1IW7A 1WCMK 4QIWL 4A3LC 4Y52K 3HOYK 3PO2K 3BP3A 4X6AK 3G4AA 3I4NC 4O2DA 1IL2A 4A3FC 3N0BA 1SFOA 2WB1D 5FJ8K 2KWAA 1HI9A 1TWCC 1O28A 5JVOA 3H0GC 4WJ3M 3BP8C 1O25A 4G0WA 1EI6A 3GDZA 3S16C 3M4OK 3AD8C 1J6WA 1SFOK 5TJ3A 2R7ZC 4LJZA 4A3JK 3M3YK 4A3MK 1B4BA 3WODA 4KM9A 3LAPA 1WIHA 2PMZL 3GTPC 3S2HC 4BY1C 1YNJA 4YFXA 3GTMK 2YU9C 3FKIC 2E2JK 2GAHC 4LQYA 3SZYA 4J3NA 4GTFA 4MEYA 3S1RK 1YNNA 3A8JA 4OIRA 2VUMA 4BBRK 3OEPA 3GTOA 3Q3QA 4FM9A 1TWFC 3NUHA 2CFAA 4M1XA 4KC6A 1WSVA 1G51A 5TMFA 3AQOA 1V5VA 4X6AC 3S1MC 1BS2A 3JSTA 4A3BK 4PABA 1BGWA 2FQTA 3T01A 2VUMK 3GTOK 3FOEA 4AYBD 1EK8A 1HQMA 3CQZC 2JA7A 4G7OA 4RMFA 4JK1A 1I50A 1ZXOA 2Y0SD 5C4JC 2EBBA 2R92A 3S14C 3OPFA 4A3LK 1O2BA 1ISEA 4C3IK 5IYBC 3PO3C 1IS1A 4ZH4A 2JA7K 1SFOC 1I50K 2R7ZA 2A6EA 4A3IK 3GTQC 4LK0A 3VA7A 1J6XA 4YG2A 2GSNA 3GTPA 2E2JC 2YU9A 3LPXA 2NVTK 1O24A 3S16K 1VLOA 2V6TA 3A8IA 2GAGC 2R7ZK 4GFQA 2NVYA 4PAAA 4BBRC 3HKZD 1JVIA 3GTPK 4BY1K 3S2HK 2YU9K 1XPPA 1RU0A 2PA8D 4P5AA 3S1NK 3S15C 4A3KC 5FLMC 2NVQC 1ZQ1C 3RZOC 2VUMC 3GTOC 2PPBA 3CQZA 4KM8A 2NVXA 5EGHA 2XCOA 3S1MK 4C3IC 2CW0A 3ERED 4Q4ZA 5CJ9A 2WAQL 1WQHA 2O5IA 2JA7C 3CQZK 1I50C 1O2FB 3H3VL 1F93A 5C4JK 2R92C 4C3HC 3CAGA 4A3IC 4WILA 3S14K 3GTQA 4Y7NK 3HOVC 2A6HA 4G0VA 1F9NA 5IYBK 3GEIA 3HXAA 1DD5A 2NVTC 3PO3K 3LAJA 3K7AK 4KATA 4KMUA 3HOXC 3HOUC 1IQ0A 4QIWD 5M3FK 5CHPA 3GTGA 3GTQK 1YX2A 3S17C 3DXJA 3GTLC 3BUEA 4KMDA 5C3EK 5E68A 4OINA 4KAWX 1USMA 1ZBSA 4P9SA 1ZYRA 1VJEA 3ADAC 1R9TA 3S1NC 3L4JA 1Y1VA 1XXCA 1WOPA 2NVYC 4BKWA 1JOEA 5C44C 4QJVA 4BLBA 1WOSA 2JA5A 5IP9C 4LOWA 1X31C 4LLGA 4KASA 1R9TK 4BBSK 1TWHA 3S15K 4A3KK 1KQ4A 3G4CA 4KN7A 5FLMK 4KN4A 2NVQK 3HOZC 4C3JC 3RZOK 1O29A 1VGXA 2JA5K 3S1QC 2NVXC 2PMZD 2P5MA 3TFHA 3FOFA 4Y7NC 4GTAA 2ZUFA 4A3DC 4GTDA 3S2DC 5HL8A 3K7AC 2E2HA 5M5XK 4A93K 2B63C 1I6VA 2R92K 4C3HK 3AH5A 4OIQA 1K83C 1WSRA 4G7HA 2D6FC 3HOVK 2XCQA 5C3EC 3GTLA 2RH6A 5M3MK 3HOXK 3HOUK 3GTKA 1VH2A 3I4MK 3GTGC 4BY7C 5M5WK 4ILDA 1SMYA 4DDQA 1F7VA 3S17K 3SZZA 3N0CA 3GTLK 1GE9A 1ZVUA 3GEHA 1DCPA 5IP7C 5IOTA 3N3YA 1R9TC 1EFWA 4BBSC 1C0AA 3EQLA 3MMLB 3S0XA 2E2IC 5C4XC 1Y1VC 3V4GA 4KB4A 1WORA 2NVYK 5C44K 4A3CC 3HOWC 2V6SA 4FZBA 4XSXA 2JA5C 1XXAA 2JA6C 1I3QC 5IP9K 2GSUA 2GSOA 3OREA 1TWHC 2WB1L 4KMHA 4KMAA 5IORA 3RZDC 1AB4A 4C3JK 3HOZK 4GZYA 1I6HC 4A93C 4GTLA 1UV7A 2NVXK 3S1QK 1YCLA 4A3EK 2B63A 4Q5SA 5TMCA 2W7VA 1K83A 4MEXA 1Y1WA 1WQGA 3L4KA 4WJ4A 4C2MK 4A3DK 1J98A 3S2DK 5D4DA 2PHCB 5IYCK 2E2HC 1XZPB 4OIPA 1IE0A 2B63K 3TTGA 4KB2A 3I4MC 2BE5A 1Y1WK 1K83K 2JA8C 4YFKA 1BJTA 4XSZA 1XXBA 2ZFZA 2WAQD 4NOIA 1IBAA 1PJ5A 5JFEA 3GTMA 2Y3PA 3GTKC 3H3VD 2E2IA 2A68A 4KARA 3GTGK 4BY7K 4LR2A 4GTEA 2O5JA 4P5BA 1B4AA 4LK1A 4MQ9A 4C45A 2JA6A 1I3QA 4XLNA 2V6UA 4AYBL 1XZQB 3GTJC 4BXXC 4XCHA 4GTBA 5IP7K 5IYDC 1TWAC 2R93C 2Y0SL 5C4XK 2E2IK 1Y1VK 3TFJA 1PJ6A 4A3CK 3HOWK 1O26A 4YFNA 2RGRA 1INNA 2JA6K 1I3QK 4A3EC 1PJ7A 2XCRB 4A3GK 3AD9C 1TWHK
chains in the Genus database with same CATH topology
5M3MK 3HOXK 1SFOK 3HOUK 1WCMC 2R7ZC 3GTGC 3I4MK 4LJZA 4A3JK 4Y52C 5M5WK 3M3YK 3S1MK 3RZDK 3HOYC 3PO2C 1SMYA 3S17K 4A3MK 2CW0A 5IYCC 3WODA 4Q4ZA 3GTLK 1I6HK 2WAQL 2PMZL 2O5IA 2JA7C 4BY1C 1YNJA 4YFXA 3GTPC 3CQZK 1I50C 3GTMK 5IP7C 3FKIC 1R9TC 2YU9C 4BBSC 2E2JK 3H3VL 3EQLA 5C4JK 2E2IC 5C4XC 2R92C 1Y1VC 1TWGK 1Y1WC 4A3IC 3S14K 2NVYK 5C44K 4A3CC 4MEYA 3HOWC 3S1RK 4Y7NK 3HOVC 1YNNA 2A6HA 4XSXA 2JA5C 5IYBK 4OIRA 3HKZL 2JA6C 1I3QC 5IP9K 4BBRK 3I4NK 2E2HK 2NVTC 3PO3K 1TWFC 3K7AK 3M4OC 4KMUA 4A3FK 1TWHC 2PA8L 5TMFA 3HOXC 3HOUC 4X6AC 3S1MC 2WB1L 3S2HC 4A3JC 4QIWD 5M3FK 3M3YC 3RZDC 2JA8K 4A3BK 3GTQK 5M5YK 4C3JK 3HOZK 3S17C 4A3MC 4GZYA 3DXJA 3GTLC 1I6HC 1TWCK 5C3EK 4OINA 2VUMK 4A93C 3S1QK 3H0GK 2NVXK 4AYBD 3GTOK 1HQMA 4A3EK 3CQZC 3GTMC 1ZYRA 4Q5SA 4G7OA 4JK1A 3GTKK 5TMCA 4G7ZA 3S1NC 2Y0SD 5C4JC 3S14C 2NVYC 4MEXA 4A3LK 5C44C 4C3IK 4C2MK 3S1RC 4A3DK 4QJVA 4XLPA 3S2DK 5D4DA 5IYBC 5IP9C 5IYCK 2E2HC 3PO3C 4OIPA 4A3GC 4LLGA 3GTJK 4QJVB 4ZH4A 4BXXK 2B63K 2JA7K 1SFOC 5IYDK 1TWAK 1BDFA 1I50K 3I4MC 2R93K 3FKIK 1R9TK 4BBSK 2BE5A 2A6EA 3S15K 4A3KK 4BY7C 4OIOA 4KN7A 5FLMK 1Y1WK 1K83K 4KN4A 4A3IK 4YFKA 2JA8C 4XSZA 4LK0A 2NVQK 3GTQC 3HOZC 4A3BC 3RZOK 2WAQD 4YG2A 2JA5K 2A69A 2NVXC 4NOIA 2PMZD 3S1QC 2E2JC 2NVTK 3S16K 1TWFK 3GTKC 1TWGC 3H3VD 2A68A 1IW7A 1WCMK 2R7ZK 3GTGK 4BY7K 4QIWL 4Y7NC 4A3LC 4Y52K 3HOYK 3PO2K 4X6AK 2O5JA 4A3DC 4LK1A 4MQ9A 3I4NC 4BBRC 3S2DC 3HKZD 4XLNA 3K7AC 4AYBL 3GTPK 4A3FC 4BY1K 3S2HK 3GTJC 5M5XK 4A93K 4BXXC 5IP7K 5IYDC 2YU9K 1XPPA 1TWAC 2B63C 1I6VA 2PA8D 2R93C 2Y0SL 5C4XK 2E2IK 2R92K 4C3HK 1Y1VK 3S1NK 3S15C 2WB1D 4A3KC 4OIQA 5FJ8K 5FLMC 1K83C 2NVQC 4G7HA 4A3CK 3HOWK 3HOVK 1TWCC 5C3EC 3RZOC 2VUMC 4YFNA 3H0GC 2PPBA 3GTOC 2JA6K 1I3QK 4A3EC 3S16C 4A3GK 3M4OK 1TWHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M K;  3HOX K;  1SFO K;  3HOU K;  1WCM C;  2R7Z C;  3GTG C;  3I4M K;  4LJZ A;  4A3J K;  4Y52 C;  5M5W K;  3M3Y K;  3S1M K;  3RZD K;  3HOY C;  3PO2 C;  1SMY A;  3S17 K;  4A3M K;  2CW0 A;  5IYC C;  3WOD A;  4Q4Z A;  3GTL K;  1I6H K;  2WAQ L;  2PMZ L;  2O5I A;  2JA7 C;  4BY1 C;  1YNJ A;  4YFX A;  3GTP C;  3CQZ K;  1I50 C;  3GTM K;  5IP7 C;  3FKI C;  1R9T C;  2YU9 C;  4BBS C;  2E2J K;  3H3V L;  3EQL A;  5C4J K;  2E2I C;  5C4X C;  2R92 C;  1Y1V C;  1TWG K;  1Y1W C;  4A3I C;  3S14 K;  2NVY K;  5C44 K;  4A3C C;  4MEY A;  3HOW C;  3S1R K;  4Y7N K;  3HOV C;  1YNN A;  2A6H A;  4XSX A;  2JA5 C;  5IYB K;  4OIR A;  3HKZ L;  2JA6 C;  1I3Q C;  5IP9 K;  4BBR K;  3I4N K;  2E2H K;  2NVT C;  3PO3 K;  1TWF C;  3K7A K;  3M4O C;  4KMU A;  4A3F K;  1TWH C;  2PA8 L;  5TMF A;  3HOX C;  3HOU C;  4X6A C;  3S1M C;  2WB1 L;  3S2H C;  4A3J C;  4QIW D;  5M3F K;  3M3Y C;  3RZD C;  2JA8 K;  4A3B K;  3GTQ K;  5M5Y K;  4C3J K;  3HOZ K;  3S17 C;  4A3M C;  4GZY A;  3DXJ A;  3GTL C;  1I6H C;  1TWC K;  5C3E K;  4OIN A;  2VUM K;  4A93 C;  3S1Q K;  3H0G K;  2NVX K;  4AYB D;  3GTO K;  1HQM A;  4A3E K;  3CQZ C;  3GTM C;  1ZYR A;  4Q5S A;  4G7O A;  4JK1 A;  3GTK K;  5TMC A;  4G7Z A;  3S1N C;  2Y0S D;  5C4J C;  3S14 C;  2NVY C;  4MEX A;  4A3L K;  5C44 C;  4C3I K;  4C2M K;  3S1R C;  4A3D K;  4QJV A;  4XLP A;  3S2D K;  5D4D A;  5IYB C;  5IP9 C;  5IYC K;  2E2H C;  3PO3 C;  4OIP A;  4A3G C;  4LLG A;  3GTJ K;  4QJV B;  4ZH4 A;  4BXX K;  2B63 K;  2JA7 K;  1SFO C;  5IYD K;  1TWA K;  1BDF A;  1I50 K;  3I4M C;  2R93 K;  3FKI K;  1R9T K;  4BBS K;  2BE5 A;  2A6E A;  3S15 K;  4A3K K;  4BY7 C;  4OIO A;  4KN7 A;  5FLM K;  1Y1W K;  1K83 K;  4KN4 A;  4A3I K;  4YFK A;  2JA8 C;  4XSZ A;  4LK0 A;  2NVQ K;  3GTQ C;  3HOZ C;  4A3B C;  3RZO K;  2WAQ D;  4YG2 A;  2JA5 K;  2A69 A;  2NVX C;  4NOI A;  2PMZ D;  3S1Q C;  2E2J C;  2NVT K;  3S16 K;  1TWF K;  3GTK C;  1TWG C;  3H3V D;  2A68 A;  1IW7 A;  1WCM K;  2R7Z K;  3GTG K;  4BY7 K;  4QIW L;  4Y7N C;  4A3L C;  4Y52 K;  3HOY K;  3PO2 K;  4X6A K;  2O5J A;  4A3D C;  4LK1 A;  4MQ9 A;  3I4N C;  4BBR C;  3S2D C;  3HKZ D;  4XLN A;  3K7A C;  4AYB L;  3GTP K;  4A3F C;  4BY1 K;  3S2H K;  3GTJ C;  5M5X K;  4A93 K;  4BXX C;  5IP7 K;  5IYD C;  2YU9 K;  1XPP A;  1TWA C;  2B63 C;  1I6V A;  2PA8 D;  2R93 C;  2Y0S L;  5C4X K;  2E2I K;  2R92 K;  4C3H K;  1Y1V K;  3S1N K;  3S15 C;  2WB1 D;  4A3K C;  4OIQ A;  5FJ8 K;  5FLM C;  1K83 C;  2NVQ C;  4G7H A;  4A3C K;  3HOW K;  3HOV K;  1TWC C;  5C3E C;  3RZO C;  2VUM C;  4YFN A;  3H0G C;  2PPB A;  3GTO C;  2JA6 K;  1I3Q K;  4A3E C;  3S16 C;  4A3G K;  3M4O K;  1TWH K; 
#chains in the Genus database with same CATH topology
 1WOO A;  1TWG A;  2ZUE A;  1WCM C;  4C2M C;  4Y52 C;  3RZD K;  5IOS A;  3HOY C;  3PO2 C;  1L0W A;  3GSI A;  3A8K A;  5IYC C;  1JQW A;  1I6H K;  2P8T A;  4GT9 A;  1VRQ C;  1TWG K;  1Y1W C;  4BLA A;  3FHZ A;  1XZP A;  4G0U A;  1TWC A;  3HKZ L;  3I4N K;  4AH6 A;  3H0G A;  1J6V A;  2E2H K;  3M4O C;  4A3F K;  2PA8 L;  3AD7 C;  3TFI A;  3T02 A;  4A3J C;  1DCO A;  3M3Y C;  2JA8 K;  5M5Y K;  4A3M C;  3T00 A;  4KDD A;  1TWC K;  4GTC A;  3AQP A;  3H0G K;  3GTJ A;  3GTM C;  1TWA A;  3IPJ A;  4G7Z A;  3FKI A;  3GTK K;  2R93 A;  3QX3 A;  5EGE A;  2FQO A;  1DCH A;  1EH1 A;  3S1R C;  4XLP A;  1XZQ A;  3GIR A;  3GEE A;  4A3G C;  1WQF A;  3GTJ K;  4QJV B;  1TWF A;  4BXX K;  5IYD K;  1BDF A;  1TWA K;  2CFA B;  1USO A;  2R93 K;  3FKI K;  5L46 A;  1WCM A;  4OIO A;  1EQR A;  1F7U A;  4A3B C;  5IOQ A;  2A69 A;  1O27 A;  1TWF K;  1TWG C;  1O2A A;  2JH3 A;  1IW7 A;  1WCM K;  4QIW L;  4A3L C;  4Y52 K;  3HOY K;  3PO2 K;  3BP3 A;  4X6A K;  3G4A A;  3I4N C;  4O2D A;  1IL2 A;  4A3F C;  3N0B A;  1SFO A;  2WB1 D;  5FJ8 K;  2KWA A;  1HI9 A;  1TWC C;  1O28 A;  5JVO A;  3H0G C;  4WJ3 M;  3BP8 C;  1O25 A;  4G0W A;  1EI6 A;  3GDZ A;  3S16 C;  3M4O K;  3AD8 C;  1J6W A;  1SFO K;  5TJ3 A;  2R7Z C;  4LJZ A;  4A3J K;  3M3Y K;  4A3M K;  1B4B A;  3WOD A;  4KM9 A;  3LAP A;  1WIH A;  2PMZ L;  3GTP C;  3S2H C;  4BY1 C;  1YNJ A;  4YFX A;  3GTM K;  2YU9 C;  3FKI C;  2E2J K;  2GAH C;  4LQY A;  3SZY A;  4J3N A;  4GTF A;  4MEY A;  3S1R K;  1YNN A;  3A8J A;  4OIR A;  2VUM A;  4BBR K;  3OEP A;  3GTO A;  3Q3Q A;  4FM9 A;  1TWF C;  3NUH A;  2CFA A;  4M1X A;  4KC6 A;  1WSV A;  1G51 A;  5TMF A;  3AQO A;  1V5V A;  4X6A C;  3S1M C;  1BS2 A;  3JST A;  4A3B K;  4PAB A;  1BGW A;  2FQT A;  3T01 A;  2VUM K;  3GTO K;  3FOE A;  4AYB D;  1EK8 A;  1HQM A;  3CQZ C;  2JA7 A;  4G7O A;  4RMF A;  4JK1 A;  1I50 A;  1ZXO A;  2Y0S D;  5C4J C;  2EBB A;  2R92 A;  3S14 C;  3OPF A;  4A3L K;  1O2B A;  1ISE A;  4C3I K;  5IYB C;  3PO3 C;  1IS1 A;  4ZH4 A;  2JA7 K;  1SFO C;  1I50 K;  2R7Z A;  2A6E A;  4A3I K;  3GTQ C;  4LK0 A;  3VA7 A;  1J6X A;  4YG2 A;  2GSN A;  3GTP A;  2E2J C;  2YU9 A;  3LPX A;  2NVT K;  1O24 A;  3S16 K;  1VLO A;  2V6T A;  3A8I A;  2GAG C;  2R7Z K;  4GFQ A;  2NVY A;  4PAA A;  4BBR C;  3HKZ D;  1JVI A;  3GTP K;  4BY1 K;  3S2H K;  2YU9 K;  1XPP A;  1RU0 A;  2PA8 D;  4P5A A;  3S1N K;  3S15 C;  4A3K C;  5FLM C;  2NVQ C;  1ZQ1 C;  3RZO C;  2VUM C;  3GTO C;  2PPB A;  3CQZ A;  4KM8 A;  2NVX A;  5EGH A;  2XCO A;  3S1M K;  4C3I C;  2CW0 A;  3ERE D;  4Q4Z A;  5CJ9 A;  2WAQ L;  1WQH A;  2O5I A;  2JA7 C;  3CQZ K;  1I50 C;  1O2F B;  3H3V L;  1F93 A;  5C4J K;  2R92 C;  4C3H C;  3CAG A;  4A3I C;  4WIL A;  3S14 K;  3GTQ A;  4Y7N K;  3HOV C;  2A6H A;  4G0V A;  1F9N A;  5IYB K;  3GEI A;  3HXA A;  1DD5 A;  2NVT C;  3PO3 K;  3LAJ A;  3K7A K;  4KAT A;  4KMU A;  3HOX C;  3HOU C;  1IQ0 A;  4QIW D;  5M3F K;  5CHP A;  3GTG A;  3GTQ K;  1YX2 A;  3S17 C;  3DXJ A;  3GTL C;  3BUE A;  4KMD A;  5C3E K;  5E68 A;  4OIN A;  4KAW X;  1USM A;  1ZBS A;  4P9S A;  1ZYR A;  1VJE A;  3ADA C;  1R9T A;  3S1N C;  3L4J A;  1Y1V A;  1XXC A;  1WOP A;  2NVY C;  4BKW A;  1JOE A;  5C44 C;  4QJV A;  4BLB A;  1WOS A;  2JA5 A;  5IP9 C;  4LOW A;  1X31 C;  4LLG A;  4KAS A;  1R9T K;  4BBS K;  1TWH A;  3S15 K;  4A3K K;  1KQ4 A;  3G4C A;  4KN7 A;  5FLM K;  4KN4 A;  2NVQ K;  3HOZ C;  4C3J C;  3RZO K;  1O29 A;  1VGX A;  2JA5 K;  3S1Q C;  2NVX C;  2PMZ D;  2P5M A;  3TFH A;  3FOF A;  4Y7N C;  4GTA A;  2ZUF A;  4A3D C;  4GTD A;  3S2D C;  5HL8 A;  3K7A C;  2E2H A;  5M5X K;  4A93 K;  2B63 C;  1I6V A;  2R92 K;  4C3H K;  3AH5 A;  4OIQ A;  1K83 C;  1WSR A;  4G7H A;  2D6F C;  3HOV K;  2XCQ A;  5C3E C;  3GTL A;  2RH6 A;  5M3M K;  3HOX K;  3HOU K;  3GTK A;  1VH2 A;  3I4M K;  3GTG C;  4BY7 C;  5M5W K;  4ILD A;  1SMY A;  4DDQ A;  1F7V A;  3S17 K;  3SZZ A;  3N0C A;  3GTL K;  1GE9 A;  1ZVU A;  3GEH A;  1DCP A;  5IP7 C;  5IOT A;  3N3Y A;  1R9T C;  1EFW A;  4BBS C;  1C0A A;  3EQL A;  3MML B;  3S0X A;  2E2I C;  5C4X C;  1Y1V C;  3V4G A;  4KB4 A;  1WOR A;  2NVY K;  5C44 K;  4A3C C;  3HOW C;  2V6S A;  4FZB A;  4XSX A;  2JA5 C;  1XXA A;  2JA6 C;  1I3Q C;  5IP9 K;  2GSU A;  2GSO A;  3ORE A;  1TWH C;  2WB1 L;  4KMH A;  4KMA A;  5IOR A;  3RZD C;  1AB4 A;  4C3J K;  3HOZ K;  4GZY A;  1I6H C;  4A93 C;  4GTL A;  1UV7 A;  2NVX K;  3S1Q K;  1YCL A;  4A3E K;  2B63 A;  4Q5S A;  5TMC A;  2W7V A;  1K83 A;  4MEX A;  1Y1W A;  1WQG A;  3L4K A;  4WJ4 A;  4C2M K;  4A3D K;  1J98 A;  3S2D K;  5D4D A;  2PHC B;  5IYC K;  2E2H C;  1XZP B;  4OIP A;  1IE0 A;  2B63 K;  3TTG A;  4KB2 A;  3I4M C;  2BE5 A;  1Y1W K;  1K83 K;  2JA8 C;  4YFK A;  1BJT A;  4XSZ A;  1XXB A;  2ZFZ A;  2WAQ D;  4NOI A;  1IBA A;  1PJ5 A;  5JFE A;  3GTM A;  2Y3P A;  3GTK C;  3H3V D;  2E2I A;  2A68 A;  4KAR A;  3GTG K;  4BY7 K;  4LR2 A;  4GTE A;  2O5J A;  4P5B A;  1B4A A;  4LK1 A;  4MQ9 A;  4C45 A;  2JA6 A;  1I3Q A;  4XLN A;  2V6U A;  4AYB L;  1XZQ B;  3GTJ C;  4BXX C;  4XCH A;  4GTB A;  5IP7 K;  5IYD C;  1TWA C;  2R93 C;  2Y0S L;  5C4X K;  2E2I K;  1Y1V K;  3TFJ A;  1PJ6 A;  4A3C K;  3HOW K;  1O26 A;  4YFN A;  2RGR A;  1INN A;  2JA6 K;  1I3Q K;  4A3E C;  1PJ7 A;  2XCR B;  4A3G K;  3AD9 C;  1TWH K; 
#chains in the Genus database with same CATH homology
 5M3M K;  3HOX K;  1SFO K;  3HOU K;  1WCM C;  2R7Z C;  3GTG C;  3I4M K;  4LJZ A;  4A3J K;  4Y52 C;  5M5W K;  3M3Y K;  3S1M K;  3RZD K;  3HOY C;  3PO2 C;  1SMY A;  3S17 K;  4A3M K;  2CW0 A;  5IYC C;  3WOD A;  4Q4Z A;  3GTL K;  1I6H K;  2WAQ L;  2PMZ L;  2O5I A;  2JA7 C;  4BY1 C;  1YNJ A;  4YFX A;  3GTP C;  3CQZ K;  1I50 C;  3GTM K;  5IP7 C;  3FKI C;  1R9T C;  2YU9 C;  4BBS C;  2E2J K;  3H3V L;  3EQL A;  5C4J K;  2E2I C;  5C4X C;  2R92 C;  1Y1V C;  1TWG K;  1Y1W C;  4A3I C;  3S14 K;  2NVY K;  5C44 K;  4A3C C;  4MEY A;  3HOW C;  3S1R K;  4Y7N K;  3HOV C;  1YNN A;  2A6H A;  4XSX A;  2JA5 C;  5IYB K;  4OIR A;  3HKZ L;  2JA6 C;  1I3Q C;  5IP9 K;  4BBR K;  3I4N K;  2E2H K;  2NVT C;  3PO3 K;  1TWF C;  3K7A K;  3M4O C;  4KMU A;  4A3F K;  1TWH C;  2PA8 L;  5TMF A;  3HOX C;  3HOU C;  4X6A C;  3S1M C;  2WB1 L;  3S2H C;  4A3J C;  4QIW D;  5M3F K;  3M3Y C;  3RZD C;  2JA8 K;  4A3B K;  3GTQ K;  5M5Y K;  4C3J K;  3HOZ K;  3S17 C;  4A3M C;  4GZY A;  3DXJ A;  3GTL C;  1I6H C;  1TWC K;  5C3E K;  4OIN A;  2VUM K;  4A93 C;  3S1Q K;  3H0G K;  2NVX K;  4AYB D;  3GTO K;  1HQM A;  4A3E K;  3CQZ C;  3GTM C;  1ZYR A;  4Q5S A;  4G7O A;  4JK1 A;  3GTK K;  5TMC A;  4G7Z A;  3S1N C;  2Y0S D;  5C4J C;  3S14 C;  2NVY C;  4MEX A;  4A3L K;  5C44 C;  4C3I K;  4C2M K;  3S1R C;  4A3D K;  4QJV A;  4XLP A;  3S2D K;  5D4D A;  5IYB C;  5IP9 C;  5IYC K;  2E2H C;  3PO3 C;  4OIP A;  4A3G C;  4LLG A;  3GTJ K;  4QJV B;  4ZH4 A;  4BXX K;  2B63 K;  2JA7 K;  1SFO C;  5IYD K;  1TWA K;  1BDF A;  1I50 K;  3I4M C;  2R93 K;  3FKI K;  1R9T K;  4BBS K;  2BE5 A;  2A6E A;  3S15 K;  4A3K K;  4BY7 C;  4OIO A;  4KN7 A;  5FLM K;  1Y1W K;  1K83 K;  4KN4 A;  4A3I K;  4YFK A;  2JA8 C;  4XSZ A;  4LK0 A;  2NVQ K;  3GTQ C;  3HOZ C;  4A3B C;  3RZO K;  2WAQ D;  4YG2 A;  2JA5 K;  2A69 A;  2NVX C;  4NOI A;  2PMZ D;  3S1Q C;  2E2J C;  2NVT K;  3S16 K;  1TWF K;  3GTK C;  1TWG C;  3H3V D;  2A68 A;  1IW7 A;  1WCM K;  2R7Z K;  3GTG K;  4BY7 K;  4QIW L;  4Y7N C;  4A3L C;  4Y52 K;  3HOY K;  3PO2 K;  4X6A K;  2O5J A;  4A3D C;  4LK1 A;  4MQ9 A;  3I4N C;  4BBR C;  3S2D C;  3HKZ D;  4XLN A;  3K7A C;  4AYB L;  3GTP K;  4A3F C;  4BY1 K;  3S2H K;  3GTJ C;  5M5X K;  4A93 K;  4BXX C;  5IP7 K;  5IYD C;  2YU9 K;  1XPP A;  1TWA C;  2B63 C;  1I6V A;  2PA8 D;  2R93 C;  2Y0S L;  5C4X K;  2E2I K;  2R92 K;  4C3H K;  1Y1V K;  3S1N K;  3S15 C;  2WB1 D;  4A3K C;  4OIQ A;  5FJ8 K;  5FLM C;  1K83 C;  2NVQ C;  4G7H A;  4A3C K;  3HOW K;  3HOV K;  1TWC C;  5C3E C;  3RZO C;  2VUM C;  4YFN A;  3H0G C;  2PPB A;  3GTO C;  2JA6 K;  1I3Q K;  4A3E C;  3S16 C;  4A3G K;  3M4O K;  1TWH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...