4QJVB

The x-ray crystal structure of rpo3/rpo11 heterodimer of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qjvB00
2O5IA 4QIWL 5IP7C 2JA6K 4QJVA 3GTKC 2E2JC 4A3GC 4OIOA 3GTPC 3FKIC 4A3IK 4Q4ZA 2O5JA 3S1NK 1XPPA 4AYBL 1I6VA 3GTLC 3S2DC 4A3DK 4G7ZA 1Y1WK 3HOUK 1R9TK 3HOYK 3HOZC 2PMZL 3GTGC 1ZYRA 3PO2C 5C4JK 4KN4A 4YFNA 2JA7C 2R92K 2JA8K 3I4NK 4A3CC 2R93K 5C4XC 4A3MC 1TWAK 4QIWD 5IP9K 3RZDK 3PO3K 4A3FC 1I3QC 3RZOK 4A3JC 1K83C 3S1RC 3GTOK 3I4MK 1IW7A 2YU9C 1TWGC 2JA5K 3HOXC 2A69A 1SFOK 3HOWK 4YFKA 2A68A 5C3EK 5M3FK 4XSZA 3M3YC 2R7ZC 3GTQK 2PMZD 3H0GC 4OIPA 1TWHK 1WCMK 2VUMK 3K7AC 4OINA 2B63C 4XSXA 2A6EA 3S1QK 4BBRC 5IP7K 3GTKK 2E2JK 3H3VL 3GTPK 4A3EC 2Y0SL 5M5XK 1I50C 4LK1A 4G7OA 2NVXC 4A3LC 3S16C 4NOIA 5IYCC 3HOZK 5IYDC 3GTMC 4JK1A 3GTGK 4KN7A 3M4OC 4A3KC 4LLGA 1YNJA 2JA7K 1I6HC 4A3CK 4YFXA 4BY7C 5C4XK 4A3MK 5C44C 5IYBC 4QJVB 4Y52C 4OIRA 3H3VD 4A3FK 3S1NC 4BXXC 3HKZL 2Y0SD 4A3JK 1K83K 5D4DA 4BBSK 2YU9K 4OIQA 1BDFA 3S1MC 5TMFA 3HOXK 1Y1VC 2PPBA 3M3YK 5C4JC 2NVQC 2R92C 3S14C 1SMYA 3H0GK 4C2MK 2E2IC 4X6AC 4A3GK 2NVTC 3CQZC 5FLMC 3K7AK 4BY1C 4A3BC 3FKIK 1TWCC 4A3BK 4C3IK 4BBRK 1TWFC 5IP9C 3RZDC 4LK0A 4MEXA 4YG2A 5M5WK 3GTLK 3S2DK 1I50K 3GTOC 3HOVC 4A93C 4MQ9A 2NVYC 2WB1L 3HKZD 2WAQL 4A3LK 3S15C 3PO2K 3S17C 4Y7NC 2E2HC 5C3EC 3GTMK 4XLPA 5IYDK 3GTJC 3M4OK 4A3KK 2JA6C 2BE5A 2PA8L 2VUMC 1I6HK 4ZH4A 3S1QC 4BY7K 1YNNA 4A3IC 5C44K 5FJ8K 5IYBK 1I3QK 3S1RK 4Y52K 4A3DC 4GZYA 5M5YK 4MEYA 1TWGK 3EQLA 1Y1WC 3HOUC 1R9TC 3HOYC 4BXXK 3S2HK 4C3HK 4Q5SA 2R7ZK 2WB1D 2WAQD 3S1MK 3I4NC 1Y1VK 2CW0A 5M3MK 2JA8C 2R93C 2B63K 2NVQK 3S14K 1TWAC 2E2IK 4X6AK 2NVTK 3CQZK 5FLMK 2PA8D 4A3EK 4BY1K 3PO3C 1TWCK 1HQMA 3WODA 3S2HC 1TWFK 3RZOC 3I4MC 4G7HA 2NVXK 3S16K 2JA5C 5IYCK 1SFOC 3HOVK 3HOWC 2A6HA 4A93K 4BBSC 2NVYK 4LJZA 4AYBD 5TMCA 3DXJA 3GTQC 3S15K 4KMUA 3S17K 4XLNA 4Y7NK 4C3JK 2E2HK 1TWHC 1WCMC 3GTJK
chains in the Genus database with same CATH superfamily
4FZBA 2O5IA 4QJVA 3GTKC 4OIOA 3S2DC 3SZYA 3HOYK 1ZYRA 4PABA 1YX2A 3I4NK 2JA8K 4A3CC 3G4CA 1TWCA 3IPJA 3OEPA 1TWAK 1B4BA 4WILA 1I3QC 1ISEA 3N3YA 4G0UA 1L0WA 1K83C 4AH6A 2ZUFA 3I4MK 3RZOK 3AH5A 3LAJA 3AD8C 1SFOK 1IS1A 3OPFA 2R7ZC 2VUMA 3S0XA 4OIPA 1TWHK 5CHPA 4OINA 4KB2A 2CFAA 3GTKK 1EI6A 3L4JA 4LK1A 1DCOA 3GSIA 2ZUEA 5IYDC 1PJ7A 4JK1A 1EFWA 3M4OC 1WOSA 1TWAA 3GEEA 4KM8A 4A3CK 3LPXA 1YCLA 4Y52C 4GFQA 1SFOA 2P5MA 1K83K 3MMLB 4BBSK 1BDFA 3TFHA 5TMFA 4GTFA 2R92C 3GTKA 1SMYA 4BY1C 5FLMC 3BP3A 3RZDC 5M5WK 1F9NA 4GTLA 4A93C 3GTOC 3TFIA 3S15C 2E2HC 5IYDK 4KC6A 5E68A 4P5BA 3M4OK 2PA8L 5IOTA 3S1QC 1I3QA 5FJ8K 1IE0A 4GTEA 4Y52K 5IORA 1EK8A 1TWGK 3HOUC 1R9TC 3S2HK 2R7ZA 3N0CA 2V6TA 2CW0A 5M3MK 3ERED 4KASA 1XZQA 2B63K 4BY1K 5FLMK 2PA8D 4KB4A 3OREA 4A93K 3HOWC 3S15K 4KMUA 2E2HK 5IP7C 1VLOA 2CFAB 4A3GC 2E2JC 3FKIC 4Q4ZA 2O5JA 3S1NK 3GTLC 4KATA 3L4KA 1Y1WA 4KMHA 3HOUK 1R9TK 1PJ6A 1RU0A 2R92A 5C4JK 4LOWA 4WJ4A 1G51A 4KN4A 4A3MC 3GEHA 4A3FC 3GTOA 3S1RC 1J98A 1C0AA 1KQ4A 2YU9C 3HOWK 2A68A 5M3FK 1DCHA 1WCMA 2VUMK 1EQRA 3K7AC 2D6FC 4BBRC 5IP7K 2E2JK 2Y0SL 1R9TA 5M5XK 1I50C 4G7OA 3S16C 4P5AA 2JH3A 4NOIA 4KDDA 3GTGA 4ILDA 1J6WA 1YNJA 4A3MK 1JVIA 1DD5A 5IOSA 3AQOA 4A3FK 2Y0SD 5D4DA 4C3HC 3V4GA 2YU9K 4G0VA 4OIQA 3FOFA 1VGXA 1Y1VC 1O2AA 2PPBA 1XZQB 3H0GA 2NVQC 1EH1A 3FKIA 2NVTC 1VH2A 3K7AK 1IL2A 1WSVA 4BBRK 1TWFC 3QX3A 4C45A 5IP9C 3GTLA 4YG2A 3S2DK 1F93A 1I50K 1GE9A 1XZPA 2ZFZA 4Y7NC 5C3EC 4XLPA 3GTJC 3AQPA 4PAAA 4BKWA 1YNNA 4A3IC 4FM9A 2RH6A 1I3QK 1XXAA 4LR2A 2YU9A 5M5YK 3NUHA 3EQLA 1Y1WC 4G0WA 4C3HK 4Q5SA 2R7ZK 1Y1VK 2R93C 2NVQK 2E2IA 3CQZA 2NVTK 3WODA 1HQMA 1O2BA 1I50A 1TWFK 1WQFA 4AYBD 3DXJA 3GTQC 5IOQA 1J6VA 4Y7NK 1WCMC 1F7UA 1UV7A 3GTJK 2FQOA 4DDQA 3GTPC 4A3IK 5TJ3A 1WOOA 5HL8A 4G7ZA 1Y1WK 1Y1VA 3GTGC 3PO2C 2GAGC 1ZBSA 2R92K 5JFEA 3AD7C 2R93K 4LQYA 1TWFA 1O27A 3RZDK 1IQ0A 3GTOK 3GDZA 1IW7A 2JA5A 1XXBA 3BUEA 1O26A 1JQWA 2A69A 4YFKA 3GTJA 2XCOA 3M3YC 3GTQK 3H0GC 4C2MC 1WCMK 1VRQC 2GAHC 3T00A 3S1QK 1PJ5A 2A6EA 2EBBA 3GEIA 4XSXA 4C3IC 3TTGA 3H3VL 3GTPK 4A3EC 1B4AA 1INNA 2Y3PA 2NVXC 1XZPB 4A3LC 5IYCC 4GTBA 1DCPA 2R93A 3CAGA 3GTGK 3GIRA 4LLGA 1I6HC 1WQHA 1ZXOA 5C44C 3AD9C 3A8JA 3Q3QA 3FHZA 4OIRA 3H3VD 4BXXC 3GTQA 3S1MC 3M3YK 3TFJA 3S14C 4BLAA 3H0GK 4C2MK 2E2IC 3GTPA 4A3GK 4WJ3M 3CQZC 4A3BC 4X6AC 3FKIK 3G4AA 4C3IK 2XCRB 4LK0A 3GTLK 3HOVC 1ZVUA 4KARA 2NVYC 4A3LK 3GTMA 4C3JC 5EGEA 4KM9A 2JA6C 1I6HK 4ZH4A 1O29A 2RGRA 1VJEA 5C44K 2PHCB 1BJTA 1USOA 3S1RK 4GTAA 4A3DC 4MEYA 4BXXK 1WIHA 3SZZA 3T02A 3S1MK 4KMAA 3A8KA 1WORA 2KWAA 3S14K 2E2IK 4X6AK 3CQZK 3FOEA 3PO3C 4A3BK 2NVXA 2W7VA 2V6SA 3S16K 5L46A 2JA5C 3HOVK 2A6HA 4BBSC 2NVYK 3T01A 1WSRA 4XLNA 1IBAA 4C3JK 4M1XA 3ADAC 4QIWL 2JA6K 5EGHA 1BS2A 1XPPA 4AYBL 1I6VA 4A3DK 3HOZC 2PMZL 3N0BA 3VA7A 1X31C 4YFNA 2JA7C 4KMDA 5C4XC 2GSUA 4QIWD 5IP9K 3PO3K 5CJ9A 2GSNA 4A3JC 2NVYA 1TWGC 2JA5K 3HOXC 3S2HC 5C3EK 4XSZA 2PMZD 1TWHA 2JA6A 4KAWX 2B63C 1O25A 1WQGA 2V6UA 1XXCA 4RMFA 2P8TA 1USMA 1V5VA 3HOZK 3GTMC 4KN7A 4GTDA 4A3KC 2JA7K 4O2DA 4YFXA 4BY7C 5C4XK 5IYBC 4XCHA 4QJVB 1J6XA 1K83A 3S1NC 3HKZL 4A3JK 1O2FB 3HOXK 5C4JC 1TWCC 4MEXA 5JVOA 3A8IA 4MQ9A 2WB1L 3HKZD 2WAQL 1HI9A 2FQTA 3PO2K 3S17C 2JA7A 1O24A 3GTMK 1JOEA 4A3KK 2BE5A 2VUMC 4BY7K 5IYBK 1O28A 1TWGA 4GZYA 4GT9A 3HOYC 1ZQ1C 1BGWA 2WB1D 2WAQD 3I4NC 2JA8C 4P9SA 2B63A 3HXAA 3JSTA 1F7VA 2GSOA 4BLBA 1TWAC 4GTCA 3LAPA 4A3EK 1TWCK 1WOPA 3RZOC 2XCQA 3I4MC 4G7HA 2NVXK 5IYCK 1SFOC 1AB4A 4LJZA 5TMCA 2E2HA 3S17K 3BP8C 1TWHC 4J3NA
chains in the Genus database with same CATH topology
2O5IA 4QIWL 5IP7C 2JA6K 4QJVA 3GTKC 2E2JC 4A3GC 4OIOA 3GTPC 3FKIC 4A3IK 4Q4ZA 2O5JA 3S1NK 1XPPA 4AYBL 1I6VA 3GTLC 3S2DC 4A3DK 4G7ZA 1Y1WK 3HOUK 1R9TK 3HOYK 3HOZC 2PMZL 3GTGC 1ZYRA 3PO2C 5C4JK 4KN4A 4YFNA 2JA7C 2R92K 2JA8K 3I4NK 4A3CC 2R93K 5C4XC 4A3MC 1TWAK 4QIWD 5IP9K 3RZDK 3PO3K 4A3FC 1I3QC 3RZOK 4A3JC 1K83C 3S1RC 3GTOK 3I4MK 1IW7A 2YU9C 1TWGC 2JA5K 3HOXC 2A69A 1SFOK 3HOWK 4YFKA 2A68A 5C3EK 5M3FK 4XSZA 3M3YC 2R7ZC 3GTQK 2PMZD 3H0GC 4OIPA 1TWHK 1WCMK 2VUMK 3K7AC 4OINA 2B63C 4XSXA 2A6EA 3S1QK 4BBRC 5IP7K 3GTKK 2E2JK 3H3VL 3GTPK 4A3EC 2Y0SL 5M5XK 1I50C 4LK1A 4G7OA 2NVXC 4A3LC 3S16C 4NOIA 5IYCC 3HOZK 5IYDC 3GTMC 4JK1A 3GTGK 4KN7A 3M4OC 4A3KC 4LLGA 1YNJA 2JA7K 1I6HC 4A3CK 4YFXA 4BY7C 5C4XK 4A3MK 5C44C 5IYBC 4QJVB 4Y52C 4OIRA 3H3VD 4A3FK 3S1NC 4BXXC 3HKZL 2Y0SD 4A3JK 1K83K 5D4DA 4BBSK 2YU9K 4OIQA 1BDFA 3S1MC 5TMFA 3HOXK 1Y1VC 2PPBA 3M3YK 5C4JC 2NVQC 2R92C 3S14C 1SMYA 3H0GK 4C2MK 2E2IC 4X6AC 4A3GK 2NVTC 3CQZC 5FLMC 3K7AK 4BY1C 4A3BC 3FKIK 1TWCC 4A3BK 4C3IK 4BBRK 1TWFC 5IP9C 3RZDC 4LK0A 4MEXA 4YG2A 5M5WK 3GTLK 3S2DK 1I50K 3GTOC 3HOVC 4A93C 4MQ9A 2NVYC 2WB1L 3HKZD 2WAQL 4A3LK 3S15C 3PO2K 3S17C 4Y7NC 2E2HC 5C3EC 3GTMK 4XLPA 5IYDK 3GTJC 3M4OK 4A3KK 2JA6C 2BE5A 2PA8L 2VUMC 1I6HK 4ZH4A 3S1QC 4BY7K 1YNNA 4A3IC 5C44K 5FJ8K 5IYBK 1I3QK 3S1RK 4Y52K 4A3DC 4GZYA 5M5YK 4MEYA 1TWGK 3EQLA 1Y1WC 3HOUC 1R9TC 3HOYC 4BXXK 3S2HK 4C3HK 4Q5SA 2R7ZK 2WB1D 2WAQD 3S1MK 3I4NC 1Y1VK 2CW0A 5M3MK 2JA8C 2R93C 2B63K 2NVQK 3S14K 1TWAC 2E2IK 4X6AK 2NVTK 3CQZK 5FLMK 2PA8D 4A3EK 4BY1K 3PO3C 1TWCK 1HQMA 3WODA 3S2HC 1TWFK 3RZOC 3I4MC 4G7HA 2NVXK 3S16K 2JA5C 5IYCK 1SFOC 3HOVK 3HOWC 2A6HA 4A93K 4BBSC 2NVYK 4LJZA 4AYBD 5TMCA 3DXJA 3GTQC 3S15K 4KMUA 3S17K 4XLNA 4Y7NK 4C3JK 2E2HK 1TWHC 1WCMC 3GTJK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5I A;  4QIW L;  5IP7 C;  2JA6 K;  4QJV A;  3GTK C;  2E2J C;  4A3G C;  4OIO A;  3GTP C;  3FKI C;  4A3I K;  4Q4Z A;  2O5J A;  3S1N K;  1XPP A;  4AYB L;  1I6V A;  3GTL C;  3S2D C;  4A3D K;  4G7Z A;  1Y1W K;  3HOU K;  1R9T K;  3HOY K;  3HOZ C;  2PMZ L;  3GTG C;  1ZYR A;  3PO2 C;  5C4J K;  4KN4 A;  4YFN A;  2JA7 C;  2R92 K;  2JA8 K;  3I4N K;  4A3C C;  2R93 K;  5C4X C;  4A3M C;  1TWA K;  4QIW D;  5IP9 K;  3RZD K;  3PO3 K;  4A3F C;  1I3Q C;  3RZO K;  4A3J C;  1K83 C;  3S1R C;  3GTO K;  3I4M K;  1IW7 A;  2YU9 C;  1TWG C;  2JA5 K;  3HOX C;  2A69 A;  1SFO K;  3HOW K;  4YFK A;  2A68 A;  5C3E K;  5M3F K;  4XSZ A;  3M3Y C;  2R7Z C;  3GTQ K;  2PMZ D;  3H0G C;  4OIP A;  1TWH K;  1WCM K;  2VUM K;  3K7A C;  4OIN A;  2B63 C;  4XSX A;  2A6E A;  3S1Q K;  4BBR C;  5IP7 K;  3GTK K;  2E2J K;  3H3V L;  3GTP K;  4A3E C;  2Y0S L;  5M5X K;  1I50 C;  4LK1 A;  4G7O A;  2NVX C;  4A3L C;  3S16 C;  4NOI A;  5IYC C;  3HOZ K;  5IYD C;  3GTM C;  4JK1 A;  3GTG K;  4KN7 A;  3M4O C;  4A3K C;  4LLG A;  1YNJ A;  2JA7 K;  1I6H C;  4A3C K;  4YFX A;  4BY7 C;  5C4X K;  4A3M K;  5C44 C;  5IYB C;  4QJV B;  4Y52 C;  4OIR A;  3H3V D;  4A3F K;  3S1N C;  4BXX C;  3HKZ L;  2Y0S D;  4A3J K;  1K83 K;  5D4D A;  4BBS K;  2YU9 K;  4OIQ A;  1BDF A;  3S1M C;  5TMF A;  3HOX K;  1Y1V C;  2PPB A;  3M3Y K;  5C4J C;  2NVQ C;  2R92 C;  3S14 C;  1SMY A;  3H0G K;  4C2M K;  2E2I C;  4X6A C;  4A3G K;  2NVT C;  3CQZ C;  5FLM C;  3K7A K;  4BY1 C;  4A3B C;  3FKI K;  1TWC C;  4A3B K;  4C3I K;  4BBR K;  1TWF C;  5IP9 C;  3RZD C;  4LK0 A;  4MEX A;  4YG2 A;  5M5W K;  3GTL K;  3S2D K;  1I50 K;  3GTO C;  3HOV C;  4A93 C;  4MQ9 A;  2NVY C;  2WB1 L;  3HKZ D;  2WAQ L;  4A3L K;  3S15 C;  3PO2 K;  3S17 C;  4Y7N C;  2E2H C;  5C3E C;  3GTM K;  4XLP A;  5IYD K;  3GTJ C;  3M4O K;  4A3K K;  2JA6 C;  2BE5 A;  2PA8 L;  2VUM C;  1I6H K;  4ZH4 A;  3S1Q C;  4BY7 K;  1YNN A;  4A3I C;  5C44 K;  5FJ8 K;  5IYB K;  1I3Q K;  3S1R K;  4Y52 K;  4A3D C;  4GZY A;  5M5Y K;  4MEY A;  1TWG K;  3EQL A;  1Y1W C;  3HOU C;  1R9T C;  3HOY C;  4BXX K;  3S2H K;  4C3H K;  4Q5S A;  2R7Z K;  2WB1 D;  2WAQ D;  3S1M K;  3I4N C;  1Y1V K;  2CW0 A;  5M3M K;  2JA8 C;  2R93 C;  2B63 K;  2NVQ K;  3S14 K;  1TWA C;  2E2I K;  4X6A K;  2NVT K;  3CQZ K;  5FLM K;  2PA8 D;  4A3E K;  4BY1 K;  3PO3 C;  1TWC K;  1HQM A;  3WOD A;  3S2H C;  1TWF K;  3RZO C;  3I4M C;  4G7H A;  2NVX K;  3S16 K;  2JA5 C;  5IYC K;  1SFO C;  3HOV K;  3HOW C;  2A6H A;  4A93 K;  4BBS C;  2NVY K;  4LJZ A;  4AYB D;  5TMC A;  3DXJ A;  3GTQ C;  3S15 K;  4KMU A;  3S17 K;  4XLN A;  4Y7N K;  4C3J K;  2E2H K;  1TWH C;  1WCM C;  3GTJ K; 
#chains in the Genus database with same CATH topology
 4FZB A;  2O5I A;  4QJV A;  3GTK C;  4OIO A;  3S2D C;  3SZY A;  3HOY K;  1ZYR A;  4PAB A;  1YX2 A;  3I4N K;  2JA8 K;  4A3C C;  3G4C A;  1TWC A;  3IPJ A;  3OEP A;  1TWA K;  1B4B A;  4WIL A;  1I3Q C;  1ISE A;  3N3Y A;  4G0U A;  1L0W A;  1K83 C;  4AH6 A;  2ZUF A;  3I4M K;  3RZO K;  3AH5 A;  3LAJ A;  3AD8 C;  1SFO K;  1IS1 A;  3OPF A;  2R7Z C;  2VUM A;  3S0X A;  4OIP A;  1TWH K;  5CHP A;  4OIN A;  4KB2 A;  2CFA A;  3GTK K;  1EI6 A;  3L4J A;  4LK1 A;  1DCO A;  3GSI A;  2ZUE A;  5IYD C;  1PJ7 A;  4JK1 A;  1EFW A;  3M4O C;  1WOS A;  1TWA A;  3GEE A;  4KM8 A;  4A3C K;  3LPX A;  1YCL A;  4Y52 C;  4GFQ A;  1SFO A;  2P5M A;  1K83 K;  3MML B;  4BBS K;  1BDF A;  3TFH A;  5TMF A;  4GTF A;  2R92 C;  3GTK A;  1SMY A;  4BY1 C;  5FLM C;  3BP3 A;  3RZD C;  5M5W K;  1F9N A;  4GTL A;  4A93 C;  3GTO C;  3TFI A;  3S15 C;  2E2H C;  5IYD K;  4KC6 A;  5E68 A;  4P5B A;  3M4O K;  2PA8 L;  5IOT A;  3S1Q C;  1I3Q A;  5FJ8 K;  1IE0 A;  4GTE A;  4Y52 K;  5IOR A;  1EK8 A;  1TWG K;  3HOU C;  1R9T C;  3S2H K;  2R7Z A;  3N0C A;  2V6T A;  2CW0 A;  5M3M K;  3ERE D;  4KAS A;  1XZQ A;  2B63 K;  4BY1 K;  5FLM K;  2PA8 D;  4KB4 A;  3ORE A;  4A93 K;  3HOW C;  3S15 K;  4KMU A;  2E2H K;  5IP7 C;  1VLO A;  2CFA B;  4A3G C;  2E2J C;  3FKI C;  4Q4Z A;  2O5J A;  3S1N K;  3GTL C;  4KAT A;  3L4K A;  1Y1W A;  4KMH A;  3HOU K;  1R9T K;  1PJ6 A;  1RU0 A;  2R92 A;  5C4J K;  4LOW A;  4WJ4 A;  1G51 A;  4KN4 A;  4A3M C;  3GEH A;  4A3F C;  3GTO A;  3S1R C;  1J98 A;  1C0A A;  1KQ4 A;  2YU9 C;  3HOW K;  2A68 A;  5M3F K;  1DCH A;  1WCM A;  2VUM K;  1EQR A;  3K7A C;  2D6F C;  4BBR C;  5IP7 K;  2E2J K;  2Y0S L;  1R9T A;  5M5X K;  1I50 C;  4G7O A;  3S16 C;  4P5A A;  2JH3 A;  4NOI A;  4KDD A;  3GTG A;  4ILD A;  1J6W A;  1YNJ A;  4A3M K;  1JVI A;  1DD5 A;  5IOS A;  3AQO A;  4A3F K;  2Y0S D;  5D4D A;  4C3H C;  3V4G A;  2YU9 K;  4G0V A;  4OIQ A;  3FOF A;  1VGX A;  1Y1V C;  1O2A A;  2PPB A;  1XZQ B;  3H0G A;  2NVQ C;  1EH1 A;  3FKI A;  2NVT C;  1VH2 A;  3K7A K;  1IL2 A;  1WSV A;  4BBR K;  1TWF C;  3QX3 A;  4C45 A;  5IP9 C;  3GTL A;  4YG2 A;  3S2D K;  1F93 A;  1I50 K;  1GE9 A;  1XZP A;  2ZFZ A;  4Y7N C;  5C3E C;  4XLP A;  3GTJ C;  3AQP A;  4PAA A;  4BKW A;  1YNN A;  4A3I C;  4FM9 A;  2RH6 A;  1I3Q K;  1XXA A;  4LR2 A;  2YU9 A;  5M5Y K;  3NUH A;  3EQL A;  1Y1W C;  4G0W A;  4C3H K;  4Q5S A;  2R7Z K;  1Y1V K;  2R93 C;  2NVQ K;  2E2I A;  3CQZ A;  2NVT K;  3WOD A;  1HQM A;  1O2B A;  1I50 A;  1TWF K;  1WQF A;  4AYB D;  3DXJ A;  3GTQ C;  5IOQ A;  1J6V A;  4Y7N K;  1WCM C;  1F7U A;  1UV7 A;  3GTJ K;  2FQO A;  4DDQ A;  3GTP C;  4A3I K;  5TJ3 A;  1WOO A;  5HL8 A;  4G7Z A;  1Y1W K;  1Y1V A;  3GTG C;  3PO2 C;  2GAG C;  1ZBS A;  2R92 K;  5JFE A;  3AD7 C;  2R93 K;  4LQY A;  1TWF A;  1O27 A;  3RZD K;  1IQ0 A;  3GTO K;  3GDZ A;  1IW7 A;  2JA5 A;  1XXB A;  3BUE A;  1O26 A;  1JQW A;  2A69 A;  4YFK A;  3GTJ A;  2XCO A;  3M3Y C;  3GTQ K;  3H0G C;  4C2M C;  1WCM K;  1VRQ C;  2GAH C;  3T00 A;  3S1Q K;  1PJ5 A;  2A6E A;  2EBB A;  3GEI A;  4XSX A;  4C3I C;  3TTG A;  3H3V L;  3GTP K;  4A3E C;  1B4A A;  1INN A;  2Y3P A;  2NVX C;  1XZP B;  4A3L C;  5IYC C;  4GTB A;  1DCP A;  2R93 A;  3CAG A;  3GTG K;  3GIR A;  4LLG A;  1I6H C;  1WQH A;  1ZXO A;  5C44 C;  3AD9 C;  3A8J A;  3Q3Q A;  3FHZ A;  4OIR A;  3H3V D;  4BXX C;  3GTQ A;  3S1M C;  3M3Y K;  3TFJ A;  3S14 C;  4BLA A;  3H0G K;  4C2M K;  2E2I C;  3GTP A;  4A3G K;  4WJ3 M;  3CQZ C;  4A3B C;  4X6A C;  3FKI K;  3G4A A;  4C3I K;  2XCR B;  4LK0 A;  3GTL K;  3HOV C;  1ZVU A;  4KAR A;  2NVY C;  4A3L K;  3GTM A;  4C3J C;  5EGE A;  4KM9 A;  2JA6 C;  1I6H K;  4ZH4 A;  1O29 A;  2RGR A;  1VJE A;  5C44 K;  2PHC B;  1BJT A;  1USO A;  3S1R K;  4GTA A;  4A3D C;  4MEY A;  4BXX K;  1WIH A;  3SZZ A;  3T02 A;  3S1M K;  4KMA A;  3A8K A;  1WOR A;  2KWA A;  3S14 K;  2E2I K;  4X6A K;  3CQZ K;  3FOE A;  3PO3 C;  4A3B K;  2NVX A;  2W7V A;  2V6S A;  3S16 K;  5L46 A;  2JA5 C;  3HOV K;  2A6H A;  4BBS C;  2NVY K;  3T01 A;  1WSR A;  4XLN A;  1IBA A;  4C3J K;  4M1X A;  3ADA C;  4QIW L;  2JA6 K;  5EGH A;  1BS2 A;  1XPP A;  4AYB L;  1I6V A;  4A3D K;  3HOZ C;  2PMZ L;  3N0B A;  3VA7 A;  1X31 C;  4YFN A;  2JA7 C;  4KMD A;  5C4X C;  2GSU A;  4QIW D;  5IP9 K;  3PO3 K;  5CJ9 A;  2GSN A;  4A3J C;  2NVY A;  1TWG C;  2JA5 K;  3HOX C;  3S2H C;  5C3E K;  4XSZ A;  2PMZ D;  1TWH A;  2JA6 A;  4KAW X;  2B63 C;  1O25 A;  1WQG A;  2V6U A;  1XXC A;  4RMF A;  2P8T A;  1USM A;  1V5V A;  3HOZ K;  3GTM C;  4KN7 A;  4GTD A;  4A3K C;  2JA7 K;  4O2D A;  4YFX A;  4BY7 C;  5C4X K;  5IYB C;  4XCH A;  4QJV B;  1J6X A;  1K83 A;  3S1N C;  3HKZ L;  4A3J K;  1O2F B;  3HOX K;  5C4J C;  1TWC C;  4MEX A;  5JVO A;  3A8I A;  4MQ9 A;  2WB1 L;  3HKZ D;  2WAQ L;  1HI9 A;  2FQT A;  3PO2 K;  3S17 C;  2JA7 A;  1O24 A;  3GTM K;  1JOE A;  4A3K K;  2BE5 A;  2VUM C;  4BY7 K;  5IYB K;  1O28 A;  1TWG A;  4GZY A;  4GT9 A;  3HOY C;  1ZQ1 C;  1BGW A;  2WB1 D;  2WAQ D;  3I4N C;  2JA8 C;  4P9S A;  2B63 A;  3HXA A;  3JST A;  1F7V A;  2GSO A;  4BLB A;  1TWA C;  4GTC A;  3LAP A;  4A3E K;  1TWC K;  1WOP A;  3RZO C;  2XCQ A;  3I4M C;  4G7H A;  2NVX K;  5IYC K;  1SFO C;  1AB4 A;  4LJZ A;  5TMC A;  2E2H A;  3S17 K;  3BP8 C;  1TWH C;  4J3N A; 
#chains in the Genus database with same CATH homology
 2O5I A;  4QIW L;  5IP7 C;  2JA6 K;  4QJV A;  3GTK C;  2E2J C;  4A3G C;  4OIO A;  3GTP C;  3FKI C;  4A3I K;  4Q4Z A;  2O5J A;  3S1N K;  1XPP A;  4AYB L;  1I6V A;  3GTL C;  3S2D C;  4A3D K;  4G7Z A;  1Y1W K;  3HOU K;  1R9T K;  3HOY K;  3HOZ C;  2PMZ L;  3GTG C;  1ZYR A;  3PO2 C;  5C4J K;  4KN4 A;  4YFN A;  2JA7 C;  2R92 K;  2JA8 K;  3I4N K;  4A3C C;  2R93 K;  5C4X C;  4A3M C;  1TWA K;  4QIW D;  5IP9 K;  3RZD K;  3PO3 K;  4A3F C;  1I3Q C;  3RZO K;  4A3J C;  1K83 C;  3S1R C;  3GTO K;  3I4M K;  1IW7 A;  2YU9 C;  1TWG C;  2JA5 K;  3HOX C;  2A69 A;  1SFO K;  3HOW K;  4YFK A;  2A68 A;  5C3E K;  5M3F K;  4XSZ A;  3M3Y C;  2R7Z C;  3GTQ K;  2PMZ D;  3H0G C;  4OIP A;  1TWH K;  1WCM K;  2VUM K;  3K7A C;  4OIN A;  2B63 C;  4XSX A;  2A6E A;  3S1Q K;  4BBR C;  5IP7 K;  3GTK K;  2E2J K;  3H3V L;  3GTP K;  4A3E C;  2Y0S L;  5M5X K;  1I50 C;  4LK1 A;  4G7O A;  2NVX C;  4A3L C;  3S16 C;  4NOI A;  5IYC C;  3HOZ K;  5IYD C;  3GTM C;  4JK1 A;  3GTG K;  4KN7 A;  3M4O C;  4A3K C;  4LLG A;  1YNJ A;  2JA7 K;  1I6H C;  4A3C K;  4YFX A;  4BY7 C;  5C4X K;  4A3M K;  5C44 C;  5IYB C;  4QJV B;  4Y52 C;  4OIR A;  3H3V D;  4A3F K;  3S1N C;  4BXX C;  3HKZ L;  2Y0S D;  4A3J K;  1K83 K;  5D4D A;  4BBS K;  2YU9 K;  4OIQ A;  1BDF A;  3S1M C;  5TMF A;  3HOX K;  1Y1V C;  2PPB A;  3M3Y K;  5C4J C;  2NVQ C;  2R92 C;  3S14 C;  1SMY A;  3H0G K;  4C2M K;  2E2I C;  4X6A C;  4A3G K;  2NVT C;  3CQZ C;  5FLM C;  3K7A K;  4BY1 C;  4A3B C;  3FKI K;  1TWC C;  4A3B K;  4C3I K;  4BBR K;  1TWF C;  5IP9 C;  3RZD C;  4LK0 A;  4MEX A;  4YG2 A;  5M5W K;  3GTL K;  3S2D K;  1I50 K;  3GTO C;  3HOV C;  4A93 C;  4MQ9 A;  2NVY C;  2WB1 L;  3HKZ D;  2WAQ L;  4A3L K;  3S15 C;  3PO2 K;  3S17 C;  4Y7N C;  2E2H C;  5C3E C;  3GTM K;  4XLP A;  5IYD K;  3GTJ C;  3M4O K;  4A3K K;  2JA6 C;  2BE5 A;  2PA8 L;  2VUM C;  1I6H K;  4ZH4 A;  3S1Q C;  4BY7 K;  1YNN A;  4A3I C;  5C44 K;  5FJ8 K;  5IYB K;  1I3Q K;  3S1R K;  4Y52 K;  4A3D C;  4GZY A;  5M5Y K;  4MEY A;  1TWG K;  3EQL A;  1Y1W C;  3HOU C;  1R9T C;  3HOY C;  4BXX K;  3S2H K;  4C3H K;  4Q5S A;  2R7Z K;  2WB1 D;  2WAQ D;  3S1M K;  3I4N C;  1Y1V K;  2CW0 A;  5M3M K;  2JA8 C;  2R93 C;  2B63 K;  2NVQ K;  3S14 K;  1TWA C;  2E2I K;  4X6A K;  2NVT K;  3CQZ K;  5FLM K;  2PA8 D;  4A3E K;  4BY1 K;  3PO3 C;  1TWC K;  1HQM A;  3WOD A;  3S2H C;  1TWF K;  3RZO C;  3I4M C;  4G7H A;  2NVX K;  3S16 K;  2JA5 C;  5IYC K;  1SFO C;  3HOV K;  3HOW C;  2A6H A;  4A93 K;  4BBS C;  2NVY K;  4LJZ A;  4AYB D;  5TMC A;  3DXJ A;  3GTQ C;  3S15 K;  4KMU A;  3S17 K;  4XLN A;  4Y7N K;  4C3J K;  2E2H K;  1TWH C;  1WCM C;  3GTJ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...