4QJVB

The x-ray crystal structure of rpo3/rpo11 heterodimer of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qjvB00
1TWFC 5M5XK 4A3MC 3S17K 2NVYK 1TWHK 1SFOK 3GTKK 1WCMC 2WB1D 3HKZD 2JA5K 3I4MK 4A3IK 4A3KK 3PO2C 1R9TC 3S2HK 3GTOK 3S15C 4Y7NK 2A6HA 4A3DC 5TMFA 4A3LK 2VUMC 5FLMK 1BDFA 2NVYC 4BXXK 3GTMC 1Y1VK 5C3EK 2E2IK 3HOUK 4A93K 4A3BK 2NVXC 3H0GK 3FKIC 3GTJK 3HOWK 4Q5SA 1K83C 4QIWL 4X6AK 5FJ8K 2JA8C 4AYBD 3S2DK 3DXJA 4C3JK 3GTPK 1Y1VC 1I6HC 2PPBA 4BY7K 3CQZK 5IP7K 5C4JC 4OIRA 1YNJA 1TWAC 3S1QC 3H0GC 5C4XC 4X6AC 2O5IA 4LK1A 3S14K 5IYDK 3HOVK 4A3EK 3S16C 4BBSC 3RZOC 1SMYA 4YFNA 4Q4ZA 4OINA 4XSZA 4A3JC 5TMCA 4OIPA 5M3FK 4A3GC 4BY1C 4OIQA 2YU9K 3GTGK 3RZDK 4QIWD 3S17C 2A6EA 1TWHC 1SFOC 3GTKC 2JA5C 3K7AK 3I4MC 4A3IC 4A3KC 3S2HC 4GZYA 1TWCK 1YNNA 2R7ZK 4A3GK 3GTOC 4Y7NC 2JA6K 4C3HK 3S1NK 1I50K 3GTQK 5IP9K 3M4OK 4A3LC 3H3VL 2B63K 4OIOA 1HQMA 4BBRK 5FLMC 3S1RK 2E2JK 2Y0SL 2JA7K 2NVQK 3GTGC 5C3EC 2E2IC 3I4NK 4BXXC 3HOUC 5M5WK 4A93C 4A3BC 3M3YK 4A3CK 2CW0A 1IW7A 3GTJC 3HOWC 1Y1WK 1I50C 3S2DC 5M3MK 3M4OC 2R93K 2A69A 4YFXA 4BBRC 3GTPC 4KN7A 2JA7C 3HOYK 2PA8D 4A3FK 3GTLK 4BY7C 3CQZC 5IP7C 4XLPA 3S1MK 4G7ZA 3PO3K 4C2MK 3HOXK 2PA8L 3WODA 5IYDC 3HOVC 2A68A 2E2HK 5IYBK 3S14C 4Y52K 4A3EC 2WAQL 1I3QK 3H3VD 3HOZK 1TWFK 4G7OA 2Y0SD 4A3MK 4YFKA 2O5JA 1WCMK 4NOIA 3PO2K 1R9TK 4G7HA 2YU9C 4LLGA 3RZDC 4LK0A 4A3DK 3K7AC 2PMZL 3HOZC 2BE5A 5IYCK 2VUMK 4XSXA 1TWCC 2R7ZC 4MQ9A 3GTMK 3S1NC 2JA6C 3GTQC 1I6VA 5IP9C 4QJVA 2NVXK 4XLNA 4BY1K 2B63C 3S1RC 2E2JC 4MEYA 2NVQC 3FKIK 2R92K 1ZYRA 3I4NC 1K83K 5D4DA 2JA8K 2WB1L 3HKZL 5IYCC 3M3YC 4A3CC 2WAQD 1I6HK 2NVTK 4YG2A 4ZH4A 1Y1WC 5M5YK 4KN4A 3GTLC 5C4JK 2R93C 5C44K 1TWAK 1TWGK 3S1QK 2R92C 3HOYC 5C4XK 4A3FC 3EQLA 3S1MC 2PMZD 2NVTC 3S16K 4LJZA 3PO3C 3RZOK 4BBSK 4KMUA 4MEXA 3HOXC 1XPPA 5C44C 4QJVB 4JK1A 1TWGC 4AYBL 4C3IK 4Y52C 5IYBC 4A3JK 2E2HC 3S15K 1I3QC
chains in the Genus database with same CATH superfamily
2RH6A 2XCOA 4KM8A 2NVYK 1SFOK 3GTKK 1WCMC 2WB1D 2JA5K 1VJEA 1R9TC 3L4KA 4Y7NK 3MMLB 1WORA 2NVYC 3T00A 1XZPB 3HOUK 2NVXC 5CHPA 3GIRA 3GTJA 3H0GK 1K83C 4QIWL 4X6AK 3GTPK 2JA7A 1O28A 2PPBA 2ZUEA 3CQZA 4P9SA 1USMA 5EGHA 3H0GC 4X6AC 5IYDK 1J6WA 2P5MA 3TTGA 4OINA 1XZQA 1YCLA 3A8IA 4GTLA 5M3FK 4A3GC 1EH1A 2A6EA 3I4MC 4A3IC 4A3KC 3S2HC 1TWCK 5IOTA 4FM9A 2JA6K 3GTQA 5IP9K 3M4OK 5TJ3A 3H3VL 2GSUA 4BBRK 2B63K 2E2IC 5M5WK 4A3BC 3M3YK 2PHCB 1IW7A 3HOWC 3ADAC 3GTLA 3M4OC 4BBRC 4KN7A 4A3FK 4BY7C 1WOPA 4XLPA 2V6SA 3HXAA 1TWGA 3CAGA 2A68A 5IYBK 4A3EC 3HOZK 4G7OA 3AD7C 1WCMA 2O5JA 1V5VA 1R9TA 4G7HA 1PJ6A 1DCPA 5JVOA 3K7AC 3OPFA 4GTCA 3HOZC 4A3DK 3SZYA 2NVYA 4ILDA 3GTKA 3S1NC 3ERED 4GTBA 3S1RC 2E2JC 3I4NC 3FKIK 1ZYRA 1K83A 5D4DA 3HKZL 4A3CC 2WAQD 2GSNA 1I6HK 4FZBA 3GSIA 5L46A 3H0GA 2CFAB 2EBBA 3N0BA 3EQLA 3S1MC 1F93A 2PMZD 3S16K 3PO3C 1XZPA 4BBSK 3HOXC 1XPPA 4AYBL 4Y52C 2E2HC 1F9NA 1TWFC 3S0XA 4A3MC 3S17K 1TWHK 1DD5A 4XCHA 3PO2C 3L4JA 3N0CA 5IORA 3GTOK 3OREA 5TMFA 4A3LK 2VUMC 1VGXA 2ZFZA 4BXXK 3GTMC 1Y1VK 2E2IA 5C3EK 1TWCA 4KAWX 1J6XA 3S2DK 1XXBA 5EGEA 4C3JK 4PABA 1Y1VC 4BKWA 4KB4A 1IL2A 5CJ9A 5C4XC 4KM9A 4LK1A 2ZUFA 3HOVK 4YFNA 4XSZA 4A3JC 4OIQA 2YU9K 4QIWD 1SFOC 3GTKC 2JA5C 3AH5A 4J3NA 4GZYA 1JQWA 2R7ZK 1J98A 2V6UA 4Y7NC 4C3HK 1I50K 1DCHA 1VLOA 1HQMA 2NVQK 2Y0SL 1HI9A 3HOUC 1Y1WK 1I50C 2R93K 2D6FC 2A69A 4YFXA 4KDDA 3GTPC 3HOYK 4GTAA 4KMDA 1AB4A 3NUHA 1WOSA 4C2MK 3WODA 5IYDC 2E2HA 1IS1A 1I3QK 3H3VD 1TWFA 2GAGC 2P8TA 4LQYA 4G0UA 1O24A 4LOWA 1WSVA 4C2MC 1WSRA 4DDQA 2GSOA 4LK0A 4KB2A 2BE5A 5IYCK 2VUMA 1TWCC 3GTMA 2JA6C 5IP9C 1F7VA 4XLNA 2B63C 2R92K 3A8KA 1WOOA 2JA8K 5IYCC 3M3YC 1Y1VA 1EFWA 4YG2A 4ZH4A 1G51A 5C4JK 1TWAK 4RMFA 3S1QK 2R92C 4A3FC 1O2BA 3AQOA 4KATA 4LJZA 3RZOK 4JK1A 4C3IK 5IYBC 3S15K 3AD8C 4BY1K 1C0AA 5M5XK 1B4AA 1UV7A 1SFOA 3HKZD 2JA5A 3S15C 4P5AA 2A6HA 4A3DC 3SZZA 5FLMK 4A93K 3A8JA 2XCQA 1JOEA 1ZQ1C 3FKIC 3GTJK 1I50A 4Q5SA 4AYBD 3V4GA 3GTPA 3LPXA 2XCRB 1I6HC 3CQZK 5IP7K 4OIRA 1WQHA 1XZQB 2Y3PA 1BJTA 2O5IA 3GEHA 3S14K 4WJ3M 1XXAA 5HL8A 3S16C 4BBSC 4G0VA 4G0WA 5TMCA 1WQGA 1GE9A 1INNA 3GTGK 3RZDK 3S17C 1TWHC 1BGWA 1WQFA 3VA7A 4GTEA 1YNNA 3GEIA 3GTOC 2JA6A 3GTQK 4A3LC 2B63A 3GTGC 4BXXC 3N3YA 5C3EC 1B4BA 1RU0A 3TFIA 3LAPA 3S2DC 5M3MK 1O25A 4C3JC 2R92A 1ISEA 1ZBSA 4KMAA 1J6VA 4GFQA 3FOEA 5E68A 1O29A 4WJ4A 4GT9A 3HOVC 4KASA 2Y0SD 4YFKA 1WCMK 1USOA 3JSTA 1R9TK 2YU9C 4LLGA 2GAHC 4KC6A 4XSXA 2KWAA 4MQ9A 2R7ZC 1IBAA 3GEEA 4C3HC 2NVXK 3FKIA 4MEYA 2NVQC 1K83K 2WB1L 4O2DA 4BLAA 2NVTK 4P5BA 1Y1WC 2R93C 4C45A 5C44K 1IE0A 3HOYC 3Q3QA 2NVTC 3OEPA 1DCOA 4M1XA 4AH6A 5C44C 4QJVB 4BLBA 4KARA 4A3GK 1I3QC 3IPJA 2FQOA 2CFAA 1ZVUA 1TWHA 2V6TA 3I4MK 1O27A 4GTDA 4A3IK 1O2FB 5IOSA 4A3KK 3S2HK 3GTOA 2W7VA 1IQ0A 3GTGA 1BDFA 2E2IK 1PJ5A 4A3BK 3HOWK 5FJ8K 2JA8C 1ZXOA 3DXJA 1BS2A 4BY7K 5C4JC 1YNJA 1TWAC 3S1QC 1X31C 3FHZA 4A3EK 2FQTA 3RZOC 1SMYA 4Q4ZA 3TFHA 4C3IC 2JH3A 1KQ4A 4OIPA 1VH2A 4BY1C 3G4AA 2YU9A 3T01A 3QX3A 3K7AK 1YX2A 2R7ZA 3S1NK 3LAJA 4OIOA 5FLMC 3S1RK 2E2JK 1F7UA 2JA7K 3I4NK 4A93C 4A3CK 2CW0A 3AD9C 3GTJC 1Y1WA 2R93A 1EK8A 2NVXA 2JA7C 1JVIA 2PA8D 1O26A 3CQZC 5IP7C 3S1MK 1EQRA 1L0WA 1VRQC 5JFEA 4G7ZA 3PO3K 3HOXK 3BP8C 2PA8L 3S14C 4Y52K 2E2HK 1PJ7A 1I3QA 1O2AA 2WAQL 1XXCA 1TWFK 3GDZA 4A3MK 4WILA 4NOIA 3G4CA 4GTFA 3PO2K 3AQPA 3FOFA 3RZDC 3BUEA 4LR2A 4PAAA 2PMZL 2VUMK 5IOQA 2RGRA 3GTMK 3GTQC 1I6VA 3GTLK 4QJVA 3BP3A 5M5YK 4KN4A 3GTLC 1TWAA 1TWGK 5C4XK 1EI6A 3TFJA 4KMUA 4KMHA 4MEXA 1WIHA 1TWGC 4A3JK 3T02A
chains in the Genus database with same CATH topology
1TWFC 5M5XK 4A3MC 3S17K 2NVYK 1TWHK 1SFOK 3GTKK 1WCMC 2WB1D 3HKZD 2JA5K 3I4MK 4A3IK 4A3KK 3PO2C 1R9TC 3S2HK 3GTOK 3S15C 4Y7NK 2A6HA 4A3DC 5TMFA 4A3LK 2VUMC 5FLMK 1BDFA 2NVYC 4BXXK 3GTMC 1Y1VK 5C3EK 2E2IK 3HOUK 4A93K 4A3BK 2NVXC 3H0GK 3FKIC 3GTJK 3HOWK 4Q5SA 1K83C 4QIWL 4X6AK 5FJ8K 2JA8C 4AYBD 3S2DK 3DXJA 4C3JK 3GTPK 1Y1VC 1I6HC 2PPBA 4BY7K 3CQZK 5IP7K 5C4JC 4OIRA 1YNJA 1TWAC 3S1QC 3H0GC 5C4XC 4X6AC 2O5IA 4LK1A 3S14K 5IYDK 3HOVK 4A3EK 3S16C 4BBSC 3RZOC 1SMYA 4YFNA 4Q4ZA 4OINA 4XSZA 4A3JC 5TMCA 4OIPA 5M3FK 4A3GC 4BY1C 4OIQA 2YU9K 3GTGK 3RZDK 4QIWD 3S17C 2A6EA 1TWHC 1SFOC 3GTKC 2JA5C 3K7AK 3I4MC 4A3IC 4A3KC 3S2HC 4GZYA 1TWCK 1YNNA 2R7ZK 4A3GK 3GTOC 4Y7NC 2JA6K 4C3HK 3S1NK 1I50K 3GTQK 5IP9K 3M4OK 4A3LC 3H3VL 2B63K 4OIOA 1HQMA 4BBRK 5FLMC 3S1RK 2E2JK 2Y0SL 2JA7K 2NVQK 3GTGC 5C3EC 2E2IC 3I4NK 4BXXC 3HOUC 5M5WK 4A93C 4A3BC 3M3YK 4A3CK 2CW0A 1IW7A 3GTJC 3HOWC 1Y1WK 1I50C 3S2DC 5M3MK 3M4OC 2R93K 2A69A 4YFXA 4BBRC 3GTPC 4KN7A 2JA7C 3HOYK 2PA8D 4A3FK 3GTLK 4BY7C 3CQZC 5IP7C 4XLPA 3S1MK 4G7ZA 3PO3K 4C2MK 3HOXK 2PA8L 3WODA 5IYDC 3HOVC 2A68A 2E2HK 5IYBK 3S14C 4Y52K 4A3EC 2WAQL 1I3QK 3H3VD 3HOZK 1TWFK 4G7OA 2Y0SD 4A3MK 4YFKA 2O5JA 1WCMK 4NOIA 3PO2K 1R9TK 4G7HA 2YU9C 4LLGA 3RZDC 4LK0A 4A3DK 3K7AC 2PMZL 3HOZC 2BE5A 5IYCK 2VUMK 4XSXA 1TWCC 2R7ZC 4MQ9A 3GTMK 3S1NC 2JA6C 3GTQC 1I6VA 5IP9C 4QJVA 2NVXK 4XLNA 4BY1K 2B63C 3S1RC 2E2JC 4MEYA 2NVQC 3FKIK 2R92K 1ZYRA 3I4NC 1K83K 5D4DA 2JA8K 2WB1L 3HKZL 5IYCC 3M3YC 4A3CC 2WAQD 1I6HK 2NVTK 4YG2A 4ZH4A 1Y1WC 5M5YK 4KN4A 3GTLC 5C4JK 2R93C 5C44K 1TWAK 1TWGK 3S1QK 2R92C 3HOYC 5C4XK 4A3FC 3EQLA 3S1MC 2PMZD 2NVTC 3S16K 4LJZA 3PO3C 3RZOK 4BBSK 4KMUA 4MEXA 3HOXC 1XPPA 5C44C 4QJVB 4JK1A 1TWGC 4AYBL 4C3IK 4Y52C 5IYBC 4A3JK 2E2HC 3S15K 1I3QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF C;  5M5X K;  4A3M C;  3S17 K;  2NVY K;  1TWH K;  1SFO K;  3GTK K;  1WCM C;  2WB1 D;  3HKZ D;  2JA5 K;  3I4M K;  4A3I K;  4A3K K;  3PO2 C;  1R9T C;  3S2H K;  3GTO K;  3S15 C;  4Y7N K;  2A6H A;  4A3D C;  5TMF A;  4A3L K;  2VUM C;  5FLM K;  1BDF A;  2NVY C;  4BXX K;  3GTM C;  1Y1V K;  5C3E K;  2E2I K;  3HOU K;  4A93 K;  4A3B K;  2NVX C;  3H0G K;  3FKI C;  3GTJ K;  3HOW K;  4Q5S A;  1K83 C;  4QIW L;  4X6A K;  5FJ8 K;  2JA8 C;  4AYB D;  3S2D K;  3DXJ A;  4C3J K;  3GTP K;  1Y1V C;  1I6H C;  2PPB A;  4BY7 K;  3CQZ K;  5IP7 K;  5C4J C;  4OIR A;  1YNJ A;  1TWA C;  3S1Q C;  3H0G C;  5C4X C;  4X6A C;  2O5I A;  4LK1 A;  3S14 K;  5IYD K;  3HOV K;  4A3E K;  3S16 C;  4BBS C;  3RZO C;  1SMY A;  4YFN A;  4Q4Z A;  4OIN A;  4XSZ A;  4A3J C;  5TMC A;  4OIP A;  5M3F K;  4A3G C;  4BY1 C;  4OIQ A;  2YU9 K;  3GTG K;  3RZD K;  4QIW D;  3S17 C;  2A6E A;  1TWH C;  1SFO C;  3GTK C;  2JA5 C;  3K7A K;  3I4M C;  4A3I C;  4A3K C;  3S2H C;  4GZY A;  1TWC K;  1YNN A;  2R7Z K;  4A3G K;  3GTO C;  4Y7N C;  2JA6 K;  4C3H K;  3S1N K;  1I50 K;  3GTQ K;  5IP9 K;  3M4O K;  4A3L C;  3H3V L;  2B63 K;  4OIO A;  1HQM A;  4BBR K;  5FLM C;  3S1R K;  2E2J K;  2Y0S L;  2JA7 K;  2NVQ K;  3GTG C;  5C3E C;  2E2I C;  3I4N K;  4BXX C;  3HOU C;  5M5W K;  4A93 C;  4A3B C;  3M3Y K;  4A3C K;  2CW0 A;  1IW7 A;  3GTJ C;  3HOW C;  1Y1W K;  1I50 C;  3S2D C;  5M3M K;  3M4O C;  2R93 K;  2A69 A;  4YFX A;  4BBR C;  3GTP C;  4KN7 A;  2JA7 C;  3HOY K;  2PA8 D;  4A3F K;  3GTL K;  4BY7 C;  3CQZ C;  5IP7 C;  4XLP A;  3S1M K;  4G7Z A;  3PO3 K;  4C2M K;  3HOX K;  2PA8 L;  3WOD A;  5IYD C;  3HOV C;  2A68 A;  2E2H K;  5IYB K;  3S14 C;  4Y52 K;  4A3E C;  2WAQ L;  1I3Q K;  3H3V D;  3HOZ K;  1TWF K;  4G7O A;  2Y0S D;  4A3M K;  4YFK A;  2O5J A;  1WCM K;  4NOI A;  3PO2 K;  1R9T K;  4G7H A;  2YU9 C;  4LLG A;  3RZD C;  4LK0 A;  4A3D K;  3K7A C;  2PMZ L;  3HOZ C;  2BE5 A;  5IYC K;  2VUM K;  4XSX A;  1TWC C;  2R7Z C;  4MQ9 A;  3GTM K;  3S1N C;  2JA6 C;  3GTQ C;  1I6V A;  5IP9 C;  4QJV A;  2NVX K;  4XLN A;  4BY1 K;  2B63 C;  3S1R C;  2E2J C;  4MEY A;  2NVQ C;  3FKI K;  2R92 K;  1ZYR A;  3I4N C;  1K83 K;  5D4D A;  2JA8 K;  2WB1 L;  3HKZ L;  5IYC C;  3M3Y C;  4A3C C;  2WAQ D;  1I6H K;  2NVT K;  4YG2 A;  4ZH4 A;  1Y1W C;  5M5Y K;  4KN4 A;  3GTL C;  5C4J K;  2R93 C;  5C44 K;  1TWA K;  1TWG K;  3S1Q K;  2R92 C;  3HOY C;  5C4X K;  4A3F C;  3EQL A;  3S1M C;  2PMZ D;  2NVT C;  3S16 K;  4LJZ A;  3PO3 C;  3RZO K;  4BBS K;  4KMU A;  4MEX A;  3HOX C;  1XPP A;  5C44 C;  4QJV B;  4JK1 A;  1TWG C;  4AYB L;  4C3I K;  4Y52 C;  5IYB C;  4A3J K;  2E2H C;  3S15 K;  1I3Q C; 
#chains in the Genus database with same CATH topology
 2RH6 A;  2XCO A;  4KM8 A;  2NVY K;  1SFO K;  3GTK K;  1WCM C;  2WB1 D;  2JA5 K;  1VJE A;  1R9T C;  3L4K A;  4Y7N K;  3MML B;  1WOR A;  2NVY C;  3T00 A;  1XZP B;  3HOU K;  2NVX C;  5CHP A;  3GIR A;  3GTJ A;  3H0G K;  1K83 C;  4QIW L;  4X6A K;  3GTP K;  2JA7 A;  1O28 A;  2PPB A;  2ZUE A;  3CQZ A;  4P9S A;  1USM A;  5EGH A;  3H0G C;  4X6A C;  5IYD K;  1J6W A;  2P5M A;  3TTG A;  4OIN A;  1XZQ A;  1YCL A;  3A8I A;  4GTL A;  5M3F K;  4A3G C;  1EH1 A;  2A6E A;  3I4M C;  4A3I C;  4A3K C;  3S2H C;  1TWC K;  5IOT A;  4FM9 A;  2JA6 K;  3GTQ A;  5IP9 K;  3M4O K;  5TJ3 A;  3H3V L;  2GSU A;  4BBR K;  2B63 K;  2E2I C;  5M5W K;  4A3B C;  3M3Y K;  2PHC B;  1IW7 A;  3HOW C;  3ADA C;  3GTL A;  3M4O C;  4BBR C;  4KN7 A;  4A3F K;  4BY7 C;  1WOP A;  4XLP A;  2V6S A;  3HXA A;  1TWG A;  3CAG A;  2A68 A;  5IYB K;  4A3E C;  3HOZ K;  4G7O A;  3AD7 C;  1WCM A;  2O5J A;  1V5V A;  1R9T A;  4G7H A;  1PJ6 A;  1DCP A;  5JVO A;  3K7A C;  3OPF A;  4GTC A;  3HOZ C;  4A3D K;  3SZY A;  2NVY A;  4ILD A;  3GTK A;  3S1N C;  3ERE D;  4GTB A;  3S1R C;  2E2J C;  3I4N C;  3FKI K;  1ZYR A;  1K83 A;  5D4D A;  3HKZ L;  4A3C C;  2WAQ D;  2GSN A;  1I6H K;  4FZB A;  3GSI A;  5L46 A;  3H0G A;  2CFA B;  2EBB A;  3N0B A;  3EQL A;  3S1M C;  1F93 A;  2PMZ D;  3S16 K;  3PO3 C;  1XZP A;  4BBS K;  3HOX C;  1XPP A;  4AYB L;  4Y52 C;  2E2H C;  1F9N A;  1TWF C;  3S0X A;  4A3M C;  3S17 K;  1TWH K;  1DD5 A;  4XCH A;  3PO2 C;  3L4J A;  3N0C A;  5IOR A;  3GTO K;  3ORE A;  5TMF A;  4A3L K;  2VUM C;  1VGX A;  2ZFZ A;  4BXX K;  3GTM C;  1Y1V K;  2E2I A;  5C3E K;  1TWC A;  4KAW X;  1J6X A;  3S2D K;  1XXB A;  5EGE A;  4C3J K;  4PAB A;  1Y1V C;  4BKW A;  4KB4 A;  1IL2 A;  5CJ9 A;  5C4X C;  4KM9 A;  4LK1 A;  2ZUF A;  3HOV K;  4YFN A;  4XSZ A;  4A3J C;  4OIQ A;  2YU9 K;  4QIW D;  1SFO C;  3GTK C;  2JA5 C;  3AH5 A;  4J3N A;  4GZY A;  1JQW A;  2R7Z K;  1J98 A;  2V6U A;  4Y7N C;  4C3H K;  1I50 K;  1DCH A;  1VLO A;  1HQM A;  2NVQ K;  2Y0S L;  1HI9 A;  3HOU C;  1Y1W K;  1I50 C;  2R93 K;  2D6F C;  2A69 A;  4YFX A;  4KDD A;  3GTP C;  3HOY K;  4GTA A;  4KMD A;  1AB4 A;  3NUH A;  1WOS A;  4C2M K;  3WOD A;  5IYD C;  2E2H A;  1IS1 A;  1I3Q K;  3H3V D;  1TWF A;  2GAG C;  2P8T A;  4LQY A;  4G0U A;  1O24 A;  4LOW A;  1WSV A;  4C2M C;  1WSR A;  4DDQ A;  2GSO A;  4LK0 A;  4KB2 A;  2BE5 A;  5IYC K;  2VUM A;  1TWC C;  3GTM A;  2JA6 C;  5IP9 C;  1F7V A;  4XLN A;  2B63 C;  2R92 K;  3A8K A;  1WOO A;  2JA8 K;  5IYC C;  3M3Y C;  1Y1V A;  1EFW A;  4YG2 A;  4ZH4 A;  1G51 A;  5C4J K;  1TWA K;  4RMF A;  3S1Q K;  2R92 C;  4A3F C;  1O2B A;  3AQO A;  4KAT A;  4LJZ A;  3RZO K;  4JK1 A;  4C3I K;  5IYB C;  3S15 K;  3AD8 C;  4BY1 K;  1C0A A;  5M5X K;  1B4A A;  1UV7 A;  1SFO A;  3HKZ D;  2JA5 A;  3S15 C;  4P5A A;  2A6H A;  4A3D C;  3SZZ A;  5FLM K;  4A93 K;  3A8J A;  2XCQ A;  1JOE A;  1ZQ1 C;  3FKI C;  3GTJ K;  1I50 A;  4Q5S A;  4AYB D;  3V4G A;  3GTP A;  3LPX A;  2XCR B;  1I6H C;  3CQZ K;  5IP7 K;  4OIR A;  1WQH A;  1XZQ B;  2Y3P A;  1BJT A;  2O5I A;  3GEH A;  3S14 K;  4WJ3 M;  1XXA A;  5HL8 A;  3S16 C;  4BBS C;  4G0V A;  4G0W A;  5TMC A;  1WQG A;  1GE9 A;  1INN A;  3GTG K;  3RZD K;  3S17 C;  1TWH C;  1BGW A;  1WQF A;  3VA7 A;  4GTE A;  1YNN A;  3GEI A;  3GTO C;  2JA6 A;  3GTQ K;  4A3L C;  2B63 A;  3GTG C;  4BXX C;  3N3Y A;  5C3E C;  1B4B A;  1RU0 A;  3TFI A;  3LAP A;  3S2D C;  5M3M K;  1O25 A;  4C3J C;  2R92 A;  1ISE A;  1ZBS A;  4KMA A;  1J6V A;  4GFQ A;  3FOE A;  5E68 A;  1O29 A;  4WJ4 A;  4GT9 A;  3HOV C;  4KAS A;  2Y0S D;  4YFK A;  1WCM K;  1USO A;  3JST A;  1R9T K;  2YU9 C;  4LLG A;  2GAH C;  4KC6 A;  4XSX A;  2KWA A;  4MQ9 A;  2R7Z C;  1IBA A;  3GEE A;  4C3H C;  2NVX K;  3FKI A;  4MEY A;  2NVQ C;  1K83 K;  2WB1 L;  4O2D A;  4BLA A;  2NVT K;  4P5B A;  1Y1W C;  2R93 C;  4C45 A;  5C44 K;  1IE0 A;  3HOY C;  3Q3Q A;  2NVT C;  3OEP A;  1DCO A;  4M1X A;  4AH6 A;  5C44 C;  4QJV B;  4BLB A;  4KAR A;  4A3G K;  1I3Q C;  3IPJ A;  2FQO A;  2CFA A;  1ZVU A;  1TWH A;  2V6T A;  3I4M K;  1O27 A;  4GTD A;  4A3I K;  1O2F B;  5IOS A;  4A3K K;  3S2H K;  3GTO A;  2W7V A;  1IQ0 A;  3GTG A;  1BDF A;  2E2I K;  1PJ5 A;  4A3B K;  3HOW K;  5FJ8 K;  2JA8 C;  1ZXO A;  3DXJ A;  1BS2 A;  4BY7 K;  5C4J C;  1YNJ A;  1TWA C;  3S1Q C;  1X31 C;  3FHZ A;  4A3E K;  2FQT A;  3RZO C;  1SMY A;  4Q4Z A;  3TFH A;  4C3I C;  2JH3 A;  1KQ4 A;  4OIP A;  1VH2 A;  4BY1 C;  3G4A A;  2YU9 A;  3T01 A;  3QX3 A;  3K7A K;  1YX2 A;  2R7Z A;  3S1N K;  3LAJ A;  4OIO A;  5FLM C;  3S1R K;  2E2J K;  1F7U A;  2JA7 K;  3I4N K;  4A93 C;  4A3C K;  2CW0 A;  3AD9 C;  3GTJ C;  1Y1W A;  2R93 A;  1EK8 A;  2NVX A;  2JA7 C;  1JVI A;  2PA8 D;  1O26 A;  3CQZ C;  5IP7 C;  3S1M K;  1EQR A;  1L0W A;  1VRQ C;  5JFE A;  4G7Z A;  3PO3 K;  3HOX K;  3BP8 C;  2PA8 L;  3S14 C;  4Y52 K;  2E2H K;  1PJ7 A;  1I3Q A;  1O2A A;  2WAQ L;  1XXC A;  1TWF K;  3GDZ A;  4A3M K;  4WIL A;  4NOI A;  3G4C A;  4GTF A;  3PO2 K;  3AQP A;  3FOF A;  3RZD C;  3BUE A;  4LR2 A;  4PAA A;  2PMZ L;  2VUM K;  5IOQ A;  2RGR A;  3GTM K;  3GTQ C;  1I6V A;  3GTL K;  4QJV A;  3BP3 A;  5M5Y K;  4KN4 A;  3GTL C;  1TWA A;  1TWG K;  5C4X K;  1EI6 A;  3TFJ A;  4KMU A;  4KMH A;  4MEX A;  1WIH A;  1TWG C;  4A3J K;  3T02 A; 
#chains in the Genus database with same CATH homology
 1TWF C;  5M5X K;  4A3M C;  3S17 K;  2NVY K;  1TWH K;  1SFO K;  3GTK K;  1WCM C;  2WB1 D;  3HKZ D;  2JA5 K;  3I4M K;  4A3I K;  4A3K K;  3PO2 C;  1R9T C;  3S2H K;  3GTO K;  3S15 C;  4Y7N K;  2A6H A;  4A3D C;  5TMF A;  4A3L K;  2VUM C;  5FLM K;  1BDF A;  2NVY C;  4BXX K;  3GTM C;  1Y1V K;  5C3E K;  2E2I K;  3HOU K;  4A93 K;  4A3B K;  2NVX C;  3H0G K;  3FKI C;  3GTJ K;  3HOW K;  4Q5S A;  1K83 C;  4QIW L;  4X6A K;  5FJ8 K;  2JA8 C;  4AYB D;  3S2D K;  3DXJ A;  4C3J K;  3GTP K;  1Y1V C;  1I6H C;  2PPB A;  4BY7 K;  3CQZ K;  5IP7 K;  5C4J C;  4OIR A;  1YNJ A;  1TWA C;  3S1Q C;  3H0G C;  5C4X C;  4X6A C;  2O5I A;  4LK1 A;  3S14 K;  5IYD K;  3HOV K;  4A3E K;  3S16 C;  4BBS C;  3RZO C;  1SMY A;  4YFN A;  4Q4Z A;  4OIN A;  4XSZ A;  4A3J C;  5TMC A;  4OIP A;  5M3F K;  4A3G C;  4BY1 C;  4OIQ A;  2YU9 K;  3GTG K;  3RZD K;  4QIW D;  3S17 C;  2A6E A;  1TWH C;  1SFO C;  3GTK C;  2JA5 C;  3K7A K;  3I4M C;  4A3I C;  4A3K C;  3S2H C;  4GZY A;  1TWC K;  1YNN A;  2R7Z K;  4A3G K;  3GTO C;  4Y7N C;  2JA6 K;  4C3H K;  3S1N K;  1I50 K;  3GTQ K;  5IP9 K;  3M4O K;  4A3L C;  3H3V L;  2B63 K;  4OIO A;  1HQM A;  4BBR K;  5FLM C;  3S1R K;  2E2J K;  2Y0S L;  2JA7 K;  2NVQ K;  3GTG C;  5C3E C;  2E2I C;  3I4N K;  4BXX C;  3HOU C;  5M5W K;  4A93 C;  4A3B C;  3M3Y K;  4A3C K;  2CW0 A;  1IW7 A;  3GTJ C;  3HOW C;  1Y1W K;  1I50 C;  3S2D C;  5M3M K;  3M4O C;  2R93 K;  2A69 A;  4YFX A;  4BBR C;  3GTP C;  4KN7 A;  2JA7 C;  3HOY K;  2PA8 D;  4A3F K;  3GTL K;  4BY7 C;  3CQZ C;  5IP7 C;  4XLP A;  3S1M K;  4G7Z A;  3PO3 K;  4C2M K;  3HOX K;  2PA8 L;  3WOD A;  5IYD C;  3HOV C;  2A68 A;  2E2H K;  5IYB K;  3S14 C;  4Y52 K;  4A3E C;  2WAQ L;  1I3Q K;  3H3V D;  3HOZ K;  1TWF K;  4G7O A;  2Y0S D;  4A3M K;  4YFK A;  2O5J A;  1WCM K;  4NOI A;  3PO2 K;  1R9T K;  4G7H A;  2YU9 C;  4LLG A;  3RZD C;  4LK0 A;  4A3D K;  3K7A C;  2PMZ L;  3HOZ C;  2BE5 A;  5IYC K;  2VUM K;  4XSX A;  1TWC C;  2R7Z C;  4MQ9 A;  3GTM K;  3S1N C;  2JA6 C;  3GTQ C;  1I6V A;  5IP9 C;  4QJV A;  2NVX K;  4XLN A;  4BY1 K;  2B63 C;  3S1R C;  2E2J C;  4MEY A;  2NVQ C;  3FKI K;  2R92 K;  1ZYR A;  3I4N C;  1K83 K;  5D4D A;  2JA8 K;  2WB1 L;  3HKZ L;  5IYC C;  3M3Y C;  4A3C C;  2WAQ D;  1I6H K;  2NVT K;  4YG2 A;  4ZH4 A;  1Y1W C;  5M5Y K;  4KN4 A;  3GTL C;  5C4J K;  2R93 C;  5C44 K;  1TWA K;  1TWG K;  3S1Q K;  2R92 C;  3HOY C;  5C4X K;  4A3F C;  3EQL A;  3S1M C;  2PMZ D;  2NVT C;  3S16 K;  4LJZ A;  3PO3 C;  3RZO K;  4BBS K;  4KMU A;  4MEX A;  3HOX C;  1XPP A;  5C44 C;  4QJV B;  4JK1 A;  1TWG C;  4AYB L;  4C3I K;  4Y52 C;  5IYB C;  4A3J K;  2E2H C;  3S15 K;  1I3Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...