4QJVB

The x-ray crystal structure of rpo3/rpo11 heterodimer of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit D
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qjvB00
3GTMC 4A3KC 5C4XK 3GTLK 3S14K 4A3LC 1I6HC 2O5JA 1I3QC 2A69A 4Y52C 4XSXA 3PO2C 4X6AC 4A3BC 4BY1C 4BXXC 3S2DK 2NVTC 1K83K 2NVYC 3RZOK 3S2HC 5FLMK 2NVXC 4OIQA 3HOZC 3I4MC 3S1MC 2PPBA 3HOUK 4NOIA 4A93C 5IP9K 1Y1WC 4AYBL 3I4MK 2WB1L 3S1MK 2E2HK 4Q4ZA 4C3IK 2R7ZK 4A93K 5M5WK 4A3DK 3S1NK 1K83C 2NVYK 1TWGC 4XLNA 3RZOC 3S2HK 3S1QK 4A3GC 2PMZL 4X6AK 1I50C 2Y0SD 2JA7C 3HOYK 1I6HK 5IYCK 1TWFK 1WCMK 2WB1D 3GTPC 3H3VL 4MEYA 3M3YK 5D4DA 3HOXC 4QJVA 4BBSC 1ZYRA 3M4OK 3HOWK 3S17K 2B63C 3HKZL 2JA6C 2E2JK 4A3EC 4XSZA 5FJ8K 1TWCC 3H3VD 2R93C 4YFKA 5C4JC 2YU9K 3RZDK 2R93K 5IYBK 4QJVB 5IYCC 2JA7K 3HOVK 4BY1K 4BXXK 3S17C 3M4OC 4Y52K 4BBRK 1TWGK 5TMCA 2JA8K 3HKZD 4A3GK 2A68A 3CQZC 3GTJC 4A3IC 4QIWD 2WAQD 2R92K 1Y1VC 4AYBD 3HOYC 4Q5SA 5M3FK 4G7HA 3GTOC 2CW0A 3GTQC 4G7OA 1SMYA 3GTQK 1TWAC 3GTOK 4YFNA 5M5XK 5M5YK 2E2HC 1I6VA 4A3DC 2NVTK 3EQLA 2PA8D 3GTJK 4A3IK 4QIWL 5C4JK 5IP9C 2E2IK 4BBRC 1R9TC 4OIOA 4Y7NC 5C44C 5C3EC 1SFOK 4A3LK 5C4XC 5IYDK 4A3CK 3GTGC 3HOWC 5IP7C 5IYBC 3FKIC 1TWAK 3S16C 2BE5A 2PA8L 4C3HK 3M3YC 4XLPA 3GTKC 3PO2K 3DXJA 2PMZD 4A3MK 3WODA 4A3MC 2JA6K 2O5IA 1TWHK 4LJZA 3GTKK 1IW7A 2R92C 2NVQC 1BDFA 3HOXK 3H0GK 4A3JC 3H0GC 4A3JK 3GTGK 1TWFC 1WCMC 3S1NC 4OINA 5C3EK 2WAQL 5IYDC 4MQ9A 4Y7NK 4A3FC 4YG2A 3S1RC 2JA5C 2R7ZC 3HOVC 1Y1WK 3PO3C 4BY7C 2E2IC 3S1QC 3HOZK 2NVXK 4MEXA 4JK1A 1TWCK 1XPPA 2A6EA 4C3JK 4GZYA 4A3CC 4C2MK 5C44K 4OIRA 3K7AC 4BBSK 3PO3K 3S1RK 4BY7K 1I3QK 4KMUA 4OIPA 4KN7A 5FLMC 3CQZK 2VUMK 4LLGA 3S2DC 1I50K 2NVQK 5M3MK 1TWHC 2Y0SL 3S14C 4A3KK 3GTLC 3RZDC 1Y1VK 4YFXA 1HQMA 1YNNA 3FKIK 5TMFA 3I4NK 3K7AK 3S16K 4LK1A 4KN4A 4G7ZA 4A3EK 2JA8C 3S15K 3HOUC 1SFOC 4LK0A 2B63K 1R9TK 4ZH4A 2A6HA 3GTPK 1YNJA 4A3BK 2YU9C 4A3FK 2JA5K 2E2JC 3S15C 3GTMK 3I4NC 5IP7K 2VUMC
chains in the Genus database with same CATH superfamily
3GTMC 4RMFA 4C45A 4Y52C 4A3BC 3S2HC 4OIQA 5TJ3A 3I4MC 4NOIA 4KB4A 1O27A 4AYBL 3I4MK 4A3DK 3AQPA 4Q4ZA 5M5WK 3S1NK 3RZOC 3SZZA 4A3GC 5E68A 4GTFA 1I50C 1PJ5A 3GTQA 2GAHC 3LAJA 1WCMK 1VJEA 4LQYA 4AH6A 3FOEA 3HOXC 1YCLA 2NVXA 1J6WA 4PAAA 4A3EC 2JA6C 3VA7A 2YU9K 4O2DA 4QJVB 3GEHA 1Y1VA 4BXXK 4WILA 4KMHA 4A3GK 2A68A 3CQZC 1Y1VC 2PHCB 1F93A 5M3FK 3GTOC 4PABA 1USOA 3G4AA 2RH6A 3GTOK 3GTJK 2PA8D 2E2IA 5C44C 3FOFA 3OEPA 3GTGC 4A3CK 1WOOA 1TWAK 3S16C 3PO2K 1BS2A 2PMZD 3V4GA 4A3MK 1WSVA 3WODA 3GEIA 1IL2A 1WCMC 2WAQL 2XCQA 2R7ZC 3BP8C 1JVIA 1Y1WK 1WOPA 3HOZK 4GTEA 4GTBA 4JK1A 1XPPA 5IOTA 4C3JK 3K7AC 3PO3K 4GFQA 1TWHA 4KMUA 4OIPA 4KN7A 3CQZK 4LLGA 1X31C 4GT9A 4LR2A 1TWFA 1TWHC 1IS1A 2CFAA 1YNNA 5IOQA 3K7AK 3A8JA 4LK1A 3S15K 2B63K 4ZH4A 4LOWA 4A3BK 2V6TA 4P9SA 3GTGA 2VUMA 1UV7A 2JA5K 2E2JC 2P5MA 1F7UA 1O2FB 2VUMC 4A3KC 5C4XK 3ERED 3GTLK 3S14K 1AB4A 3MMLB 4XSXA 4DDQA 3PO2C 4X6AC 4BY1C 3S2DK 1K83K 2NVYC 1EQRA 1J98A 1VH2A 3HOZC 5IP9K 1Y1WC 4C2MC 1PJ7A 1L0WA 2E2HK 4C3IK 2R7ZK 3TFHA 1TWGC 3S1QK 1O29A 3A8KA 4X6AK 2JA7C 3GTOA 3IPJA 1HI9A 3GTPC 3M3YK 4BBSC 3M4OK 2JA7A 1JQWA 4GTDA 3H3VD 4YFKA 3RZDK 5IYBK 5IYCC 3A8IA 1BJTA 2JA7K 3HOVK 4G0WA 2FQTA 4BBRK 1TWGK 5TMCA 2CFAB 3HKZD 1GE9A 1XXAA 4QIWD 2R92K 4P5AA 4AYBD 3GSIA 4Q5SA 4KC6A 3JSTA 4G7OA 1EH1A 1JOEA 4A3DC 1I6VA 1EK8A 3EQLA 4A3IK 2E2IK 1J6XA 5C4JK 4BBRC 4KM9A 5C3EC 4M1XA 1SFOK 5C4XC 5IYDK 5HL8A 3HOWC 3GTKC 3DXJA 3L4KA 2O5IA 1TWHK 4LJZA 3GTKK 1TWGA 3GTKA 1BDFA 1O24A 4A3JK 3S1NC 3G4CA 3HXAA 4OINA 5C3EK 5IYDC 2XCRB 1V5VA 1WQFA 3GTPA 2E2HA 4XCHA 2E2IC 2ZFZA 4KARA 3S1QC 4MEXA 1XXBA 2A6EA 4A3CC 3N0CA 1BGWA 4BBSK 1XZPB 5FLMC 3GTLA 3S2DC 2NVQK 1WCMA 2R7ZA 1DCPA 4A3KK 3GTLC 1G51A 1Y1VK 3S16K 3TFIA 2YU9A 2A6HA 4GTLA 1Y1WA 1ZBSA 1EFWA 2YU9C 4A3FK 3S15C 1DCHA 3I4NC 4FZBA 1ZQ1C 3GEEA 4A3LC 1I3QC 2A69A 5CJ9A 1XXCA 4FM9A 4BXXC 2NVTC 3RZOK 1IE0A 1J6VA 2PPBA 1O28A 3ADAC 1WQHA 2JH3A 2WB1L 1WSRA 1INNA 3S2HK 4XLNA 2PMZL 1O2BA 3H0GA 2Y0SD 3HOYK 3H3VL 1WORA 4C3HC 2NVYA 4QJVA 1ZYRA 4G0VA 3HOWK 3S17K 2B63C 3AD8C 2V6SA 5FJ8K 3NUHA 4P5BA 1O26A 5C4JC 2R93K 2B63A 1ISEA 3L4JA 3M4OC 2P8TA 4Y52K 2GSOA 4KMDA 1IQ0A 3GTJC 4GTCA 4KATA 1SMYA 2GSNA 1RU0A 1TWAC 4C3IC 5M5XK 2E2HC 3TFJA 2NVTK 4QIWL 2W7VA 5IP9C 1R9TC 3OPFA 4A3LK 1WIHA 2FQOA 5IP7C 3FKIC 1XZQB 3M3YC 4WJ4A 4XLPA 4BLAA 4A3MC 2KWAA 2JA6K 1B4AA 1IW7A 3OREA 2NVQC 3HOXK 4A3JC 3H0GC 3GTGK 1USMA 1VLOA 2JA5C 4MQ9A 4YG2A 3S1RC 4BY7C 3AQOA 4KB2A 3AH5A 2NVXK 2JA5A 4GZYA 4OIRA 4WJ3M 1K83A 3Q3QA 5CHPA 3LAPA 2VUMK 5IORA 1I50K 1VRQC 2R92A 4BKWA 1I3QA 1HQMA 3I4NK 1F9NA 1TWAA 4KN4A 4G7ZA 1YX2A 4A3EK 4G0UA 2JA8C 1SFOC 4KDDA 1EI6A 3QX3A 1YNJA 5EGEA 1WQGA 3GTMK 5L46A 3CAGA 1O25A 3LPXA 5EGHA 2O5JA 1I50A 1XZQA 2RGRA 1I6HC 2Y3PA 2XCOA 4KASA 5IOSA 1VGXA 5FLMK 2NVXC 3S1MC 4A93C 3HOUK 3AD7C 3S1MK 4A93K 1DCOA 2D6FC 3SZYA 1K83C 2NVYK 3CQZA 3GTMA 1I6HK 3N3YA 1O2AA 5IYCK 1TWFK 2WB1D 4ILDA 4MEYA 5D4DA 3HKZL 2E2JK 3FHZA 4XSZA 3BUEA 1TWCC 2R93C 4BLBA 4BY1K 3FKIA 3GDZA 3S17C 2JA8K 4A3IC 2WAQD 3HOYC 4G7HA 3GTQC 2CW0A 1C0AA 1B4BA 3S0XA 3GTQK 4YFNA 1PJ6A 5M5YK 2GAGC 2V6UA 4OIOA 4Y7NC 3BP3A 3AD9C 3T01A 5IYBC 2BE5A 2PA8L 4C3HK 3GTJA 1F7VA 2R92C 3H0GK 1TWFC 5JFEA 4Y7NK 4A3FC 3T00A 3HOVC 3PO3C 1R9TA 4C3JC 1XZPA 5JVOA 3N0BA 1SFOA 1ZXOA 4J3NA 1TWCK 2ZUFA 1TWCA 4KM8A 4C2MK 2R93A 5C44K 3S1RK 4BY7K 1I3QK 1KQ4A 2ZUEA 4GTAA 4KMAA 5M3MK 2Y0SL 3S14C 3RZDC 2JA6A 4YFXA 3FKIK 5TMFA 1ZVUA 3HOUC 4LK0A 1IBAA 1R9TK 4KAWX 3GTPK 3GIRA 1WOSA 2EBBA 1DD5A 3T02A 3TTGA 5IP7K 2GSUA
chains in the Genus database with same CATH topology
3GTMC 4A3KC 5C4XK 3GTLK 3S14K 4A3LC 1I6HC 2O5JA 1I3QC 2A69A 4Y52C 4XSXA 3PO2C 4X6AC 4A3BC 4BY1C 4BXXC 3S2DK 2NVTC 1K83K 2NVYC 3RZOK 3S2HC 5FLMK 2NVXC 4OIQA 3HOZC 3I4MC 3S1MC 2PPBA 3HOUK 4NOIA 4A93C 5IP9K 1Y1WC 4AYBL 3I4MK 2WB1L 3S1MK 2E2HK 4Q4ZA 4C3IK 2R7ZK 4A93K 5M5WK 4A3DK 3S1NK 1K83C 2NVYK 1TWGC 4XLNA 3RZOC 3S2HK 3S1QK 4A3GC 2PMZL 4X6AK 1I50C 2Y0SD 2JA7C 3HOYK 1I6HK 5IYCK 1TWFK 1WCMK 2WB1D 3GTPC 3H3VL 4MEYA 3M3YK 5D4DA 3HOXC 4QJVA 4BBSC 1ZYRA 3M4OK 3HOWK 3S17K 2B63C 3HKZL 2JA6C 2E2JK 4A3EC 4XSZA 5FJ8K 1TWCC 3H3VD 2R93C 4YFKA 5C4JC 2YU9K 3RZDK 2R93K 5IYBK 4QJVB 5IYCC 2JA7K 3HOVK 4BY1K 4BXXK 3S17C 3M4OC 4Y52K 4BBRK 1TWGK 5TMCA 2JA8K 3HKZD 4A3GK 2A68A 3CQZC 3GTJC 4A3IC 4QIWD 2WAQD 2R92K 1Y1VC 4AYBD 3HOYC 4Q5SA 5M3FK 4G7HA 3GTOC 2CW0A 3GTQC 4G7OA 1SMYA 3GTQK 1TWAC 3GTOK 4YFNA 5M5XK 5M5YK 2E2HC 1I6VA 4A3DC 2NVTK 3EQLA 2PA8D 3GTJK 4A3IK 4QIWL 5C4JK 5IP9C 2E2IK 4BBRC 1R9TC 4OIOA 4Y7NC 5C44C 5C3EC 1SFOK 4A3LK 5C4XC 5IYDK 4A3CK 3GTGC 3HOWC 5IP7C 5IYBC 3FKIC 1TWAK 3S16C 2BE5A 2PA8L 4C3HK 3M3YC 4XLPA 3GTKC 3PO2K 3DXJA 2PMZD 4A3MK 3WODA 4A3MC 2JA6K 2O5IA 1TWHK 4LJZA 3GTKK 1IW7A 2R92C 2NVQC 1BDFA 3HOXK 3H0GK 4A3JC 3H0GC 4A3JK 3GTGK 1TWFC 1WCMC 3S1NC 4OINA 5C3EK 2WAQL 5IYDC 4MQ9A 4Y7NK 4A3FC 4YG2A 3S1RC 2JA5C 2R7ZC 3HOVC 1Y1WK 3PO3C 4BY7C 2E2IC 3S1QC 3HOZK 2NVXK 4MEXA 4JK1A 1TWCK 1XPPA 2A6EA 4C3JK 4GZYA 4A3CC 4C2MK 5C44K 4OIRA 3K7AC 4BBSK 3PO3K 3S1RK 4BY7K 1I3QK 4KMUA 4OIPA 4KN7A 5FLMC 3CQZK 2VUMK 4LLGA 3S2DC 1I50K 2NVQK 5M3MK 1TWHC 2Y0SL 3S14C 4A3KK 3GTLC 3RZDC 1Y1VK 4YFXA 1HQMA 1YNNA 3FKIK 5TMFA 3I4NK 3K7AK 3S16K 4LK1A 4KN4A 4G7ZA 4A3EK 2JA8C 3S15K 3HOUC 1SFOC 4LK0A 2B63K 1R9TK 4ZH4A 2A6HA 3GTPK 1YNJA 4A3BK 2YU9C 4A3FK 2JA5K 2E2JC 3S15C 3GTMK 3I4NC 5IP7K 2VUMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM C;  4A3K C;  5C4X K;  3GTL K;  3S14 K;  4A3L C;  1I6H C;  2O5J A;  1I3Q C;  2A69 A;  4Y52 C;  4XSX A;  3PO2 C;  4X6A C;  4A3B C;  4BY1 C;  4BXX C;  3S2D K;  2NVT C;  1K83 K;  2NVY C;  3RZO K;  3S2H C;  5FLM K;  2NVX C;  4OIQ A;  3HOZ C;  3I4M C;  3S1M C;  2PPB A;  3HOU K;  4NOI A;  4A93 C;  5IP9 K;  1Y1W C;  4AYB L;  3I4M K;  2WB1 L;  3S1M K;  2E2H K;  4Q4Z A;  4C3I K;  2R7Z K;  4A93 K;  5M5W K;  4A3D K;  3S1N K;  1K83 C;  2NVY K;  1TWG C;  4XLN A;  3RZO C;  3S2H K;  3S1Q K;  4A3G C;  2PMZ L;  4X6A K;  1I50 C;  2Y0S D;  2JA7 C;  3HOY K;  1I6H K;  5IYC K;  1TWF K;  1WCM K;  2WB1 D;  3GTP C;  3H3V L;  4MEY A;  3M3Y K;  5D4D A;  3HOX C;  4QJV A;  4BBS C;  1ZYR A;  3M4O K;  3HOW K;  3S17 K;  2B63 C;  3HKZ L;  2JA6 C;  2E2J K;  4A3E C;  4XSZ A;  5FJ8 K;  1TWC C;  3H3V D;  2R93 C;  4YFK A;  5C4J C;  2YU9 K;  3RZD K;  2R93 K;  5IYB K;  4QJV B;  5IYC C;  2JA7 K;  3HOV K;  4BY1 K;  4BXX K;  3S17 C;  3M4O C;  4Y52 K;  4BBR K;  1TWG K;  5TMC A;  2JA8 K;  3HKZ D;  4A3G K;  2A68 A;  3CQZ C;  3GTJ C;  4A3I C;  4QIW D;  2WAQ D;  2R92 K;  1Y1V C;  4AYB D;  3HOY C;  4Q5S A;  5M3F K;  4G7H A;  3GTO C;  2CW0 A;  3GTQ C;  4G7O A;  1SMY A;  3GTQ K;  1TWA C;  3GTO K;  4YFN A;  5M5X K;  5M5Y K;  2E2H C;  1I6V A;  4A3D C;  2NVT K;  3EQL A;  2PA8 D;  3GTJ K;  4A3I K;  4QIW L;  5C4J K;  5IP9 C;  2E2I K;  4BBR C;  1R9T C;  4OIO A;  4Y7N C;  5C44 C;  5C3E C;  1SFO K;  4A3L K;  5C4X C;  5IYD K;  4A3C K;  3GTG C;  3HOW C;  5IP7 C;  5IYB C;  3FKI C;  1TWA K;  3S16 C;  2BE5 A;  2PA8 L;  4C3H K;  3M3Y C;  4XLP A;  3GTK C;  3PO2 K;  3DXJ A;  2PMZ D;  4A3M K;  3WOD A;  4A3M C;  2JA6 K;  2O5I A;  1TWH K;  4LJZ A;  3GTK K;  1IW7 A;  2R92 C;  2NVQ C;  1BDF A;  3HOX K;  3H0G K;  4A3J C;  3H0G C;  4A3J K;  3GTG K;  1TWF C;  1WCM C;  3S1N C;  4OIN A;  5C3E K;  2WAQ L;  5IYD C;  4MQ9 A;  4Y7N K;  4A3F C;  4YG2 A;  3S1R C;  2JA5 C;  2R7Z C;  3HOV C;  1Y1W K;  3PO3 C;  4BY7 C;  2E2I C;  3S1Q C;  3HOZ K;  2NVX K;  4MEX A;  4JK1 A;  1TWC K;  1XPP A;  2A6E A;  4C3J K;  4GZY A;  4A3C C;  4C2M K;  5C44 K;  4OIR A;  3K7A C;  4BBS K;  3PO3 K;  3S1R K;  4BY7 K;  1I3Q K;  4KMU A;  4OIP A;  4KN7 A;  5FLM C;  3CQZ K;  2VUM K;  4LLG A;  3S2D C;  1I50 K;  2NVQ K;  5M3M K;  1TWH C;  2Y0S L;  3S14 C;  4A3K K;  3GTL C;  3RZD C;  1Y1V K;  4YFX A;  1HQM A;  1YNN A;  3FKI K;  5TMF A;  3I4N K;  3K7A K;  3S16 K;  4LK1 A;  4KN4 A;  4G7Z A;  4A3E K;  2JA8 C;  3S15 K;  3HOU C;  1SFO C;  4LK0 A;  2B63 K;  1R9T K;  4ZH4 A;  2A6H A;  3GTP K;  1YNJ A;  4A3B K;  2YU9 C;  4A3F K;  2JA5 K;  2E2J C;  3S15 C;  3GTM K;  3I4N C;  5IP7 K;  2VUM C; 
#chains in the Genus database with same CATH topology
 3GTM C;  4RMF A;  4C45 A;  4Y52 C;  4A3B C;  3S2H C;  4OIQ A;  5TJ3 A;  3I4M C;  4NOI A;  4KB4 A;  1O27 A;  4AYB L;  3I4M K;  4A3D K;  3AQP A;  4Q4Z A;  5M5W K;  3S1N K;  3RZO C;  3SZZ A;  4A3G C;  5E68 A;  4GTF A;  1I50 C;  1PJ5 A;  3GTQ A;  2GAH C;  3LAJ A;  1WCM K;  1VJE A;  4LQY A;  4AH6 A;  3FOE A;  3HOX C;  1YCL A;  2NVX A;  1J6W A;  4PAA A;  4A3E C;  2JA6 C;  3VA7 A;  2YU9 K;  4O2D A;  4QJV B;  3GEH A;  1Y1V A;  4BXX K;  4WIL A;  4KMH A;  4A3G K;  2A68 A;  3CQZ C;  1Y1V C;  2PHC B;  1F93 A;  5M3F K;  3GTO C;  4PAB A;  1USO A;  3G4A A;  2RH6 A;  3GTO K;  3GTJ K;  2PA8 D;  2E2I A;  5C44 C;  3FOF A;  3OEP A;  3GTG C;  4A3C K;  1WOO A;  1TWA K;  3S16 C;  3PO2 K;  1BS2 A;  2PMZ D;  3V4G A;  4A3M K;  1WSV A;  3WOD A;  3GEI A;  1IL2 A;  1WCM C;  2WAQ L;  2XCQ A;  2R7Z C;  3BP8 C;  1JVI A;  1Y1W K;  1WOP A;  3HOZ K;  4GTE A;  4GTB A;  4JK1 A;  1XPP A;  5IOT A;  4C3J K;  3K7A C;  3PO3 K;  4GFQ A;  1TWH A;  4KMU A;  4OIP A;  4KN7 A;  3CQZ K;  4LLG A;  1X31 C;  4GT9 A;  4LR2 A;  1TWF A;  1TWH C;  1IS1 A;  2CFA A;  1YNN A;  5IOQ A;  3K7A K;  3A8J A;  4LK1 A;  3S15 K;  2B63 K;  4ZH4 A;  4LOW A;  4A3B K;  2V6T A;  4P9S A;  3GTG A;  2VUM A;  1UV7 A;  2JA5 K;  2E2J C;  2P5M A;  1F7U A;  1O2F B;  2VUM C;  4A3K C;  5C4X K;  3ERE D;  3GTL K;  3S14 K;  1AB4 A;  3MML B;  4XSX A;  4DDQ A;  3PO2 C;  4X6A C;  4BY1 C;  3S2D K;  1K83 K;  2NVY C;  1EQR A;  1J98 A;  1VH2 A;  3HOZ C;  5IP9 K;  1Y1W C;  4C2M C;  1PJ7 A;  1L0W A;  2E2H K;  4C3I K;  2R7Z K;  3TFH A;  1TWG C;  3S1Q K;  1O29 A;  3A8K A;  4X6A K;  2JA7 C;  3GTO A;  3IPJ A;  1HI9 A;  3GTP C;  3M3Y K;  4BBS C;  3M4O K;  2JA7 A;  1JQW A;  4GTD A;  3H3V D;  4YFK A;  3RZD K;  5IYB K;  5IYC C;  3A8I A;  1BJT A;  2JA7 K;  3HOV K;  4G0W A;  2FQT A;  4BBR K;  1TWG K;  5TMC A;  2CFA B;  3HKZ D;  1GE9 A;  1XXA A;  4QIW D;  2R92 K;  4P5A A;  4AYB D;  3GSI A;  4Q5S A;  4KC6 A;  3JST A;  4G7O A;  1EH1 A;  1JOE A;  4A3D C;  1I6V A;  1EK8 A;  3EQL A;  4A3I K;  2E2I K;  1J6X A;  5C4J K;  4BBR C;  4KM9 A;  5C3E C;  4M1X A;  1SFO K;  5C4X C;  5IYD K;  5HL8 A;  3HOW C;  3GTK C;  3DXJ A;  3L4K A;  2O5I A;  1TWH K;  4LJZ A;  3GTK K;  1TWG A;  3GTK A;  1BDF A;  1O24 A;  4A3J K;  3S1N C;  3G4C A;  3HXA A;  4OIN A;  5C3E K;  5IYD C;  2XCR B;  1V5V A;  1WQF A;  3GTP A;  2E2H A;  4XCH A;  2E2I C;  2ZFZ A;  4KAR A;  3S1Q C;  4MEX A;  1XXB A;  2A6E A;  4A3C C;  3N0C A;  1BGW A;  4BBS K;  1XZP B;  5FLM C;  3GTL A;  3S2D C;  2NVQ K;  1WCM A;  2R7Z A;  1DCP A;  4A3K K;  3GTL C;  1G51 A;  1Y1V K;  3S16 K;  3TFI A;  2YU9 A;  2A6H A;  4GTL A;  1Y1W A;  1ZBS A;  1EFW A;  2YU9 C;  4A3F K;  3S15 C;  1DCH A;  3I4N C;  4FZB A;  1ZQ1 C;  3GEE A;  4A3L C;  1I3Q C;  2A69 A;  5CJ9 A;  1XXC A;  4FM9 A;  4BXX C;  2NVT C;  3RZO K;  1IE0 A;  1J6V A;  2PPB A;  1O28 A;  3ADA C;  1WQH A;  2JH3 A;  2WB1 L;  1WSR A;  1INN A;  3S2H K;  4XLN A;  2PMZ L;  1O2B A;  3H0G A;  2Y0S D;  3HOY K;  3H3V L;  1WOR A;  4C3H C;  2NVY A;  4QJV A;  1ZYR A;  4G0V A;  3HOW K;  3S17 K;  2B63 C;  3AD8 C;  2V6S A;  5FJ8 K;  3NUH A;  4P5B A;  1O26 A;  5C4J C;  2R93 K;  2B63 A;  1ISE A;  3L4J A;  3M4O C;  2P8T A;  4Y52 K;  2GSO A;  4KMD A;  1IQ0 A;  3GTJ C;  4GTC A;  4KAT A;  1SMY A;  2GSN A;  1RU0 A;  1TWA C;  4C3I C;  5M5X K;  2E2H C;  3TFJ A;  2NVT K;  4QIW L;  2W7V A;  5IP9 C;  1R9T C;  3OPF A;  4A3L K;  1WIH A;  2FQO A;  5IP7 C;  3FKI C;  1XZQ B;  3M3Y C;  4WJ4 A;  4XLP A;  4BLA A;  4A3M C;  2KWA A;  2JA6 K;  1B4A A;  1IW7 A;  3ORE A;  2NVQ C;  3HOX K;  4A3J C;  3H0G C;  3GTG K;  1USM A;  1VLO A;  2JA5 C;  4MQ9 A;  4YG2 A;  3S1R C;  4BY7 C;  3AQO A;  4KB2 A;  3AH5 A;  2NVX K;  2JA5 A;  4GZY A;  4OIR A;  4WJ3 M;  1K83 A;  3Q3Q A;  5CHP A;  3LAP A;  2VUM K;  5IOR A;  1I50 K;  1VRQ C;  2R92 A;  4BKW A;  1I3Q A;  1HQM A;  3I4N K;  1F9N A;  1TWA A;  4KN4 A;  4G7Z A;  1YX2 A;  4A3E K;  4G0U A;  2JA8 C;  1SFO C;  4KDD A;  1EI6 A;  3QX3 A;  1YNJ A;  5EGE A;  1WQG A;  3GTM K;  5L46 A;  3CAG A;  1O25 A;  3LPX A;  5EGH A;  2O5J A;  1I50 A;  1XZQ A;  2RGR A;  1I6H C;  2Y3P A;  2XCO A;  4KAS A;  5IOS A;  1VGX A;  5FLM K;  2NVX C;  3S1M C;  4A93 C;  3HOU K;  3AD7 C;  3S1M K;  4A93 K;  1DCO A;  2D6F C;  3SZY A;  1K83 C;  2NVY K;  3CQZ A;  3GTM A;  1I6H K;  3N3Y A;  1O2A A;  5IYC K;  1TWF K;  2WB1 D;  4ILD A;  4MEY A;  5D4D A;  3HKZ L;  2E2J K;  3FHZ A;  4XSZ A;  3BUE A;  1TWC C;  2R93 C;  4BLB A;  4BY1 K;  3FKI A;  3GDZ A;  3S17 C;  2JA8 K;  4A3I C;  2WAQ D;  3HOY C;  4G7H A;  3GTQ C;  2CW0 A;  1C0A A;  1B4B A;  3S0X A;  3GTQ K;  4YFN A;  1PJ6 A;  5M5Y K;  2GAG C;  2V6U A;  4OIO A;  4Y7N C;  3BP3 A;  3AD9 C;  3T01 A;  5IYB C;  2BE5 A;  2PA8 L;  4C3H K;  3GTJ A;  1F7V A;  2R92 C;  3H0G K;  1TWF C;  5JFE A;  4Y7N K;  4A3F C;  3T00 A;  3HOV C;  3PO3 C;  1R9T A;  4C3J C;  1XZP A;  5JVO A;  3N0B A;  1SFO A;  1ZXO A;  4J3N A;  1TWC K;  2ZUF A;  1TWC A;  4KM8 A;  4C2M K;  2R93 A;  5C44 K;  3S1R K;  4BY7 K;  1I3Q K;  1KQ4 A;  2ZUE A;  4GTA A;  4KMA A;  5M3M K;  2Y0S L;  3S14 C;  3RZD C;  2JA6 A;  4YFX A;  3FKI K;  5TMF A;  1ZVU A;  3HOU C;  4LK0 A;  1IBA A;  1R9T K;  4KAW X;  3GTP K;  3GIR A;  1WOS A;  2EBB A;  1DD5 A;  3T02 A;  3TTG A;  5IP7 K;  2GSU A; 
#chains in the Genus database with same CATH homology
 3GTM C;  4A3K C;  5C4X K;  3GTL K;  3S14 K;  4A3L C;  1I6H C;  2O5J A;  1I3Q C;  2A69 A;  4Y52 C;  4XSX A;  3PO2 C;  4X6A C;  4A3B C;  4BY1 C;  4BXX C;  3S2D K;  2NVT C;  1K83 K;  2NVY C;  3RZO K;  3S2H C;  5FLM K;  2NVX C;  4OIQ A;  3HOZ C;  3I4M C;  3S1M C;  2PPB A;  3HOU K;  4NOI A;  4A93 C;  5IP9 K;  1Y1W C;  4AYB L;  3I4M K;  2WB1 L;  3S1M K;  2E2H K;  4Q4Z A;  4C3I K;  2R7Z K;  4A93 K;  5M5W K;  4A3D K;  3S1N K;  1K83 C;  2NVY K;  1TWG C;  4XLN A;  3RZO C;  3S2H K;  3S1Q K;  4A3G C;  2PMZ L;  4X6A K;  1I50 C;  2Y0S D;  2JA7 C;  3HOY K;  1I6H K;  5IYC K;  1TWF K;  1WCM K;  2WB1 D;  3GTP C;  3H3V L;  4MEY A;  3M3Y K;  5D4D A;  3HOX C;  4QJV A;  4BBS C;  1ZYR A;  3M4O K;  3HOW K;  3S17 K;  2B63 C;  3HKZ L;  2JA6 C;  2E2J K;  4A3E C;  4XSZ A;  5FJ8 K;  1TWC C;  3H3V D;  2R93 C;  4YFK A;  5C4J C;  2YU9 K;  3RZD K;  2R93 K;  5IYB K;  4QJV B;  5IYC C;  2JA7 K;  3HOV K;  4BY1 K;  4BXX K;  3S17 C;  3M4O C;  4Y52 K;  4BBR K;  1TWG K;  5TMC A;  2JA8 K;  3HKZ D;  4A3G K;  2A68 A;  3CQZ C;  3GTJ C;  4A3I C;  4QIW D;  2WAQ D;  2R92 K;  1Y1V C;  4AYB D;  3HOY C;  4Q5S A;  5M3F K;  4G7H A;  3GTO C;  2CW0 A;  3GTQ C;  4G7O A;  1SMY A;  3GTQ K;  1TWA C;  3GTO K;  4YFN A;  5M5X K;  5M5Y K;  2E2H C;  1I6V A;  4A3D C;  2NVT K;  3EQL A;  2PA8 D;  3GTJ K;  4A3I K;  4QIW L;  5C4J K;  5IP9 C;  2E2I K;  4BBR C;  1R9T C;  4OIO A;  4Y7N C;  5C44 C;  5C3E C;  1SFO K;  4A3L K;  5C4X C;  5IYD K;  4A3C K;  3GTG C;  3HOW C;  5IP7 C;  5IYB C;  3FKI C;  1TWA K;  3S16 C;  2BE5 A;  2PA8 L;  4C3H K;  3M3Y C;  4XLP A;  3GTK C;  3PO2 K;  3DXJ A;  2PMZ D;  4A3M K;  3WOD A;  4A3M C;  2JA6 K;  2O5I A;  1TWH K;  4LJZ A;  3GTK K;  1IW7 A;  2R92 C;  2NVQ C;  1BDF A;  3HOX K;  3H0G K;  4A3J C;  3H0G C;  4A3J K;  3GTG K;  1TWF C;  1WCM C;  3S1N C;  4OIN A;  5C3E K;  2WAQ L;  5IYD C;  4MQ9 A;  4Y7N K;  4A3F C;  4YG2 A;  3S1R C;  2JA5 C;  2R7Z C;  3HOV C;  1Y1W K;  3PO3 C;  4BY7 C;  2E2I C;  3S1Q C;  3HOZ K;  2NVX K;  4MEX A;  4JK1 A;  1TWC K;  1XPP A;  2A6E A;  4C3J K;  4GZY A;  4A3C C;  4C2M K;  5C44 K;  4OIR A;  3K7A C;  4BBS K;  3PO3 K;  3S1R K;  4BY7 K;  1I3Q K;  4KMU A;  4OIP A;  4KN7 A;  5FLM C;  3CQZ K;  2VUM K;  4LLG A;  3S2D C;  1I50 K;  2NVQ K;  5M3M K;  1TWH C;  2Y0S L;  3S14 C;  4A3K K;  3GTL C;  3RZD C;  1Y1V K;  4YFX A;  1HQM A;  1YNN A;  3FKI K;  5TMF A;  3I4N K;  3K7A K;  3S16 K;  4LK1 A;  4KN4 A;  4G7Z A;  4A3E K;  2JA8 C;  3S15 K;  3HOU C;  1SFO C;  4LK0 A;  2B63 K;  1R9T K;  4ZH4 A;  2A6H A;  3GTP K;  1YNJ A;  4A3B K;  2YU9 C;  4A3F K;  2JA5 K;  2E2J C;  3S15 C;  3GTM K;  3I4N C;  5IP7 K;  2VUM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...