1VH2A

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 43
structure length 152
sequence length 152
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vh2A00
1J6XA 2FQOA 4XCHA 1J98A 1VJEA 1JQWA 1VH2A 2FQTA 1J6VA 1JVIA 1VGXA 1INNA 1JOEA 1YCLA 1J6WA 5E68A 1IE0A
chains in the Genus database with same CATH superfamily
3FOFA 1RU0A 1XXAA 2E2IA 1GE9A 2NVTC 1I50C 1B4BA 2WB1D 3TFHA 4NOIA 1I3QA 4BLBA 4KMUA 2PMZD 1JVIA 3HOUC 2JA7C 1SFOK 1WOPA 2JA5A 3M4OC 1XZPB 1TWCA 3GTLK 4BLAA 3WODA 1WQGA 1ZQ1C 5M5XK 1YCLA 1Y1WK 3S1NK 1L0WA 4C3IK 1EFWA 4A3DC 1ZXOA 4YFXA 2R93C 3AD9C 1ZYRA 1DCPA 3GIRA 1WCMA 2E2IC 4Y7NC 1PJ5A 1Y1WA 1BS2A 4BXXK 4MEXA 2CW0A 1I3QC 4J3NA 4BKWA 3S1RK 5IYCK 4A3CK 2E2HK 2A68A 1VLOA 5FJ8K 1R9TK 4A3FC 3RZOC 1TWFA 3TFIA 2JA5C 3HOVC 1TWCC 3I4MC 4C2MC 2RH6A 2ZUFA 2P8TA 5CHPA 1DD5A 2NVYK 2YU9A 2WAQD 3LAPA 2PA8L 5M5YK 1WCMC 3GTPK 4A3BK 2JA8C 1Y1WC 2NVYA 4C3IC 2ZUEA 2B63K 2R7ZK 3PO3C 4A3MC 4G0WA 1K83A 4BY7C 3GEIA 1TWFC 2V6UA 2FQOA 1TWAA 3CQZK 4BXXC 3L4JA 1O2BA 3GTJA 3SZZA 1X31C 4GTAA 2NVTK 4LK0A 1I50K 2YU9C 2VUMK 1ZBSA 1F9NA 2PMZL 4AYBD 4G7HA 3TTGA 4BBRK 3HOYC 3HOUK 1O29A 2JA7K 5M3MK 4C3HC 2NVYC 3S16C 2A69A 1XZQA 4GTFA 4AH6A 3M4OK 2FQTA 5IORA 3BP3A 2VUMA 4QJVA 2Y0SD 5C4XC 4A3EC 5IOSA 4GTDA 3H0GA 1K83C 3AH5A 3G4AA 4KN7A 3S0XA 1TWGA 3H3VD 1USOA 1XPPA 3GEEA 4A3DK 1TWAC 3GTMK 2R93K 4KN4A 3GTJC 5JVOA 4KMDA 3M3YC 2E2IK 4Y7NK 5E68A 3LPXA 1SMYA 4KB2A 3S1QC 3GTMA 3GTKK 1IE0A 4OIPA 4BY1C 5IYDC 3FHZA 4QIWL 4A3FK 5C44C 3RZOK 2JA5K 3BP8C 3HOVK 1YNJA 4OIQA 1TWCK 3T01A 2VUMC 3I4MK 3GTKA 4BBSC 4JK1A 4BBRC 3I4NC 4A93C 4C2MK 1I6VA 3HOXC 3H0GC 4XLNA 5IYBC 1TWGC 4OIOA 1O24A 1XZQB 1YX2A 4DDQA 4KAWX 3ERED 1BGWA 2WAQL 4LJZA 4QJVB 1WSRA 1WCMK 4PAAA 2JA8K 1VRQC 4A3KC 3T00A 4P5BA 5EGHA 3GTMC 4GZYA 3PO3K 3PO2C 4A3MK 4BY7K 4C3JK 1TWFK 1J98A 5HL8A 5C4JC 3IPJA 2R92K 3GTKC 3HOZC 3TFJA 3AD7C 2Y3PA 2RGRA 5IOQA 2YU9K 1G51A 3N0CA 1PJ6A 1EQRA 1XXCA 2R92A 3L4KA 3SZYA 3HOYK 3AQOA 4C3HK 4KDDA 4GTCA 3S16K 3CAGA 4KARA 5M3FK 5C4XK 4Q4ZA 1VH2A 1O2AA 4A3EK 1K83K 3H3VL 3S15C 4ZH4A 1TWAK 2ZFZA 3GTJK 2V6TA 3S2HC 3M3YK 3GTOK 4OIRA 5CJ9A 4C3JC 2P5MA 3S1QK 1EH1A 4XCHA 3HXAA 2R92C 4BY1K 1TWHA 2W7VA 4KMAA 5IP7C 5IYDK 3GTOA 4XLPA 4P5AA 3A8KA 4LLGA 3RZDC 4C45A 5C44K 5IOTA 3A8IA 4Y52C 2WB1L 4P9SA 2E2JC 5TMCA 3HKZD 4ILDA 4BBSK 4GFQA 3I4NK 1F93A 4A93K 1INNA 3HOXK 3H0GK 2JH3A 5IYBK 1TWGK 4LOWA 1AB4A 4XSZA 1Y1VA 4KB4A 5TJ3A 2NVXA 2A6HA 1B4AA 5FLMC 3K7AC 4FZBA 1I6HC 1PJ7A 4OINA 2GAGC 4KMHA 1IW7A 4WILA 4A3KK 3GTGA 1WOSA 3S17C 2NVQC 3Q3QA 1XXBA 1TWHC 3PO2K 3GTOC 4GTLA 4GTEA 3JSTA 4LR2A 1YNNA 5C4JK 3A8JA 2XCOA 3QX3A 3HOZK 2PA8D 1UV7A 4KM8A 2CFAA 4Q5SA 5JFEA 2GAHC 3S14K 3N0BA 1Y1VC 2O5JA 5C3EC 2NVXC 1USMA 3OREA 4KASA 4YG2A 4GT9A 4MQ9A 3GTGC 3GTQA 5IP9C 4KATA 3FKIA 3S1MC 1JOEA 2JA6A 3S15K 2V6SA 4XSXA 3T02A 3AD8C 3S2HK 4KM9A 4A3LC 4A3JC 3V4GA 4PABA 1O27A 1WQHA 4FM9A 1O25A 5IP7K 3AQPA 1BDFA 4WJ3M 2CFAB 3OEPA 1V5VA 1SFOA 3RZDK 4X6AC 3S14C 4Y52K 1EK8A 3VA7A 2E2JK 3GTQC 4YFKA 3GTLA 3HKZL 2A6EA 4AYBL 2D6FC 4A3IC 4G7ZA 3FKIC 3OPFA 3S2DC 3HOWC 5L46A 1ISEA 4KC6A 2JA6C 1BJTA 2XCRB 4A3GC 3N3YA 5FLMK 2Y0SL 3K7AK 1I6HK 1IQ0A 1DCOA 4QIWD 4YFNA 1J6XA 1VJEA 1WORA 3MMLB 2O5IA 3NUHA 3S17K 4G0VA 3DXJA 3BUEA 1O26A 4LQYA 1TWHK 2NVQK 2E2HA 1R9TA 1SFOC 1J6VA 1O2FB 1WIHA 1F7UA 1HI9A 4G7OA 3GTLC 3EQLA 4LK1A 1KQ4A 1C0AA 4WJ4A 3S1NC 3ADAC 4RMFA 1Y1VK 5C3EK 4M1XA 2PHCB 2NVXK 1WQFA 4GTBA 3GTPA 2GSUA 2EBBA 1DCHA 3GTGK 2B63A 1J6WA 2XCQA 5IP9K 5D4DA 3S1RC 5IYCC 2R7ZA 4A3CC 2E2HC 2KWAA 1R9TC 3S1MK 5EGEA 3CQZA 4O2DA 1ZVUA 1JQWA 3GDZA 3LAJA 2BE5A 4A3LK 4A3JK 5M5WK 3GSIA 1I50A 1XZPA 1IL2A 1IS1A 3GEHA 2JA7A 1WOOA 3GTPC 4A3BC 4X6AK 2GSOA 3G4CA 1VGXA 2B63C 3GTQK 4MEYA 1IBAA 2R7ZC 1EI6A 1F7VA 4A3IK 3FKIK 1WSVA 2PPBA 3S2DK 3HOWK 1O28A 5TMFA 2JA6K 1HQMA 2GSNA 4A3GK 1I3QK 3CQZC 4G0UA 3FOEA 2R93A
chains in the Genus database with same CATH topology
1J6XA 2FQOA 4XCHA 1J98A 1VJEA 1JQWA 1VH2A 2FQTA 1J6VA 1JVIA 1VGXA 1INNA 1JOEA 1YCLA 1J6WA 5E68A 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6X A;  2FQO A;  4XCH A;  1J98 A;  1VJE A;  1JQW A;  1VH2 A;  2FQT A;  1J6V A;  1JVI A;  1VGX A;  1INN A;  1JOE A;  1YCL A;  1J6W A;  5E68 A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 3FOF A;  1RU0 A;  1XXA A;  2E2I A;  1GE9 A;  2NVT C;  1I50 C;  1B4B A;  2WB1 D;  3TFH A;  4NOI A;  1I3Q A;  4BLB A;  4KMU A;  2PMZ D;  1JVI A;  3HOU C;  2JA7 C;  1SFO K;  1WOP A;  2JA5 A;  3M4O C;  1XZP B;  1TWC A;  3GTL K;  4BLA A;  3WOD A;  1WQG A;  1ZQ1 C;  5M5X K;  1YCL A;  1Y1W K;  3S1N K;  1L0W A;  4C3I K;  1EFW A;  4A3D C;  1ZXO A;  4YFX A;  2R93 C;  3AD9 C;  1ZYR A;  1DCP A;  3GIR A;  1WCM A;  2E2I C;  4Y7N C;  1PJ5 A;  1Y1W A;  1BS2 A;  4BXX K;  4MEX A;  2CW0 A;  1I3Q C;  4J3N A;  4BKW A;  3S1R K;  5IYC K;  4A3C K;  2E2H K;  2A68 A;  1VLO A;  5FJ8 K;  1R9T K;  4A3F C;  3RZO C;  1TWF A;  3TFI A;  2JA5 C;  3HOV C;  1TWC C;  3I4M C;  4C2M C;  2RH6 A;  2ZUF A;  2P8T A;  5CHP A;  1DD5 A;  2NVY K;  2YU9 A;  2WAQ D;  3LAP A;  2PA8 L;  5M5Y K;  1WCM C;  3GTP K;  4A3B K;  2JA8 C;  1Y1W C;  2NVY A;  4C3I C;  2ZUE A;  2B63 K;  2R7Z K;  3PO3 C;  4A3M C;  4G0W A;  1K83 A;  4BY7 C;  3GEI A;  1TWF C;  2V6U A;  2FQO A;  1TWA A;  3CQZ K;  4BXX C;  3L4J A;  1O2B A;  3GTJ A;  3SZZ A;  1X31 C;  4GTA A;  2NVT K;  4LK0 A;  1I50 K;  2YU9 C;  2VUM K;  1ZBS A;  1F9N A;  2PMZ L;  4AYB D;  4G7H A;  3TTG A;  4BBR K;  3HOY C;  3HOU K;  1O29 A;  2JA7 K;  5M3M K;  4C3H C;  2NVY C;  3S16 C;  2A69 A;  1XZQ A;  4GTF A;  4AH6 A;  3M4O K;  2FQT A;  5IOR A;  3BP3 A;  2VUM A;  4QJV A;  2Y0S D;  5C4X C;  4A3E C;  5IOS A;  4GTD A;  3H0G A;  1K83 C;  3AH5 A;  3G4A A;  4KN7 A;  3S0X A;  1TWG A;  3H3V D;  1USO A;  1XPP A;  3GEE A;  4A3D K;  1TWA C;  3GTM K;  2R93 K;  4KN4 A;  3GTJ C;  5JVO A;  4KMD A;  3M3Y C;  2E2I K;  4Y7N K;  5E68 A;  3LPX A;  1SMY A;  4KB2 A;  3S1Q C;  3GTM A;  3GTK K;  1IE0 A;  4OIP A;  4BY1 C;  5IYD C;  3FHZ A;  4QIW L;  4A3F K;  5C44 C;  3RZO K;  2JA5 K;  3BP8 C;  3HOV K;  1YNJ A;  4OIQ A;  1TWC K;  3T01 A;  2VUM C;  3I4M K;  3GTK A;  4BBS C;  4JK1 A;  4BBR C;  3I4N C;  4A93 C;  4C2M K;  1I6V A;  3HOX C;  3H0G C;  4XLN A;  5IYB C;  1TWG C;  4OIO A;  1O24 A;  1XZQ B;  1YX2 A;  4DDQ A;  4KAW X;  3ERE D;  1BGW A;  2WAQ L;  4LJZ A;  4QJV B;  1WSR A;  1WCM K;  4PAA A;  2JA8 K;  1VRQ C;  4A3K C;  3T00 A;  4P5B A;  5EGH A;  3GTM C;  4GZY A;  3PO3 K;  3PO2 C;  4A3M K;  4BY7 K;  4C3J K;  1TWF K;  1J98 A;  5HL8 A;  5C4J C;  3IPJ A;  2R92 K;  3GTK C;  3HOZ C;  3TFJ A;  3AD7 C;  2Y3P A;  2RGR A;  5IOQ A;  2YU9 K;  1G51 A;  3N0C A;  1PJ6 A;  1EQR A;  1XXC A;  2R92 A;  3L4K A;  3SZY A;  3HOY K;  3AQO A;  4C3H K;  4KDD A;  4GTC A;  3S16 K;  3CAG A;  4KAR A;  5M3F K;  5C4X K;  4Q4Z A;  1VH2 A;  1O2A A;  4A3E K;  1K83 K;  3H3V L;  3S15 C;  4ZH4 A;  1TWA K;  2ZFZ A;  3GTJ K;  2V6T A;  3S2H C;  3M3Y K;  3GTO K;  4OIR A;  5CJ9 A;  4C3J C;  2P5M A;  3S1Q K;  1EH1 A;  4XCH A;  3HXA A;  2R92 C;  4BY1 K;  1TWH A;  2W7V A;  4KMA A;  5IP7 C;  5IYD K;  3GTO A;  4XLP A;  4P5A A;  3A8K A;  4LLG A;  3RZD C;  4C45 A;  5C44 K;  5IOT A;  3A8I A;  4Y52 C;  2WB1 L;  4P9S A;  2E2J C;  5TMC A;  3HKZ D;  4ILD A;  4BBS K;  4GFQ A;  3I4N K;  1F93 A;  4A93 K;  1INN A;  3HOX K;  3H0G K;  2JH3 A;  5IYB K;  1TWG K;  4LOW A;  1AB4 A;  4XSZ A;  1Y1V A;  4KB4 A;  5TJ3 A;  2NVX A;  2A6H A;  1B4A A;  5FLM C;  3K7A C;  4FZB A;  1I6H C;  1PJ7 A;  4OIN A;  2GAG C;  4KMH A;  1IW7 A;  4WIL A;  4A3K K;  3GTG A;  1WOS A;  3S17 C;  2NVQ C;  3Q3Q A;  1XXB A;  1TWH C;  3PO2 K;  3GTO C;  4GTL A;  4GTE A;  3JST A;  4LR2 A;  1YNN A;  5C4J K;  3A8J A;  2XCO A;  3QX3 A;  3HOZ K;  2PA8 D;  1UV7 A;  4KM8 A;  2CFA A;  4Q5S A;  5JFE A;  2GAH C;  3S14 K;  3N0B A;  1Y1V C;  2O5J A;  5C3E C;  2NVX C;  1USM A;  3ORE A;  4KAS A;  4YG2 A;  4GT9 A;  4MQ9 A;  3GTG C;  3GTQ A;  5IP9 C;  4KAT A;  3FKI A;  3S1M C;  1JOE A;  2JA6 A;  3S15 K;  2V6S A;  4XSX A;  3T02 A;  3AD8 C;  3S2H K;  4KM9 A;  4A3L C;  4A3J C;  3V4G A;  4PAB A;  1O27 A;  1WQH A;  4FM9 A;  1O25 A;  5IP7 K;  3AQP A;  1BDF A;  4WJ3 M;  2CFA B;  3OEP A;  1V5V A;  1SFO A;  3RZD K;  4X6A C;  3S14 C;  4Y52 K;  1EK8 A;  3VA7 A;  2E2J K;  3GTQ C;  4YFK A;  3GTL A;  3HKZ L;  2A6E A;  4AYB L;  2D6F C;  4A3I C;  4G7Z A;  3FKI C;  3OPF A;  3S2D C;  3HOW C;  5L46 A;  1ISE A;  4KC6 A;  2JA6 C;  1BJT A;  2XCR B;  4A3G C;  3N3Y A;  5FLM K;  2Y0S L;  3K7A K;  1I6H K;  1IQ0 A;  1DCO A;  4QIW D;  4YFN A;  1J6X A;  1VJE A;  1WOR A;  3MML B;  2O5I A;  3NUH A;  3S17 K;  4G0V A;  3DXJ A;  3BUE A;  1O26 A;  4LQY A;  1TWH K;  2NVQ K;  2E2H A;  1R9T A;  1SFO C;  1J6V A;  1O2F B;  1WIH A;  1F7U A;  1HI9 A;  4G7O A;  3GTL C;  3EQL A;  4LK1 A;  1KQ4 A;  1C0A A;  4WJ4 A;  3S1N C;  3ADA C;  4RMF A;  1Y1V K;  5C3E K;  4M1X A;  2PHC B;  2NVX K;  1WQF A;  4GTB A;  3GTP A;  2GSU A;  2EBB A;  1DCH A;  3GTG K;  2B63 A;  1J6W A;  2XCQ A;  5IP9 K;  5D4D A;  3S1R C;  5IYC C;  2R7Z A;  4A3C C;  2E2H C;  2KWA A;  1R9T C;  3S1M K;  5EGE A;  3CQZ A;  4O2D A;  1ZVU A;  1JQW A;  3GDZ A;  3LAJ A;  2BE5 A;  4A3L K;  4A3J K;  5M5W K;  3GSI A;  1I50 A;  1XZP A;  1IL2 A;  1IS1 A;  3GEH A;  2JA7 A;  1WOO A;  3GTP C;  4A3B C;  4X6A K;  2GSO A;  3G4C A;  1VGX A;  2B63 C;  3GTQ K;  4MEY A;  1IBA A;  2R7Z C;  1EI6 A;  1F7V A;  4A3I K;  3FKI K;  1WSV A;  2PPB A;  3S2D K;  3HOW K;  1O28 A;  5TMF A;  2JA6 K;  1HQM A;  2GSN A;  4A3G K;  1I3Q K;  3CQZ C;  4G0U A;  3FOE A;  2R93 A; 
#chains in the Genus database with same CATH homology
 1J6X A;  2FQO A;  4XCH A;  1J98 A;  1VJE A;  1JQW A;  1VH2 A;  2FQT A;  1J6V A;  1JVI A;  1VGX A;  1INN A;  1JOE A;  1YCL A;  1J6W A;  5E68 A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...