1VH2A

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 43
structure length 152
sequence length 152
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vh2A00
1VH2A 1JQWA 2FQOA 1YCLA 1VJEA 1JOEA 1JVIA 1INNA 2FQTA 1J6XA 1J6WA 1VGXA 4XCHA 5E68A 1IE0A 1J98A 1J6VA
chains in the Genus database with same CATH superfamily
5CHPA 3I4NC 1BGWA 4A3FC 4GFQA 1TWAK 3GTGK 1YNJA 4A3MK 1F7UA 1K83K 3N0BA 2V6SA 5IYDC 3HOZK 2GSNA 4C3IK 3AH5A 4YG2A 3AD8C 3GTJA 2YU9C 1DD5A 1TWCK 4Y52K 3S17C 2NVYK 2ZUEA 2A68A 3CAGA 4RMFA 5M3MK 3RZDK 1O2FB 1G51A 1WOOA 3H0GA 5IYCK 2V6TA 3HOYK 1I3QK 1HQMA 2Y0SD 5JFEA 4GTEA 3GIRA 4ZH4A 4LK1A 1TWFK 4KN7A 4Q4ZA 5M3FK 4XSZA 5L46A 1TWHC 4XCHA 4GTLA 1B4AA 3GTKC 3M3YK 5C4XC 4OIOA 2ZUFA 4Y7NK 1R9TC 4A3EC 1Y1VK 4A3JK 5FJ8K 5IYBK 2E2IA 4AH6A 1ZQ1C 1GE9A 3GDZA 3GTOA 2O5JA 3GTQA 4A3CK 1SFOA 3I4NK 1O2AA 1WCMC 2CFAA 4A3FK 3WODA 4MEYA 1V5VA 4KB4A 4C45A 3FOEA 2Y0SL 5IYDK 2P8TA 4BXXC 4G7OA 5EGHA 1PJ7A 3GTJC 2YU9K 1BS2A 1O2BA 3S17K 3JSTA 4LLGA 2JA6A 5IORA 3TFJA 2NVXA 3GTLC 4A93C 1Y1WA 4QJVA 2XCQA 3A8JA 3OREA 4LK0A 3S1MC 4OIQA 3FKIA 3GSIA 2GSUA 3HOUC 4BBSK 1J6VA 4XLNA 1B4BA 3A8KA 1TWHK 3G4CA 2VUMA 1ZBSA 3GTKK 4BY7K 1DCHA 3S1RC 5C4XK 4PABA 3S2DC 4FZBA 4A3EK 1F93A 1R9TK 2PPBA 1USMA 5HL8A 3T00A 3VA7A 3S1NC 5C4JC 2P5MA 2E2JC 2E2IC 5EGEA 1WQFA 2PMZL 3HKZL 3PO3C 2FQOA 3H3VL 3GEIA 1YCLA 4G0UA 1IBAA 3GTOC 3QX3A 3GTQC 1XZQA 1SFOC 1WCMK 2JA5C 3S0XA 4X6AC 1O24A 2NVTC 2JA7A 4BXXK 3K7AC 2W7VA 4A3KK 1J6WA 2D6FC 3GTJK 5IP9C 5D4DA 4LQYA 4DDQA 2GAHC 4BLBA 2E2HC 2WB1D 3TTGA 2GSOA 3GTLK 1ZXOA 4P9SA 3HOXC 4A3LC 1ISEA 4A3GC 3HXAA 1I6HC 3ERED 2WAQD 1YNNA 3GTMK 2B63A 4G0WA 1XZPA 5M5XK 1INNA 1UV7A 4G7ZA 4NOIA 2VUMC 3S1RK 3N3YA 1IS1A 4QIWL 4AYBD 3S2DK 4A3BC 1EFWA 4BY1C 3S1NK 3S14C 5C4JK 2E2JK 4MQ9A 3BUEA 1TWGA 1PJ5A 2E2IK 4GTFA 4LR2A 3PO3K 5E68A 1I50A 1J98A 1KQ4A 3TFHA 4GTCA 1TWAA 1K83A 2JA5K 4YFKA 1C0AA 4MEXA 4KMHA 4X6AK 1IQ0A 4GTDA 2NVTK 1IW7A 4KMAA 1F7VA 3K7AK 2Y3PA 3S1QC 2NVYA 5IP9K 3AD7C 1EK8A 1VRQC 4OINA 3RZOC 1WSRA 1XPPA 3NUHA 4BBRC 1I3QA 3T01A 2E2HK 1YX2A 1WORA 4A3IC 4C3HC 1XZPB 3HOXK 4A3LK 2JA8C 1JOEA 4AYBL 4WJ4A 1WSVA 4KAWX 1I6HK 1TWFA 1BDFA 4P5AA 1XXAA 2B63C 3GEHA 2R92A 2VUMK 4KDDA 1ZVUA 4JK1A 3H0GC 1Y1VA 2ZFZA 2RGRA 4A3BK 4BLAA 4BKWA 4P5BA 4BY1K 3S14K 4LOWA 3LAJA 3TFIA 1TWGC 2R7ZA 3MMLB 1HI9A 3S2HC 4KB2A 4OIPA 4WJ3M 3SZZA 5IP7C 4A3DC 2O5IA 1K83C 5JVOA 1WQGA 1WIHA 2CFAB 4M1XA 2FQTA 3S1QK 4Y52C 1X31C 4KMUA 3RZOK 4KASA 2BE5A 3I4MC 4GZYA 4BBRK 3HOYC 1I3QC 4YFNA 4A3IK 4C3HK 2JA8K 1BJTA 1O28A 2A69A 4KM9A 1O25A 4YFXA 1EQRA 4O2DA 1TWHA 2B63K 4QJVB 3GTKA 3M3YC 5IOSA 2GAGC 2CW0A 2R92C 2JA6C 5TMCA 2NVXC 4A93K 1PJ6A 3M4OC 4GT9A 4GTBA 3CQZA 3H0GK 5CJ9A 4KMDA 1Y1WC 1Y1VC 3S1MK 4ILDA 4GTAA 3FKIC 3IPJA 3HOUK 1WQHA 1TWGK 2R7ZC 3S2HK 1IE0A 5IOTA 4PAAA 1AB4A 1WCMA 2JH3A 3EQLA 5IP7K 1DCOA 1VGXA 3BP8C 5FLMC 4A3DK 2R93A 1WOPA 4XLPA 1XZQB 3GTPA 3OPFA 1O29A 3A8IA 3SZYA 3GTOK 4KARA 2NVQC 5M5WK 3GTQK 3GTGA 1O26A 4LJZA 1SFOK 3GTLA 3I4MK 3Q3QA 5TJ3A 2WB1L 5C3EC 4J3NA 3GTMA 2JA7C 4BBSC 2WAQL 4C3JC 1EI6A 1TWCA 1ZYRA 5C44C 3GEEA 4BY7C 4C2MC 2EBBA 2R92K 4KC6A 2JA6K 3HOVC 3L4JA 3LAPA 2NVXK 3S15C 3M4OK 4KM8A 3FOFA 3CQZC 1Y1WK 4A3GK 3BP3A 4KN4A 5TMFA 3FKIK 1EH1A 1JVIA 1VLOA 2R7ZK 2PA8D 4G0VA 2JA5A 1VH2A 3HOWC 5M5YK 3PO2C 5FLMK 2A6HA 1USOA 2R93C 3HKZD 2PMZD 4A3KC 3H3VD 3S16C 1RU0A 3ADAC 3FHZA 3G4AA 3GTPC 1O27A 1I50C 1L0WA 2E2HA 2NVQK 4Q5SA 1TWAC 3GTGC 4A3MC 2RH6A 4FM9A 1I6VA 3HOZC 5C3EK 4C3IC 2YU9A 2JA7K 2V6UA 3GTMC 3T02A 2A6EA 4C3JK 5C44K 1TWCC 2XCOA 3AQOA 2NVYC 4XSXA 3DXJA 3N0CA 3L4KA 3RZDC 2PA8L 1IL2A 4C2MK 1SMYA 2KWAA 5IYCC 1WOSA 3HOVK 4G7HA 1JQWA 3S15K 2XCRB 3AQPA 1J6XA 3CQZK 1TWFC 3OEPA 5IOQA 4OIRA 3AD9C 4KATA 1F9NA 2PHCB 1XXCA 4QIWD 1R9TA 4Y7NC 3HOWK 1XXBA 1VJEA 4A3JC 3PO2K 5IYBC 1DCPA 2R93K 4WILA 3LPXA 3S16K 3GTPK 1I50K 3V4GA 4A3CC
chains in the Genus database with same CATH topology
1VH2A 1JQWA 2FQOA 1YCLA 1VJEA 1JOEA 1JVIA 1INNA 2FQTA 1J6XA 1J6WA 1VGXA 4XCHA 5E68A 1IE0A 1J98A 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH2 A;  1JQW A;  2FQO A;  1YCL A;  1VJE A;  1JOE A;  1JVI A;  1INN A;  2FQT A;  1J6X A;  1J6W A;  1VGX A;  4XCH A;  5E68 A;  1IE0 A;  1J98 A;  1J6V A; 
#chains in the Genus database with same CATH topology
 5CHP A;  3I4N C;  1BGW A;  4A3F C;  4GFQ A;  1TWA K;  3GTG K;  1YNJ A;  4A3M K;  1F7U A;  1K83 K;  3N0B A;  2V6S A;  5IYD C;  3HOZ K;  2GSN A;  4C3I K;  3AH5 A;  4YG2 A;  3AD8 C;  3GTJ A;  2YU9 C;  1DD5 A;  1TWC K;  4Y52 K;  3S17 C;  2NVY K;  2ZUE A;  2A68 A;  3CAG A;  4RMF A;  5M3M K;  3RZD K;  1O2F B;  1G51 A;  1WOO A;  3H0G A;  5IYC K;  2V6T A;  3HOY K;  1I3Q K;  1HQM A;  2Y0S D;  5JFE A;  4GTE A;  3GIR A;  4ZH4 A;  4LK1 A;  1TWF K;  4KN7 A;  4Q4Z A;  5M3F K;  4XSZ A;  5L46 A;  1TWH C;  4XCH A;  4GTL A;  1B4A A;  3GTK C;  3M3Y K;  5C4X C;  4OIO A;  2ZUF A;  4Y7N K;  1R9T C;  4A3E C;  1Y1V K;  4A3J K;  5FJ8 K;  5IYB K;  2E2I A;  4AH6 A;  1ZQ1 C;  1GE9 A;  3GDZ A;  3GTO A;  2O5J A;  3GTQ A;  4A3C K;  1SFO A;  3I4N K;  1O2A A;  1WCM C;  2CFA A;  4A3F K;  3WOD A;  4MEY A;  1V5V A;  4KB4 A;  4C45 A;  3FOE A;  2Y0S L;  5IYD K;  2P8T A;  4BXX C;  4G7O A;  5EGH A;  1PJ7 A;  3GTJ C;  2YU9 K;  1BS2 A;  1O2B A;  3S17 K;  3JST A;  4LLG A;  2JA6 A;  5IOR A;  3TFJ A;  2NVX A;  3GTL C;  4A93 C;  1Y1W A;  4QJV A;  2XCQ A;  3A8J A;  3ORE A;  4LK0 A;  3S1M C;  4OIQ A;  3FKI A;  3GSI A;  2GSU A;  3HOU C;  4BBS K;  1J6V A;  4XLN A;  1B4B A;  3A8K A;  1TWH K;  3G4C A;  2VUM A;  1ZBS A;  3GTK K;  4BY7 K;  1DCH A;  3S1R C;  5C4X K;  4PAB A;  3S2D C;  4FZB A;  4A3E K;  1F93 A;  1R9T K;  2PPB A;  1USM A;  5HL8 A;  3T00 A;  3VA7 A;  3S1N C;  5C4J C;  2P5M A;  2E2J C;  2E2I C;  5EGE A;  1WQF A;  2PMZ L;  3HKZ L;  3PO3 C;  2FQO A;  3H3V L;  3GEI A;  1YCL A;  4G0U A;  1IBA A;  3GTO C;  3QX3 A;  3GTQ C;  1XZQ A;  1SFO C;  1WCM K;  2JA5 C;  3S0X A;  4X6A C;  1O24 A;  2NVT C;  2JA7 A;  4BXX K;  3K7A C;  2W7V A;  4A3K K;  1J6W A;  2D6F C;  3GTJ K;  5IP9 C;  5D4D A;  4LQY A;  4DDQ A;  2GAH C;  4BLB A;  2E2H C;  2WB1 D;  3TTG A;  2GSO A;  3GTL K;  1ZXO A;  4P9S A;  3HOX C;  4A3L C;  1ISE A;  4A3G C;  3HXA A;  1I6H C;  3ERE D;  2WAQ D;  1YNN A;  3GTM K;  2B63 A;  4G0W A;  1XZP A;  5M5X K;  1INN A;  1UV7 A;  4G7Z A;  4NOI A;  2VUM C;  3S1R K;  3N3Y A;  1IS1 A;  4QIW L;  4AYB D;  3S2D K;  4A3B C;  1EFW A;  4BY1 C;  3S1N K;  3S14 C;  5C4J K;  2E2J K;  4MQ9 A;  3BUE A;  1TWG A;  1PJ5 A;  2E2I K;  4GTF A;  4LR2 A;  3PO3 K;  5E68 A;  1I50 A;  1J98 A;  1KQ4 A;  3TFH A;  4GTC A;  1TWA A;  1K83 A;  2JA5 K;  4YFK A;  1C0A A;  4MEX A;  4KMH A;  4X6A K;  1IQ0 A;  4GTD A;  2NVT K;  1IW7 A;  4KMA A;  1F7V A;  3K7A K;  2Y3P A;  3S1Q C;  2NVY A;  5IP9 K;  3AD7 C;  1EK8 A;  1VRQ C;  4OIN A;  3RZO C;  1WSR A;  1XPP A;  3NUH A;  4BBR C;  1I3Q A;  3T01 A;  2E2H K;  1YX2 A;  1WOR A;  4A3I C;  4C3H C;  1XZP B;  3HOX K;  4A3L K;  2JA8 C;  1JOE A;  4AYB L;  4WJ4 A;  1WSV A;  4KAW X;  1I6H K;  1TWF A;  1BDF A;  4P5A A;  1XXA A;  2B63 C;  3GEH A;  2R92 A;  2VUM K;  4KDD A;  1ZVU A;  4JK1 A;  3H0G C;  1Y1V A;  2ZFZ A;  2RGR A;  4A3B K;  4BLA A;  4BKW A;  4P5B A;  4BY1 K;  3S14 K;  4LOW A;  3LAJ A;  3TFI A;  1TWG C;  2R7Z A;  3MML B;  1HI9 A;  3S2H C;  4KB2 A;  4OIP A;  4WJ3 M;  3SZZ A;  5IP7 C;  4A3D C;  2O5I A;  1K83 C;  5JVO A;  1WQG A;  1WIH A;  2CFA B;  4M1X A;  2FQT A;  3S1Q K;  4Y52 C;  1X31 C;  4KMU A;  3RZO K;  4KAS A;  2BE5 A;  3I4M C;  4GZY A;  4BBR K;  3HOY C;  1I3Q C;  4YFN A;  4A3I K;  4C3H K;  2JA8 K;  1BJT A;  1O28 A;  2A69 A;  4KM9 A;  1O25 A;  4YFX A;  1EQR A;  4O2D A;  1TWH A;  2B63 K;  4QJV B;  3GTK A;  3M3Y C;  5IOS A;  2GAG C;  2CW0 A;  2R92 C;  2JA6 C;  5TMC A;  2NVX C;  4A93 K;  1PJ6 A;  3M4O C;  4GT9 A;  4GTB A;  3CQZ A;  3H0G K;  5CJ9 A;  4KMD A;  1Y1W C;  1Y1V C;  3S1M K;  4ILD A;  4GTA A;  3FKI C;  3IPJ A;  3HOU K;  1WQH A;  1TWG K;  2R7Z C;  3S2H K;  1IE0 A;  5IOT A;  4PAA A;  1AB4 A;  1WCM A;  2JH3 A;  3EQL A;  5IP7 K;  1DCO A;  1VGX A;  3BP8 C;  5FLM C;  4A3D K;  2R93 A;  1WOP A;  4XLP A;  1XZQ B;  3GTP A;  3OPF A;  1O29 A;  3A8I A;  3SZY A;  3GTO K;  4KAR A;  2NVQ C;  5M5W K;  3GTQ K;  3GTG A;  1O26 A;  4LJZ A;  1SFO K;  3GTL A;  3I4M K;  3Q3Q A;  5TJ3 A;  2WB1 L;  5C3E C;  4J3N A;  3GTM A;  2JA7 C;  4BBS C;  2WAQ L;  4C3J C;  1EI6 A;  1TWC A;  1ZYR A;  5C44 C;  3GEE A;  4BY7 C;  4C2M C;  2EBB A;  2R92 K;  4KC6 A;  2JA6 K;  3HOV C;  3L4J A;  3LAP A;  2NVX K;  3S15 C;  3M4O K;  4KM8 A;  3FOF A;  3CQZ C;  1Y1W K;  4A3G K;  3BP3 A;  4KN4 A;  5TMF A;  3FKI K;  1EH1 A;  1JVI A;  1VLO A;  2R7Z K;  2PA8 D;  4G0V A;  2JA5 A;  1VH2 A;  3HOW C;  5M5Y K;  3PO2 C;  5FLM K;  2A6H A;  1USO A;  2R93 C;  3HKZ D;  2PMZ D;  4A3K C;  3H3V D;  3S16 C;  1RU0 A;  3ADA C;  3FHZ A;  3G4A A;  3GTP C;  1O27 A;  1I50 C;  1L0W A;  2E2H A;  2NVQ K;  4Q5S A;  1TWA C;  3GTG C;  4A3M C;  2RH6 A;  4FM9 A;  1I6V A;  3HOZ C;  5C3E K;  4C3I C;  2YU9 A;  2JA7 K;  2V6U A;  3GTM C;  3T02 A;  2A6E A;  4C3J K;  5C44 K;  1TWC C;  2XCO A;  3AQO A;  2NVY C;  4XSX A;  3DXJ A;  3N0C A;  3L4K A;  3RZD C;  2PA8 L;  1IL2 A;  4C2M K;  1SMY A;  2KWA A;  5IYC C;  1WOS A;  3HOV K;  4G7H A;  1JQW A;  3S15 K;  2XCR B;  3AQP A;  1J6X A;  3CQZ K;  1TWF C;  3OEP A;  5IOQ A;  4OIR A;  3AD9 C;  4KAT A;  1F9N A;  2PHC B;  1XXC A;  4QIW D;  1R9T A;  4Y7N C;  3HOW K;  1XXB A;  1VJE A;  4A3J C;  3PO2 K;  5IYB C;  1DCP A;  2R93 K;  4WIL A;  3LPX A;  3S16 K;  3GTP K;  1I50 K;  3V4G A;  4A3C C; 
#chains in the Genus database with same CATH homology
 1VH2 A;  1JQW A;  2FQO A;  1YCL A;  1VJE A;  1JOE A;  1JVI A;  1INN A;  2FQT A;  1J6X A;  1J6W A;  1VGX A;  4XCH A;  5E68 A;  1IE0 A;  1J98 A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...