1VH2A

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
total genus 43
structure length 152
sequence length 152
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vh2A00
1JOEA 2FQOA 1VH2A 5E68A 1YCLA 1J98A 4XCHA 1IE0A 1JVIA 1JQWA 1INNA 1J6VA 1J6XA 1J6WA 1VGXA 1VJEA 2FQTA
chains in the Genus database with same CATH superfamily
4JK1A 5IP7C 5IYDC 1ISEA 2WAQL 2RH6A 1GE9A 2JA7C 4KC6A 4XLNA 1B4BA 3I4NC 2R7ZA 3HOZC 1YNJA 1Y1VA 4XCHA 4O2DA 3GTPC 3S16K 1IE0A 2YU9K 2E2IK 1X31C 2D6FC 1ZQ1C 1BGWA 2EBBA 2JA5C 3SZYA 4BBSK 2JA5K 4QJVA 3S2HC 2R7ZC 3S2HK 2W7VA 2V6UA 3FKIK 1TWFC 1HQMA 1XZPB 4P9SA 5M3MK 2NVYC 1WOSA 1XXBA 2CFAA 3BUEA 1SFOC 1WQHA 4LLGA 2Y3PA 2PPBA 1O2FB 5C44K 3PO3K 3RZDK 4GTLA 3DXJA 4P5AA 5IOTA 3AH5A 2P8TA 5IP9K 3M4OK 3G4CA 4GT9A 5IORA 4XLPA 2A68A 2XCOA 3I4MK 1B4AA 3HOYC 4A3KK 3GTKA 1TWAK 1XXCA 4BXXC 3GEIA 3S1NC 1I6HK 1O2BA 5HL8A 2V6TA 1TWGC 5C3EC 5C4XK 5IOQA 2FQOA 4GZYA 1TWFK 3GTQK 3GTMA 4LR2A 1WIHA 1I50A 4KMUA 1K83C 2JA6A 3L4JA 4XSZA 4C3HC 1VJEA 3ERED 3M3YC 3GTPK 3S16C 1TWCK 2JH3A 3FKIA 4C2MC 3S2DC 2A69A 4GTEA 1KQ4A 3CQZC 5FJ8K 2A6EA 1TWGK 4A3EK 4KN7A 3FHZA 3S1RK 2R93A 4KMAA 3FOEA 3A8JA 3AD8C 2R93K 3HOYK 1F9NA 3L4KA 4GFQA 1WSVA 2PA8L 4DDQA 1USMA 4X6AK 5M5WK 2B63A 1VRQC 4QIWD 3K7AC 4KASA 3SZZA 1ZBSA 3A8IA 1F7UA 1PJ6A 2NVYA 3EQLA 1TWFA 4AYBD 1AB4A 4LOWA 1L0WA 2NVXK 1WSRA 2NVYK 4Q5SA 3H3VD 1WCMA 4Y7NK 4FZBA 1WOOA 3AQPA 3GTJA 3GTQA 1RU0A 5C44C 3PO3C 4P5BA 3RZOK 4KM8A 4YFXA 3HOVC 1EQRA 3HOVK 2Y0SL 1Y1WK 3HOUC 3GTMC 5M5XK 3H0GK 3JSTA 3S1MK 1TWGA 3TFJA 3LAPA 5C3EK 2A6HA 4LJZA 1YX2A 4G7HA 2NVQK 3N3YA 3NUHA 2JA7K 3GTKC 4GTCA 1WCMK 1JQWA 3H3VL 5IP7K 2E2HC 3S1NK 1I6HC 5IYBK 1BJTA 2NVTK 4NOIA 1IQ0A 1XZPA 4OIQA 1IL2A 1VH2A 1WORA 2B63C 2Y0SD 3AQOA 4WJ4A 4A3LK 3FOFA 5IP9C 2ZUEA 4YG2A 2E2IC 2NVQC 1Y1WA 4BKWA 4YFKA 4BBRC 1C0AA 4FM9A 4BBRK 4C3JK 2PMZD 3S1MC 1F7VA 4Q4ZA 3S14C 3CQZA 1K83A 1XZQA 3G4AA 3S17C 2ZUFA 4BBSC 4KDDA 4MQ9A 4GTBA 4KM9A 5IYDK 2NVXA 3A8KA 2GSUA 4YFNA 1I3QK 2NVTC 4QJVB 4KATA 5IYBC 1WCMC 3AD9C 3AD7C 4WILA 1TWAC 4A3LC 2KWAA 2E2JC 3OPFA 2YU9A 1JOEA 1DCHA 2VUMK 5TMCA 3HOWK 5M3FK 2GAHC 2JA8K 1O24A 1UV7A 3H0GC 2WB1D 2R7ZK 5C4JK 4QIWL 1TWAA 3MMLB 3S1QK 1TWCA 4C3HK 4WJ3M 3M3YK 2CW0A 3TTGA 1WQGA 3GTLC 3V4GA 2JA6C 2O5JA 1USOA 3QX3A 4G0UA 2JA5A 3GTQC 4G7OA 2VUMA 3HXAA 2JA8C 4G0WA 1R9TK 3GTOK 1WQFA 2BE5A 4RMFA 3VA7A 4A3FC 3PO2C 2PHCB 4Y7NC 4ILDA 3H0GA 4BY1K 1I50C 4MEXA 5TJ3A 4AYBL 4BLAA 2VUMC 3IPJA 1XZQB 1HI9A 3GTKK 4C3IC 2E2IA 1IBAA 3GSIA 3S0XA 1I6VA 4A3MK 2E2HK 3GDZA 1XXAA 3GTLA 5TMFA 4A3JK 1YCLA 4A3BC 4A3CC 1XPPA 1ZVUA 3S17K 2E2HA 3CAGA 3N0CA 4A3FK 3S14K 4C2MK 3T01A 4Y52K 1WOPA 4ZH4A 2PMZL 1BS2A 3S2DK 1O28A 4KMDA 2CFAB 4LK1A 5IYCC 3HOXC 1J6VA 3S1RC 5IYCK 4XSXA 3HOXK 2R92A 2R93C 4C3JC 2XCRB 4BY7C 1JVIA 1INNA 4OIOA 5FLMC 4A93C 1SFOK 2FQTA 1R9TA 5EGEA 1ZXOA 1PJ7A 1J98A 1EFWA 1EI6A 4M1XA 4C45A 2GSOA 4KARA 3TFIA 2V6SA 3WODA 4GTDA 5CJ9A 3GTGA 1PJ5A 3GTPA 4A3KC 4AH6A 3T00A 4A3MC 4A3GC 3LPXA 1O27A 1I50K 4GTAA 2RGRA 3M4OC 4PAAA 4GTFA 3ADAC 1EK8A 4A3EC 1Y1WC 3BP8C 1Y1VC 5FLMK 1DCOA 4KB4A 2XCQA 5EGHA 1G51A 4BY1C 3GTJC 2WAQD 1I3QA 3GTJK 1BDFA 3PO2K 1YNNA 4KN4A 4Y52C 3CQZK 1O26A 1DD5A 1VGXA 5C4XC 4A3IK 1TWHA 3GEHA 1ZYRA 3I4NK 3FKIC 1K83K 4A3CK 4A3BK 4KMHA 4LK0A 4BY7K 4G0VA 1DCPA 5L46A 5IOSA 2B63K 3GIRA 2WB1L 1Y1VK 2ZFZA 5M5YK 2E2JK 3GTOA 3K7AK 5CHPA 3OREA 3N0BA 4KAWX 4OIPA 5C4JC 4A3JC 4KB2A 3BP3A 1IS1A 3HKZL 4OINA 4MEYA 5JFEA 3OEPA 4X6AC 3S15K 1V5VA 4A3GK 2GSNA 1J6XA 1TWCC 1TWHC 2PA8D 3GTGK 2JA7A 1EH1A 3RZDC 3Q3QA 2JA6K 4A3IC 1SMYA 1I3QC 1IW7A 3GTLK 4J3NA 3GTMK 4A3DC 1R9TC 2YU9C 5JVOA 3HOZK 4A3DK 4A93K 4BLBA 1SFOA 3S1QC 3GTOC 3RZOC 2R92C 4G7ZA 3LAJA 2R92K 4PABA 1O2AA 3HOUK 5E68A 5D4DA 4OIRA 3HOWC 1VLOA 3HKZD 2NVXC 3GEEA 2GAGC 4BXXK 4LQYA 1J6WA 1F93A 2O5IA 3T02A 3GTGC 3TFHA 1O25A 1TWHK 2P5MA 3S15C 3I4MC 1O29A 4C3IK
chains in the Genus database with same CATH topology
1JOEA 2FQOA 1VH2A 5E68A 1YCLA 1J98A 4XCHA 1IE0A 1JVIA 1JQWA 1INNA 1J6VA 1J6XA 1J6WA 1VGXA 1VJEA 2FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOE A;  2FQO A;  1VH2 A;  5E68 A;  1YCL A;  1J98 A;  4XCH A;  1IE0 A;  1JVI A;  1JQW A;  1INN A;  1J6V A;  1J6X A;  1J6W A;  1VGX A;  1VJE A;  2FQT A; 
#chains in the Genus database with same CATH topology
 4JK1 A;  5IP7 C;  5IYD C;  1ISE A;  2WAQ L;  2RH6 A;  1GE9 A;  2JA7 C;  4KC6 A;  4XLN A;  1B4B A;  3I4N C;  2R7Z A;  3HOZ C;  1YNJ A;  1Y1V A;  4XCH A;  4O2D A;  3GTP C;  3S16 K;  1IE0 A;  2YU9 K;  2E2I K;  1X31 C;  2D6F C;  1ZQ1 C;  1BGW A;  2EBB A;  2JA5 C;  3SZY A;  4BBS K;  2JA5 K;  4QJV A;  3S2H C;  2R7Z C;  3S2H K;  2W7V A;  2V6U A;  3FKI K;  1TWF C;  1HQM A;  1XZP B;  4P9S A;  5M3M K;  2NVY C;  1WOS A;  1XXB A;  2CFA A;  3BUE A;  1SFO C;  1WQH A;  4LLG A;  2Y3P A;  2PPB A;  1O2F B;  5C44 K;  3PO3 K;  3RZD K;  4GTL A;  3DXJ A;  4P5A A;  5IOT A;  3AH5 A;  2P8T A;  5IP9 K;  3M4O K;  3G4C A;  4GT9 A;  5IOR A;  4XLP A;  2A68 A;  2XCO A;  3I4M K;  1B4A A;  3HOY C;  4A3K K;  3GTK A;  1TWA K;  1XXC A;  4BXX C;  3GEI A;  3S1N C;  1I6H K;  1O2B A;  5HL8 A;  2V6T A;  1TWG C;  5C3E C;  5C4X K;  5IOQ A;  2FQO A;  4GZY A;  1TWF K;  3GTQ K;  3GTM A;  4LR2 A;  1WIH A;  1I50 A;  4KMU A;  1K83 C;  2JA6 A;  3L4J A;  4XSZ A;  4C3H C;  1VJE A;  3ERE D;  3M3Y C;  3GTP K;  3S16 C;  1TWC K;  2JH3 A;  3FKI A;  4C2M C;  3S2D C;  2A69 A;  4GTE A;  1KQ4 A;  3CQZ C;  5FJ8 K;  2A6E A;  1TWG K;  4A3E K;  4KN7 A;  3FHZ A;  3S1R K;  2R93 A;  4KMA A;  3FOE A;  3A8J A;  3AD8 C;  2R93 K;  3HOY K;  1F9N A;  3L4K A;  4GFQ A;  1WSV A;  2PA8 L;  4DDQ A;  1USM A;  4X6A K;  5M5W K;  2B63 A;  1VRQ C;  4QIW D;  3K7A C;  4KAS A;  3SZZ A;  1ZBS A;  3A8I A;  1F7U A;  1PJ6 A;  2NVY A;  3EQL A;  1TWF A;  4AYB D;  1AB4 A;  4LOW A;  1L0W A;  2NVX K;  1WSR A;  2NVY K;  4Q5S A;  3H3V D;  1WCM A;  4Y7N K;  4FZB A;  1WOO A;  3AQP A;  3GTJ A;  3GTQ A;  1RU0 A;  5C44 C;  3PO3 C;  4P5B A;  3RZO K;  4KM8 A;  4YFX A;  3HOV C;  1EQR A;  3HOV K;  2Y0S L;  1Y1W K;  3HOU C;  3GTM C;  5M5X K;  3H0G K;  3JST A;  3S1M K;  1TWG A;  3TFJ A;  3LAP A;  5C3E K;  2A6H A;  4LJZ A;  1YX2 A;  4G7H A;  2NVQ K;  3N3Y A;  3NUH A;  2JA7 K;  3GTK C;  4GTC A;  1WCM K;  1JQW A;  3H3V L;  5IP7 K;  2E2H C;  3S1N K;  1I6H C;  5IYB K;  1BJT A;  2NVT K;  4NOI A;  1IQ0 A;  1XZP A;  4OIQ A;  1IL2 A;  1VH2 A;  1WOR A;  2B63 C;  2Y0S D;  3AQO A;  4WJ4 A;  4A3L K;  3FOF A;  5IP9 C;  2ZUE A;  4YG2 A;  2E2I C;  2NVQ C;  1Y1W A;  4BKW A;  4YFK A;  4BBR C;  1C0A A;  4FM9 A;  4BBR K;  4C3J K;  2PMZ D;  3S1M C;  1F7V A;  4Q4Z A;  3S14 C;  3CQZ A;  1K83 A;  1XZQ A;  3G4A A;  3S17 C;  2ZUF A;  4BBS C;  4KDD A;  4MQ9 A;  4GTB A;  4KM9 A;  5IYD K;  2NVX A;  3A8K A;  2GSU A;  4YFN A;  1I3Q K;  2NVT C;  4QJV B;  4KAT A;  5IYB C;  1WCM C;  3AD9 C;  3AD7 C;  4WIL A;  1TWA C;  4A3L C;  2KWA A;  2E2J C;  3OPF A;  2YU9 A;  1JOE A;  1DCH A;  2VUM K;  5TMC A;  3HOW K;  5M3F K;  2GAH C;  2JA8 K;  1O24 A;  1UV7 A;  3H0G C;  2WB1 D;  2R7Z K;  5C4J K;  4QIW L;  1TWA A;  3MML B;  3S1Q K;  1TWC A;  4C3H K;  4WJ3 M;  3M3Y K;  2CW0 A;  3TTG A;  1WQG A;  3GTL C;  3V4G A;  2JA6 C;  2O5J A;  1USO A;  3QX3 A;  4G0U A;  2JA5 A;  3GTQ C;  4G7O A;  2VUM A;  3HXA A;  2JA8 C;  4G0W A;  1R9T K;  3GTO K;  1WQF A;  2BE5 A;  4RMF A;  3VA7 A;  4A3F C;  3PO2 C;  2PHC B;  4Y7N C;  4ILD A;  3H0G A;  4BY1 K;  1I50 C;  4MEX A;  5TJ3 A;  4AYB L;  4BLA A;  2VUM C;  3IPJ A;  1XZQ B;  1HI9 A;  3GTK K;  4C3I C;  2E2I A;  1IBA A;  3GSI A;  3S0X A;  1I6V A;  4A3M K;  2E2H K;  3GDZ A;  1XXA A;  3GTL A;  5TMF A;  4A3J K;  1YCL A;  4A3B C;  4A3C C;  1XPP A;  1ZVU A;  3S17 K;  2E2H A;  3CAG A;  3N0C A;  4A3F K;  3S14 K;  4C2M K;  3T01 A;  4Y52 K;  1WOP A;  4ZH4 A;  2PMZ L;  1BS2 A;  3S2D K;  1O28 A;  4KMD A;  2CFA B;  4LK1 A;  5IYC C;  3HOX C;  1J6V A;  3S1R C;  5IYC K;  4XSX A;  3HOX K;  2R92 A;  2R93 C;  4C3J C;  2XCR B;  4BY7 C;  1JVI A;  1INN A;  4OIO A;  5FLM C;  4A93 C;  1SFO K;  2FQT A;  1R9T A;  5EGE A;  1ZXO A;  1PJ7 A;  1J98 A;  1EFW A;  1EI6 A;  4M1X A;  4C45 A;  2GSO A;  4KAR A;  3TFI A;  2V6S A;  3WOD A;  4GTD A;  5CJ9 A;  3GTG A;  1PJ5 A;  3GTP A;  4A3K C;  4AH6 A;  3T00 A;  4A3M C;  4A3G C;  3LPX A;  1O27 A;  1I50 K;  4GTA A;  2RGR A;  3M4O C;  4PAA A;  4GTF A;  3ADA C;  1EK8 A;  4A3E C;  1Y1W C;  3BP8 C;  1Y1V C;  5FLM K;  1DCO A;  4KB4 A;  2XCQ A;  5EGH A;  1G51 A;  4BY1 C;  3GTJ C;  2WAQ D;  1I3Q A;  3GTJ K;  1BDF A;  3PO2 K;  1YNN A;  4KN4 A;  4Y52 C;  3CQZ K;  1O26 A;  1DD5 A;  1VGX A;  5C4X C;  4A3I K;  1TWH A;  3GEH A;  1ZYR A;  3I4N K;  3FKI C;  1K83 K;  4A3C K;  4A3B K;  4KMH A;  4LK0 A;  4BY7 K;  4G0V A;  1DCP A;  5L46 A;  5IOS A;  2B63 K;  3GIR A;  2WB1 L;  1Y1V K;  2ZFZ A;  5M5Y K;  2E2J K;  3GTO A;  3K7A K;  5CHP A;  3ORE A;  3N0B A;  4KAW X;  4OIP A;  5C4J C;  4A3J C;  4KB2 A;  3BP3 A;  1IS1 A;  3HKZ L;  4OIN A;  4MEY A;  5JFE A;  3OEP A;  4X6A C;  3S15 K;  1V5V A;  4A3G K;  2GSN A;  1J6X A;  1TWC C;  1TWH C;  2PA8 D;  3GTG K;  2JA7 A;  1EH1 A;  3RZD C;  3Q3Q A;  2JA6 K;  4A3I C;  1SMY A;  1I3Q C;  1IW7 A;  3GTL K;  4J3N A;  3GTM K;  4A3D C;  1R9T C;  2YU9 C;  5JVO A;  3HOZ K;  4A3D K;  4A93 K;  4BLB A;  1SFO A;  3S1Q C;  3GTO C;  3RZO C;  2R92 C;  4G7Z A;  3LAJ A;  2R92 K;  4PAB A;  1O2A A;  3HOU K;  5E68 A;  5D4D A;  4OIR A;  3HOW C;  1VLO A;  3HKZ D;  2NVX C;  3GEE A;  2GAG C;  4BXX K;  4LQY A;  1J6W A;  1F93 A;  2O5I A;  3T02 A;  3GTG C;  3TFH A;  1O25 A;  1TWH K;  2P5M A;  3S15 C;  3I4M C;  1O29 A;  4C3I K; 
#chains in the Genus database with same CATH homology
 1JOE A;  2FQO A;  1VH2 A;  5E68 A;  1YCL A;  1J98 A;  4XCH A;  1IE0 A;  1JVI A;  1JQW A;  1INN A;  1J6V A;  1J6X A;  1J6W A;  1VGX A;  1VJE A;  2FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...