1VH2A

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
b'VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 43
structure length 152
sequence length 152
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vh2A00
1IE0A 5E68A 1J6XA 1JVIA 1VH2A 1JOEA 1VGXA 2FQTA 1J98A 1JQWA 1J6VA 1J6WA 1VJEA 1INNA 4XCHA 1YCLA 2FQOA
chains in the Genus database with same CATH superfamily
3TFIA 2XCQA 5JFEA 3HOUC 3HOZK 3V4GA 5C44K 4OIPA 1X31C 5IOTA 4BLBA 4A3EC 2JA5A 3MMLB 4MEYA 3S1QC 3A8IA 3FOFA 3TTGA 3RZOK 3H3VD 2E2JC 3T00A 3PO2C 4KB2A 3GTGA 4KMAA 2CFAA 4ZH4A 5IORA 3S1RK 3S2DC 3AD8C 1TWFK 1SMYA 1WSVA 4BKWA 2KWAA 2WAQD 3GTMK 5IYCK 2A6HA 4Y7NC 1SFOK 3S15C 4A3MC 3HOWC 2E2IC 4BBRC 1C0AA 4GTEA 4BLAA 1O28A 1TWCC 3G4AA 4KATA 1F7UA 2JA6K 2XCOA 1EH1A 4KB4A 1IW7A 1Y1WA 4BY1K 1BS2A 2JA7A 1USMA 1Y1VC 2CFAB 3M3YC 3ADAC 4LK1A 3CAGA 4KARA 4A3KC 5C4XK 5M3FK 1DCOA 3WODA 4BY7K 3HXAA 4G7OA 1JOEA 1EK8A 3S1MC 2R93A 1IBAA 1XXAA 1F7VA 5IYBK 1G51A 4BBSC 3S16K 1I6HK 1JQWA 1O2FB 2NVTK 1EFWA 3HOXK 4LOWA 4A3FK 4C3JC 2PA8L 2BE5A 4G7ZA 3S1NC 3FKIC 4FM9A 2JH3A 4WJ3M 1XXCA 3RZDC 3L4KA 4A3LC 4M1XA 4G7HA 4C2MK 2FQOA 3VA7A 4X6AC 2PMZL 1YX2A 1AB4A 1Y1VA 2R7ZK 5FLMK 5IYDK 3GTGC 4G0UA 1I3QK 4RMFA 3GTOC 5IP9C 1IL2A 5E68A 2P5MA 1YNJA 3H0GC 4C3IC 1USOA 4Q4ZA 2NVQK 4A3GC 1F9NA 4LLGA 2YU9K 4GT9A 1IQ0A 2D6FC 1TWAK 2VUMC 5TMFA 4GTBA 2WB1D 1WOPA 1XPPA 4KN4A 3GTKC 4A3IK 4Y52C 4A3DC 1JVIA 2V6TA 3GDZA 5EGHA 1PJ6A 2GSOA 1K83K 4LR2A 1O29A 3HOYK 2RH6A 2GAGC 2R93C 3K7AK 3HOXC 2Y0SD 4FZBA 4A3CC 4XSXA 1GE9A 5M5YK 2NVYK 2W7VA 3N0BA 1R9TK 1WQHA 3S14K 5C4JK 3GTQK 3IPJA 2E2HK 2ZUEA 3GTOA 3M4OC 4KDDA 3I4MC 2NVXK 3GTPC 4A3BK 4GZYA 3FOEA 5HL8A 4AH6A 3NUHA 1XZQA 3H0GA 2JA8K 4AYBD 4C3HC 3HKZL 4A3JC 2O5JA 3GTJK 1VH2A 5FLMC 2VUMA 1WCMK 3GTKA 1IE0A 4GTAA 4BXXC 2JA5K 1L0WA 2B63K 1WQGA 4A93K 4P5AA 4OINA 3PO3C 5C3EK 1I50C 4MQ9A 2ZFZA 1WOOA 1TWGC 2P8TA 3OPFA 4DDQA 3I4NK 1XZQB 1VLOA 1WORA 5M3MK 1B4AA 3H3VL 3TFJA 1RU0A 1J6XA 3S17K 2R92K 2WAQL 3CQZC 1PJ7A 1O26A 1EQRA 1KQ4A 1Y1WK 5IP7K 4KM9A 3ERED 2PMZD 2JA7K 3HOZC 3S2HK 3GTPA 2Y3PA 5C44C 3K7AC 3Q3QA 3LPXA 3GTLK 4GTCA 2NVYC 3AD9C 3G4CA 2O5IA 3RZOC 5CJ9A 3HOUK 3GTQC 3S1RC 1TWFC 1EI6A 4A3EK 3GTMC 1I50A 3N3YA 4QIWL 5IYCC 1HQMA 4P5BA 3S1QK 1SFOC 2JA8C 1TWGA 2E2JK 3PO2K 1WQFA 4G0WA 1WOSA 4KAWX 2JA6C 3AH5A 4BY1C 3GIRA 4Y7NK 3S15K 4A3MK 3N0CA 3HOWK 4GTFA 2E2IK 4BBRK 3CQZA 5CHPA 2FQTA 5C4XC 1TWCK 1O24A 5TMCA 3FHZA 1K83A 1ZYRA 5FJ8K 4BY7C 3DXJA 1ISEA 4XLNA 5L46A 3M3YK 5IYBC 1O2BA 3TFHA 5IOQA 2XCRB 4A3KK 2NVYA 3LAJA 3S16C 1I6HC 3LAPA 2A69A 2NVTC 1F93A 4LK0A 3GTQA 1TWHK 4KMUA 3S1MK 2E2HA 1TWFA 4A3FC 4QJVA 3GEIA 1J98A 3AQPA 3GEEA 3S2HC 4JK1A 3GTMA 4BBSK 3OREA 1SFOA 1WIHA 4KMDA 3GTJA 2WB1L 4KN7A 1WCMA 4C3JK 4C45A 4C2MC 4KASA 3S1NK 2JA6A 3FKIK 3EQLA 3RZDK 2B63A 1BDFA 4A3LK 1PJ5A 2R7ZC 3SZZA 1YNNA 3T01A 5IYDC 3JSTA 4QJVB 4XLPA 1HI9A 4OIRA 1I3QC 3L4JA 2ZUFA 4KC6A 4KMHA 4LJZA 4X6AK 4GFQA 2PPBA 1INNA 2NVQC 2Y0SL 1XZPA 2R92A 2YU9C 3GTGK 1TWAC 3GTOK 4YFXA 5IP9K 4A3IC 2PA8D 3AD7C 2RGRA 1J6VA 1ZVUA 3H0GK 3HOVK 4C3IK 4A3GK 1WSRA 4KM8A 2VUMK 1UV7A 5M5WK 4WJ4A 4AYBL 3GTKK 3GTLA 1K83C 4Y52K 4A3DK 5EGEA 4ILDA 4P9SA 3HOYC 4MEXA 1XZPB 1O2AA 5M5XK 1O25A 4Q5SA 3A8KA 1TWHC 2V6UA 1ZXOA 4QIWD 1XXBA 2GAHC 1R9TC 2R7ZA 3BUEA 4YFNA 3S14C 5C4JC 4NOIA 2GSUA 4J3NA 1I3QA 2E2HC 4YG2A 2R93K 1DCPA 1J6WA 4OIQA 3S0XA 2NVXC 4A3CK 4A3BC 4LQYA 1V5VA 4YFKA 1VJEA 4OIOA 3AQOA 4GTLA 4PABA 2EBBA 5JVOA 2YU9A 3GTJC 5D4DA 1TWAA 3S2DK 2E2IA 1O27A 1DD5A 1WCMC 3M4OK 3I4MK 2GSNA 1BJTA 4WILA 5IOSA 3GTPK 1I6VA 1TWCA 2JA5C 3SZYA 2B63C 4A93C 5TJ3A 4PAAA 5C3EC 4C3HK 4A3JK 2A6EA 4GTDA 3GEHA 4O2DA 3QX3A 3I4NC 2PHCB 3OEPA 4BXXK 3A8JA 4G0VA 1YCLA 2CW0A 3PO3K 1Y1VK 2A68A 1I50K 3S17C 1ZQ1C 2R92C 3GSIA 3HOVC 1TWHA 1TWGK 2V6SA 1R9TA 1VGXA 1DCHA 3BP8C 1B4BA 4XSZA 1Y1WC 5IP7C 2NVXA 2JA7C 1BGWA 3HKZD 3T02A 3CQZK 1ZBSA 3FKIA 3GTLC 1VRQC 3BP3A 4XCHA 1IS1A
chains in the Genus database with same CATH topology
1IE0A 5E68A 1J6XA 1JVIA 1VH2A 1JOEA 1VGXA 2FQTA 1J98A 1JQWA 1J6VA 1J6WA 1VJEA 1INNA 4XCHA 1YCLA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IE0 A;  5E68 A;  1J6X A;  1JVI A;  1VH2 A;  1JOE A;  1VGX A;  2FQT A;  1J98 A;  1JQW A;  1J6V A;  1J6W A;  1VJE A;  1INN A;  4XCH A;  1YCL A;  2FQO A; 
#chains in the Genus database with same CATH topology
 3TFI A;  2XCQ A;  5JFE A;  3HOU C;  3HOZ K;  3V4G A;  5C44 K;  4OIP A;  1X31 C;  5IOT A;  4BLB A;  4A3E C;  2JA5 A;  3MML B;  4MEY A;  3S1Q C;  3A8I A;  3FOF A;  3TTG A;  3RZO K;  3H3V D;  2E2J C;  3T00 A;  3PO2 C;  4KB2 A;  3GTG A;  4KMA A;  2CFA A;  4ZH4 A;  5IOR A;  3S1R K;  3S2D C;  3AD8 C;  1TWF K;  1SMY A;  1WSV A;  4BKW A;  2KWA A;  2WAQ D;  3GTM K;  5IYC K;  2A6H A;  4Y7N C;  1SFO K;  3S15 C;  4A3M C;  3HOW C;  2E2I C;  4BBR C;  1C0A A;  4GTE A;  4BLA A;  1O28 A;  1TWC C;  3G4A A;  4KAT A;  1F7U A;  2JA6 K;  2XCO A;  1EH1 A;  4KB4 A;  1IW7 A;  1Y1W A;  4BY1 K;  1BS2 A;  2JA7 A;  1USM A;  1Y1V C;  2CFA B;  3M3Y C;  3ADA C;  4LK1 A;  3CAG A;  4KAR A;  4A3K C;  5C4X K;  5M3F K;  1DCO A;  3WOD A;  4BY7 K;  3HXA A;  4G7O A;  1JOE A;  1EK8 A;  3S1M C;  2R93 A;  1IBA A;  1XXA A;  1F7V A;  5IYB K;  1G51 A;  4BBS C;  3S16 K;  1I6H K;  1JQW A;  1O2F B;  2NVT K;  1EFW A;  3HOX K;  4LOW A;  4A3F K;  4C3J C;  2PA8 L;  2BE5 A;  4G7Z A;  3S1N C;  3FKI C;  4FM9 A;  2JH3 A;  4WJ3 M;  1XXC A;  3RZD C;  3L4K A;  4A3L C;  4M1X A;  4G7H A;  4C2M K;  2FQO A;  3VA7 A;  4X6A C;  2PMZ L;  1YX2 A;  1AB4 A;  1Y1V A;  2R7Z K;  5FLM K;  5IYD K;  3GTG C;  4G0U A;  1I3Q K;  4RMF A;  3GTO C;  5IP9 C;  1IL2 A;  5E68 A;  2P5M A;  1YNJ A;  3H0G C;  4C3I C;  1USO A;  4Q4Z A;  2NVQ K;  4A3G C;  1F9N A;  4LLG A;  2YU9 K;  4GT9 A;  1IQ0 A;  2D6F C;  1TWA K;  2VUM C;  5TMF A;  4GTB A;  2WB1 D;  1WOP A;  1XPP A;  4KN4 A;  3GTK C;  4A3I K;  4Y52 C;  4A3D C;  1JVI A;  2V6T A;  3GDZ A;  5EGH A;  1PJ6 A;  2GSO A;  1K83 K;  4LR2 A;  1O29 A;  3HOY K;  2RH6 A;  2GAG C;  2R93 C;  3K7A K;  3HOX C;  2Y0S D;  4FZB A;  4A3C C;  4XSX A;  1GE9 A;  5M5Y K;  2NVY K;  2W7V A;  3N0B A;  1R9T K;  1WQH A;  3S14 K;  5C4J K;  3GTQ K;  3IPJ A;  2E2H K;  2ZUE A;  3GTO A;  3M4O C;  4KDD A;  3I4M C;  2NVX K;  3GTP C;  4A3B K;  4GZY A;  3FOE A;  5HL8 A;  4AH6 A;  3NUH A;  1XZQ A;  3H0G A;  2JA8 K;  4AYB D;  4C3H C;  3HKZ L;  4A3J C;  2O5J A;  3GTJ K;  1VH2 A;  5FLM C;  2VUM A;  1WCM K;  3GTK A;  1IE0 A;  4GTA A;  4BXX C;  2JA5 K;  1L0W A;  2B63 K;  1WQG A;  4A93 K;  4P5A A;  4OIN A;  3PO3 C;  5C3E K;  1I50 C;  4MQ9 A;  2ZFZ A;  1WOO A;  1TWG C;  2P8T A;  3OPF A;  4DDQ A;  3I4N K;  1XZQ B;  1VLO A;  1WOR A;  5M3M K;  1B4A A;  3H3V L;  3TFJ A;  1RU0 A;  1J6X A;  3S17 K;  2R92 K;  2WAQ L;  3CQZ C;  1PJ7 A;  1O26 A;  1EQR A;  1KQ4 A;  1Y1W K;  5IP7 K;  4KM9 A;  3ERE D;  2PMZ D;  2JA7 K;  3HOZ C;  3S2H K;  3GTP A;  2Y3P A;  5C44 C;  3K7A C;  3Q3Q A;  3LPX A;  3GTL K;  4GTC A;  2NVY C;  3AD9 C;  3G4C A;  2O5I A;  3RZO C;  5CJ9 A;  3HOU K;  3GTQ C;  3S1R C;  1TWF C;  1EI6 A;  4A3E K;  3GTM C;  1I50 A;  3N3Y A;  4QIW L;  5IYC C;  1HQM A;  4P5B A;  3S1Q K;  1SFO C;  2JA8 C;  1TWG A;  2E2J K;  3PO2 K;  1WQF A;  4G0W A;  1WOS A;  4KAW X;  2JA6 C;  3AH5 A;  4BY1 C;  3GIR A;  4Y7N K;  3S15 K;  4A3M K;  3N0C A;  3HOW K;  4GTF A;  2E2I K;  4BBR K;  3CQZ A;  5CHP A;  2FQT A;  5C4X C;  1TWC K;  1O24 A;  5TMC A;  3FHZ A;  1K83 A;  1ZYR A;  5FJ8 K;  4BY7 C;  3DXJ A;  1ISE A;  4XLN A;  5L46 A;  3M3Y K;  5IYB C;  1O2B A;  3TFH A;  5IOQ A;  2XCR B;  4A3K K;  2NVY A;  3LAJ A;  3S16 C;  1I6H C;  3LAP A;  2A69 A;  2NVT C;  1F93 A;  4LK0 A;  3GTQ A;  1TWH K;  4KMU A;  3S1M K;  2E2H A;  1TWF A;  4A3F C;  4QJV A;  3GEI A;  1J98 A;  3AQP A;  3GEE A;  3S2H C;  4JK1 A;  3GTM A;  4BBS K;  3ORE A;  1SFO A;  1WIH A;  4KMD A;  3GTJ A;  2WB1 L;  4KN7 A;  1WCM A;  4C3J K;  4C45 A;  4C2M C;  4KAS A;  3S1N K;  2JA6 A;  3FKI K;  3EQL A;  3RZD K;  2B63 A;  1BDF A;  4A3L K;  1PJ5 A;  2R7Z C;  3SZZ A;  1YNN A;  3T01 A;  5IYD C;  3JST A;  4QJV B;  4XLP A;  1HI9 A;  4OIR A;  1I3Q C;  3L4J A;  2ZUF A;  4KC6 A;  4KMH A;  4LJZ A;  4X6A K;  4GFQ A;  2PPB A;  1INN A;  2NVQ C;  2Y0S L;  1XZP A;  2R92 A;  2YU9 C;  3GTG K;  1TWA C;  3GTO K;  4YFX A;  5IP9 K;  4A3I C;  2PA8 D;  3AD7 C;  2RGR A;  1J6V A;  1ZVU A;  3H0G K;  3HOV K;  4C3I K;  4A3G K;  1WSR A;  4KM8 A;  2VUM K;  1UV7 A;  5M5W K;  4WJ4 A;  4AYB L;  3GTK K;  3GTL A;  1K83 C;  4Y52 K;  4A3D K;  5EGE A;  4ILD A;  4P9S A;  3HOY C;  4MEX A;  1XZP B;  1O2A A;  5M5X K;  1O25 A;  4Q5S A;  3A8K A;  1TWH C;  2V6U A;  1ZXO A;  4QIW D;  1XXB A;  2GAH C;  1R9T C;  2R7Z A;  3BUE A;  4YFN A;  3S14 C;  5C4J C;  4NOI A;  2GSU A;  4J3N A;  1I3Q A;  2E2H C;  4YG2 A;  2R93 K;  1DCP A;  1J6W A;  4OIQ A;  3S0X A;  2NVX C;  4A3C K;  4A3B C;  4LQY A;  1V5V A;  4YFK A;  1VJE A;  4OIO A;  3AQO A;  4GTL A;  4PAB A;  2EBB A;  5JVO A;  2YU9 A;  3GTJ C;  5D4D A;  1TWA A;  3S2D K;  2E2I A;  1O27 A;  1DD5 A;  1WCM C;  3M4O K;  3I4M K;  2GSN A;  1BJT A;  4WIL A;  5IOS A;  3GTP K;  1I6V A;  1TWC A;  2JA5 C;  3SZY A;  2B63 C;  4A93 C;  5TJ3 A;  4PAA A;  5C3E C;  4C3H K;  4A3J K;  2A6E A;  4GTD A;  3GEH A;  4O2D A;  3QX3 A;  3I4N C;  2PHC B;  3OEP A;  4BXX K;  3A8J A;  4G0V A;  1YCL A;  2CW0 A;  3PO3 K;  1Y1V K;  2A68 A;  1I50 K;  3S17 C;  1ZQ1 C;  2R92 C;  3GSI A;  3HOV C;  1TWH A;  1TWG K;  2V6S A;  1R9T A;  1VGX A;  1DCH A;  3BP8 C;  1B4B A;  4XSZ A;  1Y1W C;  5IP7 C;  2NVX A;  2JA7 C;  1BGW A;  3HKZ D;  3T02 A;  3CQZ K;  1ZBS A;  3FKI A;  3GTL C;  1VRQ C;  3BP3 A;  4XCH A;  1IS1 A; 
#chains in the Genus database with same CATH homology
 1IE0 A;  5E68 A;  1J6X A;  1JVI A;  1VH2 A;  1JOE A;  1VGX A;  2FQT A;  1J98 A;  1JQW A;  1J6V A;  1J6W A;  1VJE A;  1INN A;  4XCH A;  1YCL A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...