1VH2A

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
total genus 43
structure length 152
sequence length 152
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vh2A00
2FQOA 1JOEA 1VGXA 1J6XA 1JVIA 1IE0A 1INNA 1JQWA 1VH2A 1J6VA 1VJEA 4XCHA 1J6WA 1YCLA 5E68A 2FQTA 1J98A
chains in the Genus database with same CATH superfamily
1ZQ1C 3M3YC 1BDFA 5IOTA 1DD5A 2NVXA 4LJZA 2PMZD 2WAQD 3AD7C 1Y1WA 2JA8C 1C0AA 2CW0A 2W7VA 1JVIA 2JA7A 2CFAA 2XCOA 4QIWD 3H0GC 4A3FK 1BJTA 3ADAC 4WILA 3MMLB 3L4KA 5M5YK 1EK8A 3GTLA 5IORA 3GTJK 1YX2A 5C3EC 4BY1K 3FOFA 4A3BK 3GTJA 1USOA 5IOSA 1EH1A 3PO2K 3S2DK 4YFXA 2WB1D 4C3JC 3RZOC 3BP3A 1XXCA 2A6EA 1WQGA 1O2BA 1IS1A 3HOWK 3T01A 3S0XA 1F93A 4BLAA 4MEXA 4A3DK 4Q4ZA 3GEIA 2A6HA 2NVYA 2O5JA 1SFOA 5C4JK 1USMA 2Y3PA 4KB4A 1HQMA 1K83A 2R7ZC 3S16K 5IP7K 1V5VA 3CQZC 4XSXA 4KN4A 4C3HK 3FHZA 2B63C 4ZH4A 4OIRA 4Y7NC 2PPBA 4BBSC 3I4NK 1JOEA 2RH6A 1J6XA 4WJ3M 1XPPA 3RZDK 3PO3C 3VA7A 3HOZK 3GTOA 3S1MC 1O26A 3JSTA 1O27A 2WB1L 3HKZL 4KMUA 3S2HC 2JA7K 5IP9K 2V6TA 2R93A 5TJ3A 1SFOK 3G4AA 2ZUFA 2VUMC 2KWAA 2R93K 1Y1VA 1HI9A 1ISEA 4KMHA 2XCRB 4LLGA 3GTLK 3HOUC 3WODA 4KATA 1R9TA 2E2JK 3GTKC 3HOVC 3S1QC 3AQPA 3GTPC 1RU0A 4YG2A 1IBAA 1I50A 1TWFC 1K83K 5JVOA 3AD9C 2ZFZA 4QJVB 5M5WK 1XZPA 1WQHA 1VH2A 4A3GC 3N3YA 3S1NK 4A93K 1O28A 4A3BC 3HXAA 3AD8C 3L4JA 4BY7C 1JQWA 3T00A 3FOEA 2NVXC 2JA5C 3CQZA 3K7AC 4A3MC 1O24A 3QX3A 2B63A 3GSIA 2NVQK 4PAAA 1GE9A 3S17K 1WOSA 1XZPB 2E2HA 1Y1WC 4A3EC 1I6HK 2GAHC 1XXBA 3GTMA 3H0GA 1Y1VK 1I3QC 1WCMC 2JA8K 3OPFA 4KM8A 4C3IC 3BP8C 1J6VA 1ZBSA 4XLNA 4Q5SA 4G7ZA 5M3MK 4A3FC 1IE0A 3FKIK 5FLMC 3S15C 3GTQA 3H3VD 3HOYC 4LK0A 1ZXOA 5IYCC 5D4DA 4A3CC 4ILDA 3GTQK 3S14K 2NVTC 2GSNA 1TWGA 4G7HA 3S1RC 3GTOK 1B4AA 1AB4A 3I4NC 4GTAA 2V6SA 4J3NA 5C44C 1TWGK 1I50C 4KAWX 2FQOA 3PO2C 4A3LC 1TWHK 1IQ0A 3I4MK 4C2MC 5IOQA 3HOZC 3GTGC 1YCLA 2A69A 2Y0SL 1XZQA 2PA8L 1INNA 4X6AK 2NVYK 4A3KK 4KC6A 1IW7A 2JH3A 4BXXK 3FKIA 1TWAC 1J98A 4A3JC 2E2IC 5JFEA 2R92K 1XZQB 5C4JC 1VLOA 1TWCK 4DDQA 3S2DC 2R92A 2GAGC 2JA6C 1YNJA 1WCMA 1I3QA 5EGEA 2B63K 4A3IK 4Y7NK 1VJEA 1K83C 2R7ZA 2ZUEA 4MQ9A 2EBBA 3LPXA 3CAGA 4KM9A 4C45A 1L0WA 5C4XC 2FQTA 1WOPA 2VUMA 1WQFA 4JK1A 2YU9C 1R9TK 2NVQC 3TFJA 4OIQA 4BY1C 1I6VA 4QJVA 4YFNA 1I6HC 2CFAB 4P5AA 4BBSK 3GTPA 2R93C 1G51A 1O29A 3TFHA 1KQ4A 3N0BA 3GTKK 1YNNA 3AQOA 3G4CA 4GTEA 1IL2A 3HOVK 4LOWA 4C3JK 2XCQA 4GTBA 1WORA 5IYDC 3FKIC 5FLMK 3LAJA 3S15K 2P8TA 4GTCA 1TWFA 5IYCK 5C3EK 2JA5A 4A3CK 4A3DC 3ERED 4A93C 4AYBL 3HOXC 2E2HC 4FM9A 4KASA 2PMZL 3RZOK 3GTMC 4RMFA 4A3LK 3GTPK 3GDZA 3S16C 3IPJA 1Y1WK 4GTFA 1X31C 3GTGK 2D6FC 4BBRC 5IYBK 5CJ9A 1F7UA 4Y52C 4XCHA 3V4GA 4X6AC 4BKWA 1I3QK 1WCMK 4G0VA 3OEPA 1SMYA 2BE5A 4GTLA 4OINA 3PO3K 1ZVUA 4G0WA 4BXXC 4KMDA 1VGXA 2YU9A 4BY7K 3SZZA 1WIHA 3Q3QA 4PABA 1WSRA 4LR2A 3S17C 3CQZK 4WJ4A 1PJ6A 4GT9A 1PJ7A 1XXAA 4LQYA 2VUMK 4LK1A 3M4OK 4BLBA 1O2AA 4AH6A 5HL8A 3S1RK 3GTOC 1Y1VC 4KDDA 1TWGC 5TMFA 5M3FK 1EI6A 4GZYA 4KB2A 3LAPA 3GTJC 2GSOA 4A3KC 3S1NC 2NVTK 4OIOA 4KARA 4NOIA 1F7VA 3SZYA 1TWAK 1BS2A 1EFWA 2E2IK 3M3YK 1I50K 1TWAA 2E2IA 2R7ZK 3I4MC 3EQLA 1DCPA 1TWFK 1TWHA 3AH5A 3A8JA 1DCOA 4G0UA 3HOWC 4M1XA 4G7OA 4QIWL 2NVYC 3A8IA 4KN7A 4O2DA 3H0GK 1O25A 2O5IA 3T02A 2RGRA 2PHCB 5FJ8K 3S2HK 4A3MK 4YFKA 4XLPA 4AYBD 5IP7C 2YU9K 4A3EK 1TWCA 3GTQC 4OIPA 4XSZA 1O2FB 1UV7A 2V6UA 3TTGA 2E2JC 4BBRK 5IYBC 3RZDC 3GEEA 4C2MK 5E68A 3BUEA 2GSUA 2JA7C 2P5MA 5IP9C 5IYDK 1DCHA 1WOOA 1R9TC 3S14C 1B4BA 2WAQL 3NUHA 3GTLC 3DXJA 5TMCA 3HOUK 3M4OC 3GEHA 2NVXK 4FZBA 2A68A 1J6WA 1EQRA 5C44K 2E2HK 3GTGA 3S1QK 5M5XK 5L46A 1TWHC 1BGWA 3HKZD 4P5BA 4C3HC 3GTMK 3GTKA 2JA6K 4GFQA 4P9SA 4MEYA 1ZYRA 4A3IC 2JA6A 2Y0SD 3GIRA 4Y52K 1F9NA 2PA8D 3TFIA 4A3GK 4C3IK 3S1MK 3A8KA 4GTDA 3H3VL 1PJ5A 3N0CA 5C4XK 4A3JK 4KMAA 1WSVA 2R92C 2JA5K 3K7AK 5CHPA 3HOXK 3OREA 1TWCC 3HOYK 1VRQC 5EGHA 1SFOC
chains in the Genus database with same CATH topology
2FQOA 1JOEA 1VGXA 1J6XA 1JVIA 1IE0A 1INNA 1JQWA 1VH2A 1J6VA 1VJEA 4XCHA 1J6WA 1YCLA 5E68A 2FQTA 1J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQO A;  1JOE A;  1VGX A;  1J6X A;  1JVI A;  1IE0 A;  1INN A;  1JQW A;  1VH2 A;  1J6V A;  1VJE A;  4XCH A;  1J6W A;  1YCL A;  5E68 A;  2FQT A;  1J98 A; 
#chains in the Genus database with same CATH topology
 1ZQ1 C;  3M3Y C;  1BDF A;  5IOT A;  1DD5 A;  2NVX A;  4LJZ A;  2PMZ D;  2WAQ D;  3AD7 C;  1Y1W A;  2JA8 C;  1C0A A;  2CW0 A;  2W7V A;  1JVI A;  2JA7 A;  2CFA A;  2XCO A;  4QIW D;  3H0G C;  4A3F K;  1BJT A;  3ADA C;  4WIL A;  3MML B;  3L4K A;  5M5Y K;  1EK8 A;  3GTL A;  5IOR A;  3GTJ K;  1YX2 A;  5C3E C;  4BY1 K;  3FOF A;  4A3B K;  3GTJ A;  1USO A;  5IOS A;  1EH1 A;  3PO2 K;  3S2D K;  4YFX A;  2WB1 D;  4C3J C;  3RZO C;  3BP3 A;  1XXC A;  2A6E A;  1WQG A;  1O2B A;  1IS1 A;  3HOW K;  3T01 A;  3S0X A;  1F93 A;  4BLA A;  4MEX A;  4A3D K;  4Q4Z A;  3GEI A;  2A6H A;  2NVY A;  2O5J A;  1SFO A;  5C4J K;  1USM A;  2Y3P A;  4KB4 A;  1HQM A;  1K83 A;  2R7Z C;  3S16 K;  5IP7 K;  1V5V A;  3CQZ C;  4XSX A;  4KN4 A;  4C3H K;  3FHZ A;  2B63 C;  4ZH4 A;  4OIR A;  4Y7N C;  2PPB A;  4BBS C;  3I4N K;  1JOE A;  2RH6 A;  1J6X A;  4WJ3 M;  1XPP A;  3RZD K;  3PO3 C;  3VA7 A;  3HOZ K;  3GTO A;  3S1M C;  1O26 A;  3JST A;  1O27 A;  2WB1 L;  3HKZ L;  4KMU A;  3S2H C;  2JA7 K;  5IP9 K;  2V6T A;  2R93 A;  5TJ3 A;  1SFO K;  3G4A A;  2ZUF A;  2VUM C;  2KWA A;  2R93 K;  1Y1V A;  1HI9 A;  1ISE A;  4KMH A;  2XCR B;  4LLG A;  3GTL K;  3HOU C;  3WOD A;  4KAT A;  1R9T A;  2E2J K;  3GTK C;  3HOV C;  3S1Q C;  3AQP A;  3GTP C;  1RU0 A;  4YG2 A;  1IBA A;  1I50 A;  1TWF C;  1K83 K;  5JVO A;  3AD9 C;  2ZFZ A;  4QJV B;  5M5W K;  1XZP A;  1WQH A;  1VH2 A;  4A3G C;  3N3Y A;  3S1N K;  4A93 K;  1O28 A;  4A3B C;  3HXA A;  3AD8 C;  3L4J A;  4BY7 C;  1JQW A;  3T00 A;  3FOE A;  2NVX C;  2JA5 C;  3CQZ A;  3K7A C;  4A3M C;  1O24 A;  3QX3 A;  2B63 A;  3GSI A;  2NVQ K;  4PAA A;  1GE9 A;  3S17 K;  1WOS A;  1XZP B;  2E2H A;  1Y1W C;  4A3E C;  1I6H K;  2GAH C;  1XXB A;  3GTM A;  3H0G A;  1Y1V K;  1I3Q C;  1WCM C;  2JA8 K;  3OPF A;  4KM8 A;  4C3I C;  3BP8 C;  1J6V A;  1ZBS A;  4XLN A;  4Q5S A;  4G7Z A;  5M3M K;  4A3F C;  1IE0 A;  3FKI K;  5FLM C;  3S15 C;  3GTQ A;  3H3V D;  3HOY C;  4LK0 A;  1ZXO A;  5IYC C;  5D4D A;  4A3C C;  4ILD A;  3GTQ K;  3S14 K;  2NVT C;  2GSN A;  1TWG A;  4G7H A;  3S1R C;  3GTO K;  1B4A A;  1AB4 A;  3I4N C;  4GTA A;  2V6S A;  4J3N A;  5C44 C;  1TWG K;  1I50 C;  4KAW X;  2FQO A;  3PO2 C;  4A3L C;  1TWH K;  1IQ0 A;  3I4M K;  4C2M C;  5IOQ A;  3HOZ C;  3GTG C;  1YCL A;  2A69 A;  2Y0S L;  1XZQ A;  2PA8 L;  1INN A;  4X6A K;  2NVY K;  4A3K K;  4KC6 A;  1IW7 A;  2JH3 A;  4BXX K;  3FKI A;  1TWA C;  1J98 A;  4A3J C;  2E2I C;  5JFE A;  2R92 K;  1XZQ B;  5C4J C;  1VLO A;  1TWC K;  4DDQ A;  3S2D C;  2R92 A;  2GAG C;  2JA6 C;  1YNJ A;  1WCM A;  1I3Q A;  5EGE A;  2B63 K;  4A3I K;  4Y7N K;  1VJE A;  1K83 C;  2R7Z A;  2ZUE A;  4MQ9 A;  2EBB A;  3LPX A;  3CAG A;  4KM9 A;  4C45 A;  1L0W A;  5C4X C;  2FQT A;  1WOP A;  2VUM A;  1WQF A;  4JK1 A;  2YU9 C;  1R9T K;  2NVQ C;  3TFJ A;  4OIQ A;  4BY1 C;  1I6V A;  4QJV A;  4YFN A;  1I6H C;  2CFA B;  4P5A A;  4BBS K;  3GTP A;  2R93 C;  1G51 A;  1O29 A;  3TFH A;  1KQ4 A;  3N0B A;  3GTK K;  1YNN A;  3AQO A;  3G4C A;  4GTE A;  1IL2 A;  3HOV K;  4LOW A;  4C3J K;  2XCQ A;  4GTB A;  1WOR A;  5IYD C;  3FKI C;  5FLM K;  3LAJ A;  3S15 K;  2P8T A;  4GTC A;  1TWF A;  5IYC K;  5C3E K;  2JA5 A;  4A3C K;  4A3D C;  3ERE D;  4A93 C;  4AYB L;  3HOX C;  2E2H C;  4FM9 A;  4KAS A;  2PMZ L;  3RZO K;  3GTM C;  4RMF A;  4A3L K;  3GTP K;  3GDZ A;  3S16 C;  3IPJ A;  1Y1W K;  4GTF A;  1X31 C;  3GTG K;  2D6F C;  4BBR C;  5IYB K;  5CJ9 A;  1F7U A;  4Y52 C;  4XCH A;  3V4G A;  4X6A C;  4BKW A;  1I3Q K;  1WCM K;  4G0V A;  3OEP A;  1SMY A;  2BE5 A;  4GTL A;  4OIN A;  3PO3 K;  1ZVU A;  4G0W A;  4BXX C;  4KMD A;  1VGX A;  2YU9 A;  4BY7 K;  3SZZ A;  1WIH A;  3Q3Q A;  4PAB A;  1WSR A;  4LR2 A;  3S17 C;  3CQZ K;  4WJ4 A;  1PJ6 A;  4GT9 A;  1PJ7 A;  1XXA A;  4LQY A;  2VUM K;  4LK1 A;  3M4O K;  4BLB A;  1O2A A;  4AH6 A;  5HL8 A;  3S1R K;  3GTO C;  1Y1V C;  4KDD A;  1TWG C;  5TMF A;  5M3F K;  1EI6 A;  4GZY A;  4KB2 A;  3LAP A;  3GTJ C;  2GSO A;  4A3K C;  3S1N C;  2NVT K;  4OIO A;  4KAR A;  4NOI A;  1F7V A;  3SZY A;  1TWA K;  1BS2 A;  1EFW A;  2E2I K;  3M3Y K;  1I50 K;  1TWA A;  2E2I A;  2R7Z K;  3I4M C;  3EQL A;  1DCP A;  1TWF K;  1TWH A;  3AH5 A;  3A8J A;  1DCO A;  4G0U A;  3HOW C;  4M1X A;  4G7O A;  4QIW L;  2NVY C;  3A8I A;  4KN7 A;  4O2D A;  3H0G K;  1O25 A;  2O5I A;  3T02 A;  2RGR A;  2PHC B;  5FJ8 K;  3S2H K;  4A3M K;  4YFK A;  4XLP A;  4AYB D;  5IP7 C;  2YU9 K;  4A3E K;  1TWC A;  3GTQ C;  4OIP A;  4XSZ A;  1O2F B;  1UV7 A;  2V6U A;  3TTG A;  2E2J C;  4BBR K;  5IYB C;  3RZD C;  3GEE A;  4C2M K;  5E68 A;  3BUE A;  2GSU A;  2JA7 C;  2P5M A;  5IP9 C;  5IYD K;  1DCH A;  1WOO A;  1R9T C;  3S14 C;  1B4B A;  2WAQ L;  3NUH A;  3GTL C;  3DXJ A;  5TMC A;  3HOU K;  3M4O C;  3GEH A;  2NVX K;  4FZB A;  2A68 A;  1J6W A;  1EQR A;  5C44 K;  2E2H K;  3GTG A;  3S1Q K;  5M5X K;  5L46 A;  1TWH C;  1BGW A;  3HKZ D;  4P5B A;  4C3H C;  3GTM K;  3GTK A;  2JA6 K;  4GFQ A;  4P9S A;  4MEY A;  1ZYR A;  4A3I C;  2JA6 A;  2Y0S D;  3GIR A;  4Y52 K;  1F9N A;  2PA8 D;  3TFI A;  4A3G K;  4C3I K;  3S1M K;  3A8K A;  4GTD A;  3H3V L;  1PJ5 A;  3N0C A;  5C4X K;  4A3J K;  4KMA A;  1WSV A;  2R92 C;  2JA5 K;  3K7A K;  5CHP A;  3HOX K;  3ORE A;  1TWC C;  3HOY K;  1VRQ C;  5EGH A;  1SFO C; 
#chains in the Genus database with same CATH homology
 2FQO A;  1JOE A;  1VGX A;  1J6X A;  1JVI A;  1IE0 A;  1INN A;  1JQW A;  1VH2 A;  1J6V A;  1VJE A;  4XCH A;  1J6W A;  1YCL A;  5E68 A;  2FQT A;  1J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...