2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
1XZPB 3A8JA 3GSIA 1PJ6A 1PJ5A 3A8KA 1WOPA 3AD7C 1WOSA 1YX2A 3GIRA 1X31C 3GEHA 1WOOA 1WSRA 3TFIA 1VRQC 1XZQA 3A8IA 3TFHA 1V5VA 2GAGC 5L46A 3AD8C 4P9SA 3TFJA 1PJ7A 1VLOA 3GEEA 3TTGA 1WORA 3AD9C 2GAHC 1WSVA 3GEIA 3ADAC 1XZQB 4PABA 4PAAA 1XZPA
chains in the Genus database with same CATH superfamily
2MXYA 1RT1B 4P75A 3LAPA 1FEEA 1WWHA 3KG0A 4URGA 3D6FB 5KFCA 2D6FC 1M1HA 3MM7B 5T41A 1EKRA 2K1RA 3CJSA 4J90A 1ICEB 2UUWA 1C0AA 2J9CA 1DBDA 2CQPA 3DU6A 2DNLA 3TZWA 2CVEA 3HHDA 2WW4A 3WZ0A 1KEKA 4HI2A 2IFXA 4DU7A 3CO9A 5IYCK 2W01A 4Y0FA 1EQMA 3EGZA 4ZN3A 3A3OB 3J7YI 4ILDA 4L6V3 1LQ9A 1TWCA 2BRLA 5IOSA 4IQMA 2V2ZA 2W2PP 3SCJE 2MZTA 2M2BA 2RRNA 4LMZA 1XIQA 1LWXA 2C3OA 3VCDA 3IXQA 2J8SA 2RIJA 5DQIA 2IBKA 2FHJA 3JQJA 4IH6A 2RE1A 4DOZA 2DYAA 5CCMA 3PIPQ 4OV6A 5DDPC 5DG7A 1CJKB 1RWWB 4MK8A 1M5VC 2ZH2A 1N33F 5ETPA 4CI0B 3O8WA 1I50A 2G1DA 4DR7F 4Q2MA 2FVRA 4I56A 3G6YA 2E1PA 3ZZPA 1QAJA 2IIHA 2AP6A 1H73A 1NKEA 4YFKA 4PXCA 4PCQA 4F4WA 1EETB 3TW0A 4C97A 2B8QA 3IRXB 4E2FB 1HR0F 3FGVA 3S14C 2CQDA 4ZLNA 4HACB 1DURA 1OY8A 3GSIA 1PJ6A 3E2EA 2XZTB 2GSOA 4ZJLA 5HMWA 2B43A 1VMBA 5BYSA 1TWAK 1SH2A 5KT3A 2OPRB 1F7UA 3S01A 4GZYA 2EK1A 2VPXB 2V6AA 2WSEC 5CCLA 2YWGA 2E1AA 1VISA 2P5MA 3QGPA 5THWA 1H7WA 2EFNA 2PEBA 1FO1A 3QAEA 4GTCA 1NK8A 3FKIA 3MPWA 1R8PA 4DG1A 1E6YA 3KG4A 1HPZB 2LYVA 2XYGB 4LR8A 3A8KA 2R8KA 1JMTA 1NK6A 3V6DB 4C7QA 5LOQA 5LSLA 4ZVEA 4Y52K 3IC1A 1TWFK 2EI5A 2XI2A 4YS2A 4MQ9A 4QYZK 2ZBQA 2N7YA 2EBEA 3CT9A 1DQ9A 1YRUA 5IWAF 4LF7F 2GMJA 4JOUA 2VBZA 3ZTSA 1IVZA 2E7VA 3HZGA 1U1QA 4IR9A 1GX5A 2ZOFA 4PAAA 1HBUB 4J9QA 5IYDC 3QMQA 1RA7A 5IM0A 1YX2A 2GA7A 2UVRA 2A6OA 3DHXA 4DR1F 2YWHA 4KAWX 1R0AA 4U8YA 1R0BG 2BJ3A 2Y1RI 4TU9A 3FBFA 4FP9A 4AE5A 1URNA 2WBRA 4KO0B 3ZZOA 3LQVA 4UZBA 1FXDA 1UWAA 4C8OA 4HACA 2DNOA 3ZZYA 3QPIA 3MFHA 2C3MA 3FKIK 4DN9A 4ZMMA 4X4QA 3EPIA 5D4DA 1U45A 3I0SB 2HHTA 4L75A 1Y11A 3GTGK 5GAHU 2BM1A 2YBVA 5HJXA 4NE9C 4ZPVR 5LMNJ 2DNRA 3GTOK 5ETLA 3GTQC 5M3MK 4OX9J 2HVEA 2XG8A 4FYWB 3UVJB 1HBNA 2EWHA 1X0PA 2RRBA 3BP8C 3PKMA 1FWLA 5K9FA 1SVDA 2W8LA 3J80U 2ZH6A 2W9CA 3K0JA 4WWSA 2X1GA 4OINA 1XMQF 3HOUC 4G65A 4HH1A 1C1CB 2JRSA 3MAQA 1IW7A 2UP1A 2BEFA 2YQ3A 1R0CB 4BY1K 4F2RA 1DTTA 2JHEA 3I0SA 1WEYA 3DYAA 5J2PB 5CA5A 3G86A 3RGIA 5I4MA 1L5UA 3QGGA 3KMQA 3LP2B 3A4TA 5KFMA 1F9EB 3FRYA 3DXBA 3T5KA 2J76E 2HMIA 2AJ1A 3KLEA 2CPYA 4YB7A 4F0KA 5KG3A 4DV7J 1SMYA 3WDOA 3OW2R 4ZK7M 3BUEA 4I64A 5HBMA 1N34J 4LF2A 3EQLA 4J9PA 2VOPA 1DQAA 4H4OB 1IJFB 2BJ7A 4TN2A 3EX7B 3HOZK 4EBCA 4Q5VA 2DNPA 3G87A 1F5BA 1LXNA 4WTOB 2RDJA 3HSJA 1JXEA 4MJKA 4MIAA 4K2JA 3UR0A 3NBPB 2PT0A 2E29A 3DU5A 1QAYA 3KG1A 4XK8C 4FF1A 2A69A 4LVOP 1YRTA 2GQ2A 1B0PA 2AYBA 2W4PA 4JV2A 4DV2F 3M30A 2JA8C 4WFXA 1OJ4A 2BVZA 4JI2J 4OYBA 3CW2C 4CLUA 2W2MP 4KDDA 1E6YB 2ZJRQ 4CH7A 2E2JK 3MMAA 1ZAWA 1DZ5A 1VOMA 4ES1A 2ADBA 2JL9A 2VBWA 3R27A 1NKBA 2IYGA 4NLRA 4LF8J 3BYPA 4JI1J 1HNIA 1VR6A 2BQ3A 4DSJA 1U0SA 3R9LA 1R6YA 2KYXA 3AFGA 4NZ7A 4ZHRA 4YFNA 2W2OP 1NDLA 5EWGA 3WBZA 3S17K 2RF2B 2NZCA 4P71A 4DLGA 4IDKA 1JQWA 3EXYA 3GZ7A 1ACMB 3ZNJ1 4A48A 3MR7A 1O8BA 1FERA 1J5EF 2JA5A 2V9KA 4F2SA 4ES2A 2YKMA 4D3GA 2R8JA 3MEDA 3N5FA 4AXIA 2DRAA 1IWGA 3ENAA 4I69A 4Y28C 2G0JA 2FJDB 1EP4B 3J81Y 5I3PA 2YQ0A 4ZVQB 4EYHB 2E1CA 4IG3B 3OJUA 3NS6A 1Z2LA 2D1CA 4DX6A 2D9PA 3AOBA 2MHEA 3BKUA 1ZYQA 4LSNA 3RW7A 2MEWA 2QL5B 4KPYA 4UF4A 3GV5B 1DCOA 2IJFA 3DYAB 1XPPA 4X4OA 2IM3A 1QD1A 4KV8B 4V19X 5HQMA 2RU3A 3EZUA 2O5DA 2OGUA 4ZVFA 2XGPA 1TKTA 2E2HA 3CCZA 4DR3J 4Q8EA 3GFHA 2ZDOA 5F3TA 1QTNB 1T9XA 2CQ0A 1U6BA 1K0VA 4ZH4A 1GXUA 2ZEJA 3OXFA 1P1TA 1KFSA 3GFYA 3N4WA 3KHHA 4I1TA 1XZPA 5T7LB 3UPFA 1WDDA 5CJ9A 2E5GA 5J2MA 4OHXA 2K7KA 1DD5A 1S99A 4R0JA 5BYQA 4E0DA 4A8MP 4IYQA 2IYIA 3Q2TC 4KMAA 2IMOA 2OH2A 3EUNA 4J9LA 2QA2A 1WNEA 2CRLA 4F4AA 4PUOB 1RK8A 5D0GA 3IS9B 1TL5A 1ZM4A 5HVHA 3TR5A 1N8RT 3VTIA 1P9QC 1RJJA 3OV7A 1XMBA 3RG6A 1RTHA 2FDNA 5D3GB 4K2XA 2VFVA 3HLUA 3OHBA 5FLMC 2OIHA 1WC6A 5L46A 2M70A 3KHRA 2K2PA 5J2QA 1OWXA 1B0VA 3M32B 5CQGA 2IVFB 1IBMJ 4OHVA 4F67A 1I3QK 1S0VA 2J0XA 2V2KA 5GAHI 4DV2J 3CCSS 3HO1A 3BP3A 3RRKA 3S2HK 2BANB 1Q82T 2E5LJ 3CCJS 3TA0A 1GNKA 3M8QA 4M8LA 3ET6A 3DLHA 1MNEA 3IGNA 1P9YA 4IQXA 2ZD1A 3CTRA 2LDIA 1IS1A 2MPUA 1F93A 1RTHB 5EWEA 1XC9A 1KNZA 1S6OA 3M8QB 4WILA 4KE5A 2M9KA 1HNZF 4ZIWA 4ER8A 4KHPF 1IKYB 3JXOA 1VC6A 2I8EA 1GEHA 3WIUA 4CP5A 4LF4F 5GAEU 4WCEQ 2DBBA 2V8DA 2QZ8A 1RTIA 5IOTA 3NGDA 2WOMA 1YZ6A 4LBIA 5FDLB 2JWNA 2J6TA 4LIWA 1RYRA 4KN4A 5IC6B 5L1IA 4C11A 4O3NA 3KJVB 1S97A 4RW4B 2FQQB 1LWFA 4J9VA 5LMNF 2ZFZA 4NXNF 1RHJB 1I3OB 2F7VA 1JLCA 1IR2A 5D15A 4MYUA 5IXUA 2ROPA 4QW8A 3KJQB 1EAYC 2ATCB 3KYLA 5I3UB 3CUNA 5IT4A 4G1QB 2I0XA 1JX4A 2YWEA 3SQOP 2Y1IA 3HOUK 1FFGB 4DPUA 2EC0A 1M0SA 1RU2A 3KK3B 1SQEA 3SCLE 1D3WA 1AYEA 5T7LA 4BCAA 1T03B 4X2BA 2F63A 2XTJP 3BGRA 1INNA 4DR1J 2DGVA 1RTJA 3V5RA 4ECTA 3V4IA 3H42A 1KOHA 4MAKA 2ZC3A 4LF4J 2DTJA 1S9FA 4M5DB 3IA0A 1Z2ZA 3TAMA 2P2CB 1JLAB 3K7RA 2YTCA 3VZHA 3D28A 2FZGB 3VHQA 1BQNB 1WI8A 4M5JA 1Q7YT 4FBUA 1ZPVA 3WX8A 2HS4A 3NRBA 1RT6B 5E5NA 1NHKL 4R8UA 1RT3A 2VB6A 4WF9Q 3TI0A 4FVCA 2NR0A 2KZZA 4JK1A 5IOQA 3VAMA 4W4MA 4LSLA 5IS2A 1JLGA 3DOKB 1J6VA 4XDDA 4J5OA 2AJ2A 2DO0A 3BDPA 3C6TA 2DNZA 1FFWB 3C16B 3MEGA 3WODA 2KXHA 1PILA 2JEJA 2PGCA 3G4CA 1NUEA 2PMZL 1IBMF 1RT1A 1NDKA 5AE2A 1DLOB 2LLZA 4M5NA 2Z56B 4F36A 3KHGA 3KJFB 5E3AA 4A8WA 2MKYA 4ZPDA 2ZH4A 5F8MA 3IRWP 5A0YA 5M2PA 2VKZG 3CMQA 4ECQA 2A2DA 4C98A 4LF9J 4O3SA 1HL6A 3L4BC 1WF2A 2YVSA 1X9SA 4L73A 2MKKA 4N41A 2G2ZA 2P9CA 3TZXA 1JB0C 5KFBA 1X9WA 3H59A 2KFNA 2B6AB 1TWCC 4A3LC 5D0RA 3RB3A 1B4BA 2DGTA 3QSYB 1CG2A 3GTYX 4OZ5A 1VC5A 2AD9A 1I6VA 4A3IK 4LK0A 2FLOA 4YEAA 3FBBA 4DWIA 1MU2A 3LOUA 1RB0A 4DFKA 2FJWA 5KG0A 2BZ2A 1FVQA 1RAOA 2NLWA 3ILIA 4P52A 3WC0A 1U7LA 2MQ8A 2VPZB 2KM8B 1YGYA 5IQ6A 1OO0B 3PXGa 3EJMA 4UT4A 3CF5Q 3VAFA 3V6KA 4PXBA 4USMA 4C8MA 2IA6A 3KUEA 2FVCA 1T3NA 4GTFA 3W5XA 3BQ0A 3KK2B 2V2VA 4UW2A 1WTFA 2E9TA 2FGOA 1H2UX 1LXJA 3H4BA 4DFPA 1U1OA 3H5YA 1J98A 3BGFA 2HAIA 4NL5A 5I42B 2GC8A 4HTJA 2HHSA 2P6SA 1YVFA 2R2RA 3LP0B 1S1WB 3G4SS 1U1KA 1SL0A 3VAKA 2XMAA 3OR2B 1UJ4A 2A1BA 5DDOC 1R31A 1EZZB 4WFYA 2V63A 2Y1JA 2CQCA 2HNDB 5F8HA 4A3LK 1O5JA 1AT1B 2R92K 3P5BP 5EX3A 4XCHA 2BJEA 4F3OA 2ZUAA 1UWBA 4IFVA 2KRRA 3M8PB 2VUMK 1HHSA 1JJ2R 1F2GA 1ZXOA 3M05A 4C8YA 1HYSB 3DGVA 5K14A 3AHPA 3LGNA 1N5YA 4WP8A 3DOLA 4WTYA 1KQ4A 5AXLA 4TXSA 3M3YK 1JJ4A 4YB1P 3CWJA 4ED5A 1TELA 3OUYB 4LQ9A 4ZCLA 2OUGA 2RGRA 4DXLA 1R9TK 4AUKA 3KLIA 4WK1A 1RQ0A 2QRRA 1MN7A 3GTJA 2FHJD 2WVEA 2QIFA 1U2RA 1UFLA 3GTKA 3Q0AA 5F8LA 1VRQC 1YJ7A 2Z8QA 4MEYA 2Z2YB 1PJ7A 5GMKa 3L3CA 2R7TA 4X4PA 2E66A 4RX6A 2BOAA 1RHRB 1K83C 3C6TB 4KGVB 3S16K 4K4VA 1J6WA 1BD6A 1IWAA 4CLPA 4DCOB 3DOKA 2V4QA 2RQCA 5J1NA 4DPYA 2XHWA 5A76A 4ED2A 2F3JA 4BBYA 2RHQB 4CO0A 2HLTA 4NXMJ 4KBIA 1TMMA 4P2MA 2GNKA 2UVVA 2U1AA 4BC7A 4A3CC 2YNHB 4Q2LA 1TWGC 4C4WA 1FT8A 3JYTA 3MECB 1O26A 2C2DA 4EFAC 1HR0J 4Y2KA 3I31A 4WKRA 1NB7A 3UDLA 1RWMB 2UUTA 2WK4A 3CJ8A 2B9EA 2DH7A 3UCGA 5KG2A 3K7AC 3I82A 2VJVA 4PG4A 4K4YA 1QAXA 3H2UB 1IUJA 2AEJA 1R0AB 4LRBA 3G82A 4J37A 5HI7A 4DN0A 2Y8WA 2KDOA 3TAMB 1KLMB 3G6VA 1FWPA 4B3TJ 3MCNA 3M8PA 4LF5J 2W25A 4NA3A 4PWWA 5JJBA 3ZTRA 5B7WA 3QT8A 1IQZA 4EYIB 4AQYF 5HROB 3FEZA 3GTPK 3JSMB 1FWKA 2A3JA 1WHXA 5LMUJ 4DPXA 2HAFA 4ETZA 2B56A 1JLCB 1SH3A 3MECA 1RBOB 4RZRA 5LJ3Y 3MCSA 2MLYA 4ECVA 2VD3A 3CJTA 1TKZB 3HFZB 2VA3A 3JSMA 3Q3QA 4OJHA 5DRKA 3OR1A 3MM6B 1RLDA 2E2JC 2ZFHA 1DAXA 4G0VA 1USOA 1Y10A 2J7UA 1H72C 2MB0B 4ZA1A 4NRTA 3QT5A 2Y1LB 3QSIA 5D77A 1CJVB 1TV6B 4LR9A 4OJ3A 4QR1A 3T3FA 1U09A 4M63A 2C42A 2PSZA 2CQ4A 5G0RA 3P3DA 3BO4A 4U96A 2JLEA 3CVKA 5J2QB 4DQRA 4DL5A 4KH1B 2GJFA 2NUUG 2ZUFA 3R5CA 2GCFA 4ZPBA 1UVIA 4QU7A 4QCLA 1F5CA 1YNJA 4CLZA 3A8JA 4X65J 2XSJA 4IG0B 2ZH8A 2YKOA 1RAEB 4TY8A 2BW7A 2DNMA 1O2AA 2BE2A 2DXFA 4C3JC 4CO2A 1IR0A 2C2KB 2H54B 4QPTA 5KFYA 1R27B 5EDWA 4NOHA 3NOCA 3R5AA 2MJUA 1KQFB 3UO0A 3M2VB 1HNZJ 3P96A 3SCKE 4USIA 2IVYA 3M8WA 4DV3J 4J9UE 3GCXP 2OP5A 1KKHA 4OYXA 4DUZJ 3GTQA 3GEIA 3DLGB 1C0TB 3OL6A 1S4FA 3BF4A 1I5OB 3SV4A 4O4RA 3FZBA 1VJWA 5KAKA 5E3CA 3G71S 2RQ4A 1T9VA 3MM8B 3AA9A 1VLOA 1J5EJ 2IJNA 3JSRA 3POTA 1OMSA 4ZVOB 2ZKTA 3FMWA 2MLZA 4FYXB 2GSUA 1BQNA 2AEFA 4NLUA 3N6LA 4PWUA 2PMZD 2YU9C 2ZH9A 3MUMP 2RRAA 1ZAXA 2PN6A 3F73A 2AHOB 3P6YC 2V4JA 1A9NB 4C2MK 1HNWF 5IOLA 3WC2A 4ID8A 4Y2MA 4LSZB 1CULB 3OTBA 2V8GA 2AJQA 4JI5J 1B3TA 3Q22A 5IP9C 1VK8A 4NI2A 1V6HA 1WHWA 1XNRF 3NXZA 4KYZA 4OHWA 2YKQA 1JLAA 4NLPA 4ZLJA 1TFWA 2LQ9A 2CJYB 1KS2A 1X31C 2R2SA 4ECYA 1RWNB 4YB6A 4OHZA 2RT3A 2EKNA 2FY8A 1KVIA 5KG6A 1QY7A 4X4RA 1XR6A 3ULHA 4A3MK 4C8LA 1N36F 2O66A 1Y1WC 4ZLPA 3D6TB 4WJ3M 4DV4J 3OR2A 2CPEA 3PX0A 5K8NA 3QGHA 1EQRA 4IDKB 4JI0J 1LWFB 4A3FC 7AT1B 3KDOA 2AT1B 2WB1D 3VWSA 4DDFA 3GR0A 4EBEA 2MMYA 3HHNB 3RJMB 1D8ZA 5IYCC 1Q16B 2ZC4A 1N36J 3FKIC 1UP1A 2H9ZA 1KONA 4KASA 2Q1LA 1FK9A 4K4SA 3OVSA 3Q8UA 4PPZA 3O2IA 4NRUA 1AA1B 3FFIB 3ADAC 4IH5A 1TVRB 1IL2A 3D68A 4HT5A 4HHHA 4ED8A 5E3QA 4WK3A 4HYKA 4L72B 5BR8J 4CM2A 4RBVA 1WORA 2GAHC 2V68A 2YNGB 2NVQK 3V4MA 1HQUB 2C2NA 2F9JA 1Q78A 4ILRA 1RTZA 2JA6K 2O1PA 2BJ9A 2NYHA 2WAQD 1TUGB 4MMOA 3IWLA 3FKBA 3D7SB 1H0HB 2JA8K 1XMQJ 2DNKA 3U27A 2B6AA 3BGUA 3HDSA 1JKHA 3HF5A 5SZTA 1U24A 2AJFE 4P7VA 1PIEA 2GMLA 2HVHA 2CFAA 2YQ1A 5CHCB 2CQIA 4PWDA 4PXDA 3K59A 4M5IA 1T9UA 1VH2A 2UUCJ 2UZAA 3KLFA 4Z7YA 4KHMA 3CCUS 4KAIA 3EWGA 3M8RA 3DGPA 5EWFA 5AE1A 3M8ZA 3SIPB 4K8RA 2CQ3A 4Q45A 1FX2A 4DLEA 1O29A 1H38A 4OLOA 1GTHA 3ZZUA 1F7VA 4N77A 4K5RA 3BKTA 4DV7F 3WX4A 3VGSA 3X1LB 2MZ1A 3ISNC 3UDCA 3TQEA 1RE1B 4JI2F 3QIPA 1UVKA 3AAWB 5DG9A 1AB8A 3D5MA 3O3LA 4OX9F 4EI2A 4LFAJ 4LJMA 2XBPA 1HYSA 2XC9A 3A8IA 4K4TA 3HVWA 2AV5A 4A3JK 4ETXA 2LMIA 4UOCA 1DFDA 2HGLA 5C25A 2RHSB 4CO4A 2YPZA 1AZSB 2DR8A 3V6JA 4NX9A 4PWDB 2HNYB 4LK1A 4KARA 2J8AA 4G0WA 2WW8A 2QA4G 1CSJA 1HD0A 3M8SA 1X4EA 2B63C 4MK7A 4LF6J 1S6QB 4OZ1A 4E98A 3ISZA 5EGHA 1YBAA 3B4MA 4G7HA 1QUPA 3CD6S 3JAMY 2Y3PA 4N56A 3MM5A 4OYZA 3PO3C 3FQLA 4DL3A 3D6MB 1R43A 4XDCA 5KFXA 5AJ3F 4KGKA 2HK2A 3TJ9A 4F4KA 3DHWC 2QLFB 5ETKA 4JI6J 2FD2A 3I9ZA 2QT7A 3UCZP 3MMBB 4HVZA 1U6ZA 3HKZL 5HMZA 2HPUA 4Z2XA 1NJXA 4BKWA 4FYYB 1U8WA 4TU8A 1WELA 3PY8A 1XK8A 3HPOA 1CVJA 5I3QA 2CPJA 3K8WA 4O3OA 5J1EA 6FD1A 4F04B 5DG8A 3HOYK 5E7OB 3QT6A 2GO8A 3Q8YA 1NK4A 2ZZTA 2PFFB 3ENVA 3FNNA 3GJQB 1HNXJ 1GAOA 4NLWA 1K9MT 3GTMA 4Y65A 3NWRA 2J9DA 3ILOA 2LEBA 4N76A 2PE8A 4BY7K 2KN4A 1BC6A 2NPIA 3CDEA 1FX4A 1R8HA 4C3KA 4CO5A 4KB4A 5F8GA 3DOMB 2Z0GA 5F9LA 1PCAA 3JQMA 4K4XA 5GMEA 1P1LA 2POKA 4DX8H 1I50K 2C2ZB 1Q8KA 4PYAA 2HEKA 4B3TF 3BO3A 1R89A 1YJNS 3HVTA 3TFHA 4BBRC 1HI9A 1XWLA 3CCTA 5C3EK 2XY7A 2Z2MA 4WBFA 4IRCA 4YMEA 3KKFA 4Z7CA 4LJZA 4UZCA 5L1LA 2YU9K 3FDSA 2ZBIA 3RRGA 4DR2F 3IR6B 3GWCA 2EXUA 4JP8A 4P73A 2EW9A 3HHLC 1EQ0A 2VODA 3TYTA 2D3UA 3MR3A 1NJYA 3MGJA 4C8ZA 1FTRA 2FYXA 3K8VA 2I5JB 2NSCA 2VG6A 2HWHA 1HWUA 2VPYB 2E9RX 3F0NA 1SUQA 4DI6A 2FJBB 5DZ7A 4I6YA 2KTQA 1T8EA 2DXDA 1M5PC 1IR1A 1YG0A 1XXAA 2UXBJ 3TUPA 1K0TA 2FLPA 2X3DA 4NEZA 4OZ2A 4WXOA 2PC6A 1FD8A 3NLCA 4RUHA 1CJUA 3GR1A 1CJTB 2B4OA 3NCPA 2FC9A 4ZIVA 3LANA 1N4LA 2LU1A 3TVZA 3RB0A 1GT8A 3PYFA 4TYAA 1D1UA 5U47A 1NRKA 1FHTA 3K5MA 4JI8F 3HCXA 1HQ2A 2XEXA 1FVSA 3L7UA 2ZZNA 2LVWA 2HFUA 1ZBTA 2ZE2A 1S7HA 3LGHA 2LA4A 4JB8B 1Y9OA 1UL3A 3CMAS 4DSIA 3JTNA 3QWPA 2D74B 4KPCA 3N0VA 3E8OA 4NCAA 2VUMC 2Y0BB 4ES3A 3MPDA 3NWGA 3GIKA 2VZ9A 5ADZA 1FRHA 3GTKK 2RUSA 1KVJA 2O67A 3C3LA 1YITS 4FM9A 4ZP6A 3KJVA 5HATA 2VF3A 3RU0A 4NWBA 4GKJJ 4LF7J 4NEYA 4A3GC 2NXUA 3HHKA 1FNOA 3M2VA 2VU5A 3GTOC 2KFYA 2OSRA 3ZNUA 1RKJA 3THTA 2DNNA 4OMFG 2VJUA 3AD8C 2MY8A 3BSCA 1RTJB 5KTQA 2FHKA 3LPXA 2XWYA 4NCBA 4HTIA 4YP3A 1G6BA 3R7NB 1B99A 2YXLA 2HBYB 4BLAA 2JA7K 3KNAA 5J1EB 3WQPA 3FVYA 2HRYA 2MQPA 2R7SA 4DR4F 3AQPA 2W4CA 2ROEA 4WZMA 1Y4ZB 4KO0A 2PA3A 4OIOA 3MD1A 5KFZA 1HWJA 3S16C 4DZ6A 3N0CA 1NDCA 2UXBF 5MAOA 1YJTA 4HR2A 5I3UA 1HWKA 3DDKA 4DX5A 5KOWA 2IC3B 5C4JC 3S1RK 3TTGA 3IM8A 2CQ1A 4P2FA 3PR5B 5A8RA 5KFUA 3CCLS 1XMOJ 4C3MA 2ATLA 5JVOA 3UR3C 4I68A 5E3RA 1U6FA 3BV8A 3RRHA 1S0NA 2YNIA 4PQAA 4HT7A 2C28A 3E01B 2X7IA 4JI3F 1VI7A 3BJYA 1G1XA 2OO4A 1XNQF 4X6AC 2CZ4A 2LQBA 5GAEI 2V9WA 2OFHX 3GLJA 1HKAA 1C1CA 2X3GA 4BLGA 1I94J 2UUCF 3SCIE 3ITHB 2QMWA 1HW9A 3D0HE 2KYZA 1NK5A 3PX4A 3CD5A 4I2QA 2GVZA 5F41A 3VQTA 5LMUF 2BR0A 4O23A 3DOLB 3IRXA 2X51A 4WKYA 5LJ5Y 2ZOGA 2R93C 1Q8BA 4A93C 1MW7A 3NY0A 1JWWA 5C5JA 2FJAB 2GV1A 1UCNA 1VHIA 3TNVA 2VASA 4K0KJ 2E7WA 4DQPA 1L3SA 2HQFA 1T9YA 2J0QD 1T94A 2DNHA 3MPVA 2DKOB 2I38A 4P6QA 1VC0A 4L3KA 5C4JK 3S1RC 4OZ3A 1VQPS 2Y9HA 4B9SA 1BDFA 1TVRA 5M5WK 3G8TA 1TAQA 4H54A 1VJEA 3MURP 4KT0C 2GIQA 2Q79A 3BBFA 4ATNA 3M6VA 4KRWA 2DY1A 1HBUA 4PXEA 1XMOF 4DV1F 2B4VA 4IOBA 4NASA 1V5VA 1T05B 4OIPA 3L7OA 3ITHA 4K4UA 3D6HB 4CLKA 4FKYA 1REGX 3R7SB 3LWLA 2PEHA 2B7CB 3L7PA 4OX7A 3PV8A 4KJIA 2E1RA 3T5LA 2O5JA 4OI3A 2CJ9A 3GB0A 3KUGA 4C2MA 2B4PA 3SZZA 1VQOS 2QE5A 1USMA 1WF1A 2DNQA 1V3ZA 4LFAF 2E5IA 5DDQC 3QRPA 4LRCA 3NGUA 1UZDA 3DCAA 4B17A 3X3UA 3EVWA 1N52B 3R2DJ 2JH3A 2XS7A 3SV3A 1YJ9S 5IYBK 4RBUA 1WKJA 3D3BJ 4GVBB 3TJ8A 1EX8A 3GIIA 1MROB 3H0GK 4C0OC 2A68A 1FA0A 4DL7A 1D09B 3SSQA 3TA2A 4P5BA 3ZTOA 4DUYJ 2XSFA 3B78A 1TFYA 2QSFA 4DEZA 5ETQA 3DDIA 2ZWPA 3I0RB 4WFZA 3QZ8A 2RQMA 2VFRA 3BPDA 3JSBA 4U95A 5L39A 1JXLA 2CZVC 4CH1A 2COLA 3M1VB 1B64A 4WIQA 1X4GA 2W2QP 4A8YA 4YOEA 2AJ4A 3OTOJ 3DLEB 2DD8S 4ZITA 3CJRA 1KC8T 2GS8A 1UKUA 1NSPA 4BHQA 1MMNA 4MT1A 4YDXA 2ERRA 3NGSA 1YTYA 3HOZC 1YSJA 2YKNA 2RU9A 1FKOA 5B0CA 5ETVA 2FLLA 3MDFA 2DNYA 3TP2A 1ELOA 2V8PA 2KT5A 1UVNA 3MHYA 1C4CA 2HHHF 2OPSA 4LFCJ 4OJ1A 2X1FA 2M5YA 4ILLA 5CZVA 2HFSA 3G96A 1HNIB 3Q23A 2OPRA 4CNZA 2DNGA 3K5NA 5C24A 4HH0A 3KLEB 3HJFA 2YKAA 3CDWA 1FKPB 1NPKA 4TQSA 4R0EA 4X62J 4QWCA 4M5DA 2W7OA 3FUYA 1BQMB 3LGMA 2XCAA 3CIZA 4JBCA 4ZN1A 3CMES 1OY6A 2WONB 1ULRA 2NVTK 1UWBB 2C1EB 1CJUB 4IFVB 3EYZA 1XR5A 3H5XA 2ALZA 4EWTA 3T5JA 3TEGA 2V5HG 3DMJA 4ANDA 1VYAA 1J6XA 3IBCB 3W64A 3HVTB 4Q0BB 2QFJA 1HWLA 4GKKJ 5HO4A 4X6AK 2HGNA 1N5VA 4LSLB 3MOJB 4OYOA 1S1TB 2MKCA 1EI6A 1U2FA 4WZQA 3D54A 1VGXA 4ZOSA 1RGVA 2EK6A 4K59A 4Q5SA 3H5SA 4DPWA 2L41A 1Q8IA 2CJAA 1RBLA 3UWTA 4DU8A 4ZCMA 4TY8B 3EZOA 1UTAA 3QNWB 4IRKA 1TWAA 3SFGA 5ETTA 2YKPA 4NLGA 3A3NB 3MM8A 3DRPB 1F3FA 5HL7Q 3DLEA 2GHVC 4Y2IA 3I32A 5E3PA 1SKUB 4WJBA 2R8HA 4AQYJ 1RBAA 3TX8A 3PCOB 3VZIA 4ED4A 2ZH7A 1N34F 1WIHA 2WZ1A 2QX0A 1TWGA 1KQGB 3SZ2A 2VC1A 4WP9A 1FJGF 1XQIA 3OTEA 5L9NA 3RB4A 2NVTC 1O51A 2PD1A 3IAM9 3JSTA 2YWKA 2DIVA 2MKSA 1LWEB 3C15B 2NVYA 1DQ8A 4UUWA 1R9TA 2J7WA 2BE2B 4Z37A 3POTB 3B8HA 3EGVA 1H7XA 3G8QA 3I9V9 4IH7A 1TV6A 3R5JB 2YNFB 2VC0A 5BR8F 3GILA 3BM7A 1HHTP 1RAJA 4C3HC 5LXYA 2W8KA 2DT9A 2KWAA 3QRQA 4CO3A 3QO9A 3PVXA 3EICA 4C3LA 2V50A 1Y1WA 1VQ9S 2A10A 2NXEA 4X64J 3TAQA 2VQFF 2GQQA 4ECXA 1LEOA 1K47A 3V6DA 1IQTA 2ABYA 2F8HA 3NS7B 2M8DB 1GH8A 2ZNZA 1SXLA 5BXIA 5F0UA 1UEVA 1CC7A 4U67Q 2JA7A 3MMBA 3DOMA 2JA5C 1CEZA 1O28A 2PPBA 2XGQA 1REVB 4GVLA 4J9MA 3GJRB 4RU2A 3OREA 5KFSA 4EK2A 2GGPB 2FJVA 1TWCK 4B02A 2XMWA 2LDYA 1PYTA 3UE2A 1E6VA 2VBYA 3DLKA 1NNDA 4ZKAA 5GMDA 3W2VB 2R7OA 3J80Y 2BKPA 3MUVP 2XY5A 1LWCA 4B3MJ 2GW8A 3P4UB 1CLFA 4BY1C 2H4YB 3TO8A 1DRZA 2BJDA 3LPEA 1RTIB 3GIJA 4FF3A 3RBEA 2XZWA 3MMJA 1BWEA 3PIOQ 5KG1A 4QR2A 3GTJC 1BHNA 2DGWA 2RNEA 4DUZF 2MYFA 1O27A 2AQ4A 1IKXB 1NDPA 2OEJA 1GXLA 1L3TA 4QJVB 1UEUA 1HLWA 4OIQA 2JLGA 4AYBD 2OHDA 2DHXA 2AF6A 2QL9B 2ROGA 1K83A 1SCJB 3RR8A 3FCWA 4TQRA 4YHHF 1CC8A 2ASJA 4PYDA 1AB4A 4QW9A 3QQCD 4IRDA 1SIZA 2NUHA 1RT4B 3ET6B 1UFKA 4FF2A 3IM9A 1AZSA 3C66A 2LU2A 3HOYC 1NH8A 1WC4A 3RAQA 2XYHB 2EBGA 2I1RA 1TL1B 2W9CB 5F0WA 3UN2A 3MZIA 4BY7C 5A2QY 3KK1A 1A0OB 2R2TA 1LOUA 1QM9A 2VKRA 1S57A 5ITHA 2A6MA 3Q8VA 4ZPCA 5C25B 4YFUA 5M5XK 2W2NP 1TWHC 5LT5A 3R97A 1F0XA 1L3KA 4B3SJ 2B63K 3TARA 2HHQA 2HVZA 1URRA 3W8PA 1ZM3A 3BN7A 3T02A 2ZH3A 2MY7A 1RISA 2B4UA 2ZBPA 2XLKA 1GX6A 2XHCA 3DRSB 4A93K 2CAJA 3DLKB 1RT2B 1UFWA 1KQSR 1HQEB 2KT2A 2A6HA 1VQLS 3ZZTA 4RL1A 5HLFB 1N5YB 5I42A 4DV0J 1LK5A 3HT3A 4OLPA 2XNQA 5A8KA 4C0BA 2DISA 2IC3A 5HQ8A 4MTPA 4AL6A 5SUHA 2RVJA 3M32A 3CJ3A 2K06A 2LP4A 3W9JA 1YWXA 1J2VA 1XXBA 3EMTA 3OPKA 2RB7A 2BX6A 2QLBB 4KFBB 3OJSA 3BGLA 2W7AA 4QIWD 3MF5A 3K2YA 2V2QA 1RU1A 2XMMA 3EDRB 2ASYA 4L76A 4WIIA 1S5ZA 3QGIA 3FCVA 2I6WA 2MQNA 1U1MA 1NBEB 3CCES 3L9ZA 1NSAA 4USUA 5JFEA 3MXHP 2B9WA 1Q7LB 3OFEA 1F5AA 3PW4A 2LKZA 2O01C 1PC5A 5AXKA 3NUHA 3SBMA 2UUAF 2G4BA 1VBZA 1KLNA 3MAHA 4YN3B 3QWUA 3NS5A 1DCPA 3D1HA 4FXWA 1IBKF 1MWYA 1OIAA 1K83K 2DH9A 3IN5A 2QJ3A 3V4IB 3S7RA 1O2BA 1K1QA 3QT7A 1MSWD 1FRJA 3OBIA 4AT1B 3JS9A 3N9UC 3A12A 4DR2J 3NP5A 3G6XA 4NA1A 3SXLA 4DDQA 1YCLA 3M2RA 1DLOA 4OYWA 1NU4A 3N28A 2NVXK 5C4XC 5HBMB 1L3UA 5KFNA 4RW9A 4GTAA 3N5BA 1RWKB 3JTOA 5IV3A 3TUJC 4XSZA 3LALA 4JYAJ 2AWZA 1H98A 1SUQB 3K58A 4LF5F 1V3RA 3M30B 3K17A 5FIIA 1NEEA 2VPWB 2Z30B 5J2PA 1LW2A 1SV5A 1S6PA 1KTQA 1I51B 1SPBP 4A3BC 4DZDA 1RWVB 3PYEA 2AGPA 3C2PA 2WCXA 4XO0A 4HI1A 2PO4A 4ED7A 5LXRA 4XLNA 3LAMA 1GMUA 5LL6d 1CULA 2V6TA 3THPA 4FZVA 3C15A 3RBDA 4C3IK 1BQMA 4XIUA 3PYDA 1Y1WK 3UVJA 1WSRA 3P49B 1WQHA 5KOXA 1UJ5A 3QATA 1LW2B 2MLXA 4QWEA 3PRVA 2KL8A 4IG0A 4CLFA 4MEXA 2RQKA 2GX8A 2XMKA 1BUXA 3PDNA 5D4PA 3FOEA 1N6QA 1NHVA 2UXDF 1AXQA 3J81j 5HQLA 2VG7A 5C4XK 1SKWA 4TY9A 4PZVA 3O1LA 4F4XA 4Y3CA 3JB9k 3HSZA 4OYPA 3SYZA 4KQZA 3GG0A 3Q8PB 4OX6A 4BS2A 1JNRB 1HD1A 3C6UA 3H5UA 4KMHA 4U7CA 1I3QC 5HLFA 4IFYA 4B9VA 2DR6A 3EGWB 2AU0A 3ICLA 2EKYA 1Y1VC 3KLGB 4JI4F 4I6WA 1VQNS 2AIRB 4AL7A 4KGZB 3Q8RB 3OPFA 3S17C 2GVDB 3ETOA 4NZ0A 3GSDA 3KDNA 2NCKL 2L9NA 3DI6A 2F1FA 3TZYA 2XO6A 1TQLA 3ILLA 1Z1ZA 4LRAA 3K5PA 5IQQA 3IAS9 5ETOA 1T03A 1VQ8S 1GTEA 4C9DA 1U1NA 1SV5B 4CIOA 1T3OA 4OI0A 2UVUA 5KFHA 4TLRA 5KT4A 4EZ6A 2PHCB 2PFDA 2DH8A 3U7JA 1W2IA 4PQUA 2V34A 5KFAA 3K57A 2DHAA 4DF4A 3DRXA 1RLCL 1YJWS 3PACA 3TEHB 1RAHB 2GMHA 3CAGA 4B9NA 5B0FA 2LXFA 2E5LF 3B6BA 6FDRA 1U0HB 4QOTA 1EB0A 3M4OC 4DSKA 1FE0A 4MFBB 2VG7B 2QSWA 3UD3P 4MH8A 5KFDA 3S1QC 3I4MK 1OQ6A 1YJUA 3DFEA 3LPYA 2M88A 3O5TB 4USWA 1GQEA 3DNCA 1HPZA 4A3GK 3IS9A 2C3YA 2UXCF 1MN9A 1FJ7A 4P72A 5DZ6A 3OL9A 1C4AA 2OD4A 3PO4A 2Z2ZA 3ISND 1HI1A 3KLIB 1GXTA 4DJBA 4GC6A 3DGPB 3LA0A 5B0AA 3FSXA 1E6VB 3V81A 2DGOA 3DDNA 5TJ3A 4E8UA 2FQTA 4UQTA 2HVDA 4WFAQ 2FLNA 1FNMA 2E5HA 3M6XA 3FZ2A 3HOWK 2AYEA 4M94A 2VFTA 1U2CA 2K8GA 3NMRA 1PG5B 2RKIB 2XULA 1QSLA 2EC2A 5H1SV 2OELA 3OLBA 2NXCA 4O4GA 1FF2A 4DV5F 2R7UA 2JEIA 1X9MA 3VF0B 5FJ8K 2DITA 3I4MC 2AZ1A 2HRTA 3KOAA 1NZAA 3D4JA 1SJ3P 3MR6A 2EBBA 1P27B 3MMCA 4LFCF 2EEYA 3LP0A 2YX7A 5L9XA 3Q83A 5IP9K 1VK3A 1N0VC 4GTEA 1UA1A 4ICLB 3HXMA 2JEGA 2HHVA 3H2LA 3UI3A 1VIXA 2ZWOA 4DBQA 2E44A 1RZMA 4C3HK 1V9OA 4NLYA 4WU2A 2LXUA 3UN5A 1ZA2B 1RHKB 2Y8YA 1EJ7L 4GT9A 2ZITA 3ETMA 1NLKL 4KTQA 1SKRA 4J9KA 4FNIA 3GTGA 3LUYA 3S1NC 5KFPA 3ZZZA 2QV6A 1BGWA 1I6HK 4KB2A 1XZQB 4IOAQ 2XNRA 4C48A 1ZM2A 3MEDB 2N3OA 2CADA 2HZVA 2BJ8A 1RADB 3DI6B 2UV8G 4C8NA 4OL8A 1DTTB 3MEGB 2XQCA 2UUBJ 2BE9B 4KIAA 1O6XA 2G13A 2NQPA 3M8YA 5TMFA 4PPDA 4OYMA 1SJQA 5KFRA 4ZJOA 3TX0A 3HOXC 1RT7A 5A8WB 2D7SA 2B9YA 5EHHA 4KR0B 2HBZB 1O24A 4GMKA 4NXNJ 3FC9A 3IBFB 2HNZA 3MD3A 4ZPWR 1R9TC 4ECSA 2V8VA 4FN5A 3CDBA 3I55S 4P10A 3S2DK 2R7XA 3NNHA 2F5GA 3D0GE 3TFIA 1IKWB 3BR8A 5ETMA 1KLMA 4RUCA 4Q7AA 1X4HA 4RNHA 3CCRS 4JI3J 4N7TA 2M3DA 3OSNA 3D1OA 3DC2A 4J91A 4KM9A 3PR4A 1VQ6S 2MZQA 1JLGB 3BDEA 5M2RA 3I6PA 1XBWA 4DPTA 1MMLA 4NOIA 1KQKA 4CYUA 3T1YF 3CJ0A 1FEHA 7FD1A 3GIMA 4RW8A 4G1QA 2HHWA 3BQ1A 1PSDA 2YKNB 5IP7K 3MAAB 4H4OA 3R8YA 1J27A 2H4WB 4OJGA 4A8QA 1AFJA 1R8CA 3UW1A 4YY3J 4GTBA 3BSNA 2CVIA 1VS3A 1TWFC 1N5SA 2L08A 4X84A 3OLAA 4RNOA 2VUMA 4GC7A 4PR6A 3IMQJ 1KWMA 4EU0A 2JC0A 4AD6A 3PM9A 4N47A 3M9MB 2XSJB 2CQHA 1SBRA 3RAXA 5DQHA 2M7SA 2CNKB 3KFWX 2OLWA 3R5GA 3VVUA 2G1HA 1RT4A 3GTOA 2HQGA 2ADCA 1TWAC 4IOCQ 4CLTA 3H4DA 1Q53A 4A3EK 4F0HA 2W1BA 4HKQA 1VCTA 1NJZA 2F4FA 3LP2A 4RBTA 3QZ7A 5CHPA 5J2NA 3PRBA 4DX7A 3QJJA 3QX3A 3UDVA 3ZTQA 5RUBA 2HW3A 4ZPAA 1VQKS 2OAUA 3HKZD 2HBQB 4USHA 3JAMU 2JEFA 3AH5A 3TRGA 3BH7B 1YK9A 1U47A 1LKZA 5J1PA 2RSQA 3W9IA 3FOFA 1DCHA 4NMXA 2H65B 1LW0B 3S14K 5FDLA 5D4OA 3QLHA 1O25A 3DXJA 1RKIA 2WVCA 3PW2A 1FXLA 4AL5A 3HXAA 4G1PA 3SMZA 5B0DA 2V67A 3IBWA 3TWZA 1LFPA 3OR1B 1HBNB 3RZOC 4Y2AA 4OFZA 1IJEB 3GG1A 3MWBA 3HD2A 3HZEA 1JLBB 1PJ5A 3HOVK 4PUOA 1VQYA 1EIYB 3R5BA 2JFKA 2CFXA 5IM0B 3TQ1A 4KKOB 4P7TA 3PRDA 1O2FB 3QFHA 2XMJA 4QQBA 4RUAA 2FTRA 3PEHA 2FUG9 3S15C 2MKJA 1BJTA 3I0RA 2CJBA 4PG6A 4C6AA 2K3KA 1CS4B 1TUVA 5F8IA 1YQHA 4A3DK 3CDAA 1N6QB 3M6WA 3GTLA 4X66J 2UU9F 2QL7B 3P45B 4ZP8A 5HK4A 4NLSA 3K5LA 5J2NB 3GDZA 3JYTB 1G4CA 1T7PA 1JLBA 3L09A 1KVKA 2J0WA 2CFAB 1P6TA 3OFHA 4F25A 4K4ZA 3RZDK 3O44A 4JV0A 2QLJB 1NHUA 2LQ5A 4A8SA 3LP1B 4RJVA 4DV0F 2XYPB 4WU3A 3VVTA 3JTPA 3CEDA 3U02A 1FKOB 4OI1A 4GKJF 2R7RA 1IKVA 5KFOA 2Q3PA 1TK8A 4G3IA 2GQCA 2KXFA 3E3XA 1N5QA 4HLBA 4OZLA 2ZM6J 2EFPA 4LR7A 3CDUA 2E2HK 2I5JA 5IT9Y 1RTDA 4M5KA 1S6PB 4NLXA 4WE1B 3ZZRA 4A8OA 2DRBA 1K73T 3N3YA 4DSFA 5DO2A 4QWDA 3CE8A 2F8MA 1Z4UA 5M3FK 4XPCA 1PBAA 3W63A 3FBCA 4ELUA 4C2MC 3TZZA 2LEAA 1VRUA 3PW7A 4K4WA 3C16A 5HAOA 4JV5F 2G9OA 2SXLA 2FJXA 1RAFB 3PW5A 5L8RC 5K20B 1AW0A 2KVQE 2CPXA 2Z58B 2ZHAA 4M95A 2OPPA 2DY9A 4USKA 3NG8A 4WYWA 1S1VA 1U1LA 2DXEA 1ZYRA 3RZOK 1J5OA 1X4FA 2Q66A 5BJRA 2UU9J 2BW2A 1XZQA 5IFMA 1YHQS 4UY85 1KP6A 3BPSP 1N33J 1Y0HA 1Y1VK 1IBKJ 2MZJA 2A0FB 2F4VJ 2OPSB 1GK8A 2IY5B 4ZP7A 3OL7A 3C14A 3KTQA 2OD6A 1BS2A 2CKWA 4W92B 1RT7B 5A8WA 3S6EA 3GYXB 3PEJA 3PTWA 3MUTP 4K7QA 2AKWB 1B70B 3D67A 5C24B 4YY3F 1C1BA 3CCQS 2Y3YA 1S1VB 1IBAA 1UAWA 8RUCA 3MTJA 3CCVS 3KK2A 3R7BB 4ERDA 2BKNA 2G0IA 4NZ6A 2GSNA 3M2RB 5DGAA 1QTMA 2M0GB 2EFQA 2IM0A 3F56A 2BBEA 3DXSX 3M2UB 4DR5J 2ZVIA 1LV5A 4H4MB 2WONA 2FQOA 2CNNB 2JX2A 1U4BA 1LK7A 1JJHA 4EZ9A 4XSXA 3H0GC 2HLUA 4EEYA 1PKUA 2O3DA 2KRBA 1ZOTA 3FBEA 3GV8B 2ZHOA 1X4AA 2RKIA 1WC5A 1HI8A 2R9LA 3PO2K 3IR7B 2Z57B 3SSSA 2JA6A 3W3SA 4P9SA 2R93A 1QDUB 3AD9C 4P2XA 4PG5A 5DM6Q 2OEKA 1SJFA 3UNGC 5B0BA 4A3FK 3H7HB 1R8BA 2BKOA 3ONQA 1HNVB 2D3O1 2MZSA 5HN0A 3R5DA 1XERA 4L74A 2O5IA 3KUHA 2KM8C 2AYGA 5C42A 4NI2B 5F3ZA 4USVA 4RWWA 2BYCA 2IHR1 3QFWA 2FGCA 4EO6A 2EVZA 3PO2C 3W5YA 3HHLB 2DGQA 4UTGA 2VOOA 2NXJA 5IT0A 1RTDB 3AXMA 3OQ2A 4ZVSB 4GVBA 3G4AA 5AT1B 2RS8A 2ZDPA 2N82B 1D9DA 4FPIA 1P8GA 1W7WA 5AXNA 4TNOA 3LAJA 3P5TL 2XMVA 3U1LA 1QSSA 3K7AK 1G51A 1SC4B 3E01A 1FDNA 4BXXC 4YR3A 3KK1B 1SFOK 4IKAA 2MDAA 3MFIA 2VFUA 5E68A 3LP1A 1PO6A 2FZCB 4AFFA 4J9OA 3HMJG 4EMDA 2HFVA 1SC6A 4DQSA 3LTOA 2ILYA 1I1GA 1VGYA 1VQ5S 4LIRA 2BUNA 3IO1A 2W9BA 4PQUB 2V6UA 4JV5J 1WOSA 3BO2A 4NYZA 3R2CJ 4UOFA 3NAIA 3H20A 4B9MA 2OJ3A 4F4YA 1U49A 1OS5A 5FLMK 5G0RB 4KC6A 3I87A 2B3TB 2NVYK 4JI0F 2J5AA 5C2GA 3AH6A 4DL6A 2W24A 2CNOB 1T0TV 1Y00A 2I2YA 4DS5A 2NVYC 2GJIA 2K3IA 1S7IA 4ID5B 1RCXB 3CC7S 1BXNA 2WOMB 1HNXF 1U02A 4PEOA 3SFUA 5JVGQ 4G7OA 5GAGU 4TU7A 4B3RF 5KFWA 5KFFA 2HS3A 3ZTPA 4ED0A 2MSSA 3G9CA 4DCJB 2R2UA 3M9NB 1HA1A 4ENOA 4C0HA 3KLVA 5KT6A 3KK3A 2L9WA 1NZ8A 1LNQA 4ZCIA 2UXCJ 1AUSL 1W26A 2EFOA 3KJNB 5C7PA 2D69A 3FMBA 4FS2A 4CZCA 1XR7A 5GAGI 2FPHX 2M52A 3VAHA 4IR1A 1EFWA 6AT1B 3UD5A 4QR0A 2VL1A 1SB6A 4YB5A 3T6JA 1AUDA 2F9DA 4QJVA 3MPYA 1M5HA 2CPHA 3Q89A 3NGTA 3DLJA 4OI6A 3OTOF 3PJWA 5EGEA 3HD1A 2MGZA 2HZCA 1YDLA 2N3LA 2JA7C 4G1IA 1I3QA 4Q8FA 1G3OA 4ECWA 4LUBA 2KG0A 3M6UA 2XMTA 1HQEA 2IRYA 1SFOA 2R92C 3I5BA 5ETNA 3BSAA 2CPDA 2DCLA 2HQ3A 4RNMA 1Q79A 3ZC4A 4LF9F 2L9DA 4RWXA 1TWHK 2E5JA 2IM2A 1TU0B 4FPRA 2B5JB 1OQ3A 4JI5F 1JQGA 3OD2A 4AYBL 2QA4S 4DG1B 4GO5X 3D0IE 4ELTA 1D8YA 2E2IC 2KJVA 2VQEJ 3CPWR 3OHAA 2QN6B 3NAHA 2VQFJ 3HT0A 4PRFA 2R7ZC 3H40A 3EPGA 2C2OB 1KR4A 5J2MB 1N32F 1RT5B 4ITSA 2HQCA 3F41A 4NCGA 3H90A 4CNYA 4DQIA 1S72S 1HIYA 3OTCA 1T02A 3D66A 4F0MA 4V1Ak 3PG9A 1FE4A 1IKWA 1TL1A 2J0SD 2W7VA 1FK9B 3VAJA 4I67A 3GU0A 2W9AA 4ID5A 3FEYB 1JVIA 3CQZC 1XXCA 1VBYA 2DIUA 4XAKA 1HBMB 3R1LA 1UETA 2HHPA 3DLGA 2K1RB 3GTGC 3PX6A 5IV4A 3CJ2A 4X64F 3UFCX 1JXVA 1TK0A 1ZM9A 4B3RJ 2NVXA 3M4OK 4DSEA 3QLHB 4YG2A 1SH0A 2A18A 2LQJA 3I4HX 5CYMB 3B4DA 2DO4A 2HHHJ 4B9UA 3T00A 3VGVA 2E7XA 4URSA 4ECRA 4J9SA 3AJ1A 3MM9A 1YBUA 2IPOB 1RACB 3MI7X 3W2WB 1S48A 1YBTA 1WDTA 4FF4A 1VQ4S 5G4DA 5K14B 2V94A 2P9EA 3JSYA 4Y6IA 3RUBL 2I9SA 3IG1A 4RW7B 4K50A 3FFIA 1S6UA 1XJWB 4EBDA 1SQFA 4B08A 5A2QU 1KHVA 3J81U 4A3CK 2OPPB 4WYLA 2V4JB 2RF2A 2H5EA 5IORA 2YH1A 1YKWA 1F9NA 4KB7A 4QYZJ 2J6SA 2C3UA 2IBOA 2BA9A 2KFZA 4EUVA 2HNZB 3R6GB 5F8NA 1ZPWX 1XTZA 1T9WA 2OTJS 2YPYA 2XLJA 2OI2A 3VA7A 3VV2B 2RILA 1RABB 3R3TA 5CYQA 3I4PA 5KFQA 1S76D 3MPUB 4RU9A 3AY0A 5EN1A 4F3MA 1SQGA 1AROP 3G6ES 3I4NK 1X5TA 2W4DA 3C14B 1H2VZ 4J9NA 3NOGA 4DR6J 3L4KA 1D9AA 3OL8A 3MCMA 4H4KC 1RP5A 5CD4A 2QFIA 3KWMA 2MKIA 3S1QK 2WHOA 3LW5C 4KM8A 1FJGJ 4C45A 1HQMA 5DGBA 1N88A 2CYYA 2IRUA 2VQEF 5HP1B 2N4DA 4CQ1A 5E33A 3W7BA 3HX9A 3AXKA 1NM2A 3GMGA 1RWOB 1V5IB 3W62A 3ZO7A 1ISEA 4DQQA 2EPIA 4DV1J 2IVMA 2E2IK 1OPZA 1Q5VA 1TTHB 2C22A 3N6MA 2HGMA 4ALZA 1RDRA 4G6VB 2DPJA 2EFGA 4X4TA 4TKTA 1R3NA 4OYIA 4LR2A 1C0UB 3DRPA 2BM0A 2Y0SD 2P9GA 3A13A 2ZJPQ 1L3VA 4OI4A 1OY9A 4A3EC 4TLQA 2DGXA 3T1AA 1TUWA 2DGSA 1FI4A 2H5JB 3KLFB 4P74A 3RZAA 4DF8A 2JSXA 1JIHA 4OIXA 5CYMA 5FJ4A 4JV1A 4U6PA 3D9BA 3FQKA 2VDIA 2DR7A 3US5A 3HOXK 2KHDA 1KTVA 2ASDA 1X0FA 3ERED 2G2YA 3K5OA 5HVFA 2V0NA 2DHHA 1UW4A 3KLHA 1KSPA 1U1RA 3VR1A 2GO9A 2XMUA 1IM6A 4DV4F 2VA2A 1QE1A 4UOGA 4RW6B 1S79A 4X62F 1TWHA 4USJC 1WJ9A 1B4SA 3CC4S 1U8SA 1UVMA 5M2UA 1NK0A 2LFVA 3BGOP 5KFGA 2R3VA 2DEIA 4O44B 1I6HC 3I5AA 4OIRA 4AH6A 3SQGB 5IP7C 2LECA 1Y5IB 4ZS6A 2QG9B 1CBKA 2PI4A 2P8TA 1JJCB 4A3KC 2BJ1A 4LBHA 1QE1B 2X1BA 3BYRA 1NXIA 1RT2A 2RDDA 4GTDA 2OEMA 1NMEB 1F1BB 3GTLK 3UCUP 1YIJS 1TR0A 5EX0A 1S1XB 3BB5A 3HFKA 1RAAB 4RW6A 3SZYA 1N54B 3GP9A 2HIYA 5JXSA 1HBMA 1FCAA 2B0GA 4I4BA 4DL0C 2BE7D 4MYTA 4DSLA 1RAIB 3W65A 1ZH5A 4DV5J 4WFNQ 1X5SA 2FVSA 5D0EA 1UZHA 3Q8SB 4TYBA 4ECZA 3GEHA 3FEXB 4RR5A 3PHTA 4ZVHA 2P8IA 4KN7A 3MEEB 3C46A 2NVQC 2VV5A 3CNQP 1X5PA 5DLGA 4ZVUB 3HJVA 3A3PB 5CD4H 1G2EA 2LEPA 4ZCKA 1I50C 3KHLA 1TL3A 3BBCA 1X8DA 2HQIA 3HOWC 1YI2S 4EO8A 4BBSC 4DV6J 1SL1A 3HHEA 1H2TZ 2IDEA 2EFVA 3U1MA 1VBXA 2RH6A 3RB6A 2YNGA 4CLLA 2RS2A 4ANCA 1WACA 4OX8A 2QMXA 5EGYA 4IFYB 2CJKA 2AJ0A 3R1HA 5IYBC 1IKXA 1UEKA 2Q43A 3S0XA 3NEKA 3BKFA 2QYGA 2ZBRA 5DQGA 2D9OA 1OSCA 2AW0A 5HANA 2MSTA 4LRFA 1SKSA 1CPZA 3GYGA 1S4EA 2HFZA 1KN6A 3U1NA 2JC1A 1LWEA 2WVBA 3HSDA 1FDBA 2CWKA 2CQGA 4HHUA 3OVAA 4NA2A 5E2QA 3FHZA 3THVA 3FCHA 3T41A 1CJKA 1BGXT 2W7PA 2AEMA 3GJSB 1XNQJ 3TFJA 1YJVA 3CD7A 3GYNA 1S1TA 4RW9B 4YR2A 2XS2A 2JJ4D 3S1TA 1ZETA 4WP3A 1BWVA 4ZPTR 1LFWA 2AX0A 3FRZA 1ZVUA 4OZJA 4A47A 2R93K 3AJDA 3CC2S 5A6WA 3GTPA 3QO9B 4CTAA 4V19J 5DM7Q 1WG4A 3M7VA 4EGLA 1MLAA 3I5CA 2BQUA 1N0UA 3J7ZT 3HSGA 4RW7A 1FJEB 1TWGK 1WCMA 4J3NA 1WQFA 3OT9A 2R4FA 4CM0A 1NAQA 4F4ZA 2E2HC 3O6QA 2XB2D 1S9EB 2GVDA 2UXDJ 2FHOB 3A8EA 1CJTA 5KG5A 4CCHA 1S59A 4LF6F 1UVLA 4J9RA 4IO1A 1RA6A 1SC3B 5IC4B 5C42B 1WG1A 1S1WA 2R42A 3UD4P 4O0NA 3KMSA 1GFWB 4QBUA 4Q0BA 2HSEB 2JNJA 3DM2A 4ZHRB 1M5KC 2ZE2B 2HWTA 2Y0SL 3PKYA 2QLXA 3DMJB 4MIBA 2BABA 3AA8A 3KXDA 5H9FK 3L4JA 2CWXA 1FRKA 1Y7PA 2HIQA 2PI5A 4M1XA 2PMWA 1WOPA 4USTA 3PW0A 1Y1VA 3T9NA 3MMAB 5HROA 2DB1A 1QVGR 5KFTA 3SEOA 2FB0A 3TVKA 3MTKA 1Y3JA 2YWWA 3M1VA 3T1YJ 3CJKA 4BC9A 4LLGA 3IPJA 3GCWP 3MM9B 2FZKB 1IKVB 2R7ZK 4RW4A 4KHPJ 4QWAA 4C11B 2QC3A 1Q4RA 1TAUA 2LXIA 4DR5F 4K5SA 2VFSA 1S1UB 3TUZC 5B08A 3PFEA 3BREA 1WCMK 2F40A 1XN9A 1TL4A 1MROA 4YQWA 1WHYA 3SI8A 2B5JA 2Q6BA 2YX1A 2RH3A 3PYGA 3R6LB 3TOQA 1CJVA 5AXMA 2DVIA 1VIOA 2HZAA 3FK4A 1UW9A 2P5VA 4NYOA 4ZDNA 5GVQA 1FKAF 1R6VA 3I96A 3TA1A 1S9GB 4XTTA 5LSOA 1O0PA 3RW6A 4KKOA 3GEEA 4GFQA 9ATCB 4QIGA 2MGZB 1RU0A 3BGRB 2H3EB 3OXLA 1VHFA 2HS0A 4O4GB 3NBPA 2MZRA 3BQ2A 3JQKA 4BBSK 2DK2A 1RT5A 3PO5A 3CD0A 3DRSA 1PGZA 2GFFA 4O3QA 4KMUA 5K5MA 4BLBA 3HFVA 4IO9Q 1WC3A 3DKDA 2CPZA 2RD5C 2G0CA 5EUHA 3Q24A 2ACYA 2C2EA 3OFFA 5IYDK 2JVRA 2VIHA 3D1QA 5CXTA 1R7IA 1RT3B 4OI2A 3W9HA 4F50A 1FESA 5B09A 1T05A 1NPRA 4N8NA 4B3SF 2NSBA 1TL7A 2DR9A 3AB2B 3QJPA 4HHJA 1RWPB 1F60B 1RUSA 3W5ZA 1CQMA 3RR7A 2E1MC 3MR5A 3ZXWA 2GIRA 3MEKA 3OXGA 4Y2CA 3H25A 2X1AA 3PJ9A 3RBZA 1FRXA 1BY9A 2L3MA 2V4RA 2YNHA 3GJTB 3GFXA 4O3RA 4FBTA 4Y7NK 5AJ3J 2DR5A 3QAUA 2KI2A 1RHUB 2ILZA 1XZPB 3GIRA 1IBLF 1PBUA 5D4LA 2ACMA 5K8OA 2Q6CA 4DR7J 1ZTTA 1SFOC 2KT3A 3PJXA 1HBOB 4DFMA 2KHCA 3DRRA 3V6HA 1UV7A 1QUVA 5DS7A 5L38A 2RDIA 3PNIA 3SSRA 4A3BK 3SDEB 3OFGA 3GONA 2UUBF 4JI7J 4P2SA 4FXDA 4DUYF 2XO7A 4XPEA 1L0WA 3GFZA 4C3IC 2AGOA 3PFOA 3QYYA 4Q43A 2R7VA 4LREA 1JNZB 4J7CA 3J7A1 5A8RB 1FXRA 1FD2A 4I7FA 4WPAA 4Q4ZA 3NKYA 3VAIA 3N79A 2H51B 2VDHA 5H9EJ 4I2QB 3EVMA 5KT2A 1V3SA 4A8KA 3ILJA 2YY3A 4LOWA 2IDLA 4KATA 5KG7A 2ALYB 1BLUA 3W2VA 3M4XA 4AXJA 1UVJA 4OYAA 3UDEA 2HRUA 3MMLB 3Q8QB 3OUYA 5D0HA 2DEJA 4QYRA 1EARA 3TAPA 3F44A 2FJEB 5ETRA 4NLQA 1KDNA 3T1HJ 1S49A 2NVXC 3TANA 1QJHA 2MHNA 1W25A 5HJYA 4KSEB 4QIEA 1WQGA 1QLNA 1IQ0A 1HI0P 1N5TA 1WUUA 1REVA 2YNIB 3LO3A 3B54A 3BS9A 2XM3A 1WF0A 2CIMA 3S2DC 1UPPA 5JVHQ 1B7YB 3Q86A 3V2UC 4XLPA 4FXVA 2JVOA 4CDIA 3WIVA 2R7WA 4PG8A 3MM6A 4FKXA 3KNGA 4UY8T 2RJZA 3V4GA 3I4NC 5H9EK 1PYSB 2XY6A 4MKAA 1ZZFA 2HNYA 4UQGA 3Q2SC 4MIWA 3BN4A 4MK9A 3C6UB 3OTDA 1MU2B 1WI6A 3CGIA 1M5OC 1I6JA 1VRTB 2PMHA 3VGUA 2DRDA 2Z4PA 2FY1A 1RHQB 4ZVTB 3T1HF 3MAAA 2VUGA 5E0OA 1TKXB 3CULA 2VONA 4H4MA 1NJIT 4M1KA 3CQZK 3S1NK 4KHRA 1ZZNA 4LT6A 4QIVA 4B3OB 3VAGA 1RCOB 3IWNC 2CUYA 1PC4A 1KD1T 5FD1A 4TVAB 2B7BB 2WAQL 3H3VL 2WRMA 1VQSA 2QTWA 2ZUGA 1TWFA 1QVFR 2E9ZA 2R7ZA 1UA0A 3IFEA 4FZBA 4H4KA 4BXXK 1IN0A 1ZA1B 3BEGB 4WJ4A 3IWXA 4U9RA 3DLBA 2KO1A 3M3YC 3H0PA 1PAEX 2B8PA 1S12A 1N56A 3CIMA 2W9BB 5FLXU 1NH7A 2PA8L 1Q5YA 2IMWP 2MJNA 2HBRB 2NREA 2WSCC 2WBMA 5D3GA 2IAJA 2NXNA 4ANEA 4A3KK 1ROFA 2H1YA 3AQOA 5DETA 1NPPA 2YNFA 4R5PA 3EZ5A 3A1YG 1K1SA 2MQLA 3AD7C 1M5SA 1NSKL 2CW0A 1DHMA 2WB1L 3W61A 3RZDC 1Q86T 1RT6A 1S1UA 2NYIA 2WVFA 5KFEA 5KFKA 1S77D 1F2HA 5HMYA 1MWZA 2WVDA 2YX4A 3G2XA 2C2RA 2VBXA 4Q44A 3J7AN 5JMNA 1HQUA 1GE9A 3PHEA 4RPFA 2DHSA 3N01A 3CXCR 4HDHA 4R8UB 2N7CA 1VLYA 1GMWA 1JLQB 4B9TA 4X4VA 1WTBA 2AGQA 4LFBJ 3EE3A 5E41A 1KBRA 2BANA 1SJ4P 5CZXA 2CQ2A 3W2WA 3PO3K 3NNAA 1JLEA 1ZAVA 2AYMA 4JI8J 4PG7A 2AMCB 2ZNYA 4Y00A 3W1YC 4PKDB 2RAQA 1VRTA 1NO8A 2GAGC 1Y5NB 3AJ2A 1EK8A 3S8SA 2A6EA 1WSVA 1DTQA 1X60A 4A4JA 1KFDA 2ZJQQ 2XCOA 1ZQ1C 4OHYA 2UVWA 1EP4A 1W2BR 2JLFA 1MWQA 2HK3A 1RAGB 3M2UA 2C2MB 2OPQB 4DHVA 2BOPA 1DJ0A 3CB4A 5HVGA 2OFGX 3QBCA 3G8SA 1K44A 2RUGA 4U7UD 3H98A 1RWUA 5KFLA 3J7Z5 3HK2A 2BE5A 5D78A 4DPOA 2APOA 2PIIA 2VG5A 4HEA9 4DR3F 1LW0A 1IKYA 1H74A 1OYEA 2N4CA 5L1KA 1J5OB 2KKHA 2ASLA 2GIFA 3KLGA 1TL3B 4Y34A 5IZHA 4O44A 4RUBA 1RHMB 5C44K 4BWMA 3CJ5A 4PABA 2ZBCA 4X4NA 3HP6A 2R92A 1F6TA 5C44C 4BBRK 3CO0P 5DDRC 2QLWA 2B9XA 2KVIA 4KGMA 1TKZA 1VFJA 3VQSA 4LF1A 2WTFA 1B0TA 4FNHA 1Q8LA 5B0GA 1UJ6A 4KFBA 3HI9A 3CJ4A 1TKDA 1C2PA 3GV7B 4C3JK 4RMFA 2HHXA 1FTCA 1YZ7A 2HFOA 3GPAA 1WEXA 3QIPB 3CQZA 4L3NA 4I2PB 3EVOA 4KMDA 1U48A 2F8EX 3RTVA 1JLFA 1GMWD 3VGTA 1I94F 1BMQB 3EDQB 4M5LA 2JOQA 2WB4A 1JK9B 4MKVA 1TL7B 3VALA 4RNFA 4B3MF 3MCOA 4DV3F 1R8AA 1NB2A 3K89A 4RW8B 5C3EC 1EKSA 1QAIA 3QIDA 4M5HA 2HYIB 4YHHJ 2IA0A 4JYAF 4CLSA 3B82A 2XCRB 4WXWA 2KB2A 1HNVA 4F3QA 2ZH1A 4LFBF 2CG4A 2FVPA 4DFJA 1S6QA 3CJQA 4NXMF 1UMJA 5TMCA 2M8HA 2F4VF 2LCWA 4IUFA 2QO3A 3HHLA 4LBPA 1JLFB 5KFJA 4RLEA 4X4SA 3TJAA 4ZP9A 5DJBA 1FJCA 2FVQA 2F65A 2YU9A 3NGRA 1ZBSA 1TKTB 1OYDA 4DV6F 1TMJA 4ELVA 1H6KX 3AODA 3SQGA 5A6PA 2R8IA 4YDDB 2CNLB 3PZPA 1SJRA 4I2PA 1T9TA 2J9EA 2IAJB 3QJLA 5KT7A 1X4CA 1TZ0A 4LSNB 4F26A 2H5IB 3RYLA 1CS4A 1Q1KA 4F02A 1HARA 1X5OA 2OSQA 2V69A 3T6BA 2XCQA 1A7GE 3BSOA 1IE0A 1X4DA 1AFIA 4HDGA 7FDRA 1OSDA 3QRRA 1D0EA 3GQCA 5IWAJ 2A2CA 2MQQA 4DMZA 3FSIA 1FFSB 2DGUA 4FDFA 2BQRA 3HVRA 3G82B 2HQDA 1T95A 3ENWA 2ZUEA 4F7VA 3W8GA 3RAMA 2E2IA 5L1JA 4CH0S 3IR5B 1NJWA 2VG5B 3BBBA 4DL2A 4BDPA 4KV8A 1QSYA 3ZFVA 1HWIA 2UV8A 4UOHA 3DN9A 2GVZB 2KXNB 1HMVB 5LM7E 1SIWB 2PA8D 1PYOB 1SI9A 1BE4A 2XLIA 4GRSA 1VRUB 4O0IA 3MMCB 4JUZA 3T9ZA 3P8BB 2V8HA 3FJ2A 3J7YU 4A8FA 3EM1A 4URQU 5CABA 1B7FA 1F9FA 3GTLC 5HP1A 4GTLA 3S2HC 2GHWA 3H3VD 1JLEB 1VQ7S 4FYDA 1Q95G 4QIWL 4R5PB 1F3VA 3HM9A 2IRXA 4U8VA 5B0EA 2J6UA 4WFBQ 3HHLD 2WSFC 2KH9A 3GTQK 5M5YK 3TUIC 2JA5K 2HWIA 4JI6F 5BYRA 2CDQA 2CPIA 4FYVB 2HHUA 4C8KA 2DCUB 3IGVA 5K8MA 4ZVGA 4X66F 1WC1A 4N8OA 4CYUB 1NK7A 1EHWA 2HVIA 5CYQB 3OEPA 3CJKB 1T11A 2OMOA 3V81B 3UNYA 4KGXB 3S15K 2M4MA 2UUAJ 4DUTA 2MQOA 3MOZA 1C0TA 3D2WA 4LRDA 3UQSA 2QMUB 2DHGA 1IXKA 8ATCB 3LWMA 1WKKA 2KJWA 4A3MC 2GZOA 2BRKA 1S9EA 2HNDA 3IG1B 3GTJK 2HMIB 5GADU 2ZOMA 4U7UK 2D3ZA 4CTAB 1WKLA 5CH7B 4ZVRB 1YRXA 3AOCA 4MFBA 4OQJA 5T14A 2LQ8A 1N32J 2VICA 4O2DA 2P6TA 1ITPA 2J9DE 2VG6B 4M5GA 1WEZA 2ZHBA 2FHMA 1RWXB 2RMLA 3DM2B 4CLYA 4NCGB 2GJ2A 1RXOB 1BQXA 1VJQA 3IP0A 1KHWA 3LAKA 3DRRB 2CJXB 4ZVPB 4YFXA 2BDPA 2B63A 2CQBA 2EG1A 1Y5LB 2OTLS 1WC0A 1C1BB 1MG7A 1ZTWA 3T01A 2R8GA 2YWFA 1LWCB 1Q0NA 4KC5A 1FRMA 2LA6A 4A46A 1RSCA 4R25A 1YLXA 4NYPA 2D3OR 1S0MA 3MM7A 1TKXA 4G7ZA 2K7JA 1NK9A 1NCLA 1HMVA 2ZH5A 4W98A 2XS5A 2G2OA 1U26A 2KU7A 2R7QA 4P5AA 2AZ3A 4LQYA 2V6SA 2KG1A 1WHVA 2HFNA 2CZ9A 1X4BA 5ETSA 4A8XA 5HSPA 1U0HA 4CO1A 9RUBA 3H0GA 3HVAA 4NMLA 4UUXA 2CA9A 4GO7X 3C8YA 5CAAA 3W66A 2DJWA 5KG4A 5KFIA 2JA6C 3NGKA 4FS1A 3GTMC 5AE3A 1CQNA 2JDJA 2NZ4A 2QEXS 5A8KB 3OSPA 3MM5B 4NPOA 2CDRB 4OZNA 4WE1A 5H9FJ 1FRLA 2VHGA 2AX1A 1A6LA 5JUMA 1JLQA 2KZMA 3EGNA 1UPMB 4I6AA 4JI4J 3OVBA 1VBKA 2EG2A 1X7VA 2JZ5A 2D41A 3BZQA 2HURA 2QYCA 5HMXA 3H2VE 4CRJA 3NCRA 1D9FA 3AOAA 5IT9U 1XEZA 4RKUC 4RNNA 3UN3A 4LQ3A 2YH0A 4QU6A 1HHQA 4QZVB 2ZKUA 1MMDA 5C2CA 5CYJA 2MTLA 2ZD1B 2ZVSA 4S0MA 4NLVA 2XZDB 3CSKA 4QWBA 1WCMC 3EXCX 1HFEL 1FDAA 1HBOA 2H48B 2U2FA 3BH6B 4I7FB 8AT1B 4MKBA 1Q81T 4ILMA 3GTPC 2C3PA 4M5MA 3GTKC 2BACA 3DRYA 1RI7A 1WG5A 4BWJA 3SDEA 1PAUB 4B9LA 3MEEA 1RYSA 1WD6A 1HNWJ 3W60A 2QGFB 1H3DA 1EETA 1FDDA 4CLWA 2XCPA 2XI3A 2XWXA 1S0OA 2GGPA 4YUDA 1ZS6A 3MR2A 4OZ0A 2BMBA 2B51A 4ED3A 5FLXY 3FSYA 4ED6A 1U1PA 2BV3A 3ELHA 2OKQA 1OPIA 1IBLJ 1TP7A 4A3DC 1EH1A 1M1KT 4N5SA 3NL0A 1TK5A 4B3OA 1DARA 3L95X 2CG8A 2CJQA 4CWBA 2VH7A 4DCPB 4HL9A 4GKKF 4W90B 1S1XA 3HOVC 1VDHA 4MKYA 3T5HA 4DL4A 4OV1A 5D8HB 2HKEA 4JI1F 3NNCA 4K0KF 1SJ1A 4X4UA 4RO0A 4A3IC 3I56S 2J7KA 1FKPA 1KOOA 2NS1B 3CCWA 5MLCV 3H8YA 4JI7F 1APSA 3S1MC 1JOEA 3AT1B 4ED1A 1JKHB 3CCMS 3KLHB 1S9GA 3ZZ0A 1SL2A 1K8AT 2Z2LA 1WOOA 4G0UA 1M1GA 1YNNA 1U25A 2CPFA 3DLLQ 4X65F 2YKMB 2OPQA 4KY3A 1NSQA 4A3JC 3HULA 2FC8A 4DR6F 1M90T 4ZJQA 2QA1A 4IG3A 4O3PA 4NLTA 1G7CB 1HW8A 1VQMS 4DS4A 1N48A 4NLDA 4DR4J 1YJRA 2OMLA 5F8JA 2HG4A 2FIUA 2GHPA 3GTMK 3T19A 3C19A 3LH2S 5KT5A 5K8PA 2CXEA 4YR0A 5LSRA 4NLOA 5A0YB 3NMAA 2L48A 4LVNP 2MQMA 3WHIA 1B4AA 4CT9A 3BR9A 1IBCB 1SC1B 3E51A 3M9OB 4Y7NC 4D3HA 4I0WA 5D4NA 4ECUA 4KH0B 5KFVA 4Y52C 1DTQB 2DPIA 1F9HA 5GADI 3N6NA 1C0UA 2MKHA 2NPFA 3RBXA 1S10A 4QIFA 1IM4A 3TVYA 2BXJA 3D3CJ 5HL8A 2ZM6F 3ENQA 5D6GA 4ZLLA 3S1MK 1Y3KA 1XNRJ 4F8RA 5DLFA 1GMVA 4ICLA 3NCQA 3GE9A 1FRIA 4QPXA 2IJRA 2ZZMA 3HKWA 5F9NA 4LF8F 1DY3A 2JFDA 3LF0A 3N0BA 1FNXH 4FVMA 4CT8A 3AB4B 1NKCA 2PDAA 2IM1A 1KRPA
chains in the Genus database with same CATH topology
1XZPB 3A8JA 3GSIA 1PJ6A 1PJ5A 3A8KA 1WOPA 3AD7C 1WOSA 1YX2A 3GIRA 1X31C 3GEHA 1WOOA 1WSRA 3TFIA 1VRQC 1XZQA 3A8IA 3TFHA 1V5VA 2GAGC 5L46A 3AD8C 4P9SA 3TFJA 1PJ7A 1VLOA 3GEEA 3TTGA 1WORA 3AD9C 2GAHC 1WSVA 3GEIA 3ADAC 1XZQB 4PABA 4PAAA 1XZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZP B;  3A8J A;  3GSI A;  1PJ6 A;  1PJ5 A;  3A8K A;  1WOP A;  3AD7 C;  1WOS A;  1YX2 A;  3GIR A;  1X31 C;  3GEH A;  1WOO A;  1WSR A;  3TFI A;  1VRQ C;  1XZQ A;  3A8I A;  3TFH A;  1V5V A;  2GAG C;  5L46 A;  3AD8 C;  4P9S A;  3TFJ A;  1PJ7 A;  1VLO A;  3GEE A;  3TTG A;  1WOR A;  3AD9 C;  2GAH C;  1WSV A;  3GEI A;  3ADA C;  1XZQ B;  4PAB A;  4PAA A;  1XZP A; 
#chains in the Genus database with same CATH topology
 2MXY A;  1RT1 B;  4P75 A;  3LAP A;  1FEE A;  1WWH A;  3KG0 A;  4URG A;  3D6F B;  5KFC A;  2D6F C;  1M1H A;  3MM7 B;  5T41 A;  1EKR A;  2K1R A;  3CJS A;  4J90 A;  1ICE B;  2UUW A;  1C0A A;  2J9C A;  1DBD A;  2CQP A;  3DU6 A;  2DNL A;  3TZW A;  2CVE A;  3HHD A;  2WW4 A;  3WZ0 A;  1KEK A;  4HI2 A;  2IFX A;  4DU7 A;  3CO9 A;  5IYC K;  2W01 A;  4Y0F A;  1EQM A;  3EGZ A;  4ZN3 A;  3A3O B;  3J7Y I;  4ILD A;  4L6V 3;  1LQ9 A;  1TWC A;  2BRL A;  5IOS A;  4IQM A;  2V2Z A;  2W2P P;  3SCJ E;  2MZT A;  2M2B A;  2RRN A;  4LMZ A;  1XIQ A;  1LWX A;  2C3O A;  3VCD A;  3IXQ A;  2J8S A;  2RIJ A;  5DQI A;  2IBK A;  2FHJ A;  3JQJ A;  4IH6 A;  2RE1 A;  4DOZ A;  2DYA A;  5CCM A;  3PIP Q;  4OV6 A;  5DDP C;  5DG7 A;  1CJK B;  1RWW B;  4MK8 A;  1M5V C;  2ZH2 A;  1N33 F;  5ETP A;  4CI0 B;  3O8W A;  1I50 A;  2G1D A;  4DR7 F;  4Q2M A;  2FVR A;  4I56 A;  3G6Y A;  2E1P A;  3ZZP A;  1QAJ A;  2IIH A;  2AP6 A;  1H73 A;  1NKE A;  4YFK A;  4PXC A;  4PCQ A;  4F4W A;  1EET B;  3TW0 A;  4C97 A;  2B8Q A;  3IRX B;  4E2F B;  1HR0 F;  3FGV A;  3S14 C;  2CQD A;  4ZLN A;  4HAC B;  1DUR A;  1OY8 A;  3GSI A;  1PJ6 A;  3E2E A;  2XZT B;  2GSO A;  4ZJL A;  5HMW A;  2B43 A;  1VMB A;  5BYS A;  1TWA K;  1SH2 A;  5KT3 A;  2OPR B;  1F7U A;  3S01 A;  4GZY A;  2EK1 A;  2VPX B;  2V6A A;  2WSE C;  5CCL A;  2YWG A;  2E1A A;  1VIS A;  2P5M A;  3QGP A;  5THW A;  1H7W A;  2EFN A;  2PEB A;  1FO1 A;  3QAE A;  4GTC A;  1NK8 A;  3FKI A;  3MPW A;  1R8P A;  4DG1 A;  1E6Y A;  3KG4 A;  1HPZ B;  2LYV A;  2XYG B;  4LR8 A;  3A8K A;  2R8K A;  1JMT A;  1NK6 A;  3V6D B;  4C7Q A;  5LOQ A;  5LSL A;  4ZVE A;  4Y52 K;  3IC1 A;  1TWF K;  2EI5 A;  2XI2 A;  4YS2 A;  4MQ9 A;  4QYZ K;  2ZBQ A;  2N7Y A;  2EBE A;  3CT9 A;  1DQ9 A;  1YRU A;  5IWA F;  4LF7 F;  2GMJ A;  4JOU A;  2VBZ A;  3ZTS A;  1IVZ A;  2E7V A;  3HZG A;  1U1Q A;  4IR9 A;  1GX5 A;  2ZOF A;  4PAA A;  1HBU B;  4J9Q A;  5IYD C;  3QMQ A;  1RA7 A;  5IM0 A;  1YX2 A;  2GA7 A;  2UVR A;  2A6O A;  3DHX A;  4DR1 F;  2YWH A;  4KAW X;  1R0A A;  4U8Y A;  1R0B G;  2BJ3 A;  2Y1R I;  4TU9 A;  3FBF A;  4FP9 A;  4AE5 A;  1URN A;  2WBR A;  4KO0 B;  3ZZO A;  3LQV A;  4UZB A;  1FXD A;  1UWA A;  4C8O A;  4HAC A;  2DNO A;  3ZZY A;  3QPI A;  3MFH A;  2C3M A;  3FKI K;  4DN9 A;  4ZMM A;  4X4Q A;  3EPI A;  5D4D A;  1U45 A;  3I0S B;  2HHT A;  4L75 A;  1Y11 A;  3GTG K;  5GAH U;  2BM1 A;  2YBV A;  5HJX A;  4NE9 C;  4ZPV R;  5LMN J;  2DNR A;  3GTO K;  5ETL A;  3GTQ C;  5M3M K;  4OX9 J;  2HVE A;  2XG8 A;  4FYW B;  3UVJ B;  1HBN A;  2EWH A;  1X0P A;  2RRB A;  3BP8 C;  3PKM A;  1FWL A;  5K9F A;  1SVD A;  2W8L A;  3J80 U;  2ZH6 A;  2W9C A;  3K0J A;  4WWS A;  2X1G A;  4OIN A;  1XMQ F;  3HOU C;  4G65 A;  4HH1 A;  1C1C B;  2JRS A;  3MAQ A;  1IW7 A;  2UP1 A;  2BEF A;  2YQ3 A;  1R0C B;  4BY1 K;  4F2R A;  1DTT A;  2JHE A;  3I0S A;  1WEY A;  3DYA A;  5J2P B;  5CA5 A;  3G86 A;  3RGI A;  5I4M A;  1L5U A;  3QGG A;  3KMQ A;  3LP2 B;  3A4T A;  5KFM A;  1F9E B;  3FRY A;  3DXB A;  3T5K A;  2J76 E;  2HMI A;  2AJ1 A;  3KLE A;  2CPY A;  4YB7 A;  4F0K A;  5KG3 A;  4DV7 J;  1SMY A;  3WDO A;  3OW2 R;  4ZK7 M;  3BUE A;  4I64 A;  5HBM A;  1N34 J;  4LF2 A;  3EQL A;  4J9P A;  2VOP A;  1DQA A;  4H4O B;  1IJF B;  2BJ7 A;  4TN2 A;  3EX7 B;  3HOZ K;  4EBC A;  4Q5V A;  2DNP A;  3G87 A;  1F5B A;  1LXN A;  4WTO B;  2RDJ A;  3HSJ A;  1JXE A;  4MJK A;  4MIA A;  4K2J A;  3UR0 A;  3NBP B;  2PT0 A;  2E29 A;  3DU5 A;  1QAY A;  3KG1 A;  4XK8 C;  4FF1 A;  2A69 A;  4LVO P;  1YRT A;  2GQ2 A;  1B0P A;  2AYB A;  2W4P A;  4JV2 A;  4DV2 F;  3M30 A;  2JA8 C;  4WFX A;  1OJ4 A;  2BVZ A;  4JI2 J;  4OYB A;  3CW2 C;  4CLU A;  2W2M P;  4KDD A;  1E6Y B;  2ZJR Q;  4CH7 A;  2E2J K;  3MMA A;  1ZAW A;  1DZ5 A;  1VOM A;  4ES1 A;  2ADB A;  2JL9 A;  2VBW A;  3R27 A;  1NKB A;  2IYG A;  4NLR A;  4LF8 J;  3BYP A;  4JI1 J;  1HNI A;  1VR6 A;  2BQ3 A;  4DSJ A;  1U0S A;  3R9L A;  1R6Y A;  2KYX A;  3AFG A;  4NZ7 A;  4ZHR A;  4YFN A;  2W2O P;  1NDL A;  5EWG A;  3WBZ A;  3S17 K;  2RF2 B;  2NZC A;  4P71 A;  4DLG A;  4IDK A;  1JQW A;  3EXY A;  3GZ7 A;  1ACM B;  3ZNJ 1;  4A48 A;  3MR7 A;  1O8B A;  1FER A;  1J5E F;  2JA5 A;  2V9K A;  4F2S A;  4ES2 A;  2YKM A;  4D3G A;  2R8J A;  3MED A;  3N5F A;  4AXI A;  2DRA A;  1IWG A;  3ENA A;  4I69 A;  4Y28 C;  2G0J A;  2FJD B;  1EP4 B;  3J81 Y;  5I3P A;  2YQ0 A;  4ZVQ B;  4EYH B;  2E1C A;  4IG3 B;  3OJU A;  3NS6 A;  1Z2L A;  2D1C A;  4DX6 A;  2D9P A;  3AOB A;  2MHE A;  3BKU A;  1ZYQ A;  4LSN A;  3RW7 A;  2MEW A;  2QL5 B;  4KPY A;  4UF4 A;  3GV5 B;  1DCO A;  2IJF A;  3DYA B;  1XPP A;  4X4O A;  2IM3 A;  1QD1 A;  4KV8 B;  4V19 X;  5HQM A;  2RU3 A;  3EZU A;  2O5D A;  2OGU A;  4ZVF A;  2XGP A;  1TKT A;  2E2H A;  3CCZ A;  4DR3 J;  4Q8E A;  3GFH A;  2ZDO A;  5F3T A;  1QTN B;  1T9X A;  2CQ0 A;  1U6B A;  1K0V A;  4ZH4 A;  1GXU A;  2ZEJ A;  3OXF A;  1P1T A;  1KFS A;  3GFY A;  3N4W A;  3KHH A;  4I1T A;  1XZP A;  5T7L B;  3UPF A;  1WDD A;  5CJ9 A;  2E5G A;  5J2M A;  4OHX A;  2K7K A;  1DD5 A;  1S99 A;  4R0J A;  5BYQ A;  4E0D A;  4A8M P;  4IYQ A;  2IYI A;  3Q2T C;  4KMA A;  2IMO A;  2OH2 A;  3EUN A;  4J9L A;  2QA2 A;  1WNE A;  2CRL A;  4F4A A;  4PUO B;  1RK8 A;  5D0G A;  3IS9 B;  1TL5 A;  1ZM4 A;  5HVH A;  3TR5 A;  1N8R T;  3VTI A;  1P9Q C;  1RJJ A;  3OV7 A;  1XMB A;  3RG6 A;  1RTH A;  2FDN A;  5D3G B;  4K2X A;  2VFV A;  3HLU A;  3OHB A;  5FLM C;  2OIH A;  1WC6 A;  5L46 A;  2M70 A;  3KHR A;  2K2P A;  5J2Q A;  1OWX A;  1B0V A;  3M32 B;  5CQG A;  2IVF B;  1IBM J;  4OHV A;  4F67 A;  1I3Q K;  1S0V A;  2J0X A;  2V2K A;  5GAH I;  4DV2 J;  3CCS S;  3HO1 A;  3BP3 A;  3RRK A;  3S2H K;  2BAN B;  1Q82 T;  2E5L J;  3CCJ S;  3TA0 A;  1GNK A;  3M8Q A;  4M8L A;  3ET6 A;  3DLH A;  1MNE A;  3IGN A;  1P9Y A;  4IQX A;  2ZD1 A;  3CTR A;  2LDI A;  1IS1 A;  2MPU A;  1F93 A;  1RTH B;  5EWE A;  1XC9 A;  1KNZ A;  1S6O A;  3M8Q B;  4WIL A;  4KE5 A;  2M9K A;  1HNZ F;  4ZIW A;  4ER8 A;  4KHP F;  1IKY B;  3JXO A;  1VC6 A;  2I8E A;  1GEH A;  3WIU A;  4CP5 A;  4LF4 F;  5GAE U;  4WCE Q;  2DBB A;  2V8D A;  2QZ8 A;  1RTI A;  5IOT A;  3NGD A;  2WOM A;  1YZ6 A;  4LBI A;  5FDL B;  2JWN A;  2J6T A;  4LIW A;  1RYR A;  4KN4 A;  5IC6 B;  5L1I A;  4C11 A;  4O3N A;  3KJV B;  1S97 A;  4RW4 B;  2FQQ B;  1LWF A;  4J9V A;  5LMN F;  2ZFZ A;  4NXN F;  1RHJ B;  1I3O B;  2F7V A;  1JLC A;  1IR2 A;  5D15 A;  4MYU A;  5IXU A;  2ROP A;  4QW8 A;  3KJQ B;  1EAY C;  2ATC B;  3KYL A;  5I3U B;  3CUN A;  5IT4 A;  4G1Q B;  2I0X A;  1JX4 A;  2YWE A;  3SQO P;  2Y1I A;  3HOU K;  1FFG B;  4DPU A;  2EC0 A;  1M0S A;  1RU2 A;  3KK3 B;  1SQE A;  3SCL E;  1D3W A;  1AYE A;  5T7L A;  4BCA A;  1T03 B;  4X2B A;  2F63 A;  2XTJ P;  3BGR A;  1INN A;  4DR1 J;  2DGV A;  1RTJ A;  3V5R A;  4ECT A;  3V4I A;  3H42 A;  1KOH A;  4MAK A;  2ZC3 A;  4LF4 J;  2DTJ A;  1S9F A;  4M5D B;  3IA0 A;  1Z2Z A;  3TAM A;  2P2C B;  1JLA B;  3K7R A;  2YTC A;  3VZH A;  3D28 A;  2FZG B;  3VHQ A;  1BQN B;  1WI8 A;  4M5J A;  1Q7Y T;  4FBU A;  1ZPV A;  3WX8 A;  2HS4 A;  3NRB A;  1RT6 B;  5E5N A;  1NHK L;  4R8U A;  1RT3 A;  2VB6 A;  4WF9 Q;  3TI0 A;  4FVC A;  2NR0 A;  2KZZ A;  4JK1 A;  5IOQ A;  3VAM A;  4W4M A;  4LSL A;  5IS2 A;  1JLG A;  3DOK B;  1J6V A;  4XDD A;  4J5O A;  2AJ2 A;  2DO0 A;  3BDP A;  3C6T A;  2DNZ A;  1FFW B;  3C16 B;  3MEG A;  3WOD A;  2KXH A;  1PIL A;  2JEJ A;  2PGC A;  3G4C A;  1NUE A;  2PMZ L;  1IBM F;  1RT1 A;  1NDK A;  5AE2 A;  1DLO B;  2LLZ A;  4M5N A;  2Z56 B;  4F36 A;  3KHG A;  3KJF B;  5E3A A;  4A8W A;  2MKY A;  4ZPD A;  2ZH4 A;  5F8M A;  3IRW P;  5A0Y A;  5M2P A;  2VKZ G;  3CMQ A;  4ECQ A;  2A2D A;  4C98 A;  4LF9 J;  4O3S A;  1HL6 A;  3L4B C;  1WF2 A;  2YVS A;  1X9S A;  4L73 A;  2MKK A;  4N41 A;  2G2Z A;  2P9C A;  3TZX A;  1JB0 C;  5KFB A;  1X9W A;  3H59 A;  2KFN A;  2B6A B;  1TWC C;  4A3L C;  5D0R A;  3RB3 A;  1B4B A;  2DGT A;  3QSY B;  1CG2 A;  3GTY X;  4OZ5 A;  1VC5 A;  2AD9 A;  1I6V A;  4A3I K;  4LK0 A;  2FLO A;  4YEA A;  3FBB A;  4DWI A;  1MU2 A;  3LOU A;  1RB0 A;  4DFK A;  2FJW A;  5KG0 A;  2BZ2 A;  1FVQ A;  1RAO A;  2NLW A;  3ILI A;  4P52 A;  3WC0 A;  1U7L A;  2MQ8 A;  2VPZ B;  2KM8 B;  1YGY A;  5IQ6 A;  1OO0 B;  3PXG a;  3EJM A;  4UT4 A;  3CF5 Q;  3VAF A;  3V6K A;  4PXB A;  4USM A;  4C8M A;  2IA6 A;  3KUE A;  2FVC A;  1T3N A;  4GTF A;  3W5X A;  3BQ0 A;  3KK2 B;  2V2V A;  4UW2 A;  1WTF A;  2E9T A;  2FGO A;  1H2U X;  1LXJ A;  3H4B A;  4DFP A;  1U1O A;  3H5Y A;  1J98 A;  3BGF A;  2HAI A;  4NL5 A;  5I42 B;  2GC8 A;  4HTJ A;  2HHS A;  2P6S A;  1YVF A;  2R2R A;  3LP0 B;  1S1W B;  3G4S S;  1U1K A;  1SL0 A;  3VAK A;  2XMA A;  3OR2 B;  1UJ4 A;  2A1B A;  5DDO C;  1R31 A;  1EZZ B;  4WFY A;  2V63 A;  2Y1J A;  2CQC A;  2HND B;  5F8H A;  4A3L K;  1O5J A;  1AT1 B;  2R92 K;  3P5B P;  5EX3 A;  4XCH A;  2BJE A;  4F3O A;  2ZUA A;  1UWB A;  4IFV A;  2KRR A;  3M8P B;  2VUM K;  1HHS A;  1JJ2 R;  1F2G A;  1ZXO A;  3M05 A;  4C8Y A;  1HYS B;  3DGV A;  5K14 A;  3AHP A;  3LGN A;  1N5Y A;  4WP8 A;  3DOL A;  4WTY A;  1KQ4 A;  5AXL A;  4TXS A;  3M3Y K;  1JJ4 A;  4YB1 P;  3CWJ A;  4ED5 A;  1TEL A;  3OUY B;  4LQ9 A;  4ZCL A;  2OUG A;  2RGR A;  4DXL A;  1R9T K;  4AUK A;  3KLI A;  4WK1 A;  1RQ0 A;  2QRR A;  1MN7 A;  3GTJ A;  2FHJ D;  2WVE A;  2QIF A;  1U2R A;  1UFL A;  3GTK A;  3Q0A A;  5F8L A;  1VRQ C;  1YJ7 A;  2Z8Q A;  4MEY A;  2Z2Y B;  1PJ7 A;  5GMK a;  3L3C A;  2R7T A;  4X4P A;  2E66 A;  4RX6 A;  2BOA A;  1RHR B;  1K83 C;  3C6T B;  4KGV B;  3S16 K;  4K4V A;  1J6W A;  1BD6 A;  1IWA A;  4CLP A;  4DCO B;  3DOK A;  2V4Q A;  2RQC A;  5J1N A;  4DPY A;  2XHW A;  5A76 A;  4ED2 A;  2F3J A;  4BBY A;  2RHQ B;  4CO0 A;  2HLT A;  4NXM J;  4KBI A;  1TMM A;  4P2M A;  2GNK A;  2UVV A;  2U1A A;  4BC7 A;  4A3C C;  2YNH B;  4Q2L A;  1TWG C;  4C4W A;  1FT8 A;  3JYT A;  3MEC B;  1O26 A;  2C2D A;  4EFA C;  1HR0 J;  4Y2K A;  3I31 A;  4WKR A;  1NB7 A;  3UDL A;  1RWM B;  2UUT A;  2WK4 A;  3CJ8 A;  2B9E A;  2DH7 A;  3UCG A;  5KG2 A;  3K7A C;  3I82 A;  2VJV A;  4PG4 A;  4K4Y A;  1QAX A;  3H2U B;  1IUJ A;  2AEJ A;  1R0A B;  4LRB A;  3G82 A;  4J37 A;  5HI7 A;  4DN0 A;  2Y8W A;  2KDO A;  3TAM B;  1KLM B;  3G6V A;  1FWP A;  4B3T J;  3MCN A;  3M8P A;  4LF5 J;  2W25 A;  4NA3 A;  4PWW A;  5JJB A;  3ZTR A;  5B7W A;  3QT8 A;  1IQZ A;  4EYI B;  4AQY F;  5HRO B;  3FEZ A;  3GTP K;  3JSM B;  1FWK A;  2A3J A;  1WHX A;  5LMU J;  4DPX A;  2HAF A;  4ETZ A;  2B56 A;  1JLC B;  1SH3 A;  3MEC A;  1RBO B;  4RZR A;  5LJ3 Y;  3MCS A;  2MLY A;  4ECV A;  2VD3 A;  3CJT A;  1TKZ B;  3HFZ B;  2VA3 A;  3JSM A;  3Q3Q A;  4OJH A;  5DRK A;  3OR1 A;  3MM6 B;  1RLD A;  2E2J C;  2ZFH A;  1DAX A;  4G0V A;  1USO A;  1Y10 A;  2J7U A;  1H72 C;  2MB0 B;  4ZA1 A;  4NRT A;  3QT5 A;  2Y1L B;  3QSI A;  5D77 A;  1CJV B;  1TV6 B;  4LR9 A;  4OJ3 A;  4QR1 A;  3T3F A;  1U09 A;  4M63 A;  2C42 A;  2PSZ A;  2CQ4 A;  5G0R A;  3P3D A;  3BO4 A;  4U96 A;  2JLE A;  3CVK A;  5J2Q B;  4DQR A;  4DL5 A;  4KH1 B;  2GJF A;  2NUU G;  2ZUF A;  3R5C A;  2GCF A;  4ZPB A;  1UVI A;  4QU7 A;  4QCL A;  1F5C A;  1YNJ A;  4CLZ A;  3A8J A;  4X65 J;  2XSJ A;  4IG0 B;  2ZH8 A;  2YKO A;  1RAE B;  4TY8 A;  2BW7 A;  2DNM A;  1O2A A;  2BE2 A;  2DXF A;  4C3J C;  4CO2 A;  1IR0 A;  2C2K B;  2H54 B;  4QPT A;  5KFY A;  1R27 B;  5EDW A;  4NOH A;  3NOC A;  3R5A A;  2MJU A;  1KQF B;  3UO0 A;  3M2V B;  1HNZ J;  3P96 A;  3SCK E;  4USI A;  2IVY A;  3M8W A;  4DV3 J;  4J9U E;  3GCX P;  2OP5 A;  1KKH A;  4OYX A;  4DUZ J;  3GTQ A;  3GEI A;  3DLG B;  1C0T B;  3OL6 A;  1S4F A;  3BF4 A;  1I5O B;  3SV4 A;  4O4R A;  3FZB A;  1VJW A;  5KAK A;  5E3C A;  3G71 S;  2RQ4 A;  1T9V A;  3MM8 B;  3AA9 A;  1VLO A;  1J5E J;  2IJN A;  3JSR A;  3POT A;  1OMS A;  4ZVO B;  2ZKT A;  3FMW A;  2MLZ A;  4FYX B;  2GSU A;  1BQN A;  2AEF A;  4NLU A;  3N6L A;  4PWU A;  2PMZ D;  2YU9 C;  2ZH9 A;  3MUM P;  2RRA A;  1ZAX A;  2PN6 A;  3F73 A;  2AHO B;  3P6Y C;  2V4J A;  1A9N B;  4C2M K;  1HNW F;  5IOL A;  3WC2 A;  4ID8 A;  4Y2M A;  4LSZ B;  1CUL B;  3OTB A;  2V8G A;  2AJQ A;  4JI5 J;  1B3T A;  3Q22 A;  5IP9 C;  1VK8 A;  4NI2 A;  1V6H A;  1WHW A;  1XNR F;  3NXZ A;  4KYZ A;  4OHW A;  2YKQ A;  1JLA A;  4NLP A;  4ZLJ A;  1TFW A;  2LQ9 A;  2CJY B;  1KS2 A;  1X31 C;  2R2S A;  4ECY A;  1RWN B;  4YB6 A;  4OHZ A;  2RT3 A;  2EKN A;  2FY8 A;  1KVI A;  5KG6 A;  1QY7 A;  4X4R A;  1XR6 A;  3ULH A;  4A3M K;  4C8L A;  1N36 F;  2O66 A;  1Y1W C;  4ZLP A;  3D6T B;  4WJ3 M;  4DV4 J;  3OR2 A;  2CPE A;  3PX0 A;  5K8N A;  3QGH A;  1EQR A;  4IDK B;  4JI0 J;  1LWF B;  4A3F C;  7AT1 B;  3KDO A;  2AT1 B;  2WB1 D;  3VWS A;  4DDF A;  3GR0 A;  4EBE A;  2MMY A;  3HHN B;  3RJM B;  1D8Z A;  5IYC C;  1Q16 B;  2ZC4 A;  1N36 J;  3FKI C;  1UP1 A;  2H9Z A;  1KON A;  4KAS A;  2Q1L A;  1FK9 A;  4K4S A;  3OVS A;  3Q8U A;  4PPZ A;  3O2I A;  4NRU A;  1AA1 B;  3FFI B;  3ADA C;  4IH5 A;  1TVR B;  1IL2 A;  3D68 A;  4HT5 A;  4HHH A;  4ED8 A;  5E3Q A;  4WK3 A;  4HYK A;  4L72 B;  5BR8 J;  4CM2 A;  4RBV A;  1WOR A;  2GAH C;  2V68 A;  2YNG B;  2NVQ K;  3V4M A;  1HQU B;  2C2N A;  2F9J A;  1Q78 A;  4ILR A;  1RTZ A;  2JA6 K;  2O1P A;  2BJ9 A;  2NYH A;  2WAQ D;  1TUG B;  4MMO A;  3IWL A;  3FKB A;  3D7S B;  1H0H B;  2JA8 K;  1XMQ J;  2DNK A;  3U27 A;  2B6A A;  3BGU A;  3HDS A;  1JKH A;  3HF5 A;  5SZT A;  1U24 A;  2AJF E;  4P7V A;  1PIE A;  2GML A;  2HVH A;  2CFA A;  2YQ1 A;  5CHC B;  2CQI A;  4PWD A;  4PXD A;  3K59 A;  4M5I A;  1T9U A;  1VH2 A;  2UUC J;  2UZA A;  3KLF A;  4Z7Y A;  4KHM A;  3CCU S;  4KAI A;  3EWG A;  3M8R A;  3DGP A;  5EWF A;  5AE1 A;  3M8Z A;  3SIP B;  4K8R A;  2CQ3 A;  4Q45 A;  1FX2 A;  4DLE A;  1O29 A;  1H38 A;  4OLO A;  1GTH A;  3ZZU A;  1F7V A;  4N77 A;  4K5R A;  3BKT A;  4DV7 F;  3WX4 A;  3VGS A;  3X1L B;  2MZ1 A;  3ISN C;  3UDC A;  3TQE A;  1RE1 B;  4JI2 F;  3QIP A;  1UVK A;  3AAW B;  5DG9 A;  1AB8 A;  3D5M A;  3O3L A;  4OX9 F;  4EI2 A;  4LFA J;  4LJM A;  2XBP A;  1HYS A;  2XC9 A;  3A8I A;  4K4T A;  3HVW A;  2AV5 A;  4A3J K;  4ETX A;  2LMI A;  4UOC A;  1DFD A;  2HGL A;  5C25 A;  2RHS B;  4CO4 A;  2YPZ A;  1AZS B;  2DR8 A;  3V6J A;  4NX9 A;  4PWD B;  2HNY B;  4LK1 A;  4KAR A;  2J8A A;  4G0W A;  2WW8 A;  2QA4 G;  1CSJ A;  1HD0 A;  3M8S A;  1X4E A;  2B63 C;  4MK7 A;  4LF6 J;  1S6Q B;  4OZ1 A;  4E98 A;  3ISZ A;  5EGH A;  1YBA A;  3B4M A;  4G7H A;  1QUP A;  3CD6 S;  3JAM Y;  2Y3P A;  4N56 A;  3MM5 A;  4OYZ A;  3PO3 C;  3FQL A;  4DL3 A;  3D6M B;  1R43 A;  4XDC A;  5KFX A;  5AJ3 F;  4KGK A;  2HK2 A;  3TJ9 A;  4F4K A;  3DHW C;  2QLF B;  5ETK A;  4JI6 J;  2FD2 A;  3I9Z A;  2QT7 A;  3UCZ P;  3MMB B;  4HVZ A;  1U6Z A;  3HKZ L;  5HMZ A;  2HPU A;  4Z2X A;  1NJX A;  4BKW A;  4FYY B;  1U8W A;  4TU8 A;  1WEL A;  3PY8 A;  1XK8 A;  3HPO A;  1CVJ A;  5I3Q A;  2CPJ A;  3K8W A;  4O3O A;  5J1E A;  6FD1 A;  4F04 B;  5DG8 A;  3HOY K;  5E7O B;  3QT6 A;  2GO8 A;  3Q8Y A;  1NK4 A;  2ZZT A;  2PFF B;  3ENV A;  3FNN A;  3GJQ B;  1HNX J;  1GAO A;  4NLW A;  1K9M T;  3GTM A;  4Y65 A;  3NWR A;  2J9D A;  3ILO A;  2LEB A;  4N76 A;  2PE8 A;  4BY7 K;  2KN4 A;  1BC6 A;  2NPI A;  3CDE A;  1FX4 A;  1R8H A;  4C3K A;  4CO5 A;  4KB4 A;  5F8G A;  3DOM B;  2Z0G A;  5F9L A;  1PCA A;  3JQM A;  4K4X A;  5GME A;  1P1L A;  2POK A;  4DX8 H;  1I50 K;  2C2Z B;  1Q8K A;  4PYA A;  2HEK A;  4B3T F;  3BO3 A;  1R89 A;  1YJN S;  3HVT A;  3TFH A;  4BBR C;  1HI9 A;  1XWL A;  3CCT A;  5C3E K;  2XY7 A;  2Z2M A;  4WBF A;  4IRC A;  4YME A;  3KKF A;  4Z7C A;  4LJZ A;  4UZC A;  5L1L A;  2YU9 K;  3FDS A;  2ZBI A;  3RRG A;  4DR2 F;  3IR6 B;  3GWC A;  2EXU A;  4JP8 A;  4P73 A;  2EW9 A;  3HHL C;  1EQ0 A;  2VOD A;  3TYT A;  2D3U A;  3MR3 A;  1NJY A;  3MGJ A;  4C8Z A;  1FTR A;  2FYX A;  3K8V A;  2I5J B;  2NSC A;  2VG6 A;  2HWH A;  1HWU A;  2VPY B;  2E9R X;  3F0N A;  1SUQ A;  4DI6 A;  2FJB B;  5DZ7 A;  4I6Y A;  2KTQ A;  1T8E A;  2DXD A;  1M5P C;  1IR1 A;  1YG0 A;  1XXA A;  2UXB J;  3TUP A;  1K0T A;  2FLP A;  2X3D A;  4NEZ A;  4OZ2 A;  4WXO A;  2PC6 A;  1FD8 A;  3NLC A;  4RUH A;  1CJU A;  3GR1 A;  1CJT B;  2B4O A;  3NCP A;  2FC9 A;  4ZIV A;  3LAN A;  1N4L A;  2LU1 A;  3TVZ A;  3RB0 A;  1GT8 A;  3PYF A;  4TYA A;  1D1U A;  5U47 A;  1NRK A;  1FHT A;  3K5M A;  4JI8 F;  3HCX A;  1HQ2 A;  2XEX A;  1FVS A;  3L7U A;  2ZZN A;  2LVW A;  2HFU A;  1ZBT A;  2ZE2 A;  1S7H A;  3LGH A;  2LA4 A;  4JB8 B;  1Y9O A;  1UL3 A;  3CMA S;  4DSI A;  3JTN A;  3QWP A;  2D74 B;  4KPC A;  3N0V A;  3E8O A;  4NCA A;  2VUM C;  2Y0B B;  4ES3 A;  3MPD A;  3NWG A;  3GIK A;  2VZ9 A;  5ADZ A;  1FRH A;  3GTK K;  2RUS A;  1KVJ A;  2O67 A;  3C3L A;  1YIT S;  4FM9 A;  4ZP6 A;  3KJV A;  5HAT A;  2VF3 A;  3RU0 A;  4NWB A;  4GKJ J;  4LF7 J;  4NEY A;  4A3G C;  2NXU A;  3HHK A;  1FNO A;  3M2V A;  2VU5 A;  3GTO C;  2KFY A;  2OSR A;  3ZNU A;  1RKJ A;  3THT A;  2DNN A;  4OMF G;  2VJU A;  3AD8 C;  2MY8 A;  3BSC A;  1RTJ B;  5KTQ A;  2FHK A;  3LPX A;  2XWY A;  4NCB A;  4HTI A;  4YP3 A;  1G6B A;  3R7N B;  1B99 A;  2YXL A;  2HBY B;  4BLA A;  2JA7 K;  3KNA A;  5J1E B;  3WQP A;  3FVY A;  2HRY A;  2MQP A;  2R7S A;  4DR4 F;  3AQP A;  2W4C A;  2ROE A;  4WZM A;  1Y4Z B;  4KO0 A;  2PA3 A;  4OIO A;  3MD1 A;  5KFZ A;  1HWJ A;  3S16 C;  4DZ6 A;  3N0C A;  1NDC A;  2UXB F;  5MAO A;  1YJT A;  4HR2 A;  5I3U A;  1HWK A;  3DDK A;  4DX5 A;  5KOW A;  2IC3 B;  5C4J C;  3S1R K;  3TTG A;  3IM8 A;  2CQ1 A;  4P2F A;  3PR5 B;  5A8R A;  5KFU A;  3CCL S;  1XMO J;  4C3M A;  2ATL A;  5JVO A;  3UR3 C;  4I68 A;  5E3R A;  1U6F A;  3BV8 A;  3RRH A;  1S0N A;  2YNI A;  4PQA A;  4HT7 A;  2C28 A;  3E01 B;  2X7I A;  4JI3 F;  1VI7 A;  3BJY A;  1G1X A;  2OO4 A;  1XNQ F;  4X6A C;  2CZ4 A;  2LQB A;  5GAE I;  2V9W A;  2OFH X;  3GLJ A;  1HKA A;  1C1C A;  2X3G A;  4BLG A;  1I94 J;  2UUC F;  3SCI E;  3ITH B;  2QMW A;  1HW9 A;  3D0H E;  2KYZ A;  1NK5 A;  3PX4 A;  3CD5 A;  4I2Q A;  2GVZ A;  5F41 A;  3VQT A;  5LMU F;  2BR0 A;  4O23 A;  3DOL B;  3IRX A;  2X51 A;  4WKY A;  5LJ5 Y;  2ZOG A;  2R93 C;  1Q8B A;  4A93 C;  1MW7 A;  3NY0 A;  1JWW A;  5C5J A;  2FJA B;  2GV1 A;  1UCN A;  1VHI A;  3TNV A;  2VAS A;  4K0K J;  2E7W A;  4DQP A;  1L3S A;  2HQF A;  1T9Y A;  2J0Q D;  1T94 A;  2DNH A;  3MPV A;  2DKO B;  2I38 A;  4P6Q A;  1VC0 A;  4L3K A;  5C4J K;  3S1R C;  4OZ3 A;  1VQP S;  2Y9H A;  4B9S A;  1BDF A;  1TVR A;  5M5W K;  3G8T A;  1TAQ A;  4H54 A;  1VJE A;  3MUR P;  4KT0 C;  2GIQ A;  2Q79 A;  3BBF A;  4ATN A;  3M6V A;  4KRW A;  2DY1 A;  1HBU A;  4PXE A;  1XMO F;  4DV1 F;  2B4V A;  4IOB A;  4NAS A;  1V5V A;  1T05 B;  4OIP A;  3L7O A;  3ITH A;  4K4U A;  3D6H B;  4CLK A;  4FKY A;  1REG X;  3R7S B;  3LWL A;  2PEH A;  2B7C B;  3L7P A;  4OX7 A;  3PV8 A;  4KJI A;  2E1R A;  3T5L A;  2O5J A;  4OI3 A;  2CJ9 A;  3GB0 A;  3KUG A;  4C2M A;  2B4P A;  3SZZ A;  1VQO S;  2QE5 A;  1USM A;  1WF1 A;  2DNQ A;  1V3Z A;  4LFA F;  2E5I A;  5DDQ C;  3QRP A;  4LRC A;  3NGU A;  1UZD A;  3DCA A;  4B17 A;  3X3U A;  3EVW A;  1N52 B;  3R2D J;  2JH3 A;  2XS7 A;  3SV3 A;  1YJ9 S;  5IYB K;  4RBU A;  1WKJ A;  3D3B J;  4GVB B;  3TJ8 A;  1EX8 A;  3GII A;  1MRO B;  3H0G K;  4C0O C;  2A68 A;  1FA0 A;  4DL7 A;  1D09 B;  3SSQ A;  3TA2 A;  4P5B A;  3ZTO A;  4DUY J;  2XSF A;  3B78 A;  1TFY A;  2QSF A;  4DEZ A;  5ETQ A;  3DDI A;  2ZWP A;  3I0R B;  4WFZ A;  3QZ8 A;  2RQM A;  2VFR A;  3BPD A;  3JSB A;  4U95 A;  5L39 A;  1JXL A;  2CZV C;  4CH1 A;  2COL A;  3M1V B;  1B64 A;  4WIQ A;  1X4G A;  2W2Q P;  4A8Y A;  4YOE A;  2AJ4 A;  3OTO J;  3DLE B;  2DD8 S;  4ZIT A;  3CJR A;  1KC8 T;  2GS8 A;  1UKU A;  1NSP A;  4BHQ A;  1MMN A;  4MT1 A;  4YDX A;  2ERR A;  3NGS A;  1YTY A;  3HOZ C;  1YSJ A;  2YKN A;  2RU9 A;  1FKO A;  5B0C A;  5ETV A;  2FLL A;  3MDF A;  2DNY A;  3TP2 A;  1ELO A;  2V8P A;  2KT5 A;  1UVN A;  3MHY A;  1C4C A;  2HHH F;  2OPS A;  4LFC J;  4OJ1 A;  2X1F A;  2M5Y A;  4ILL A;  5CZV A;  2HFS A;  3G96 A;  1HNI B;  3Q23 A;  2OPR A;  4CNZ A;  2DNG A;  3K5N A;  5C24 A;  4HH0 A;  3KLE B;  3HJF A;  2YKA A;  3CDW A;  1FKP B;  1NPK A;  4TQS A;  4R0E A;  4X62 J;  4QWC A;  4M5D A;  2W7O A;  3FUY A;  1BQM B;  3LGM A;  2XCA A;  3CIZ A;  4JBC A;  4ZN1 A;  3CME S;  1OY6 A;  2WON B;  1ULR A;  2NVT K;  1UWB B;  2C1E B;  1CJU B;  4IFV B;  3EYZ A;  1XR5 A;  3H5X A;  2ALZ A;  4EWT A;  3T5J A;  3TEG A;  2V5H G;  3DMJ A;  4AND A;  1VYA A;  1J6X A;  3IBC B;  3W64 A;  3HVT B;  4Q0B B;  2QFJ A;  1HWL A;  4GKK J;  5HO4 A;  4X6A K;  2HGN A;  1N5V A;  4LSL B;  3MOJ B;  4OYO A;  1S1T B;  2MKC A;  1EI6 A;  1U2F A;  4WZQ A;  3D54 A;  1VGX A;  4ZOS A;  1RGV A;  2EK6 A;  4K59 A;  4Q5S A;  3H5S A;  4DPW A;  2L41 A;  1Q8I A;  2CJA A;  1RBL A;  3UWT A;  4DU8 A;  4ZCM A;  4TY8 B;  3EZO A;  1UTA A;  3QNW B;  4IRK A;  1TWA A;  3SFG A;  5ETT A;  2YKP A;  4NLG A;  3A3N B;  3MM8 A;  3DRP B;  1F3F A;  5HL7 Q;  3DLE A;  2GHV C;  4Y2I A;  3I32 A;  5E3P A;  1SKU B;  4WJB A;  2R8H A;  4AQY J;  1RBA A;  3TX8 A;  3PCO B;  3VZI A;  4ED4 A;  2ZH7 A;  1N34 F;  1WIH A;  2WZ1 A;  2QX0 A;  1TWG A;  1KQG B;  3SZ2 A;  2VC1 A;  4WP9 A;  1FJG F;  1XQI A;  3OTE A;  5L9N A;  3RB4 A;  2NVT C;  1O51 A;  2PD1 A;  3IAM 9;  3JST A;  2YWK A;  2DIV A;  2MKS A;  1LWE B;  3C15 B;  2NVY A;  1DQ8 A;  4UUW A;  1R9T A;  2J7W A;  2BE2 B;  4Z37 A;  3POT B;  3B8H A;  3EGV A;  1H7X A;  3G8Q A;  3I9V 9;  4IH7 A;  1TV6 A;  3R5J B;  2YNF B;  2VC0 A;  5BR8 F;  3GIL A;  3BM7 A;  1HHT P;  1RAJ A;  4C3H C;  5LXY A;  2W8K A;  2DT9 A;  2KWA A;  3QRQ A;  4CO3 A;  3QO9 A;  3PVX A;  3EIC A;  4C3L A;  2V50 A;  1Y1W A;  1VQ9 S;  2A10 A;  2NXE A;  4X64 J;  3TAQ A;  2VQF F;  2GQQ A;  4ECX A;  1LEO A;  1K47 A;  3V6D A;  1IQT A;  2ABY A;  2F8H A;  3NS7 B;  2M8D B;  1GH8 A;  2ZNZ A;  1SXL A;  5BXI A;  5F0U A;  1UEV A;  1CC7 A;  4U67 Q;  2JA7 A;  3MMB A;  3DOM A;  2JA5 C;  1CEZ A;  1O28 A;  2PPB A;  2XGQ A;  1REV B;  4GVL A;  4J9M A;  3GJR B;  4RU2 A;  3ORE A;  5KFS A;  4EK2 A;  2GGP B;  2FJV A;  1TWC K;  4B02 A;  2XMW A;  2LDY A;  1PYT A;  3UE2 A;  1E6V A;  2VBY A;  3DLK A;  1NND A;  4ZKA A;  5GMD A;  3W2V B;  2R7O A;  3J80 Y;  2BKP A;  3MUV P;  2XY5 A;  1LWC A;  4B3M J;  2GW8 A;  3P4U B;  1CLF A;  4BY1 C;  2H4Y B;  3TO8 A;  1DRZ A;  2BJD A;  3LPE A;  1RTI B;  3GIJ A;  4FF3 A;  3RBE A;  2XZW A;  3MMJ A;  1BWE A;  3PIO Q;  5KG1 A;  4QR2 A;  3GTJ C;  1BHN A;  2DGW A;  2RNE A;  4DUZ F;  2MYF A;  1O27 A;  2AQ4 A;  1IKX B;  1NDP A;  2OEJ A;  1GXL A;  1L3T A;  4QJV B;  1UEU A;  1HLW A;  4OIQ A;  2JLG A;  4AYB D;  2OHD A;  2DHX A;  2AF6 A;  2QL9 B;  2ROG A;  1K83 A;  1SCJ B;  3RR8 A;  3FCW A;  4TQR A;  4YHH F;  1CC8 A;  2ASJ A;  4PYD A;  1AB4 A;  4QW9 A;  3QQC D;  4IRD A;  1SIZ A;  2NUH A;  1RT4 B;  3ET6 B;  1UFK A;  4FF2 A;  3IM9 A;  1AZS A;  3C66 A;  2LU2 A;  3HOY C;  1NH8 A;  1WC4 A;  3RAQ A;  2XYH B;  2EBG A;  2I1R A;  1TL1 B;  2W9C B;  5F0W A;  3UN2 A;  3MZI A;  4BY7 C;  5A2Q Y;  3KK1 A;  1A0O B;  2R2T A;  1LOU A;  1QM9 A;  2VKR A;  1S57 A;  5ITH A;  2A6M A;  3Q8V A;  4ZPC A;  5C25 B;  4YFU A;  5M5X K;  2W2N P;  1TWH C;  5LT5 A;  3R97 A;  1F0X A;  1L3K A;  4B3S J;  2B63 K;  3TAR A;  2HHQ A;  2HVZ A;  1URR A;  3W8P A;  1ZM3 A;  3BN7 A;  3T02 A;  2ZH3 A;  2MY7 A;  1RIS A;  2B4U A;  2ZBP A;  2XLK A;  1GX6 A;  2XHC A;  3DRS B;  4A93 K;  2CAJ A;  3DLK B;  1RT2 B;  1UFW A;  1KQS R;  1HQE B;  2KT2 A;  2A6H A;  1VQL S;  3ZZT A;  4RL1 A;  5HLF B;  1N5Y B;  5I42 A;  4DV0 J;  1LK5 A;  3HT3 A;  4OLP A;  2XNQ A;  5A8K A;  4C0B A;  2DIS A;  2IC3 A;  5HQ8 A;  4MTP A;  4AL6 A;  5SUH A;  2RVJ A;  3M32 A;  3CJ3 A;  2K06 A;  2LP4 A;  3W9J A;  1YWX A;  1J2V A;  1XXB A;  3EMT A;  3OPK A;  2RB7 A;  2BX6 A;  2QLB B;  4KFB B;  3OJS A;  3BGL A;  2W7A A;  4QIW D;  3MF5 A;  3K2Y A;  2V2Q A;  1RU1 A;  2XMM A;  3EDR B;  2ASY A;  4L76 A;  4WII A;  1S5Z A;  3QGI A;  3FCV A;  2I6W A;  2MQN A;  1U1M A;  1NBE B;  3CCE S;  3L9Z A;  1NSA A;  4USU A;  5JFE A;  3MXH P;  2B9W A;  1Q7L B;  3OFE A;  1F5A A;  3PW4 A;  2LKZ A;  2O01 C;  1PC5 A;  5AXK A;  3NUH A;  3SBM A;  2UUA F;  2G4B A;  1VBZ A;  1KLN A;  3MAH A;  4YN3 B;  3QWU A;  3NS5 A;  1DCP A;  3D1H A;  4FXW A;  1IBK F;  1MWY A;  1OIA A;  1K83 K;  2DH9 A;  3IN5 A;  2QJ3 A;  3V4I B;  3S7R A;  1O2B A;  1K1Q A;  3QT7 A;  1MSW D;  1FRJ A;  3OBI A;  4AT1 B;  3JS9 A;  3N9U C;  3A12 A;  4DR2 J;  3NP5 A;  3G6X A;  4NA1 A;  3SXL A;  4DDQ A;  1YCL A;  3M2R A;  1DLO A;  4OYW A;  1NU4 A;  3N28 A;  2NVX K;  5C4X C;  5HBM B;  1L3U A;  5KFN A;  4RW9 A;  4GTA A;  3N5B A;  1RWK B;  3JTO A;  5IV3 A;  3TUJ C;  4XSZ A;  3LAL A;  4JYA J;  2AWZ A;  1H98 A;  1SUQ B;  3K58 A;  4LF5 F;  1V3R A;  3M30 B;  3K17 A;  5FII A;  1NEE A;  2VPW B;  2Z30 B;  5J2P A;  1LW2 A;  1SV5 A;  1S6P A;  1KTQ A;  1I51 B;  1SPB P;  4A3B C;  4DZD A;  1RWV B;  3PYE A;  2AGP A;  3C2P A;  2WCX A;  4XO0 A;  4HI1 A;  2PO4 A;  4ED7 A;  5LXR A;  4XLN A;  3LAM A;  1GMU A;  5LL6 d;  1CUL A;  2V6T A;  3THP A;  4FZV A;  3C15 A;  3RBD A;  4C3I K;  1BQM A;  4XIU A;  3PYD A;  1Y1W K;  3UVJ A;  1WSR A;  3P49 B;  1WQH A;  5KOX A;  1UJ5 A;  3QAT A;  1LW2 B;  2MLX A;  4QWE A;  3PRV A;  2KL8 A;  4IG0 A;  4CLF A;  4MEX A;  2RQK A;  2GX8 A;  2XMK A;  1BUX A;  3PDN A;  5D4P A;  3FOE A;  1N6Q A;  1NHV A;  2UXD F;  1AXQ A;  3J81 j;  5HQL A;  2VG7 A;  5C4X K;  1SKW A;  4TY9 A;  4PZV A;  3O1L A;  4F4X A;  4Y3C A;  3JB9 k;  3HSZ A;  4OYP A;  3SYZ A;  4KQZ A;  3GG0 A;  3Q8P B;  4OX6 A;  4BS2 A;  1JNR B;  1HD1 A;  3C6U A;  3H5U A;  4KMH A;  4U7C A;  1I3Q C;  5HLF A;  4IFY A;  4B9V A;  2DR6 A;  3EGW B;  2AU0 A;  3ICL A;  2EKY A;  1Y1V C;  3KLG B;  4JI4 F;  4I6W A;  1VQN S;  2AIR B;  4AL7 A;  4KGZ B;  3Q8R B;  3OPF A;  3S17 C;  2GVD B;  3ETO A;  4NZ0 A;  3GSD A;  3KDN A;  2NCK L;  2L9N A;  3DI6 A;  2F1F A;  3TZY A;  2XO6 A;  1TQL A;  3ILL A;  1Z1Z A;  4LRA A;  3K5P A;  5IQQ A;  3IAS 9;  5ETO A;  1T03 A;  1VQ8 S;  1GTE A;  4C9D A;  1U1N A;  1SV5 B;  4CIO A;  1T3O A;  4OI0 A;  2UVU A;  5KFH A;  4TLR A;  5KT4 A;  4EZ6 A;  2PHC B;  2PFD A;  2DH8 A;  3U7J A;  1W2I A;  4PQU A;  2V34 A;  5KFA A;  3K57 A;  2DHA A;  4DF4 A;  3DRX A;  1RLC L;  1YJW S;  3PAC A;  3TEH B;  1RAH B;  2GMH A;  3CAG A;  4B9N A;  5B0F A;  2LXF A;  2E5L F;  3B6B A;  6FDR A;  1U0H B;  4QOT A;  1EB0 A;  3M4O C;  4DSK A;  1FE0 A;  4MFB B;  2VG7 B;  2QSW A;  3UD3 P;  4MH8 A;  5KFD A;  3S1Q C;  3I4M K;  1OQ6 A;  1YJU A;  3DFE A;  3LPY A;  2M88 A;  3O5T B;  4USW A;  1GQE A;  3DNC A;  1HPZ A;  4A3G K;  3IS9 A;  2C3Y A;  2UXC F;  1MN9 A;  1FJ7 A;  4P72 A;  5DZ6 A;  3OL9 A;  1C4A A;  2OD4 A;  3PO4 A;  2Z2Z A;  3ISN D;  1HI1 A;  3KLI B;  1GXT A;  4DJB A;  4GC6 A;  3DGP B;  3LA0 A;  5B0A A;  3FSX A;  1E6V B;  3V81 A;  2DGO A;  3DDN A;  5TJ3 A;  4E8U A;  2FQT A;  4UQT A;  2HVD A;  4WFA Q;  2FLN A;  1FNM A;  2E5H A;  3M6X A;  3FZ2 A;  3HOW K;  2AYE A;  4M94 A;  2VFT A;  1U2C A;  2K8G A;  3NMR A;  1PG5 B;  2RKI B;  2XUL A;  1QSL A;  2EC2 A;  5H1S V;  2OEL A;  3OLB A;  2NXC A;  4O4G A;  1FF2 A;  4DV5 F;  2R7U A;  2JEI A;  1X9M A;  3VF0 B;  5FJ8 K;  2DIT A;  3I4M C;  2AZ1 A;  2HRT A;  3KOA A;  1NZA A;  3D4J A;  1SJ3 P;  3MR6 A;  2EBB A;  1P27 B;  3MMC A;  4LFC F;  2EEY A;  3LP0 A;  2YX7 A;  5L9X A;  3Q83 A;  5IP9 K;  1VK3 A;  1N0V C;  4GTE A;  1UA1 A;  4ICL B;  3HXM A;  2JEG A;  2HHV A;  3H2L A;  3UI3 A;  1VIX A;  2ZWO A;  4DBQ A;  2E44 A;  1RZM A;  4C3H K;  1V9O A;  4NLY A;  4WU2 A;  2LXU A;  3UN5 A;  1ZA2 B;  1RHK B;  2Y8Y A;  1EJ7 L;  4GT9 A;  2ZIT A;  3ETM A;  1NLK L;  4KTQ A;  1SKR A;  4J9K A;  4FNI A;  3GTG A;  3LUY A;  3S1N C;  5KFP A;  3ZZZ A;  2QV6 A;  1BGW A;  1I6H K;  4KB2 A;  1XZQ B;  4IOA Q;  2XNR A;  4C48 A;  1ZM2 A;  3MED B;  2N3O A;  2CAD A;  2HZV A;  2BJ8 A;  1RAD B;  3DI6 B;  2UV8 G;  4C8N A;  4OL8 A;  1DTT B;  3MEG B;  2XQC A;  2UUB J;  2BE9 B;  4KIA A;  1O6X A;  2G13 A;  2NQP A;  3M8Y A;  5TMF A;  4PPD A;  4OYM A;  1SJQ A;  5KFR A;  4ZJO A;  3TX0 A;  3HOX C;  1RT7 A;  5A8W B;  2D7S A;  2B9Y A;  5EHH A;  4KR0 B;  2HBZ B;  1O24 A;  4GMK A;  4NXN J;  3FC9 A;  3IBF B;  2HNZ A;  3MD3 A;  4ZPW R;  1R9T C;  4ECS A;  2V8V A;  4FN5 A;  3CDB A;  3I55 S;  4P10 A;  3S2D K;  2R7X A;  3NNH A;  2F5G A;  3D0G E;  3TFI A;  1IKW B;  3BR8 A;  5ETM A;  1KLM A;  4RUC A;  4Q7A A;  1X4H A;  4RNH A;  3CCR S;  4JI3 J;  4N7T A;  2M3D A;  3OSN A;  3D1O A;  3DC2 A;  4J91 A;  4KM9 A;  3PR4 A;  1VQ6 S;  2MZQ A;  1JLG B;  3BDE A;  5M2R A;  3I6P A;  1XBW A;  4DPT A;  1MML A;  4NOI A;  1KQK A;  4CYU A;  3T1Y F;  3CJ0 A;  1FEH A;  7FD1 A;  3GIM A;  4RW8 A;  4G1Q A;  2HHW A;  3BQ1 A;  1PSD A;  2YKN B;  5IP7 K;  3MAA B;  4H4O A;  3R8Y A;  1J27 A;  2H4W B;  4OJG A;  4A8Q A;  1AFJ A;  1R8C A;  3UW1 A;  4YY3 J;  4GTB A;  3BSN A;  2CVI A;  1VS3 A;  1TWF C;  1N5S A;  2L08 A;  4X84 A;  3OLA A;  4RNO A;  2VUM A;  4GC7 A;  4PR6 A;  3IMQ J;  1KWM A;  4EU0 A;  2JC0 A;  4AD6 A;  3PM9 A;  4N47 A;  3M9M B;  2XSJ B;  2CQH A;  1SBR A;  3RAX A;  5DQH A;  2M7S A;  2CNK B;  3KFW X;  2OLW A;  3R5G A;  3VVU A;  2G1H A;  1RT4 A;  3GTO A;  2HQG A;  2ADC A;  1TWA C;  4IOC Q;  4CLT A;  3H4D A;  1Q53 A;  4A3E K;  4F0H A;  2W1B A;  4HKQ A;  1VCT A;  1NJZ A;  2F4F A;  3LP2 A;  4RBT A;  3QZ7 A;  5CHP A;  5J2N A;  3PRB A;  4DX7 A;  3QJJ A;  3QX3 A;  3UDV A;  3ZTQ A;  5RUB A;  2HW3 A;  4ZPA A;  1VQK S;  2OAU A;  3HKZ D;  2HBQ B;  4USH A;  3JAM U;  2JEF A;  3AH5 A;  3TRG A;  3BH7 B;  1YK9 A;  1U47 A;  1LKZ A;  5J1P A;  2RSQ A;  3W9I A;  3FOF A;  1DCH A;  4NMX A;  2H65 B;  1LW0 B;  3S14 K;  5FDL A;  5D4O A;  3QLH A;  1O25 A;  3DXJ A;  1RKI A;  2WVC A;  3PW2 A;  1FXL A;  4AL5 A;  3HXA A;  4G1P A;  3SMZ A;  5B0D A;  2V67 A;  3IBW A;  3TWZ A;  1LFP A;  3OR1 B;  1HBN B;  3RZO C;  4Y2A A;  4OFZ A;  1IJE B;  3GG1 A;  3MWB A;  3HD2 A;  3HZE A;  1JLB B;  1PJ5 A;  3HOV K;  4PUO A;  1VQY A;  1EIY B;  3R5B A;  2JFK A;  2CFX A;  5IM0 B;  3TQ1 A;  4KKO B;  4P7T A;  3PRD A;  1O2F B;  3QFH A;  2XMJ A;  4QQB A;  4RUA A;  2FTR A;  3PEH A;  2FUG 9;  3S15 C;  2MKJ A;  1BJT A;  3I0R A;  2CJB A;  4PG6 A;  4C6A A;  2K3K A;  1CS4 B;  1TUV A;  5F8I A;  1YQH A;  4A3D K;  3CDA A;  1N6Q B;  3M6W A;  3GTL A;  4X66 J;  2UU9 F;  2QL7 B;  3P45 B;  4ZP8 A;  5HK4 A;  4NLS A;  3K5L A;  5J2N B;  3GDZ A;  3JYT B;  1G4C A;  1T7P A;  1JLB A;  3L09 A;  1KVK A;  2J0W A;  2CFA B;  1P6T A;  3OFH A;  4F25 A;  4K4Z A;  3RZD K;  3O44 A;  4JV0 A;  2QLJ B;  1NHU A;  2LQ5 A;  4A8S A;  3LP1 B;  4RJV A;  4DV0 F;  2XYP B;  4WU3 A;  3VVT A;  3JTP A;  3CED A;  3U02 A;  1FKO B;  4OI1 A;  4GKJ F;  2R7R A;  1IKV A;  5KFO A;  2Q3P A;  1TK8 A;  4G3I A;  2GQC A;  2KXF A;  3E3X A;  1N5Q A;  4HLB A;  4OZL A;  2ZM6 J;  2EFP A;  4LR7 A;  3CDU A;  2E2H K;  2I5J A;  5IT9 Y;  1RTD A;  4M5K A;  1S6P B;  4NLX A;  4WE1 B;  3ZZR A;  4A8O A;  2DRB A;  1K73 T;  3N3Y A;  4DSF A;  5DO2 A;  4QWD A;  3CE8 A;  2F8M A;  1Z4U A;  5M3F K;  4XPC A;  1PBA A;  3W63 A;  3FBC A;  4ELU A;  4C2M C;  3TZZ A;  2LEA A;  1VRU A;  3PW7 A;  4K4W A;  3C16 A;  5HAO A;  4JV5 F;  2G9O A;  2SXL A;  2FJX A;  1RAF B;  3PW5 A;  5L8R C;  5K20 B;  1AW0 A;  2KVQ E;  2CPX A;  2Z58 B;  2ZHA A;  4M95 A;  2OPP A;  2DY9 A;  4USK A;  3NG8 A;  4WYW A;  1S1V A;  1U1L A;  2DXE A;  1ZYR A;  3RZO K;  1J5O A;  1X4F A;  2Q66 A;  5BJR A;  2UU9 J;  2BW2 A;  1XZQ A;  5IFM A;  1YHQ S;  4UY8 5;  1KP6 A;  3BPS P;  1N33 J;  1Y0H A;  1Y1V K;  1IBK J;  2MZJ A;  2A0F B;  2F4V J;  2OPS B;  1GK8 A;  2IY5 B;  4ZP7 A;  3OL7 A;  3C14 A;  3KTQ A;  2OD6 A;  1BS2 A;  2CKW A;  4W92 B;  1RT7 B;  5A8W A;  3S6E A;  3GYX B;  3PEJ A;  3PTW A;  3MUT P;  4K7Q A;  2AKW B;  1B70 B;  3D67 A;  5C24 B;  4YY3 F;  1C1B A;  3CCQ S;  2Y3Y A;  1S1V B;  1IBA A;  1UAW A;  8RUC A;  3MTJ A;  3CCV S;  3KK2 A;  3R7B B;  4ERD A;  2BKN A;  2G0I A;  4NZ6 A;  2GSN A;  3M2R B;  5DGA A;  1QTM A;  2M0G B;  2EFQ A;  2IM0 A;  3F56 A;  2BBE A;  3DXS X;  3M2U B;  4DR5 J;  2ZVI A;  1LV5 A;  4H4M B;  2WON A;  2FQO A;  2CNN B;  2JX2 A;  1U4B A;  1LK7 A;  1JJH A;  4EZ9 A;  4XSX A;  3H0G C;  2HLU A;  4EEY A;  1PKU A;  2O3D A;  2KRB A;  1ZOT A;  3FBE A;  3GV8 B;  2ZHO A;  1X4A A;  2RKI A;  1WC5 A;  1HI8 A;  2R9L A;  3PO2 K;  3IR7 B;  2Z57 B;  3SSS A;  2JA6 A;  3W3S A;  4P9S A;  2R93 A;  1QDU B;  3AD9 C;  4P2X A;  4PG5 A;  5DM6 Q;  2OEK A;  1SJF A;  3UNG C;  5B0B A;  4A3F K;  3H7H B;  1R8B A;  2BKO A;  3ONQ A;  1HNV B;  2D3O 1;  2MZS A;  5HN0 A;  3R5D A;  1XER A;  4L74 A;  2O5I A;  3KUH A;  2KM8 C;  2AYG A;  5C42 A;  4NI2 B;  5F3Z A;  4USV A;  4RWW A;  2BYC A;  2IHR 1;  3QFW A;  2FGC A;  4EO6 A;  2EVZ A;  3PO2 C;  3W5Y A;  3HHL B;  2DGQ A;  4UTG A;  2VOO A;  2NXJ A;  5IT0 A;  1RTD B;  3AXM A;  3OQ2 A;  4ZVS B;  4GVB A;  3G4A A;  5AT1 B;  2RS8 A;  2ZDP A;  2N82 B;  1D9D A;  4FPI A;  1P8G A;  1W7W A;  5AXN A;  4TNO A;  3LAJ A;  3P5T L;  2XMV A;  3U1L A;  1QSS A;  3K7A K;  1G51 A;  1SC4 B;  3E01 A;  1FDN A;  4BXX C;  4YR3 A;  3KK1 B;  1SFO K;  4IKA A;  2MDA A;  3MFI A;  2VFU A;  5E68 A;  3LP1 A;  1PO6 A;  2FZC B;  4AFF A;  4J9O A;  3HMJ G;  4EMD A;  2HFV A;  1SC6 A;  4DQS A;  3LTO A;  2ILY A;  1I1G A;  1VGY A;  1VQ5 S;  4LIR A;  2BUN A;  3IO1 A;  2W9B A;  4PQU B;  2V6U A;  4JV5 J;  1WOS A;  3BO2 A;  4NYZ A;  3R2C J;  4UOF A;  3NAI A;  3H20 A;  4B9M A;  2OJ3 A;  4F4Y A;  1U49 A;  1OS5 A;  5FLM K;  5G0R B;  4KC6 A;  3I87 A;  2B3T B;  2NVY K;  4JI0 F;  2J5A A;  5C2G A;  3AH6 A;  4DL6 A;  2W24 A;  2CNO B;  1T0T V;  1Y00 A;  2I2Y A;  4DS5 A;  2NVY C;  2GJI A;  2K3I A;  1S7I A;  4ID5 B;  1RCX B;  3CC7 S;  1BXN A;  2WOM B;  1HNX F;  1U02 A;  4PEO A;  3SFU A;  5JVG Q;  4G7O A;  5GAG U;  4TU7 A;  4B3R F;  5KFW A;  5KFF A;  2HS3 A;  3ZTP A;  4ED0 A;  2MSS A;  3G9C A;  4DCJ B;  2R2U A;  3M9N B;  1HA1 A;  4ENO A;  4C0H A;  3KLV A;  5KT6 A;  3KK3 A;  2L9W A;  1NZ8 A;  1LNQ A;  4ZCI A;  2UXC J;  1AUS L;  1W26 A;  2EFO A;  3KJN B;  5C7P A;  2D69 A;  3FMB A;  4FS2 A;  4CZC A;  1XR7 A;  5GAG I;  2FPH X;  2M52 A;  3VAH A;  4IR1 A;  1EFW A;  6AT1 B;  3UD5 A;  4QR0 A;  2VL1 A;  1SB6 A;  4YB5 A;  3T6J A;  1AUD A;  2F9D A;  4QJV A;  3MPY A;  1M5H A;  2CPH A;  3Q89 A;  3NGT A;  3DLJ A;  4OI6 A;  3OTO F;  3PJW A;  5EGE A;  3HD1 A;  2MGZ A;  2HZC A;  1YDL A;  2N3L A;  2JA7 C;  4G1I A;  1I3Q A;  4Q8F A;  1G3O A;  4ECW A;  4LUB A;  2KG0 A;  3M6U A;  2XMT A;  1HQE A;  2IRY A;  1SFO A;  2R92 C;  3I5B A;  5ETN A;  3BSA A;  2CPD A;  2DCL A;  2HQ3 A;  4RNM A;  1Q79 A;  3ZC4 A;  4LF9 F;  2L9D A;  4RWX A;  1TWH K;  2E5J A;  2IM2 A;  1TU0 B;  4FPR A;  2B5J B;  1OQ3 A;  4JI5 F;  1JQG A;  3OD2 A;  4AYB L;  2QA4 S;  4DG1 B;  4GO5 X;  3D0I E;  4ELT A;  1D8Y A;  2E2I C;  2KJV A;  2VQE J;  3CPW R;  3OHA A;  2QN6 B;  3NAH A;  2VQF J;  3HT0 A;  4PRF A;  2R7Z C;  3H40 A;  3EPG A;  2C2O B;  1KR4 A;  5J2M B;  1N32 F;  1RT5 B;  4ITS A;  2HQC A;  3F41 A;  4NCG A;  3H90 A;  4CNY A;  4DQI A;  1S72 S;  1HIY A;  3OTC A;  1T02 A;  3D66 A;  4F0M A;  4V1A k;  3PG9 A;  1FE4 A;  1IKW A;  1TL1 A;  2J0S D;  2W7V A;  1FK9 B;  3VAJ A;  4I67 A;  3GU0 A;  2W9A A;  4ID5 A;  3FEY B;  1JVI A;  3CQZ C;  1XXC A;  1VBY A;  2DIU A;  4XAK A;  1HBM B;  3R1L A;  1UET A;  2HHP A;  3DLG A;  2K1R B;  3GTG C;  3PX6 A;  5IV4 A;  3CJ2 A;  4X64 F;  3UFC X;  1JXV A;  1TK0 A;  1ZM9 A;  4B3R J;  2NVX A;  3M4O K;  4DSE A;  3QLH B;  4YG2 A;  1SH0 A;  2A18 A;  2LQJ A;  3I4H X;  5CYM B;  3B4D A;  2DO4 A;  2HHH J;  4B9U A;  3T00 A;  3VGV A;  2E7X A;  4URS A;  4ECR A;  4J9S A;  3AJ1 A;  3MM9 A;  1YBU A;  2IPO B;  1RAC B;  3MI7 X;  3W2W B;  1S48 A;  1YBT A;  1WDT A;  4FF4 A;  1VQ4 S;  5G4D A;  5K14 B;  2V94 A;  2P9E A;  3JSY A;  4Y6I A;  3RUB L;  2I9S A;  3IG1 A;  4RW7 B;  4K50 A;  3FFI A;  1S6U A;  1XJW B;  4EBD A;  1SQF A;  4B08 A;  5A2Q U;  1KHV A;  3J81 U;  4A3C K;  2OPP B;  4WYL A;  2V4J B;  2RF2 A;  2H5E A;  5IOR A;  2YH1 A;  1YKW A;  1F9N A;  4KB7 A;  4QYZ J;  2J6S A;  2C3U A;  2IBO A;  2BA9 A;  2KFZ A;  4EUV A;  2HNZ B;  3R6G B;  5F8N A;  1ZPW X;  1XTZ A;  1T9W A;  2OTJ S;  2YPY A;  2XLJ A;  2OI2 A;  3VA7 A;  3VV2 B;  2RIL A;  1RAB B;  3R3T A;  5CYQ A;  3I4P A;  5KFQ A;  1S76 D;  3MPU B;  4RU9 A;  3AY0 A;  5EN1 A;  4F3M A;  1SQG A;  1ARO P;  3G6E S;  3I4N K;  1X5T A;  2W4D A;  3C14 B;  1H2V Z;  4J9N A;  3NOG A;  4DR6 J;  3L4K A;  1D9A A;  3OL8 A;  3MCM A;  4H4K C;  1RP5 A;  5CD4 A;  2QFI A;  3KWM A;  2MKI A;  3S1Q K;  2WHO A;  3LW5 C;  4KM8 A;  1FJG J;  4C45 A;  1HQM A;  5DGB A;  1N88 A;  2CYY A;  2IRU A;  2VQE F;  5HP1 B;  2N4D A;  4CQ1 A;  5E33 A;  3W7B A;  3HX9 A;  3AXK A;  1NM2 A;  3GMG A;  1RWO B;  1V5I B;  3W62 A;  3ZO7 A;  1ISE A;  4DQQ A;  2EPI A;  4DV1 J;  2IVM A;  2E2I K;  1OPZ A;  1Q5V A;  1TTH B;  2C22 A;  3N6M A;  2HGM A;  4ALZ A;  1RDR A;  4G6V B;  2DPJ A;  2EFG A;  4X4T A;  4TKT A;  1R3N A;  4OYI A;  4LR2 A;  1C0U B;  3DRP A;  2BM0 A;  2Y0S D;  2P9G A;  3A13 A;  2ZJP Q;  1L3V A;  4OI4 A;  1OY9 A;  4A3E C;  4TLQ A;  2DGX A;  3T1A A;  1TUW A;  2DGS A;  1FI4 A;  2H5J B;  3KLF B;  4P74 A;  3RZA A;  4DF8 A;  2JSX A;  1JIH A;  4OIX A;  5CYM A;  5FJ4 A;  4JV1 A;  4U6P A;  3D9B A;  3FQK A;  2VDI A;  2DR7 A;  3US5 A;  3HOX K;  2KHD A;  1KTV A;  2ASD A;  1X0F A;  3ERE D;  2G2Y A;  3K5O A;  5HVF A;  2V0N A;  2DHH A;  1UW4 A;  3KLH A;  1KSP A;  1U1R A;  3VR1 A;  2GO9 A;  2XMU A;  1IM6 A;  4DV4 F;  2VA2 A;  1QE1 A;  4UOG A;  4RW6 B;  1S79 A;  4X62 F;  1TWH A;  4USJ C;  1WJ9 A;  1B4S A;  3CC4 S;  1U8S A;  1UVM A;  5M2U A;  1NK0 A;  2LFV A;  3BGO P;  5KFG A;  2R3V A;  2DEI A;  4O44 B;  1I6H C;  3I5A A;  4OIR A;  4AH6 A;  3SQG B;  5IP7 C;  2LEC A;  1Y5I B;  4ZS6 A;  2QG9 B;  1CBK A;  2PI4 A;  2P8T A;  1JJC B;  4A3K C;  2BJ1 A;  4LBH A;  1QE1 B;  2X1B A;  3BYR A;  1NXI A;  1RT2 A;  2RDD A;  4GTD A;  2OEM A;  1NME B;  1F1B B;  3GTL K;  3UCU P;  1YIJ S;  1TR0 A;  5EX0 A;  1S1X B;  3BB5 A;  3HFK A;  1RAA B;  4RW6 A;  3SZY A;  1N54 B;  3GP9 A;  2HIY A;  5JXS A;  1HBM A;  1FCA A;  2B0G A;  4I4B A;  4DL0 C;  2BE7 D;  4MYT A;  4DSL A;  1RAI B;  3W65 A;  1ZH5 A;  4DV5 J;  4WFN Q;  1X5S A;  2FVS A;  5D0E A;  1UZH A;  3Q8S B;  4TYB A;  4ECZ A;  3GEH A;  3FEX B;  4RR5 A;  3PHT A;  4ZVH A;  2P8I A;  4KN7 A;  3MEE B;  3C46 A;  2NVQ C;  2VV5 A;  3CNQ P;  1X5P A;  5DLG A;  4ZVU B;  3HJV A;  3A3P B;  5CD4 H;  1G2E A;  2LEP A;  4ZCK A;  1I50 C;  3KHL A;  1TL3 A;  3BBC A;  1X8D A;  2HQI A;  3HOW C;  1YI2 S;  4EO8 A;  4BBS C;  4DV6 J;  1SL1 A;  3HHE A;  1H2T Z;  2IDE A;  2EFV A;  3U1M A;  1VBX A;  2RH6 A;  3RB6 A;  2YNG A;  4CLL A;  2RS2 A;  4ANC A;  1WAC A;  4OX8 A;  2QMX A;  5EGY A;  4IFY B;  2CJK A;  2AJ0 A;  3R1H A;  5IYB C;  1IKX A;  1UEK A;  2Q43 A;  3S0X A;  3NEK A;  3BKF A;  2QYG A;  2ZBR A;  5DQG A;  2D9O A;  1OSC A;  2AW0 A;  5HAN A;  2MST A;  4LRF A;  1SKS A;  1CPZ A;  3GYG A;  1S4E A;  2HFZ A;  1KN6 A;  3U1N A;  2JC1 A;  1LWE A;  2WVB A;  3HSD A;  1FDB A;  2CWK A;  2CQG A;  4HHU A;  3OVA A;  4NA2 A;  5E2Q A;  3FHZ A;  3THV A;  3FCH A;  3T41 A;  1CJK A;  1BGX T;  2W7P A;  2AEM A;  3GJS B;  1XNQ J;  3TFJ A;  1YJV A;  3CD7 A;  3GYN A;  1S1T A;  4RW9 B;  4YR2 A;  2XS2 A;  2JJ4 D;  3S1T A;  1ZET A;  4WP3 A;  1BWV A;  4ZPT R;  1LFW A;  2AX0 A;  3FRZ A;  1ZVU A;  4OZJ A;  4A47 A;  2R93 K;  3AJD A;  3CC2 S;  5A6W A;  3GTP A;  3QO9 B;  4CTA A;  4V19 J;  5DM7 Q;  1WG4 A;  3M7V A;  4EGL A;  1MLA A;  3I5C A;  2BQU A;  1N0U A;  3J7Z T;  3HSG A;  4RW7 A;  1FJE B;  1TWG K;  1WCM A;  4J3N A;  1WQF A;  3OT9 A;  2R4F A;  4CM0 A;  1NAQ A;  4F4Z A;  2E2H C;  3O6Q A;  2XB2 D;  1S9E B;  2GVD A;  2UXD J;  2FHO B;  3A8E A;  1CJT A;  5KG5 A;  4CCH A;  1S59 A;  4LF6 F;  1UVL A;  4J9R A;  4IO1 A;  1RA6 A;  1SC3 B;  5IC4 B;  5C42 B;  1WG1 A;  1S1W A;  2R42 A;  3UD4 P;  4O0N A;  3KMS A;  1GFW B;  4QBU A;  4Q0B A;  2HSE B;  2JNJ A;  3DM2 A;  4ZHR B;  1M5K C;  2ZE2 B;  2HWT A;  2Y0S L;  3PKY A;  2QLX A;  3DMJ B;  4MIB A;  2BAB A;  3AA8 A;  3KXD A;  5H9F K;  3L4J A;  2CWX A;  1FRK A;  1Y7P A;  2HIQ A;  2PI5 A;  4M1X A;  2PMW A;  1WOP A;  4UST A;  3PW0 A;  1Y1V A;  3T9N A;  3MMA B;  5HRO A;  2DB1 A;  1QVG R;  5KFT A;  3SEO A;  2FB0 A;  3TVK A;  3MTK A;  1Y3J A;  2YWW A;  3M1V A;  3T1Y J;  3CJK A;  4BC9 A;  4LLG A;  3IPJ A;  3GCW P;  3MM9 B;  2FZK B;  1IKV B;  2R7Z K;  4RW4 A;  4KHP J;  4QWA A;  4C11 B;  2QC3 A;  1Q4R A;  1TAU A;  2LXI A;  4DR5 F;  4K5S A;  2VFS A;  1S1U B;  3TUZ C;  5B08 A;  3PFE A;  3BRE A;  1WCM K;  2F40 A;  1XN9 A;  1TL4 A;  1MRO A;  4YQW A;  1WHY A;  3SI8 A;  2B5J A;  2Q6B A;  2YX1 A;  2RH3 A;  3PYG A;  3R6L B;  3TOQ A;  1CJV A;  5AXM A;  2DVI A;  1VIO A;  2HZA A;  3FK4 A;  1UW9 A;  2P5V A;  4NYO A;  4ZDN A;  5GVQ A;  1FKA F;  1R6V A;  3I96 A;  3TA1 A;  1S9G B;  4XTT A;  5LSO A;  1O0P A;  3RW6 A;  4KKO A;  3GEE A;  4GFQ A;  9ATC B;  4QIG A;  2MGZ B;  1RU0 A;  3BGR B;  2H3E B;  3OXL A;  1VHF A;  2HS0 A;  4O4G B;  3NBP A;  2MZR A;  3BQ2 A;  3JQK A;  4BBS K;  2DK2 A;  1RT5 A;  3PO5 A;  3CD0 A;  3DRS A;  1PGZ A;  2GFF A;  4O3Q A;  4KMU A;  5K5M A;  4BLB A;  3HFV A;  4IO9 Q;  1WC3 A;  3DKD A;  2CPZ A;  2RD5 C;  2G0C A;  5EUH A;  3Q24 A;  2ACY A;  2C2E A;  3OFF A;  5IYD K;  2JVR A;  2VIH A;  3D1Q A;  5CXT A;  1R7I A;  1RT3 B;  4OI2 A;  3W9H A;  4F50 A;  1FES A;  5B09 A;  1T05 A;  1NPR A;  4N8N A;  4B3S F;  2NSB A;  1TL7 A;  2DR9 A;  3AB2 B;  3QJP A;  4HHJ A;  1RWP B;  1F60 B;  1RUS A;  3W5Z A;  1CQM A;  3RR7 A;  2E1M C;  3MR5 A;  3ZXW A;  2GIR A;  3MEK A;  3OXG A;  4Y2C A;  3H25 A;  2X1A A;  3PJ9 A;  3RBZ A;  1FRX A;  1BY9 A;  2L3M A;  2V4R A;  2YNH A;  3GJT B;  3GFX A;  4O3R A;  4FBT A;  4Y7N K;  5AJ3 J;  2DR5 A;  3QAU A;  2KI2 A;  1RHU B;  2ILZ A;  1XZP B;  3GIR A;  1IBL F;  1PBU A;  5D4L A;  2ACM A;  5K8O A;  2Q6C A;  4DR7 J;  1ZTT A;  1SFO C;  2KT3 A;  3PJX A;  1HBO B;  4DFM A;  2KHC A;  3DRR A;  3V6H A;  1UV7 A;  1QUV A;  5DS7 A;  5L38 A;  2RDI A;  3PNI A;  3SSR A;  4A3B K;  3SDE B;  3OFG A;  3GON A;  2UUB F;  4JI7 J;  4P2S A;  4FXD A;  4DUY F;  2XO7 A;  4XPE A;  1L0W A;  3GFZ A;  4C3I C;  2AGO A;  3PFO A;  3QYY A;  4Q43 A;  2R7V A;  4LRE A;  1JNZ B;  4J7C A;  3J7A 1;  5A8R B;  1FXR A;  1FD2 A;  4I7F A;  4WPA A;  4Q4Z A;  3NKY A;  3VAI A;  3N79 A;  2H51 B;  2VDH A;  5H9E J;  4I2Q B;  3EVM A;  5KT2 A;  1V3S A;  4A8K A;  3ILJ A;  2YY3 A;  4LOW A;  2IDL A;  4KAT A;  5KG7 A;  2ALY B;  1BLU A;  3W2V A;  3M4X A;  4AXJ A;  1UVJ A;  4OYA A;  3UDE A;  2HRU A;  3MML B;  3Q8Q B;  3OUY A;  5D0H A;  2DEJ A;  4QYR A;  1EAR A;  3TAP A;  3F44 A;  2FJE B;  5ETR A;  4NLQ A;  1KDN A;  3T1H J;  1S49 A;  2NVX C;  3TAN A;  1QJH A;  2MHN A;  1W25 A;  5HJY A;  4KSE B;  4QIE A;  1WQG A;  1QLN A;  1IQ0 A;  1HI0 P;  1N5T A;  1WUU A;  1REV A;  2YNI B;  3LO3 A;  3B54 A;  3BS9 A;  2XM3 A;  1WF0 A;  2CIM A;  3S2D C;  1UPP A;  5JVH Q;  1B7Y B;  3Q86 A;  3V2U C;  4XLP A;  4FXV A;  2JVO A;  4CDI A;  3WIV A;  2R7W A;  4PG8 A;  3MM6 A;  4FKX A;  3KNG A;  4UY8 T;  2RJZ A;  3V4G A;  3I4N C;  5H9E K;  1PYS B;  2XY6 A;  4MKA A;  1ZZF A;  2HNY A;  4UQG A;  3Q2S C;  4MIW A;  3BN4 A;  4MK9 A;  3C6U B;  3OTD A;  1MU2 B;  1WI6 A;  3CGI A;  1M5O C;  1I6J A;  1VRT B;  2PMH A;  3VGU A;  2DRD A;  2Z4P A;  2FY1 A;  1RHQ B;  4ZVT B;  3T1H F;  3MAA A;  2VUG A;  5E0O A;  1TKX B;  3CUL A;  2VON A;  4H4M A;  1NJI T;  4M1K A;  3CQZ K;  3S1N K;  4KHR A;  1ZZN A;  4LT6 A;  4QIV A;  4B3O B;  3VAG A;  1RCO B;  3IWN C;  2CUY A;  1PC4 A;  1KD1 T;  5FD1 A;  4TVA B;  2B7B B;  2WAQ L;  3H3V L;  2WRM A;  1VQS A;  2QTW A;  2ZUG A;  1TWF A;  1QVF R;  2E9Z A;  2R7Z A;  1UA0 A;  3IFE A;  4FZB A;  4H4K A;  4BXX K;  1IN0 A;  1ZA1 B;  3BEG B;  4WJ4 A;  3IWX A;  4U9R A;  3DLB A;  2KO1 A;  3M3Y C;  3H0P A;  1PAE X;  2B8P A;  1S12 A;  1N56 A;  3CIM A;  2W9B B;  5FLX U;  1NH7 A;  2PA8 L;  1Q5Y A;  2IMW P;  2MJN A;  2HBR B;  2NRE A;  2WSC C;  2WBM A;  5D3G A;  2IAJ A;  2NXN A;  4ANE A;  4A3K K;  1ROF A;  2H1Y A;  3AQO A;  5DET A;  1NPP A;  2YNF A;  4R5P A;  3EZ5 A;  3A1Y G;  1K1S A;  2MQL A;  3AD7 C;  1M5S A;  1NSK L;  2CW0 A;  1DHM A;  2WB1 L;  3W61 A;  3RZD C;  1Q86 T;  1RT6 A;  1S1U A;  2NYI A;  2WVF A;  5KFE A;  5KFK A;  1S77 D;  1F2H A;  5HMY A;  1MWZ A;  2WVD A;  2YX4 A;  3G2X A;  2C2R A;  2VBX A;  4Q44 A;  3J7A N;  5JMN A;  1HQU A;  1GE9 A;  3PHE A;  4RPF A;  2DHS A;  3N01 A;  3CXC R;  4HDH A;  4R8U B;  2N7C A;  1VLY A;  1GMW A;  1JLQ B;  4B9T A;  4X4V A;  1WTB A;  2AGQ A;  4LFB J;  3EE3 A;  5E41 A;  1KBR A;  2BAN A;  1SJ4 P;  5CZX A;  2CQ2 A;  3W2W A;  3PO3 K;  3NNA A;  1JLE A;  1ZAV A;  2AYM A;  4JI8 J;  4PG7 A;  2AMC B;  2ZNY A;  4Y00 A;  3W1Y C;  4PKD B;  2RAQ A;  1VRT A;  1NO8 A;  2GAG C;  1Y5N B;  3AJ2 A;  1EK8 A;  3S8S A;  2A6E A;  1WSV A;  1DTQ A;  1X60 A;  4A4J A;  1KFD A;  2ZJQ Q;  2XCO A;  1ZQ1 C;  4OHY A;  2UVW A;  1EP4 A;  1W2B R;  2JLF A;  1MWQ A;  2HK3 A;  1RAG B;  3M2U A;  2C2M B;  2OPQ B;  4DHV A;  2BOP A;  1DJ0 A;  3CB4 A;  5HVG A;  2OFG X;  3QBC A;  3G8S A;  1K44 A;  2RUG A;  4U7U D;  3H98 A;  1RWU A;  5KFL A;  3J7Z 5;  3HK2 A;  2BE5 A;  5D78 A;  4DPO A;  2APO A;  2PII A;  2VG5 A;  4HEA 9;  4DR3 F;  1LW0 A;  1IKY A;  1H74 A;  1OYE A;  2N4C A;  5L1K A;  1J5O B;  2KKH A;  2ASL A;  2GIF A;  3KLG A;  1TL3 B;  4Y34 A;  5IZH A;  4O44 A;  4RUB A;  1RHM B;  5C44 K;  4BWM A;  3CJ5 A;  4PAB A;  2ZBC A;  4X4N A;  3HP6 A;  2R92 A;  1F6T A;  5C44 C;  4BBR K;  3CO0 P;  5DDR C;  2QLW A;  2B9X A;  2KVI A;  4KGM A;  1TKZ A;  1VFJ A;  3VQS A;  4LF1 A;  2WTF A;  1B0T A;  4FNH A;  1Q8L A;  5B0G A;  1UJ6 A;  4KFB A;  3HI9 A;  3CJ4 A;  1TKD A;  1C2P A;  3GV7 B;  4C3J K;  4RMF A;  2HHX A;  1FTC A;  1YZ7 A;  2HFO A;  3GPA A;  1WEX A;  3QIP B;  3CQZ A;  4L3N A;  4I2P B;  3EVO A;  4KMD A;  1U48 A;  2F8E X;  3RTV A;  1JLF A;  1GMW D;  3VGT A;  1I94 F;  1BMQ B;  3EDQ B;  4M5L A;  2JOQ A;  2WB4 A;  1JK9 B;  4MKV A;  1TL7 B;  3VAL A;  4RNF A;  4B3M F;  3MCO A;  4DV3 F;  1R8A A;  1NB2 A;  3K89 A;  4RW8 B;  5C3E C;  1EKS A;  1QAI A;  3QID A;  4M5H A;  2HYI B;  4YHH J;  2IA0 A;  4JYA F;  4CLS A;  3B82 A;  2XCR B;  4WXW A;  2KB2 A;  1HNV A;  4F3Q A;  2ZH1 A;  4LFB F;  2CG4 A;  2FVP A;  4DFJ A;  1S6Q A;  3CJQ A;  4NXM F;  1UMJ A;  5TMC A;  2M8H A;  2F4V F;  2LCW A;  4IUF A;  2QO3 A;  3HHL A;  4LBP A;  1JLF B;  5KFJ A;  4RLE A;  4X4S A;  3TJA A;  4ZP9 A;  5DJB A;  1FJC A;  2FVQ A;  2F65 A;  2YU9 A;  3NGR A;  1ZBS A;  1TKT B;  1OYD A;  4DV6 F;  1TMJ A;  4ELV A;  1H6K X;  3AOD A;  3SQG A;  5A6P A;  2R8I A;  4YDD B;  2CNL B;  3PZP A;  1SJR A;  4I2P A;  1T9T A;  2J9E A;  2IAJ B;  3QJL A;  5KT7 A;  1X4C A;  1TZ0 A;  4LSN B;  4F26 A;  2H5I B;  3RYL A;  1CS4 A;  1Q1K A;  4F02 A;  1HAR A;  1X5O A;  2OSQ A;  2V69 A;  3T6B A;  2XCQ A;  1A7G E;  3BSO A;  1IE0 A;  1X4D A;  1AFI A;  4HDG A;  7FDR A;  1OSD A;  3QRR A;  1D0E A;  3GQC A;  5IWA J;  2A2C A;  2MQQ A;  4DMZ A;  3FSI A;  1FFS B;  2DGU A;  4FDF A;  2BQR A;  3HVR A;  3G82 B;  2HQD A;  1T95 A;  3ENW A;  2ZUE A;  4F7V A;  3W8G A;  3RAM A;  2E2I A;  5L1J A;  4CH0 S;  3IR5 B;  1NJW A;  2VG5 B;  3BBB A;  4DL2 A;  4BDP A;  4KV8 A;  1QSY A;  3ZFV A;  1HWI A;  2UV8 A;  4UOH A;  3DN9 A;  2GVZ B;  2KXN B;  1HMV B;  5LM7 E;  1SIW B;  2PA8 D;  1PYO B;  1SI9 A;  1BE4 A;  2XLI A;  4GRS A;  1VRU B;  4O0I A;  3MMC B;  4JUZ A;  3T9Z A;  3P8B B;  2V8H A;  3FJ2 A;  3J7Y U;  4A8F A;  3EM1 A;  4URQ U;  5CAB A;  1B7F A;  1F9F A;  3GTL C;  5HP1 A;  4GTL A;  3S2H C;  2GHW A;  3H3V D;  1JLE B;  1VQ7 S;  4FYD A;  1Q95 G;  4QIW L;  4R5P B;  1F3V A;  3HM9 A;  2IRX A;  4U8V A;  5B0E A;  2J6U A;  4WFB Q;  3HHL D;  2WSF C;  2KH9 A;  3GTQ K;  5M5Y K;  3TUI C;  2JA5 K;  2HWI A;  4JI6 F;  5BYR A;  2CDQ A;  2CPI A;  4FYV B;  2HHU A;  4C8K A;  2DCU B;  3IGV A;  5K8M A;  4ZVG A;  4X66 F;  1WC1 A;  4N8O A;  4CYU B;  1NK7 A;  1EHW A;  2HVI A;  5CYQ B;  3OEP A;  3CJK B;  1T11 A;  2OMO A;  3V81 B;  3UNY A;  4KGX B;  3S15 K;  2M4M A;  2UUA J;  4DUT A;  2MQO A;  3MOZ A;  1C0T A;  3D2W A;  4LRD A;  3UQS A;  2QMU B;  2DHG A;  1IXK A;  8ATC B;  3LWM A;  1WKK A;  2KJW A;  4A3M C;  2GZO A;  2BRK A;  1S9E A;  2HND A;  3IG1 B;  3GTJ K;  2HMI B;  5GAD U;  2ZOM A;  4U7U K;  2D3Z A;  4CTA B;  1WKL A;  5CH7 B;  4ZVR B;  1YRX A;  3AOC A;  4MFB A;  4OQJ A;  5T14 A;  2LQ8 A;  1N32 J;  2VIC A;  4O2D A;  2P6T A;  1ITP A;  2J9D E;  2VG6 B;  4M5G A;  1WEZ A;  2ZHB A;  2FHM A;  1RWX B;  2RML A;  3DM2 B;  4CLY A;  4NCG B;  2GJ2 A;  1RXO B;  1BQX A;  1VJQ A;  3IP0 A;  1KHW A;  3LAK A;  3DRR B;  2CJX B;  4ZVP B;  4YFX A;  2BDP A;  2B63 A;  2CQB A;  2EG1 A;  1Y5L B;  2OTL S;  1WC0 A;  1C1B B;  1MG7 A;  1ZTW A;  3T01 A;  2R8G A;  2YWF A;  1LWC B;  1Q0N A;  4KC5 A;  1FRM A;  2LA6 A;  4A46 A;  1RSC A;  4R25 A;  1YLX A;  4NYP A;  2D3O R;  1S0M A;  3MM7 A;  1TKX A;  4G7Z A;  2K7J A;  1NK9 A;  1NCL A;  1HMV A;  2ZH5 A;  4W98 A;  2XS5 A;  2G2O A;  1U26 A;  2KU7 A;  2R7Q A;  4P5A A;  2AZ3 A;  4LQY A;  2V6S A;  2KG1 A;  1WHV A;  2HFN A;  2CZ9 A;  1X4B A;  5ETS A;  4A8X A;  5HSP A;  1U0H A;  4CO1 A;  9RUB A;  3H0G A;  3HVA A;  4NML A;  4UUX A;  2CA9 A;  4GO7 X;  3C8Y A;  5CAA A;  3W66 A;  2DJW A;  5KG4 A;  5KFI A;  2JA6 C;  3NGK A;  4FS1 A;  3GTM C;  5AE3 A;  1CQN A;  2JDJ A;  2NZ4 A;  2QEX S;  5A8K B;  3OSP A;  3MM5 B;  4NPO A;  2CDR B;  4OZN A;  4WE1 A;  5H9F J;  1FRL A;  2VHG A;  2AX1 A;  1A6L A;  5JUM A;  1JLQ A;  2KZM A;  3EGN A;  1UPM B;  4I6A A;  4JI4 J;  3OVB A;  1VBK A;  2EG2 A;  1X7V A;  2JZ5 A;  2D41 A;  3BZQ A;  2HUR A;  2QYC A;  5HMX A;  3H2V E;  4CRJ A;  3NCR A;  1D9F A;  3AOA A;  5IT9 U;  1XEZ A;  4RKU C;  4RNN A;  3UN3 A;  4LQ3 A;  2YH0 A;  4QU6 A;  1HHQ A;  4QZV B;  2ZKU A;  1MMD A;  5C2C A;  5CYJ A;  2MTL A;  2ZD1 B;  2ZVS A;  4S0M A;  4NLV A;  2XZD B;  3CSK A;  4QWB A;  1WCM C;  3EXC X;  1HFE L;  1FDA A;  1HBO A;  2H48 B;  2U2F A;  3BH6 B;  4I7F B;  8AT1 B;  4MKB A;  1Q81 T;  4ILM A;  3GTP C;  2C3P A;  4M5M A;  3GTK C;  2BAC A;  3DRY A;  1RI7 A;  1WG5 A;  4BWJ A;  3SDE A;  1PAU B;  4B9L A;  3MEE A;  1RYS A;  1WD6 A;  1HNW J;  3W60 A;  2QGF B;  1H3D A;  1EET A;  1FDD A;  4CLW A;  2XCP A;  2XI3 A;  2XWX A;  1S0O A;  2GGP A;  4YUD A;  1ZS6 A;  3MR2 A;  4OZ0 A;  2BMB A;  2B51 A;  4ED3 A;  5FLX Y;  3FSY A;  4ED6 A;  1U1P A;  2BV3 A;  3ELH A;  2OKQ A;  1OPI A;  1IBL J;  1TP7 A;  4A3D C;  1EH1 A;  1M1K T;  4N5S A;  3NL0 A;  1TK5 A;  4B3O A;  1DAR A;  3L95 X;  2CG8 A;  2CJQ A;  4CWB A;  2VH7 A;  4DCP B;  4HL9 A;  4GKK F;  4W90 B;  1S1X A;  3HOV C;  1VDH A;  4MKY A;  3T5H A;  4DL4 A;  4OV1 A;  5D8H B;  2HKE A;  4JI1 F;  3NNC A;  4K0K F;  1SJ1 A;  4X4U A;  4RO0 A;  4A3I C;  3I56 S;  2J7K A;  1FKP A;  1KOO A;  2NS1 B;  3CCW A;  5MLC V;  3H8Y A;  4JI7 F;  1APS A;  3S1M C;  1JOE A;  3AT1 B;  4ED1 A;  1JKH B;  3CCM S;  3KLH B;  1S9G A;  3ZZ0 A;  1SL2 A;  1K8A T;  2Z2L A;  1WOO A;  4G0U A;  1M1G A;  1YNN A;  1U25 A;  2CPF A;  3DLL Q;  4X65 F;  2YKM B;  2OPQ A;  4KY3 A;  1NSQ A;  4A3J C;  3HUL A;  2FC8 A;  4DR6 F;  1M90 T;  4ZJQ A;  2QA1 A;  4IG3 A;  4O3P A;  4NLT A;  1G7C B;  1HW8 A;  1VQM S;  4DS4 A;  1N48 A;  4NLD A;  4DR4 J;  1YJR A;  2OML A;  5F8J A;  2HG4 A;  2FIU A;  2GHP A;  3GTM K;  3T19 A;  3C19 A;  3LH2 S;  5KT5 A;  5K8P A;  2CXE A;  4YR0 A;  5LSR A;  4NLO A;  5A0Y B;  3NMA A;  2L48 A;  4LVN P;  2MQM A;  3WHI A;  1B4A A;  4CT9 A;  3BR9 A;  1IBC B;  1SC1 B;  3E51 A;  3M9O B;  4Y7N C;  4D3H A;  4I0W A;  5D4N A;  4ECU A;  4KH0 B;  5KFV A;  4Y52 C;  1DTQ B;  2DPI A;  1F9H A;  5GAD I;  3N6N A;  1C0U A;  2MKH A;  2NPF A;  3RBX A;  1S10 A;  4QIF A;  1IM4 A;  3TVY A;  2BXJ A;  3D3C J;  5HL8 A;  2ZM6 F;  3ENQ A;  5D6G A;  4ZLL A;  3S1M K;  1Y3K A;  1XNR J;  4F8R A;  5DLF A;  1GMV A;  4ICL A;  3NCQ A;  3GE9 A;  1FRI A;  4QPX A;  2IJR A;  2ZZM A;  3HKW A;  5F9N A;  4LF8 F;  1DY3 A;  2JFD A;  3LF0 A;  3N0B A;  1FNX H;  4FVM A;  4CT8 A;  3AB4 B;  1NKC A;  2PDA A;  2IM1 A;  1KRP A; 
#chains in the Genus database with same CATH homology
 1XZP B;  3A8J A;  3GSI A;  1PJ6 A;  1PJ5 A;  3A8K A;  1WOP A;  3AD7 C;  1WOS A;  1YX2 A;  3GIR A;  1X31 C;  3GEH A;  1WOO A;  1WSR A;  3TFI A;  1VRQ C;  1XZQ A;  3A8I A;  3TFH A;  1V5V A;  2GAG C;  5L46 A;  3AD8 C;  4P9S A;  3TFJ A;  1PJ7 A;  1VLO A;  3GEE A;  3TTG A;  1WOR A;  3AD9 C;  2GAH C;  1WSV A;  3GEI A;  3ADA C;  1XZQ B;  4PAB A;  4PAA A;  1XZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...