2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
b'TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
1WOSA 3AD9C 1PJ6A 3AD8C 1YX2A 2GAHC 1VRQC 5L46A 1WSRA 4PAAA 3GEHA 3GEEA 3TTGA 1XZPB 1VLOA 1XZPA 1WOOA 3TFJA 2GAGC 3AD7C 1WSVA 4P9SA 3A8IA 1WORA 1PJ7A 3TFHA 1XZQB 3TFIA 1XZQA 3GIRA 1WOPA 4PABA 3A8KA 1X31C 3GEIA 3A8JA 1PJ5A 1V5VA 3GSIA 3ADAC
chains in the Genus database with same CATH superfamily
3MPDA 2GJ2A 1KOHA 5D0GA 4YY3F 2RD5C 1XR7A 4BWMA 1N32F 2MJUA 3MTJA 4F4ZA 3ZTSA 5HAOA 2RRNA 1RAOA 2HLUA 2R7ZA 4N56A 2G0JA 3OL9A 1HL6A 3LGHA 4X6AK 3HHEA 3OXGA 2R92K 2HAIA 1R8AA 3ZFVA 2ZM6J 4QPXA 1JLEB 3PO3K 7AT1B 4CTAB 4KB7A 1N34J 1JLQA 1B64A 5H9FK 1RAIB 3M6XA 1UCNA 4A8KA 5G0RB 1VQ5S 3R2CJ 3HHLD 5IWAF 4RNNA 2D41A 2BQ3A 1BUXA 1BQMB 3I4MC 2CADA 1FK9B 1H98A 1HHSA 2EC0A 2VG6B 1H73A 1O28A 5KFNA 2CPZA 1PJ7A 1T03B 2FHKA 4B3SJ 1PIEA 2NVQK 3S7RA 4KQZA 2E1AA 1F6TA 3DM2B 3MECB 1S6QB 5KFXA 1KSPA 1HNXF 3L7PA 1OSDA 4HHUA 4USIA 4ECWA 1WC0A 1S1VB 1TFWA 3OVBA 5MAOA 3SXLA 1ZVUA 3DRRB 2HBRB 1URRA 4ZPWR 5KT7A 1REVA 5I42A 2E66A 2QT7A 4EU0A 4ECYA 2RDIA 2ZVSA 4A3JC 3PNIA 1Q78A 5IP9C 3A3NB 5GAGI 1Y00A 4YFNA 3O2IA 3WDOA 4DSEA 2DGVA 1U0HA 4FP9A 4R5PA 3CULA 4RU2A 4YMEA 4MIBA 3BSAA 3HZEA 2DPIA 5EX0A 2M70A 3KHGA 4G0VA 3G96A 1XXBA 4BLGA 4TLRA 4FBUA 2AEJA 2CNNB 2GO9A 3CQZC 3MM7A 1NJXA 2FYXA 4CDIA 2VC0A 4LF2A 1WG4A 4C8OA 1N5SA 2CG4A 2HPUA 3GTPA 4QR0A 2ZD1A 3CIZA 3CW2C 1RT1A 2PEHA 1Y3KA 2FLOA 1TWGK 6AT1B 2N82B 3LAMA 1PYOB 4HH1A 2OUGA 3H0PA 1YBAA 1FJGF 4Y6IA 1NH8A 2HBQB 3ZZTA 4LVOP 4MK9A 2DGSA 3PR5B 4NZ7A 4BC9A 2B4PA 1NM2A 3PW0A 2XWYA 1L3SA 1TMJA 2XSJA 2CFAB 4CLFA 3K7AK 4DPYA 4KO0B 1N33J 3QJLA 1HKAA 3V4MA 3TJ8A 4U95A 5CZXA 2JSXA 3W9JA 5K8NA 2QG9B 5CYMA 3UCUP 1JNRB 3MR5A 1S1XA 3BKTA 2UUAJ 1ZAVA 4EGLA 4IRCA 4OIXA 1RWPB 2X1GA 5DDOC 3C46A 3R2DJ 4ZCIA 5C44C 2MKSA 1GH8A 1EQMA 4ILLA 3OFHA 3B82A 5IYBC 1IL2A 2VA3A 3MMLB 3P8BB 1Y1VA 5L1IA 3UR3C 2KN4A 3T6BA 4RO0A 4NXNF 3MOJB 2UUCJ 4ELTA 2M0GB 1X5SA 1YGYA 5F8NA 2JEFA 3POTA 5F9NA 2WVDA 3H0GK 2CKWA 4OV6A 2G13A 2EFGA 2V2QA 3UW1A 4XIUA 2FVQA 1GMVA 3EGZA 1RAEB 2XMVA 3DYAA 1VJQA 3UD5A 1EKRA 1K83C 2B9XA 3DLEA 4G7OA 1HIYA 3KMSA 3I9ZA 1EAYC 4UY85 4XSXA 1WOPA 3GTQK 4RUBA 3HOYC 1UW4A 1YX2A 4KGMA 1FXLA 5FLXU 3PG9A 4O3NA 5F8GA 5KFOA 3EVWA 3CJ2A 2XTJP 5KOXA 2N4DA 5CJ9A 4MKAA 5ADZA 3OQ2A 3V81A 5K9FA 3J7Z5 1N6QA 3ISND 1QJHA 3LAPA 4A8QA 1RUSA 4MTPA 3D5MA 3OHAA 4HLBA 5KFVA 1WQFA 4KATA 1NK8A 1J5OA 4NLGA 2MQOA 1ZM3A 2RQCA 3EDQB 2AT1B 4NX9A 1ZQ1C 3VTIA 3Q8YA 3W2VA 3JQKA 4YFUA 3GTLK 5KFZA 3TO8A 4C2MC 3CD5A 2P5MA 4Q5SA 3KLFA 1QSYA 3UDEA 4Q4ZA 3PW4A 3IS9B 3LA0A 2NUHA 4BY1K 2A6MA 3FGVA 1Q86T 4P75A 3RBDA 1CJVA 2CZ9A 1KQGB 1Q8LA 1GAOA 4KGKA 1EI6A 3DI6B 4M8LA 1JLCA 1WKKA 5HMWA 3BDEA 4DV1J 1R31A 2WSEC 3H42A 2J76E 2Z2LA 4RL1A 2HHWA 2G0IA 5HMZA 2DNNA 4Q7AA 3PHTA 1S57A 4EMDA 2RUSA 2VQFF 2NVYA 5KAKA 3KK2A 1BHNA 2F63A 2W9BA 4QU7A 4YB7A 4KHPF 5GAEU 4WFZA 2YX7A 4AH6A 2YH1A 2VOPA 1FKPB 2O67A 4WIQA 2E5IA 4ED1A 3BEGB 3W8GA 4L3KA 1P27B 4FF4A 3JSTA 2KYXA 2B63A 4ICLA 5GAHU 1SV5A 5EDWA 4Q0BA 3LP0B 1JVIA 1PAUB 5E68A 3GYNA 4K5RA 3VAHA 4A47A 2J0WA 1RHUB 2PEBA 1ZTWA 5MLCV 4DPXA 3X1LB 4NI2B 3Q8RB 2DKOB 4IDKB 1NHVA 1ZAWA 4K2JA 4LF8F 4KM8A 1ZAXA 4DZ6A 5KG5A 3DU6A 2ZHBA 4K2XA 4ED2A 3GTYX 3KLVA 2XMMA 3FSIA 4LFAF 2DEIA 2LU2A 1RCXB 3EE3A 3R5DA 3I5AA 3HSJA 2BM1A 4NEZA 5EWGA 4W90B 3DOMB 4FXVA 2B7CB 4MKYA 1KRPA 1CLFA 3KLEA 2IJRA 3D28A 4LF9J 4ZITA 2CQ0A 4OYWA 2BANB 3PACA 3NY0A 3UDLA 1RCOB 1PG5B 5IOTA 1CSJA 2D3OR 2E5JA 3S15K 3IBCB 2YQ0A 3W8PA 2FLLA 4OIRA 4KASA 4DU8A 3H59A 1YRTA 4LF4F 4LRCA 2EFVA 5KFKA 1DURA 4QWCA 1T05A 4J9UE 4ELVA 1DTQA 1Z2ZA 2K7KA 4PZVA 2FTRA 1I51B 2A0FB 2KT2A 4F8RA 3BBBA 1E6YB 4LF5J 2OPRB 5KFDA 3S0XA 2XYGB 1C1BB 1NZAA 3BGRB 4A3CK 2OFGX 3I87A 2XEXA 3FMBA 5DG8A 5M5WK 3C19A 5B0DA 1TQLA 5LT5A 5CD4H 2UXBF 2B51A 1KBRA 5KG1A 2JA8C 1Y11A 1VHFA 1SKSA 1UFWA 4NASA 1DQ9A 2CXEA 1R7IA 2E2HA 5A6WA 2IBKA 2V8PA 3R5BA 3J7YU 3M2UB 2IM3A 4N41A 3I0SB 3NS6A 4X2BA 3Q89A 1UZDA 4DLGA 3KJVB 3Q8PB 1TWCA 3PFEA 1IXKA 2PPBA 3GTJC 1L3KA 3ULHA 1NUEA 3CSKA 3AQOA 1SL2A 3VAGA 2BJDA 3B4MA 3I96A 3RBEA 3CD6S 5DLGA 1VRUB 5T7LA 1F2HA 3MUTP 1J27A 2VKRA 4ETZA 3GLJA 4ANEA 1TWFA 3D2WA 2VPWB 3S2HC 3FKIK 3I4MK 2C3MA 3RAQA 1FVQA 4TKTA 2AF6A 2HWIA 1IBLJ 4O4RA 1R3NA 1GFWB 1RT5A 4GTCA 1V5IB 3GTOK 2R7RA 4EK2A 4P52A 3AAWB 2DJWA 4Y0FA 4UY8T 1TWHA 1RHKB 4J90A 4DV2F 1MG7A 2NXCA 5DS7A 4E98A 1CPZA 4ZLPA 4Y65A 2G1HA 3WBZA 4J9OA 2GIFA 3F73A 2IDLA 1R9TC 4QYRA 1SC4B 1TKTB 1FVSA 3IAS9 1SXLA 1HBUA 3MR2A 2BJEA 1VC6A 2JL9A 1MN9A 4A3JK 4URGA 3MR3A 4O0NA 2CQBA 4C3HC 3V6KA 2UVUA 2BOAA 5IP9K 1NSQA 3J7ZT 3E01B 5F9LA 3C8YA 4DUZF 2HFUA 1S48A 1NMEB 4KJIA 2AJQA 1C2PA 4LK1A 3BUEA 3RUBL 2CWXA 4TLQA 4DSFA 2PGCA 2Q1LA 1XEZA 3IRWP 3LWLA 1UVKA 1ISEA 1B99A 2EG2A 3RR7A 1OS5A 3IPJA 2VQFJ 1RTHA 3VAFA 1J6WA 5KG3A 4PQUB 1NH7A 2B7BB 2SXLA 4C8NA 5JVHQ 1VQLS 1UJ5A 3SQGA 4YEAA 1FHTA 2F65A 2Z30B 3C6UA 4X65J 4C8YA 2HFVA 3CQZK 2F4VJ 3IM8A 4A46A 4QW8A 2VBYA 2W7AA 2KT5A 1VQ4S 4MH8A 2ZDPA 1U1KA 1SC1B 2UUBF 3BV8A 2CNOB 3HFVA 4IG0A 4ZS6A 3H3VL 3CCTA 4F50A 2R7XA 3PYGA 5J1EA 1Q5VA 3C16B 2ABYA 1UWBA 1KQKA 2ZDOA 5J1PA 2Y3PA 2PD1A 3JAMU 4OZLA 2J9CA 4DPUA 5GAGU 2DK2A 3PYEA 1HNZJ 3K7RA 1T94A 1TR0A 4ZKAA 1SQGA 1TWAC 5GMDA 2QIFA 3ZZOA 1EX8A 4DUYF 2EVZA 4I2QB 3R5AA 1Q8IA 3TFHA 3IG1A 2X1BA 1SB6A 2DY1A 5L46A 1FKOA 4DQPA 1HW8A 4HI2A 3QJPA 2VG7A 2EK6A 3JYTB 4DR6F 5C44K 2MGZB 4QZVB 3G71S 5C4JC 1R0CB 4UUWA 2UUWA 4A8WA 4BC7A 1YITS 4CLUA 4LBPA 4NXMJ 4RLEA 1S59A 4DR7F 4A8MP 3KNAA 1VBKA 4Y52C 4A3DK 4URSA 5IYBK 2KFZA 3CJKA 2BA9A 4K4ZA 2CDRB 4ZH4A 3PIOQ 4C3IC 3I5CA 4AL6A 1QTNB 5IYCC 1N5QA 1I6VA 4TVAB 2RH3A 1UFKA 2CPEA 4JV5J 2HW3A 4WJBA 4LREA 5IP7C 4B9NA 4QR1A 3ZTQA 1PO6A 3G9CA 1BQXA 1JLBA 2W1BA 5KG6A 2IRXA 3ZTRA 3H5SA 3D9BA 5GMEA 1B4SA 2AGPA 1U49A 4BY7C 2WBRA 1O2AA 5AXNA 4PWDB 1JJHA 1WHXA 1LXJA 1YG0A 3A3OB 1X5PA 2Y1LB 2R4FA 2XO6A 4CRJA 1RK8A 4NWBA 2G2ZA 2W4PA 5IT9Y 3P6YC 1NK5A 2NXJA 1KEKA 5DQIA 1IM4A 4YB6A 2XLKA 3JSYA 2CJYB 4DR2F 4HTJA 4XPCA 2YNIB 3NG8A 1ZPWX 1VQNS 2AEMA 3CCVS 3R6GB 1IR0A 2FJEB 2PMZL 1S97A 5J2MB 2J6SA 4FF1A 1U09A 3LF0A 4DXLA 1JLEA 1GXUA 4F02A 1VIOA 1FJEB 4CTAA 4KKOB 1IUJA 3FEYB 3ET6B 3BO2A 1Q16B 3ONQA 4J9KA 4C2MK 2UV8G 5G0RA 3PO5A 5A6PA 1YRXA 3TI0A 1BQMA 2CJQA 4UOHA 2EBBA 3PRDA 3PYDA 4LSZB 2KH9A 1WSRA 1FK9A 4J9SA 3GR0A 2VG6A 2E1MC 1T03A 1NDCA 1C1CB 1S4EA 2MB0B 3GFHA 3IXQA 1CQMA 2V4RA 4K8RA 4F4KA 3DM2A 3MECA 1S6QA 3G6VA 2O5DA 1L3UA 1YI2S 5HJXA 1N54B 4A4JA 1U45A 1S1VA 4X4UA 3K58A 2JA6C 3TAPA 4ED6A 4USUA 4RR5A 2QFIA 4LUBA 1FWKA 3DRRA 1RAHB 3HKWA 3FQKA 4KB4A 3BN7A 1P8GA 3I31A 4RKUC 2O5JA 2JVRA 4KM9A 1TL1B 2VODA 2W2OP 3PJ9A 2CDQA 3US5A 2CVIA 1GMWD 2MTLA 4NMLA 4ECXA 1NHKL 2Y1IA 5CQGA 5C7PA 2WOMB 4WFAQ 2RHQB 4G7ZA 4C7QA 3OJUA 2M88A 3A1YG 3ZO7A 2CW0A 4K5SA 2FJXA 1CC8A 4MEYA 3JXOA 3U7JA 2ROEA 4H4KC 1ZOTA 4ZJOA 2NVXA 1JJCB 3EPGA 2A3JA 2WW8A 3VZHA 2W7OA 4C8KA 2Y8YA 2Y0SD 3QMQA 2J6UA 4HDHA 1LFPA 1Q7LB 1RDRA 2GQCA 4OJHA 3TRGA 3BS9A 2LA6A 2Z56B 4QOTA 2WSFC 3EICA 2PI5A 3WC2A 4UZCA 3GTKA 5B0AA 5BR8J 4XDCA 4X64F 2CFAA 4OHWA 3OUYB 2IMWP 4KO0A 1KLMB 2DRAA 3CCWA 1D3WA 4E2FB 3Q86A 3DOLB 3T5HA 1KFSA 1QE1B 4LFCJ 2AKWB 3HHLB 1HLWA 5SZTA 2HS4A 1CJUB 4RJVA 4W4MA 1M5SA 4QPTA 2M2BA 1G4CA 1HYSB 5CH7B 2YKPA 3KXDA 1RTDB 3OSPA 4QCLA 3H3VD 3ILLA 2GHVC 1VHIA 2U1AA 3W62A 2C28A 1H0HB 4ED4A 4DR6J 1CJTB 4KBIA 1USOA 2I0XA 1MMNA 4JI4J 2DO4A 2GQ2A 2ZH8A 1IBMF 3K5LA 1FDBA 3BBFA 2JA8K 2O5IA 2HYIB 3NOGA 5CCMA 4KFBB 3W66A 4ZCMA 3QT8A 4DL3A 3QATA 2W8LA 2BZ2A 4YG2A 5I3PA 2E2JC 4WTOB 1H6KX 2YNFB 1RE1B 3T9NA 1YZ7A 2RDDA 1NDLA 1KOOA 2DR5A 5IORA 5ETKA 4TYBA 1N4LA 4LRBA 3S1NK 1D1UA 3P4UB 3PO2C 1A6LA 1SQFA 4RW7B 4U6PA 3KYLA 1RP5A 1YNJA 4C3JC 2BRLA 4PPDA 1U1QA 4NA2A 4KMAA 4DV0F 4YB1P 2LQ9A 3O3LA 3CCES 5DM7Q 2BE2B 4P72A 4ZOSA 3R8YA 1TKDA 2V69A 2FHJA 1SH3A 2OEMA 1NSKL 1Q81T 2V2VA 4KH0B 1TUVA 2AYEA 3FCHA 3BYRA 5KFMA 1WDTA 1LK7A 2OD6A 3OVAA 1ZTTA 1SL0A 2MEWA 1TV6B 2GMJA 3RZDC 3FEZA 3RZAA 2EG1A 1IR2A 4DUTA 1I3OB 1T9TA 4DR2J 3AXKA 5CCLA 5HVFA 1HR0F 4B3TF 5C4XC 2RE1A 2FZGB 1JLFB 4HHHA 3S2HK 3LANA 4ENOA 3M8ZA 1Y10A 2XG8A 4OMFG 1K0VA 1IBKF 2F9DA 2R2SA 1X4DA 2VICA 4CO1A 3EVMA 5HVGA 5FJ4A 3IS9A 3HOXC 1XZQB 5C42B 3GIRA 4BS2A 4ES2A 4NRUA 5EWEA 2FUG9 1O2BA 3G6YA 3DI6A 3GU0A 4GTFA 2VFSA 5K8OA 4JP8A 3J80Y 4L76A 1R9TK 3Q2TC 1B4BA 4OINA 2PMZD 2AD9A 2BR0A 4PG6A 4C3HK 1O0PA 4F0MA 2I6WA 3KG0A 2Y8WA 2WVFA 3TVZA 5DO2A 3ENWA 2MPUA 5ETNA 2HG4A 1KFDA 1VQSA 3PDNA 3J7A1 4OI0A 3M2VB 1YHQS 1FKPA 4PKDB 4AXIA 3GTPK 1G2EA 2JHEA 2IBOA 2EPIA 4WCEQ 4NLXA 2VPXB 4CO0A 1X0PA 1GTHA 2BE7D 3GR1A 1WIHA 2VZ9A 1U48A 1UJ6A 2HRYA 2X1FA 3LP0A 1X4HA 2AIRB 2QX0A 2VASA 4DQIA 5ETVA 3SSQA 1RABB 1UEVA 3Q8UA 1QSSA 3R7BB 3AHPA 1YBUA 1FWPA 2H54B 4NI2A 4NE9C 2DNLA 1S0NA 2DRDA 2E29A 3SMZA 4IDKA 3BF4A 1KVIA 1S5ZA 3MMAB 3HOZC 2P9CA 2MZSA 3CJ3A 3R97A 1EETB 4GC7A 1D9DA 3GCWP 4BWJA 1O5JA 2VJUA 1FNMA 5E33A 1U1LA 2GIQA 2D6FC 3MPUB 2DNGA 2VH7A 1S1TB 2Z0GA 3BH7B 1TWAK 1UEUA 1ZPVA 2EWHA 4OJ1A 2A6OA 1I1GA 1X5TA 3CCSS 1ZS6A 1ULRA 2XCRB 5AXKA 4GFQA 3DOMA 2K3IA 2ZH7A 2JOQA 1WKJA 1HNWF 3U02A 1FWLA 3NS7B 4DX7A 3C66A 2BANA 1F7VA 3NCQA 2P6TA 5HQLA 3CDUA 3PO4A 2PSZA 2OD4A 3A4TA 3GJQB 3IWXA 2E5HA 1UJ4A 3N9UC 1SUQB 1INNA 2MSSA 2KFNA 1BLUA 3HVAA 1WF1A 3FCWA 3GV7B 5L1KA 2B4OA 2ZUEA 1E6YA 4C3IK 5IYCK 2OPRA 3N28A 1SJQA 3N79A 2QJ3A 3GTMC 3BGRA 4ZP8A 4O3PA 2GX8A 5LSLA 1USMA 1J5EJ 2QA2A 2JWNA 4P2SA 5KFWA 1VLOA 2HK3A 2WONB 5IP7K 2H48B 1OQ6A 2VL1A 5C5JA 1SIZA 3CD7A 1WEYA 1I50C 3ERED 2FDNA 5F8LA 3MFHA 4RUHA 5KFHA 2J7KA 2DH9A 2IYGA 4BY7K 2ASLA 3P96A 5AE1A 3FDSA 1REVB 4QW9A 1UTAA 2RIJA 3G86A 1SKWA 5KOWA 3M2UA 1RAGB 2EW9A 4GTDA 3I0SA 3M2RB 3MEGB 1LWXA 1NK9A 3KKFA 5LMNJ 2YWHA 5D15A 4L6V3 4TU9A 3MM9B 1X31C 2VPZB 3KJVA 1YTYA 1Q82T 4YUDA 4OHVA 4FVCA 2AJ4A 2YKNB 3CIMA 3MOZA 1KLNA 3LGNA 4DV4J 2GMHA 1YJVA 5HN0A 2EFNA 1MNEA 1VRUA 4EZ6A 3D0HE 2XZWA 2ZJPQ 2H4WB 5DM6Q 1F3FA 4WFYA 2HNDB 3FZ2A 3HOUC 3LW5C 3HM9A 1NHUA 1NPPA 2FHJD 1YJNS 4M5GA 3ZZPA 3E8OA 1GE9A 2R93A 4KTQA 1TU0B 3D3BJ 1VFJA 5ETMA 1D0EA 3BN4A 5KFPA 4FDFA 2NVYK 1RKIA 1FX4A 3ZXWA 2V2ZA 3D54A 2WHOA 3TNVA 3JB9k 3SI8A 3IA0A 1DBDA 1A0OB 2D74B 3U1NA 4CLPA 3DXJA 2KJWA 1S79A 2Y9HA 3GSDA 4LFBF 3D66A 1TKTA 4ZA1A 4ANCA 4FZBA 3AH6A 2V6AA 1GQEA 5DDQC 4MKBA 3E01A 3G4AA 5EGYA 4WU2A 2UXCJ 3HCXA 4MIWA 1RWXB 3T5KA 2WCXA 3UNGC 3M30A 1WCMC 5AJ3J 3FVYA 2H65B 4PQUA 4ED7A 2Y0BB 3UN5A 4KMUA 3W5XA 5TMCA 3GIIA 1WELA 5KFYA 1S77D 1HW9A 2UU9J 5FD1A 3L4KA 5A8WB 1RWWB 4F67A 2FVCA 1Y0HA 1Q95G 1H7WA 2MDAA 4K4YA 1UVJA 3N3YA 4DX5A 1M90T 3OPKA 2VOOA 1X9WA 4EI2A 4ZHRB 1MN7A 1RBLA 4LMZA 4CP5A 2HS3A 2OEJA 4FBTA 2FLPA 3M8RA 2VFRA 2A2DA 1PKUA 2K1RB 3A8IA 4K0KJ 3C16A 5KFEA 4PXDA 3S1RC 3X3UA 1HQEB 4DN0A 2E1CA 5TMFA 4DEZA 4B3RJ 3QJJA 4HACB 4GKKF 2L9WA 3VHQA 1EH1A 3IFEA 4HT5A 1VQ6S 4CYUB 4I2QA 4YQWA 2PFDA 2HEKA 2A6HA 4XSZA 1N88A 2C1EB 4DR3F 3MMJA 3TA0A 1RAFB 2MQLA 3FOEA 4OYAA 1G7CB 2W24A 5BYRA 4NCGB 3T1YJ 2CJXB 1AFIA 2XGPA 3TX8A 1ITPA 2DO0A 4BBYA 3JYTA 4YDXA 3Q0AA 4X6AC 4NLDA 2HAFA 4KC6A 3M6VA 2MGZA 4OZ3A 2F9JA 4DQSA 2QL9B 3EJMA 3L09A 1U6ZA 2OPQB 2L3MA 5KT3A 2DD8S 3CB4A 2V9WA 1FERA 1RAJA 3DDNA 2XY6A 2CUYA 3NRBA 3MXHP 4I6WA 1VC5A 4K50A 1R6VA 1HQMA 3PM9A 3CMAS 3OBIA 1O24A 1I94F 2R8JA 2RQMA 1U47A 2DITA 3MCNA 1R0AB 2E2JK 2NVQC 5F8HA 4X4RA 2Z2MA 3TQ1A 1EARA 3KK3B 4XDDA 1WF2A 3IWLA 3I9V9 2CYYA 3RW7A 2BYCA 4OZNA 4O4GB 2H9ZA 2R7UA 1AB4A 2YKOA 2C2MB 4MT1A 4PWDA 1U7LA 3PO2K 2OH2A 3FEXB 4JI0F 1W26A 2A6EA 3B8HA 5HQMA 3HT0A 4C3JK 3TUIC 3GJRB 1HWLA 4IQXA 2QZ8A 5DRKA 3PR4A 3UPFA 1SFOA 3SFGA 3V4GA 4KPCA 1YSJA 3QRQA 2J8AA 3H4DA 2RHSB 1K44A 2XYHB 3HOVC 1VDHA 1I5OB 4ECUA 2YNIA 1F5AA 3FBEA 4FM9A 3A3PB 1XZPB 1QD1A 1P1LA 4JI7F 1S6OA 2F40A 5D4PA 4P74A 2BJ7A 1OQ3A 4P5AA 2DGWA 3CJSA 2E7VA 2LKZA 3KHRA 2KXNB 5J2MA 1M1HA 5J2PB 2ASJA 4PG8A 4ZLNA 5AT1B 4Y7NC 5C4XK 4KKOA 3IMQJ 3ET6A 3KUHA 3NLCA 1IE0A 5A8RB 3C15B 1KQ4A 2WK4A 4DV7J 5LL6d 1P9YA 2F4FA 3FBFA 1JK9B 1M5OC 1EJ7L 1B3TA 2XY5A 3MPYA 3HOXK 3UD4P 1HI9A 4Q2LA 4CLLA 3QWPA 5J2QB 3CJRA 1C1CA 4ZPBA 3M8QB 5C25B 3AD9C 5JUMA 1OJ4A 2KHDA 5HL7Q 4OI4A 1Q53A 4G1PA 3IO1A 3R7NB 3DGPB 2HURA 3D1HA 2L08A 2VD3A 4F4XA 1U02A 1LEOA 3ZZRA 1S9FA 2M9KA 4M5JA 3KDNA 1NK4A 4AUKA 4ZPTR 4C0OC 4DR4J 2DCUB 4OHXA 2PT0A 1P1TA 4GO5X 3H25A 1TL1A 2L9DA 2JC1A 3DRYA 5T14A 3DLJA 4P10A 1PBUA 2DH7A 2WOMA 1UWAA 2IYIA 2E9ZA 2MKJA 2BUNA 2Q66A 3NOCA 1O6XA 1OYDA 3PW7A 3NGDA 1IJEB 5HATA 2YX1A 2PDAA 2MMYA 2F8EX 1FFGB 4KSEB 1DJ0A 3SEOA 1IW7A 2GSNA 4Q43A 1VRQC 4GTBA 2DGOA 2J8SA 3BKFA 5HROB 3MM6B 2HGMA 2V9KA 3CGIA 1FDNA 2ZOMA 3TZWA 2HMIB 5IYDC 3GJTB 1NKBA 4MKVA 3FOFA 1WF0A 4HR2A 3TANA 3HSZA 2HHHF 5B0FA 1I3QA 4OJGA 2PHCB 2HWTA 3HFZB 3AB2B 4RNOA 2RJZA 3K5MA 1S6PB 1JXEA 1X4EA 5IT4A 2HQGA 4N7TA 1R8PA 3AOBA 2DR8A 4JI5F 3OUYA 2QGFB 1TL3B 1FA0A 4A8OA 1KLMA 2HIYA 4DV5F 2MKIA 3NS5A 3CDAA 4X66F 2D9OA 1VR6A 2AYGA 2OKQA 5KG4A 8AT1B 1T3OA 3DOLA 3NL0A 1GNKA 4CM2A 1QE1A 1RLDA 2VDIA 3S14C 1YKWA 3KJFB 2HK2A 3HHLA 2IY5B 1WD6A 5JFEA 3GFZA 3NGKA 1CJUA 3VWSA 2LEAA 3L95X 1Q8BA 5LMUF 4M5LA 1HYSA 3BSNA 3S1MC 4LF7F 2GC8A 3CMQA 2W9CB 1RTDA 1RAAB 1Y1WC 4BBRC 1W2BR 2CJ9A 4C11B 3OEPA 1NPKA 1GK8A 4YHHF 1AYEA 2NYHA 3ZNJ1 3GTMK 4OLOA 1N5VA 2P8TA 1CJTA 3EYZA 4TU8A 1ZZFA 1KWMA 2ZFZA 3HULA 2CA9A 1P6TA 1KONA 3CXCR 4LBIA 1SJRA 4OLPA 3TYTA 4Q8FA 2RILA 2XWXA 1I50K 5D3GB 4ECTA 2AW0A 4UQGA 2MQMA 4KFBA 2R92A 3I4PA 1R8CA 4NYOA 1H38A 3CJQA 1EZZB 3GIMA 2AX1A 2ZBIA 5IT9U 2YNFA 2BOPA 4UOFA 3VV2B 3S01A 4PXBA 3NMRA 1JLGB 5KFCA 3MD1A 1XMBA 2HHSA 4NCBA 4JI3J 4MK8A 3QIPB 4RW7A 3LPYA 3C14B 2LECA 3HP6A 1T9WA 4O23A 3FC9A 2XO7A 3BB5A 4DR5F 2BE2A 3GPAA 4WFNQ 2V5HG 4MFBB 3MGJA 1FEEA 3W9IA 4YS2A 4XLNA 4Y2KA 4PXCA 3QZ8A 1WC6A 4ID8A 1RYRA 5D0EA 3OHBA 5M5YK 3IRXB 3TUZC 4U7UK 3FKBA 3KLHB 1TV6A 4WXOA 1V3SA 5IZHA 3QRRA 2W2MP 1KTVA 3QAUA 2OAUA 2YKMB 4P71A 2KM8C 2BKOA 2MZTA 4F4WA 2IHR1 1JLFA 2XNQA 1UETA 2DGQA 2F7VA 4ZN1A 1ZA1B 3G4CA 4OZ1A 4R25A 3TEGA 4N8NA 2Z4PA 2B43A 1WDDA 3N5FA 3M4OC 1S99A 1RWKB 1XZQA 5C42A 1C0UB 2QEXS 2DGXA 4N5SA 4XTTA 2IA0A 4X4TA 4NLQA 3ZTOA 2P9EA 4J9MA 4LIWA 1JJ2R 4DS4A 1XNRJ 4O2DA 3BO4A 2XCAA 2O1PA 3VCDA 4IH7A 3QFHA 4EUVA 1TWGA 2C3OA 2H4YB 1R6YA 2I2YA 4PEOA 5E3QA 4E0DA 1H2TZ 4RW8B 2BXJA 2DPJA 1X5OA 3M2VA 1M1GA 1OY6A 1K73T 5LM7E 5KFJA 1U25A 3AY0A 3HK2A 3KJQB 2HNYB 1XNQF 1O25A 1WCMK 2XBPA 4J91A 2ZZTA 1RHMB 3S17K 5CD4A 1QUVA 4NMXA 2DHSA 2B9YA 2CG8A 2E44A 4C8LA 1QAXA 7FDRA 3TQEA 4WFBQ 2BE5A 4IUFA 4CI0B 4ZVEA 4ZVGA 4WILA 4ZVOB 4QJVB 3PRVA 5FDLB 1KVKA 1VYAA 3RRHA 1XIQA 2VBXA 1TL7B 3H5YA 3MMAA 2WB1L 4PWUA 5ETRA 2QMUB 1ELOA 2H1YA 5EWFA 2YVSA 3F41A 1J6VA 3S1RK 1EP4B 2YWEA 3IGVA 3KHLA 3D7SB 1RBOB 4MK7A 2R2UA 2XLIA 1S1TA 1XN9A 4P2MA 2FVRA 5B09A 1K1SA 2WZ1A 3HJFA 1RXOB 2F3JA 2E1PA 1JNZB 4AQYF 3H0GA 4IR1A 4NPOA 1XMOJ 1J6XA 1S0MA 4OJ3A 4DDFA 4KE5A 2CJBA 1NRKA 3SCLE 3LWMA 3FSXA 4RUAA 3G4SS 1S0VA 5IXUA 3GTQA 4ERDA 2FIUA 4WIIA 3H40A 1WC1A 1SUQA 4TU7A 5RUBA 2MHEA 4FZVA 1B7YB 1LKZA 3G2XA 3C6TB 3KFWX 1TL4A 4USVA 3V6DB 3EZOA 5A8KB 4DV6J 1YWXA 4FNHA 1UVLA 2CQ4A 3FKIC 5LMUJ 4DX8H 2K2PA 3LOUA 4EZ9A 2ZE2B 2C2DA 1WOOA 2WONA 1BQNB 2HFNA 1QM9A 4WJ3M 2ROPA 3GTOC 3A8EA 4MEXA 4J9RA 2LQBA 2FQOA 4ZVUB 3M9NB 3OL8A 2XMAA 3IR7B 2B56A 4C9DA 3OFEA 5C24B 1S49A 2P2CB 4PWWA 1F9HA 4G0UA 4GVBB 3GTLA 2H3EB 3D6TB 3NBPB 1KDNA 4WJ4A 2VBWA 3MAAB 2ZKUA 2XZTB 1NJZA 3OLBA 2IC3B 5CXTA 1WI8A 4FXWA 3M2RA 3MEGA 4U8YA 1Q0NA 3LALA 3TWZA 4U9RA 4ED0A 4ER8A 1QAIA 3MM9A 1YJ7A 1BGWA 3HOVK 1NJWA 4HYKA 4IOAQ 1QVFR 2A69A 4DFJA 4FS2A 2ZBQA 4CZCA 4F4YA 2YKNA 4USWA 5HL8A 1PSDA 2JA5C 2OSRA 3CMES 3H5XA 4ILRA 2RVJA 2WW4A 3NXZA 3A13A 2VQEF 4I68A 4KIAA 2KL8A 2ALYB 2C42A 4Y7NK 4JB8B 4TY8B 2NCKL 3OTEA 2GAHC 4LSNB 3SSRA 2HHPA 1SH2A 2HNDA 3QQCD 2KHCA 3HJVA 1UP1A 4HVZA 3AFGA 2VUMC 2OPSB 5ETOA 5A0YB 4RNHA 4X4NA 1F7UA 1AW0A 1XR6A 4JI8F 3J80U 2XMJA 3D67A 4JV1A 3MCMA 4J9PA 1XC9A 3QGPA 2DNQA 1X9SA 4A3BC 3VR1A 3TZYA 2ZNZA 1OYEA 1LWFA 1OY8A 4F3QA 3T1HF 4I0WA 2KZZA 5IV3A 4AXJA 1YJ9S 2JX2A 4CO2A 1LXNA 2LCWA 2CZ4A 4X4VA 1B0TA 1UL3A 3I82A 3GTGC 5JMNA 1S9EB 3F56A 2G4BA 4A3GC 3GSIA 4NLSA 2BW2A 4DV3F 4JK1A 2B5JB 3I0RB 1N36F 4O0IA 2ALZA 1LW2B 5M2PA 4G3IA 1VMBA 3LAKA 1BWEA 2XMWA 1TK5A 3AT1B 4ZDNA 3HHNB 3PW5A 3DMJB 4DBQA 1MWZA 1YDLA 5CAAA 4YDDB 3N0CA 4AT1B 3G6XA 4FXDA 4CH0S 4FS1A 2ZH3A 4A3DC 2ATLA 3NWRA 1R8HA 5IT0A 4IFYB 1H3DA 3PHEA 5A8WA 4FN5A 3K59A 1G1XA 2FHMA 2HNZB 4NOHA 4L75A 4RNFA 2UXDF 2F1FA 3CDWA 2FZKB 2HKEA 2ZH2A 4ZHRA 3FJ2A 3UDVA 4ZVRB 4KAIA 4DSIA 5IYDK 1RZMA 3HX9A 2K06A 4LBHA 3EXYA 4EO8A 4DQRA 2JA7C 2K1RA 3CD0A 1NBEB 2YU9C 3MEKA 4RWWA 2YH0A 3R1HA 3BR8A 1HQEA 4ECVA 1CS4B 4K4XA 3DU5A 4HACA 4LF6J 2DR6A 3QT6A 1NB7A 2DNRA 4JI2J 4NOIA 4CYUA 3Q8SB 4WKYA 4B3MJ 2IRYA 4K4VA 1O2FB 4JYAJ 1XR5A 1HBOB 3S14K 2HIQA 2XS2A 4TN2A 3IBWA 2JFKA 3VQTA 4NCGA 1C0AA 2GW8A 4YY3J 2ZC3A 3H8YA 1TP7A 1N32J 3ZZZA 3S1MK 4RW6B 2VDHA 3VGTA 1BWVA 3TFIA 3Q8QB 1NPRA 2MQ8A 4B9MA 1Y1WK 2WB1D 3SZZA 5G4DA 1OY9A 4BBRK 2PO4A 1LWCB 4A48A 4PXEA 5KG2A 4QWAA 2YQ1A 2W4CA 2C2EA 2OPQA 1Z2LA 2AU0A 4O44B 3VGVA 1XXAA 2C2OB 1R8BA 1FTRA 1NDKA 4FYDA 4DR1F 2ZZMA 2FVSA 1RWUA 1TZ0A 4X62F 5F3ZA 1S9GB 2JVOA 4ZPVR 5IM0B 2VFTA 3T19A 4FYVB 1R0AA 1V9OA 2P6SA 5IWAJ 2NR0A 1JWWA 1FRJA 2CQCA 3KK3A 2PN6A 2MLXA 1H7XA 2MLYA 4Z7CA 2J0QD 3EQLA 2DXFA 4KN4A 1UKUA 1GMUA 3T02A 1RWNB 4TQRA 4JI6F 3ENAA 1TKXB 1S10A 2DHAA 4O4GA 2EFQA 4ZVFA 3THVA 1W7WA 4I69A 3GIJA 3G6ES 1VGYA 2J5AA 2KG0A 4QYZJ 4WK3A 1HNXJ 4HDGA 2BQUA 4GTEA 3DOKB 3UO0A 3VZIA 1O51A 2DIUA 2FC8A 2ADCA 1C0TB 1DD5A 1X9MA 5CYQB 4I56A 4LIRA 1M5HA 2NSBA 2MKKA 3I4HX 4A93C 3H7HB 2BQRA 2HBYB 1XZPA 1VOMA 2CFXA 1BD6A 3DLBA 2M52A 4OYMA 5J2PA 1FE0A 1DTTB 3GB0A 3V5RA 3TTGA 2BDPA 1XXCA 2GVDB 2EBEA 2POKA 4DL2A 1N5TA 3KLIB 1W25A 3RB4A 2HZCA 3D1QA 3AXMA 5DZ6A 1PJ5A 2MHNA 3UWTA 3C15A 5A8RA 4I1TA 2YX4A 4IG3B 3W7BA 1IKVB 2I5JB 1FT8A 3M4OK 2R7SA 4F3OA 4LR2A 1Y9OA 3ENVA 3MURP 2W2QP 3JQMA 2FGOA 5J2QA 1R0BG 1KHWA 4ZPAA 3ZNUA 3M8QA 5DDPC 5C25A 4W92B 4TY9A 1DZ5A 3CQZA 3C2PA 2GSUA 2ZOFA 3JTPA 4IRDA 2HGLA 3DGPA 1XK8A 3D4JA 1SJ4P 1FJGJ 4D3GA 1FD2A 1L0WA 1SJFA 2J0XA 4XAKA 3NAHA 4A8SA 2ACMA 2JDJA 1SVDA 2CPIA 2R3VA 2ZH1A 3HSGA 4NA1A 3UVJB 1U2CA 4A3LC 1TAUA 2GHPA 2AJ1A 2ZKTA 1KN6A 4RU9A 1RTJB 2R9LA 4A3MC 1HMVB 2HQIA 1MWQA 2VV5A 3PEJA 4JI1F 1GEHA 2B0GA 5IC4B 3AD7C 5B0GA 4A3KC 3QNWB 3QYYA 4CNZA 2CNKB 2KI2A 4ILDA 3UE2A 1S72S 4FYWB 2E2IC 2IDEA 4RPFA 1FI4A 2XY7A 4IH6A 1UPMB 3TJAA 1ROFA 4OHZA 4BLBA 1ZM2A 3EX7B 5HROA 1VQ8S 2OSQA 5AXMA 3MR6A 3MM6A 2CPDA 4I64A 1JLAB 2HMIA 1H72C 2AQ4A 1FJCA 2B8QA 4LRAA 4NXNJ 5KFRA 3KK1B 2NPFA 3WQPA 3EWGA 3MEEB 3E51A 2DXEA 4G6VB 1U24A 5HI7A 4CH7A 3LO3A 2OHDA 4LLGA 3GFXA 3S1NC 3GE9A 2DISA 1S6PA 2IAJB 1RTIB 4DCPB 5T41A 1TL3A 1XMQF 5EHHA 4P2FA 2Q43A 2PIIA 3L7OA 1D8ZA 1MLAA 2ZM6F 3HPOA 1K83A 1N34F 1RSCA 1FRMA 2R8KA 3CAGA 2PI4A 2CPYA 3O44A 4OQJA 4WZQA 4YOEA 3CVKA 2AX0A 4BHQA 3GP9A 4KHMA 1HBMB 2DR9A 2YTCA 2W9CA 4OZJA 3FFIB 4DLEA 3PW2A 4ZJQA 2XGQA 4C11A 2UV8A 2BACA 1FNXH 1S1WB 3O8WA 1B70B 4B3SF 4YFKA 3S2DC 5AE3A 4ID5B 2ILYA 4WPAA 1TL5A 1LV5A 1FNOA 3MTKA 1IQ0A 1FKAF 2AEFA 1F93A 5FLMC 5D3GA 4R8UB 1WHVA 2JH3A 4PABA 5D6GA 1DLOB 4DSLA 5J1NA 4B17A 3UR0A 4LR8A 4HTIA 4O3SA 3G8SA 3Q3QA 1CJKB 3FMWA 1GMWA 4ZIVA 4DR1J 4WK1A 1HD1A 2R7WA 1DQAA 3AODA 2B9EA 4C2MA 3CCLS 1L3VA 1K0TA 1GXLA 1JLGA 3HD1A 2E7WA 2Y0SL 4B9TA 2J6TA 3BKUA 2CAJA 3QIPA 3C14A 4CLSA 2H5IB 4DG1B 4V19X 2CQHA 1JMTA 3KWMA 2PC6A 3QLHB 4ZP9A 2QE5A 2VJVA 5K14B 4NLTA 1RADB 3OSNA 4KN7A 1VJEA 3M30B 4CLZA 3GTPC 2JA5K 4MFBA 2NXEA 4I2PB 3GQCA 4ECZA 4GRSA 2HHTA 4ZP6A 2BJ8A 3IRXA 1XQIA 3KLHA 2O66A 3T5LA 4KHPJ 4IFVB 1DHMA 4Y2MA 1WQHA 2JFDA 3DFEA 1DCHA 3P3DA 5H9EJ 4EBCA 2DNMA 1H2VZ 2YKMA 3BP8C 7FD1A 3LP1B 2X3DA 3DNCA 2VUMK 4IRKA 3HF5A 5DJBA 1NNDA 4JBCA 2BEFA 5LXYA 2OO4A 3Q2SC 1KC8T 1MSWD 4A3BK 1N33F 2V8VA 4USKA 1S1UB 2HQFA 5F8JA 3P5TL 3AOCA 1WKLA 3B54A 1C0UA 2RQKA 3S1QC 4URQU 4MAKA 4AL7A 4WZMA 2XI3A 4LF8J 4PCQA 2UUAF 1DAXA 4M5DB 2E7XA 4ZK7M 1N48A 2YWWA 2KU7A 4A3EC 1UW9A 3GTGK 2IPOB 1HQUB 1NZ8A 3RB0A 4P73A 4TQSA 4A3GK 2D7SA 5FJ8K 5K8PA 2G9OA 2GZOA 4ZVHA 4LFAJ 2NREA 3BQ2A 1U6BA 4RW8A 4KAWX 3DLGB 2KWAA 4DJBA 2CPJA 3TUJC 3O6QA 2RUGA 2XS7A 3CPWR 4OV1A 2HNYA 1YJTA 4OZ5A 2H5EA 2UUCF 4OI1A 1X7VA 4Q44A 3L4BC 2WB4A 1KTQA 3J7AN 3OXLA 1B4AA 2AHOB 1S12A 3R5CA 5BJRA 2ASDA 5KT5A 1U1NA 1U26A 2R42A 4LF4J 1AT1B 5ETPA 3MM5A 3PIPQ 4LR7A 2CPFA 3NKYA 1FXRA 4QJVA 2DIVA 3R1LA 3QX3A 2KVIA 5FDLA 5HQ8A 5L9XA 1FTCA 4EO6A 1YLXA 1L3TA 1TL7A 4OX7A 4XK8C 3VGSA 2JA7K 2FD2A 2YU9K 5HK4A 1Y7PA 2ZC4A 2ZBCA 2DNZA 1K9MT 1EP4A 2UXBJ 2RU9A 1VC0A 1N52B 4HH0A 3QO9B 4DFKA 2WVBA 2QA4S 3W9HA 1VH2A 1RJJA 1PCAA 1R89A 1UVNA 1RT7B 2V8DA 1T02A 4GTAA 4RX6A 1XWLA 3VVUA 5HLFB 4ATNA 4A3IC 2DXDA 1VQ7S 2KO1A 2MZJA 3M9OB 2CPXA 4EBEA 4QWEA 3M1VB 1XMQJ 3Q83A 2NPIA 5L9NA 4Y28C 3PEHA 1VI7A 2DNPA 4DX6A 3C6TA 5E0OA 4HKQA 3V6DA 5JVGQ 5F41A 5A8KA 4C8MA 3AQPA 2Z8QA 2W25A 5DG9A 5CABA 2ASYA 3GTJA 1CULB 4QYZK 5E3RA 4ZVPB 1L5UA 2ERRA 3MR7A 4DV1F 2ZE2A 3HSDA 3LAJA 3D3CJ 2HVEA 1BQNA 4ALZA 2NVYC 1U2RA 2CRLA 4WYLA 3G82B 2DRBA 2PMWA 3EXCX 2V6SA 2HQDA 2GVZB 5EGHA 1SL1A 5C24A 2Z2ZA 1TVRB 4GVBA 4DFPA 3NBPA 2LMIA 3RGIA 1HI0P 4LSLB 3MAAA 2OLWA 2B63C 2MKCA 4XO0A 1RT4B 2QO3A 4DV2J 2IC3A 4PRFA 4BCAA 1EB0A 2MY7A 4I67A 2Z57B 3R5JB 4G1QB 2YNHB 1SKUB 2LDYA 2JRSA 2HHXA 3KG1A 1FDAA 4A93K 3TJ9A 5C3EC 2BABA 1JKHB 2QTWA 2LFVA 4UOGA 4KYZA 2AJ0A 2BRKA 4YB5A 2OMLA 2V34A 4K4TA 1T7PA 1R9TA 4G65A 1QLNA 3P49B 4YN3B 1SKRA 4F7VA 4DUZJ 5L8RC 4GTLA 3MEDB 2K3KA 1NKCA 1HWIA 1AUSL 1NO8A 3J81U 2BKNA 4DI6A 4TY8A 1Q4RA 3VALA 4LSNA 1FFWB 1UMJA 4Y34A 5BYQA 1Y5LB 1IS1A 2RSQA 4V1Ak 4OHYA 1FRIA 2OPSA 4IYQA 5A0YA 5HBMA 3HVTB 1GT8A 1KD1T 3HDSA 1ZETA 1MU2B 4K4WA 3ZZYA 1WJ9A 3WC0A 1M5VC 4PG4A 2DHXA 1X4CA 1ZH5A 3M32B 4LF9F 3V6HA 2CQ3A 4RWXA 1GXTA 3PXGa 2UUBJ 3KUGA 3UN3A 4LR9A 3DLKB 4AYBL 1D9FA 4DL4A 4D3HA 4ZP7A 3PX4A 2B4VA 3IR6B 1S9EA 1XERA 2V94A 2XMUA 1P9QC 3RG6A 4F0HA 2B5JA 4IR9A 3I0RA 1IKWB 4A3LK 1TKZB 4DUYJ 1LW2A 1HBNB 3PYFA 4Z7YA 5E3PA 4LF5F 1VBYA 4A3MK 2UVRA 4LRFA 3LH2S 3NNAA 1TWAA 3ADAC 3OXFA 2YPZA 2XC9A 3DMJA 1BE4A 1BS2A 5M3FK 2YKQA 1JB0C 4A3KK 2CJKA 2VFUA 4B9LA 2B8PA 2RS2A 2E2IK 1OO0B 4QR2A 3K5OA 3OFGA 4IFYA 2E2HC 1XPPA 2UVVA 4NA3A 1IKXB 2HNZA 4DR7J 1HHQA 2CJAA 3UQSA 2MY8A 1RLCL 5D0HA 3R3TA 2HHQA 3CEDA 2I38A 2ZH9A 4H4OB 2LLZA 3W65A 3O1LA 3T9ZA 2FZCB 2C3PA 1CC7A 1F3VA 1VISA 1IVZA 1TWCC 1YVFA 2A1BA 2R7ZK 3CTRA 2QN6B 3T6JA 3S1TA 3PVXA 5K5MA 4NLWA 1CS4A 4BLAA 2CQ2A 2EEYA 3OR1B 2O01C 3JQJA 1FRLA 5L1LA 3NWGA 3MCSA 4V19J 2J7UA 3TA2A 1NK0A 1RT2B 2A68A 3TX0A 2OP5A 1TWFC 1DQ8A 5AXLA 2C3YA 1HBOA 3KUEA 2IMOA 1JOEA 1NAQA 1NSAA 4TXSA 2R8GA 3AJ2A 1JIHA 3WX8A 2COLA 1KHVA 2ZBRA 4P5BA 1KQFB 2QA1A 4H4MB 1FEHA 2OMOA 3BR9A 1KR4A 1SBRA 4RW9B 4ECSA 1UVIA 3D6MB 5KFFA 3K0JA 1TUWA 5LXRA 4RW6A 3RBXA 1IBLF 1T0TV 2WTFA 2JEGA 2W4DA 1TWHC 1S76D 1LWCA 4UUXA 4UQTA 2RU3A 3S2DK 4O44A 1RU0A 1U8SA 3HFKA 5IOQA 4F0KA 1NK6A 1LWEB 1RT6B 2X7IA 3EM1A 1G3OA 2MQPA 5FLMK 1SPBP 3MUVP 2LA4A 1S9GA 5IM0A 1SC3B 4U8VA 3BGFA 1RT3B 4X84A 1TK0A 2DHHA 2N4CA 3BGOP 4DSKA 5E3CA 3DLLQ 4AE5A 1K8AT 3EVOA 4DF4A 5AE2A 4OZ0A 1BC6A 4C3LA 1WSVA 4KGXB 3KDOA 1TKXA 1SI9A 5H9EK 3KNGA 3ELHA 2ZH6A 1A7GE 5ETTA 4EEYA 2D1CA 4W98A 4B9VA 2KXFA 3QIDA 5U47A 3T5JA 4GMKA 1VBXA 4NLVA 3DOKA 1RWVB 1M5PC 2EK1A 1C0TA 2RF2B 3UCGA 5CYQA 4WBFA 3FBCA 2VBZA 4X65F 3S6EA 4ZN3A 2F4VF 2JA6A 4KB2A 5D4OA 3LTOA 1YCLA 5K8MA 4O3OA 2A2CA 2AWZA 2B6AB 4XCHA 3UDCA 2HVIA 4DCJB 1DTTA 2EFOA 1QTMA 2ZH5A 1RGVA 3T3FA 2QLBB 2GVDA 3KLIA 1ZA2B 4UF4A 3OW2R 3TR5A 1HNZF 2KTQA 2RMLA 4IG3A 1VRTB 2J7WA 1IKVA 2I5JA 3CJ0A 3CT9A 3U1MA 4CT9A 1RKJA 4CLYA 4OX6A 4H54A 5D77A 2NXNA 2KRRA 4H4KA 3S1QK 2NUUG 3CCUS 2L48A 2V4JB 2XNRA 2NYIA 1KKHA 4MQ9A 5I3QA 3DRSB 4A3EK 3EGNA 2Q6CA 3S16C 3V6JA 4ZJLA 4IOCQ 3I56S 2MKYA 2Z58B 1FE4A 4NXMF 4PG7A 1Y1VK 4WYWA 1LK5A 4ED3A 4BBSC 4X64J 3GONA 3UVJA 2H5JB 2XSFA 3SV4A 3RYLA 5B0EA 4C45A 1RTJA 1KQSR 2IIHA 3EPIA 1HMVA 1B7FA 3TOQA 1NB2A 3CO0P 4OYPA 2C2NA 4EYIB 4JV5F 3QZ7A 2R2TA 3S8SA 4CLKA 3QT5A 5TJ3A 5IC6B 3DN9A 2GGPB 2OPPB 2VF3A 3NGRA 3M8WA 1QAYA 3A8JA 1YBTA 3WHIA 4RMFA 4AYBD 4KGVB 4OI2A 2ZNYA 3HKZL 1RA7A 5KFUA 2XCQA 2HGNA 1DFDA 3NNCA 3D6HB 4FF3A 3ISZA 4DF8A 4UZBA 1JLAA 3FZBA 3PFOA 2UP1A 3KK1A 1FF2A 1IBMJ 2MYFA 2GIRA 3MEEA 3Q24A 3SBMA 1XBWA 2MZQA 1OMSA 3HI9A 2XHWA 4J5OA 3FQLA 4A8FA 5DQHA 3KHHA 1KVJA 1FCAA 2IAJA 1RTIA 3GDZA 2BBEA 1F9NA 1DRZA 2ZWPA 4RZRA 2X3GA 3NGSA 3CJ5A 1D9AA 3CNQP 2RS8A 2M8HA 1F9EB 3FNNA 2VUGA 4F25A 5GADI 4A3IK 3BZQA 4N76A 3GEHA 4GT9A 3AOAA 5KFIA 1F5CA 1JQGA 2NVTC 1ACMB 2LDIA 1PAEX 4IQMA 1S6UA 4DV0J 2P9GA 3GJSB 2D3O1 2FJDB 3TEHB 1U1MA 4N47A 1YQHA 1HBMA 3W60A 3THTA 2QLFB 2VG5B 3MI7X 1HQ2A 3FFIA 1U0SA 5F0WA 4NRTA 1RU1A 1BXNA 1S1WA 2VA2A 3U1LA 2JLGA 2N3LA 3EZUA 3M7VA 3NMAA 3OTBA 1TELA 2EXUA 2F8HA 5HO4A 4ID5A 1F0XA 3WX4A 2V50A 4DL6A 3O5TB 3BQ1A 3LPXA 2QSFA 4CNYA 1HR0J 4B3TJ 1K47A 3MHYA 2XMKA 4KPYA 5B08A 2PA3A 4QIGA 4R8UA 5I3UB 2AGQA 5ETSA 1GX6A 1DLOA 1LWFB 1SJ1A 4WP3A 4U7CA 2MZ1A 3SV3A 5M5XK 1FD8A 3N5BA 2KM8B 4ITSA 2GHWA 2NS1B 4ED8A 1CJKA 1IBKJ 3OREA 4NZ0A 3H20A 3K8VA 3V4IB 2RH6A 4CH1A 3VAKA 1F1BB 2ZWOA 2B63K 2CQIA 3SCJE 3M8YA 2J9EA 4L3NA 1HNIB 2A18A 3SZ2A 1T9YA 4IKAA 3LP2B 3CCJS 1DARA 2HVDA 4IH5A 1T9VA 4DG1A 1RB0A 5E7OB 1F2GA 3R5GA 2NVXC 3PX0A 3N6MA 1BJTA 3QLHA 3GFYA 1LFWA 5F3TA 4JV2A 5C3EK 2AYBA 2AV5A 2BM0A 2IVYA 5K14A 4RUCA 1C4AA 3OFFA 4X4QA 3RRKA 3FUYA 4ETXA 3D68A 2LU1A 2IVMA 3CUNA 4I2PA 2OELA 2R7OA 3S17C 5F0UA 1CEZA 3GG0A 3GYGA 4IFVA 1RHRB 4YP3A 5ITHA 3CC2S 3EGWB 2BJ9A 1Q1KA 5IFMA 2DHGA 1U2FA 2HBZB 3LP1A 3GTKC 2VPYB 2HHVA 5J2NB 3CCMS 2O3DA 3N0BA 2W2PP 1S0OA 3SQOP 3GEIA 4KV8B 4FYYB 4UT4A 2MXYA 4J9NA 4KRWA 3K5NA 2E9RX 4B3OB 5BR8F 1SJ3P 3JTOA 4DCOB 4C6AA 3EUNA 2DT9A 3NCPA 2KFYA 3AB4B 5CA5A 1BMQB 2HFSA 1S1UA 2JLFA 4N8OA 1T8EA 3WODA 2YPYA 2CVEA 4TYAA 1RHQB 5BXIA 1IN0A 3FK4A 4LFCF 1ZYQA 3NP5A 4NEYA 4M5DA 3OPFA 4S0MA 3SCIE 2KDOA 3ZC4A 1HQUA 1O8BA 3IR5B 2ZITA 3VA7A 2QLXA 4PYDA 4USJC 3SZYA 1ICEB 2OI2A 2JZ5A 3LGMA 1IKYB 3IC1A 4MYTA 3DLGA 2CQDA 2D3UA 3OJSA 5A2QY 1HNWJ 5THWA 3D6FB 4HHJA 2CNLB 3MDFA 4JI4F 4WTYA 4ZLLA 4O3RA 3KLGB 2GAGC 1YJUA 1YZ6A 2ZJRQ 3TW0A 1ZBSA 2E2HK 3MCOA 5KFAA 3VAMA 3CCZA 2LQ5A 2MKHA 1M5KC 4ECRA 4C8ZA 1U1OA 3DRPB 4X4PA 4RW4B 5A76A 4BKWA 1VQMS 4LJMA 2J9DA 2KJVA 4QWDA 1TWCK 4CCHA 1DCPA 4ZVQB 1K83K 2PE8A 3MZIA 4L74A 1PYTA 5HP1B 3H98A 3TA1A 2OGUA 3L4JA 3GTMA 1GX5A 5HMYA 2CIMA 3HOYK 2MZRA 1LNQA 4M5HA 5D4DA 4ZPCA 1UV7A 3E2EA 3C3LA 1G51A 2AJFE 3QO9A 1T11A 3N4WA 2FJAB 1ZZNA 3CWJA 3NAIA 1I50A 3OTOF 3TP2A 5KFGA 4FF2A 1TWFK 1RT7A 3SDEB 4B02A 3DHXA 3RZOC 2Q79A 2R7TA 2P5VA 2N7YA 2ATCB 1WQGA 1T3NA 2HZAA 3HKZD 5HLFA 1WC3A 3T41A 3GZ7A 2IM0A 3SIPB 4IOBA 4JUZA 3BM7A 3ILOA 3M1VA 4LK0A 5E2QA 1NCLA 4PQAA 2W9AA 3ENQA 1TWHK 2JEJA 3NUHA 5HANA 1TAQA 4L73A 3VAJA 2FJWA 2M5YA 2WRMA 1JJ4A 3MAHA 4DL7A 2GSOA 1Q5YA 4P7TA 1PYSB 4Q5VA 1CULA 3A8KA 2FY8A 3LPEA 3MMBB 4QIEA 4FPIA 4B08A 2MSTA 3HOWC 1E6VB 4DPTA 4LQ3A 3G82A 3SSSA 2I8EA 4ZVTB 3RB3A 1VQOS 2GVZA 3DDIA 3VVTA 2DH8A 4F4AA 1QSLA 1TVRA 2XCPA 8ATCB 5F8IA 5E5NA 2QYGA 2EC2A 2MQNA 4WE1B 4LSLA 1JX4A 5IOSA 3IP0A 2IRUA 3T00A 1AZSB 1RT4A 4KH1B 4Y00A 3RW6A 5LSOA 1K1QA 3FRYA 1PC4A 2WVCA 4G1QA 2YNHA 1A9NB 2OFHX 3GG1A 4LFBJ 2LQ8A 1JKHA 3ITHB 1F60B 2XULA 2LXUA 3L9ZA 2EBGA 3H2LA 2OEKA 2W7VA 2B4UA 5KG0A 1NJYA 2E9TA 3MEDA 1Z1ZA 2BJ1A 1OPIA 4LVNP 1URNA 2OIHA 1R27B 3M8PB 4EWTA 4PPZA 3PKMA 4J3NA 3Q23A 3BJYA 3TFJA 4P9SA 4OIPA 5F8MA 3HLUA 3UCZP 3TUPA 3HXAA 1FX2A 3OL7A 1WCMA 3HVTA 1EFWA 4ZVSB 3L3CA 1MU2A 1S7IA 3K17A 3JS9A 4NLRA 2YNGB 2EKYA 1VQKS 9RUBA 3IAM9 2VIHA 4FKXA 3M32A 3DXSX 2HHUA 2KVQE 2NXUA 5LSRA 2QFJA 4RBVA 1HARA 3S16K 3OTDA 3DLKA 3CJ8A 4OFZA 2KT3A 4X4OA 2GJFA 4NLPA 4USHA 4USMA 3MF5A 3BDPA 3P45B 4OI3A 2LXFA 4BBSK 4GKKJ 3MPVA 3K2YA 1IKWA 1XTZA 2ZUAA 1TKZA 5D4LA 1HBNA 2PFFB 3GCXP 4DR3J 4LQYA 1J5EF 2XQCA 2HS0A 1T9XA 2V68A 2DGTA 2XMTA 2NZ4A 3WIUA 3GEEA 2BE9B 2N3OA 2YQ3A 4Q8EA 5B0CA 2CQGA 1Y5NB 2R8HA 2D3ZA 1AB8A 3BP3A 2C3UA 2DR7A 3AA8A 2L9NA 2QL5B 1IKXA 4CQ1A 1EQ0A 4Y2CA 1CQNA 3W63A 1LW0B 4WP9A 3HZGA 3PRBA 3F44A 5LOQA 4H4OA 4CO3A 4WXWA 1WC4A 1NK7A 4PUOB 2L41A 3ZZUA 4CWBA 2GO8A 4G1IA 3QRPA 1MMLA 1TFYA 1APSA 1AFJA 5LMNF 2RAQA 2YWGA 4HL9A 1I94J 4XPEA 3QFWA 4DDQA 3GILA 4R0JA 3GMGA 4Y3CA 2E5GA 3OR1A 2ZHAA 2MJNA 4DV4F 1IWAA 1RT2A 3OL6A 3ILJA 1N5YB 1UEKA 2IM2A 4BXXC 1RBAA 4KHRA 3QWUA 1X4GA 3IM9A 4OIOA 3GTJK 1HWUA 4QIVA 4JI0J 3OD2A 1R43A 2MLZA 1UZHA 2NVTK 4CLTA 2R93C 4MJKA 2CQPA 2DGUA 4H4MA 1OIAA 3OTOJ 4RW9A 3MMCB 4M5MA 2RRBA 2ZBPA 1MMDA 1NXIA 2KB2A 4I7FB 4P7VA 4YFXA 4OYZA 4Z2XA 2HFOA 4LOWA 2KYZA 1YJRA 4G7HA 2RT3A 4OYBA 2WAQL 4JI7J 3TAMB 1KS2A 3KOAA 2D69A 1LWEA 4K4SA 1V6HA 1RT6A 1UA0A 5E3AA 4NLYA 2V6UA 2PA8L 1RISA 1CVJA 4IO1A 3J81Y 1X4AA 4FKYA 1W2IA 1FRKA 3JSMB 4M63A 1SMYA 3M3YC 3OTCA 2GS8A 2HWHA 3H4BA 5JXSA 5C2GA 1N56A 4HEA9 1S4FA 1RT3A 1JXVA 5IV4A 1HNVB 3E3XA 5GADU 2ZHOA 4QIFA 2ZVIA 3M6WA 4WU3A 4F04B 5DG7A 4KY3A 1N8RT 2UXCF 4U67Q 1X4BA 3W2WB 2W01A 1Y4ZB 2AMCB 4RNMA 5IQ6A 2OJ3A 4U7UD 2RQ4A 3MM8B 1MROB 1QVGR 1U6FA 2NVXK 2C2KB 5AJ3F 3MUMP 2GMLA 2VHGA 3K89A 4QQBA 2AGOA 1HPZB 1TUGB 4M5KA 2YBVA 4C97A 3TAQA 2RF2A 2UU9F 1WUUA 2ZOGA 1FESA 4TNOA 1D09B 1UAWA 2CQ1A 2IJFA 4NLOA 3BSOA 1Z4UA 5HVHA 2AP6A 1CG2A 4UW2A 1N0UA 1PBAA 2X51A 3Q8VA 4ES3A 4OIQA 3M4XA 1X0FA 5D8HB 1IQTA 3OLAA 2B6AA 4L72B 3MM5B 3GTKK 1B0PA 4O3QA 4DPWA 3SYZA 4XLPA 4K0KF 2XLJA 3M05A 3QSYB 4OYOA 1REGX 2K8GA 3OR2B 1HWKA 1J98A 2RKIB 4B3RF 1H74A 4DSJA 2HVHA 1VRTA 2ACYA 1V3ZA 5DDRC 2QV6A 2FLNA 3MD3A 1WHWA 1ZXOA 4Y2IA 2VONA 3PX6A 1HWJA 2B3TB 5CHCB 4PYAA 3CJTA 4WP8A 2V4JA 6FDRA 4ZLJA 2W8KA 3EZ5A 3MAQA 5DGBA 3T1YF 3U27A 3DRSA 2HQCA 2DBBA 1GTEA 1F9FA 2RNEA 4M94A 1UPPA 3RB6A 5B0BA 2HHHJ 4FVMA 1VCTA 4R0EA 1JXLA 2QLWA 1PGZA 5JJBA 3PZPA 4B9UA 2LEPA 2B9WA 1AXQA 4AFFA 4ED5A 2KZMA 4JI5J 1F5BA 4IO9Q 2NSCA 5C4JK 5FLXY 4DV5J 4A8YA 4A3FC 2Y1JA 2P8IA 2PMHA 4X66J 5BYSA 3QAEA 1KNZA 4DQQA 2HRUA 3QGGA 2OTLS 3DDKA 3SCKE 3RU0A 4I6YA 5GVQA 3OV7A 4Y52K 4LT6A 3Q22A 1JLQB 3H2UB 1NDPA 3NCRA 4CO5A 4QU6A 2RGRA 2GGPA 2OPPA 2V63A 1FDDA 3AH5A 4EYHB 3OT9A 1ZBTA 4C98A 3VAIA 4DL5A 1C1BA 2XYPB 2HFZA 4LF7J 4NYPA 1VK8A 3THPA 1TK8A 5KG7A 1IWGA 5KFLA 2V4QA 4YR3A 1EHWA 3IN5A 2VFVA 4YHHJ 2ZUGA 4FNIA 1VJWA 4KT0C 2Y3YA 3CDBA 1WC5A 3ETOA 1Y1WA 4JV0A 1SFOC 1X4FA 4DWIA 4NCAA 3TZZA 4M1KA 9ATCB 3BGUA 4OZ2A 2DYAA 5I42B 1RU2A 3TVKA 3MPWA 3N6LA 1SC6A 3HD2A 3PY8A 2NLWA 3ZTPA 1WTFA 3PJWA 1U1PA 3RZOK 2QMXA 2M8DB 2AZ1A 5HSPA 1Q8KA 4ES1A 1Q79A 3H90A 1D8YA 4LF1A 3K8WA 1U0HB 3ICLA 4R5PB 2JC0A 4I6AA 4DV7F 3N0VA 3HHKA 4ZPDA 4DR5J 2V0NA 2VG5A 2DB1A 3MWBA 2M4MA 3TVYA 4X4SA 3MM7B 3B78A 4Y2AA 4ECQA 5I4MA 2YXLA 2WVEA 3JSBA 4J9QA 2ZD1B 1FRHA 1IBAA 5HBMB 1RT1B 1M1KT 1FRXA 2VB6A 1AUDA 1X8DA 2R7QA 4GVLA 3HOWK 4QBUA 3NGUA 2VC1A 4YR0A 1EKSA 3L7UA 1VK3A 5I3UA 3CDEA 2F5GA 1RI7A 3BREA 2XSJB 4DR4F 3PTWA 3V4IA 2J0SD 2JA6K 4ELUA 1NLKL 2M3DA 4HT7A 3DRXA 2H51B 2M7SA 1YRUA 5CYMB 1HNIA 2JEIA 3LP2A 1S1XB 1I6HC 1RACB 2WAQD 1U8WA 4AD6A 3PV8A 2FJBB 2ZFHA 2R2RA 2V8HA 4WF9Q 2GCFA 4F2RA 1HA1A 2XHCA 2MQQA 4DFMA 3R9LA 1HHTP 5KT4A 2PA8D 2LXIA 1YJWS 2EKNA 3I4NC 3I6PA 3BQ0A 2XB2D 2IM1A 4DOZA 1PILA 2LP4A 3KTQA 2FB0A 4KDDA 1I3QC 3B4DA 5L39A 4LRDA 2YY3A 3FSYA 5L1JA 1T9UA 1VS3A 1XNQJ 4ZMMA 2QYCA 4J37A 3POTB 5J2NA 1EQRA 1NU4A 4A8XA 2QMWA 2V2KA 1IR1A 3H2VE 1J2VA 2XI2A 4KV8A 4Z37A 3J81j 4B3OA 4DN9A 2HRTA 3DYAB 3BYPA 3DLEB 3ILIA 2Q6BA 1VQPS 3HHLC 5E41A 3CCRS 3DGVA 4USTA 2DY9A 1PC5A 2Q3PA 2IA6A 4LQ9A 2KXHA 1WORA 3A12A 1EIYB 2Y1RI 3CF5Q 1FXDA 1TTHB 3GV5B 3V81B 4QIWL 1X60A 1N6QB 3QBCA 5EN1A 2X1AA 1IKYA 4AQYJ 1IBCB 1RWMB 1SCJB 1J5OB 2R92C 3DHWC 3G87A 5HJYA 3DC2A 3PO3C 3KLGA 1YNNA 3W2VB 4DS5A 3RTVA 2GA7A 1RHJB 1WG1A 1HD0A 2V6TA 1WTBA 2DVIA 1RYSA 2UVWA 3KMQA 1N0VC 3KLFB 4KMDA 4J9LA 2YWKA 3TARA 4F26A 1WHYA 2QLJB 4Q45A 3DRPA 2YKAA 3OVSA 3AA9A 1CJVB 4RW4A 4MIAA 1VIXA 2U2FA 3UNYA 5H1SV 4RBUA 4JI3F 1JLCB 4DMZA 1WOSA 3EGVA 4NLUA 2BW7A 5EGEA 5HP1A 3FKIA 1HI1A 3NNHA 1QAJA 3R27A 2FGCA 4OX9F 4YR2A 2HLTA 2BV3A 1IM6A 5H9FJ 4C3KA 8RUCA 2FHOB 1VBZA 2CPHA 2XM3A 2F8MA 1FJ7A 4WKRA 3KK2B 3BO3A 3GTOA 3BGLA 2W9BB 1CBKA 4BXXK 1YIJS 5GMKa 4WWSA 3W5YA 3D0GE 2RDJA 3SDEA 4M1XA 4KC5A 5ETQA 4K4UA 2LQJA 2R93K 1U1RA 3QGIA 4GZYA 3ETMA 3LUYA 2LVWA 4CT8A 4DHVA 4DL0C 4C0BA 4ICLB 1SV5B 2OTJS 1OSCA 4Q0BB 1VLYA 3DCAA 5CZVA 3RZDK 1BDFA 1HFEL 3SFUA 5C2CA 5M3MK 3MFIA 1UA1A 3PKYA 2RB7A 2CWKA 3BH6B 3NEKA 4DZDA 2BMBA 2E1RA 3RJMB 3FBBA 3M9MB 1MWYA 1B0VA 4OX8A 1AA1B 3RAMA 1YK9A 5KFSA 2VQEJ 3MMBA 1WEXA 3AD8C 2JA5A 1VQYA 5HMXA 2BJ3A 5D0RA 1JQWA 3AJDA 1TWGC 3M3YK 1XNRF 2EI5A 2XZDB 1E6VA 2FPHX 2KG1A 1LQ9A 3P5BP 3RAXA 3RR8A 4F2SA 3FCVA 5KTQA 5DZ7A 4EBDA 5SUHA 3GV8B 3IWNC 2QSWA 4JI8J 2Z2YB 2HQ3A 3NGTA 3K7AC 2VUMA 4ZCKA 3IBFB 4WE1A 3KLEB 3CO9A 2G1DA 2FQQB 2WBMA 1AZSA 4ZCLA 3HXMA 5KFQA 2AZ3A 1OPZA 3JAMY 1IQZA 2DCLA 4OI6A 3T1HJ 4CM0A 5DGAA 2QA4G 1G6BA 1NKEA 2FJVA 5DETA 5ETLA 4C4WA 3BPDA 1HI8A 4ZIWA 1I6JA 1RA6A 1RWOB 3ITHA 5IS2A 4N77A 2NQPA 3CC4S 1Y3JA 1T05B 2UUTA 4DV3J 4G0WA 3UN2A 1DTQB 1ZM9A 1N36J 3GTGA 2C22A 3UD3P 2UZAA 2E5LF 4GKJF 3HHDA 3ISNC 3G8TA 5FIIA 3M8PA 4ANDA 4KMHA 5DQGA 3H5UA 4F3MA 3UI3A 4WFXA 3PCOB 4P6QA 3H0GC 2LEBA 1H2UX 4NL5A 1PJ6A 2K7JA 1RTZA 3HOZK 3DKDA 5K20B 4KARA 2N7CA 3CE8A 2ZH4A 4K59A 2YNGA 4QWBA 1XMOF 2R7ZC 3RRGA 2IFXA 1AROP 4E8UA 2R7VA 4LJZA 2QC3A 1UVMA 1WI6A 2UXDJ 1OWXA 3FRZA 3GTQC 2LYVA 5D4NA 3T01A 2BVZA 1SIWB 1WACA 1RQ0A 2ZEJA 2XS5A 5A2QU 2RRAA 6FD1A 3BSCA 3WZ0A 3QPIA 3M8SA 2G2OA 1ZYRA 5CHPA 1LOUA 2GNKA 1S7HA 5CYJA 1UFLA 4DU7A 2JA7A 4P2XA 2I9SA 3I5BA 1QUPA 2YU9A 3I32A 1KP6A 4DV6F 3ZZ0A 4A3FK 2V8GA 2I1RA 2DNYA 2FVPA 4UTGA 4F36A 5T7LB 2ZZNA 2HVZA 2DNHA 3R7SB 4PG5A 1EK8A 5GAEI 3WIVA 1ZM4A 2J9DE 4GO7X 3VF0B 3QSIA 3HVWA 4CIOA 4FPRA 4B9SA 2CZVC 2ZUFA 3PJXA 3DLHA 4BDPA 3GTLC 3KJNB 1T95A 1VGXA 3D0IE 5KT6A 3W61A 1NEEA 1WG5A 1RT5B 1NSPA 5GAHI 1LW0A 3F0NA 1FFSB 1XJWB 1SH0A 4C3MA 4BY1C 4QIWD 1SFOK 1C4CA 4PUOA 4K7QA 1QY7A 2GV1A 3V2UC 1O26A 3QGHA 4X62J 4KR0B 3BBCA 2JLEA 1HBUB 3N6NA 4OL8A 4C0HA 5IOLA 5IQQA 2AJ2A 3AJ1A 3IGNA 4RBTA 4EFAC 1Q7YT 3JTNA 3HT3A 1WEZA 1N5YA 4I4BA 2YWFA 2W2NP 4JI6J 3G8QA 3TZXA 4M95A 4OX9J 2C2RA 3JSRA 4AL5A 4PAAA 3CC7S 1DCOA 1RTHB 2D9PA 2AYMA 3SQGB 2KKHA 3MMCA 2A10A 2NZCA 4I7FA 3C6UB 3W1YC 1WNEA 2QRRA 2DTJA 2VKZG 2ZJQQ 3HOUK 1U4BA 4U96A 1WWHA 2DEJA 3TAMA 3T1AA 1QDUB 3CJ4A 5EX3A 2BX6A 5M2UA 3W3SA 3QT7A 3VGUA 2W7PA 3K57A 3HMJG 2ILZA 5M2RA 3RBZA 4MYUA 4CLWA 1DY3A 4IG0B 2QL7B 3N01A 2G0CA 1NJIT 5J1EB 3JSMA 4ILMA 1BGXT 1BY9A 1UWBB 3W64A 1SQEA 2FY1A 1Y5IB 4OYIA 1VQ9S 4M5IA 3UFCX 2G2YA 3FHZA 2JJ4D 1HNVA 3EDRB 4Q2MA 4MMOA 3EMTA 3W5ZA 1M0SA 2GQQA 3IG1B 3W2WA 2WSCC 4C48A 4M5NA 5LJ3Y 1IJFB 1I6HK 2GFFA 3MM8A 1FKOB 1MROA 1Y1VC 5KFBA 2R8IA 4HI1A 3K5PA 3HVRA 2V67A 2IJNA 2VG7B 3DXBA 5KFTA 2DNKA 4JOUA 3S15C 2JNJA 1HPZA 4PR6A 3J7YI 2APOA 4FYXB 5JVOA 3GIKA 2VU5A 5KT2A 3I4NK 3LQVA 1V3RA 4KGZB 4CO4A 4NZ6A 3KG4A 3CJKB 1FO1A 4NYZA 3R6LB 4J7CA 5EUHA 5L38A 4J9VA 1I3QK 5DLFA 3D1OA 2XCOA 2FC9A 2C2ZB 4OYXA 4JI1J 4A3CC 3BPSP 1O27A 4GC6A 1O29A 2HZVA 3B6BA 3GYXB 3VQSA 3OR2A 5D78A 2EFPA 4DPOA 1JLBB 2FQTA 2RKIA 3HO1A 2E5LJ 5LJ5Y 1TMMA 4GKJJ 2DNOA 2KRBA 4LF6F 2HSEB 4JI2F 2IVFB 2BKPA 3GWCA 2ADBA 1MW7A 5B7WA 2E2IA 4B3MF 1EETA 3CCQS 3I55S 2ROGA 4JYAF 3M6UA 4UOCA 2GJIA 1V5VA
chains in the Genus database with same CATH topology
1WOSA 3AD9C 1PJ6A 3AD8C 1YX2A 2GAHC 1VRQC 5L46A 1WSRA 4PAAA 3GEHA 3GEEA 3TTGA 1XZPB 1VLOA 1XZPA 1WOOA 3TFJA 2GAGC 3AD7C 1WSVA 4P9SA 3A8IA 1WORA 1PJ7A 3TFHA 1XZQB 3TFIA 1XZQA 3GIRA 1WOPA 4PABA 3A8KA 1X31C 3GEIA 3A8JA 1PJ5A 1V5VA 3GSIA 3ADAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOS A;  3AD9 C;  1PJ6 A;  3AD8 C;  1YX2 A;  2GAH C;  1VRQ C;  5L46 A;  1WSR A;  4PAA A;  3GEH A;  3GEE A;  3TTG A;  1XZP B;  1VLO A;  1XZP A;  1WOO A;  3TFJ A;  2GAG C;  3AD7 C;  1WSV A;  4P9S A;  3A8I A;  1WOR A;  1PJ7 A;  3TFH A;  1XZQ B;  3TFI A;  1XZQ A;  3GIR A;  1WOP A;  4PAB A;  3A8K A;  1X31 C;  3GEI A;  3A8J A;  1PJ5 A;  1V5V A;  3GSI A;  3ADA C; 
#chains in the Genus database with same CATH topology
 3MPD A;  2GJ2 A;  1KOH A;  5D0G A;  4YY3 F;  2RD5 C;  1XR7 A;  4BWM A;  1N32 F;  2MJU A;  3MTJ A;  4F4Z A;  3ZTS A;  5HAO A;  2RRN A;  1RAO A;  2HLU A;  2R7Z A;  4N56 A;  2G0J A;  3OL9 A;  1HL6 A;  3LGH A;  4X6A K;  3HHE A;  3OXG A;  2R92 K;  2HAI A;  1R8A A;  3ZFV A;  2ZM6 J;  4QPX A;  1JLE B;  3PO3 K;  7AT1 B;  4CTA B;  4KB7 A;  1N34 J;  1JLQ A;  1B64 A;  5H9F K;  1RAI B;  3M6X A;  1UCN A;  4A8K A;  5G0R B;  1VQ5 S;  3R2C J;  3HHL D;  5IWA F;  4RNN A;  2D41 A;  2BQ3 A;  1BUX A;  1BQM B;  3I4M C;  2CAD A;  1FK9 B;  1H98 A;  1HHS A;  2EC0 A;  2VG6 B;  1H73 A;  1O28 A;  5KFN A;  2CPZ A;  1PJ7 A;  1T03 B;  2FHK A;  4B3S J;  1PIE A;  2NVQ K;  3S7R A;  4KQZ A;  2E1A A;  1F6T A;  3DM2 B;  3MEC B;  1S6Q B;  5KFX A;  1KSP A;  1HNX F;  3L7P A;  1OSD A;  4HHU A;  4USI A;  4ECW A;  1WC0 A;  1S1V B;  1TFW A;  3OVB A;  5MAO A;  3SXL A;  1ZVU A;  3DRR B;  2HBR B;  1URR A;  4ZPW R;  5KT7 A;  1REV A;  5I42 A;  2E66 A;  2QT7 A;  4EU0 A;  4ECY A;  2RDI A;  2ZVS A;  4A3J C;  3PNI A;  1Q78 A;  5IP9 C;  3A3N B;  5GAG I;  1Y00 A;  4YFN A;  3O2I A;  3WDO A;  4DSE A;  2DGV A;  1U0H A;  4FP9 A;  4R5P A;  3CUL A;  4RU2 A;  4YME A;  4MIB A;  3BSA A;  3HZE A;  2DPI A;  5EX0 A;  2M70 A;  3KHG A;  4G0V A;  3G96 A;  1XXB A;  4BLG A;  4TLR A;  4FBU A;  2AEJ A;  2CNN B;  2GO9 A;  3CQZ C;  3MM7 A;  1NJX A;  2FYX A;  4CDI A;  2VC0 A;  4LF2 A;  1WG4 A;  4C8O A;  1N5S A;  2CG4 A;  2HPU A;  3GTP A;  4QR0 A;  2ZD1 A;  3CIZ A;  3CW2 C;  1RT1 A;  2PEH A;  1Y3K A;  2FLO A;  1TWG K;  6AT1 B;  2N82 B;  3LAM A;  1PYO B;  4HH1 A;  2OUG A;  3H0P A;  1YBA A;  1FJG F;  4Y6I A;  1NH8 A;  2HBQ B;  3ZZT A;  4LVO P;  4MK9 A;  2DGS A;  3PR5 B;  4NZ7 A;  4BC9 A;  2B4P A;  1NM2 A;  3PW0 A;  2XWY A;  1L3S A;  1TMJ A;  2XSJ A;  2CFA B;  4CLF A;  3K7A K;  4DPY A;  4KO0 B;  1N33 J;  3QJL A;  1HKA A;  3V4M A;  3TJ8 A;  4U95 A;  5CZX A;  2JSX A;  3W9J A;  5K8N A;  2QG9 B;  5CYM A;  3UCU P;  1JNR B;  3MR5 A;  1S1X A;  3BKT A;  2UUA J;  1ZAV A;  4EGL A;  4IRC A;  4OIX A;  1RWP B;  2X1G A;  5DDO C;  3C46 A;  3R2D J;  4ZCI A;  5C44 C;  2MKS A;  1GH8 A;  1EQM A;  4ILL A;  3OFH A;  3B82 A;  5IYB C;  1IL2 A;  2VA3 A;  3MML B;  3P8B B;  1Y1V A;  5L1I A;  3UR3 C;  2KN4 A;  3T6B A;  4RO0 A;  4NXN F;  3MOJ B;  2UUC J;  4ELT A;  2M0G B;  1X5S A;  1YGY A;  5F8N A;  2JEF A;  3POT A;  5F9N A;  2WVD A;  3H0G K;  2CKW A;  4OV6 A;  2G13 A;  2EFG A;  2V2Q A;  3UW1 A;  4XIU A;  2FVQ A;  1GMV A;  3EGZ A;  1RAE B;  2XMV A;  3DYA A;  1VJQ A;  3UD5 A;  1EKR A;  1K83 C;  2B9X A;  3DLE A;  4G7O A;  1HIY A;  3KMS A;  3I9Z A;  1EAY C;  4UY8 5;  4XSX A;  1WOP A;  3GTQ K;  4RUB A;  3HOY C;  1UW4 A;  1YX2 A;  4KGM A;  1FXL A;  5FLX U;  3PG9 A;  4O3N A;  5F8G A;  5KFO A;  3EVW A;  3CJ2 A;  2XTJ P;  5KOX A;  2N4D A;  5CJ9 A;  4MKA A;  5ADZ A;  3OQ2 A;  3V81 A;  5K9F A;  3J7Z 5;  1N6Q A;  3ISN D;  1QJH A;  3LAP A;  4A8Q A;  1RUS A;  4MTP A;  3D5M A;  3OHA A;  4HLB A;  5KFV A;  1WQF A;  4KAT A;  1NK8 A;  1J5O A;  4NLG A;  2MQO A;  1ZM3 A;  2RQC A;  3EDQ B;  2AT1 B;  4NX9 A;  1ZQ1 C;  3VTI A;  3Q8Y A;  3W2V A;  3JQK A;  4YFU A;  3GTL K;  5KFZ A;  3TO8 A;  4C2M C;  3CD5 A;  2P5M A;  4Q5S A;  3KLF A;  1QSY A;  3UDE A;  4Q4Z A;  3PW4 A;  3IS9 B;  3LA0 A;  2NUH A;  4BY1 K;  2A6M A;  3FGV A;  1Q86 T;  4P75 A;  3RBD A;  1CJV A;  2CZ9 A;  1KQG B;  1Q8L A;  1GAO A;  4KGK A;  1EI6 A;  3DI6 B;  4M8L A;  1JLC A;  1WKK A;  5HMW A;  3BDE A;  4DV1 J;  1R31 A;  2WSE C;  3H42 A;  2J76 E;  2Z2L A;  4RL1 A;  2HHW A;  2G0I A;  5HMZ A;  2DNN A;  4Q7A A;  3PHT A;  1S57 A;  4EMD A;  2RUS A;  2VQF F;  2NVY A;  5KAK A;  3KK2 A;  1BHN A;  2F63 A;  2W9B A;  4QU7 A;  4YB7 A;  4KHP F;  5GAE U;  4WFZ A;  2YX7 A;  4AH6 A;  2YH1 A;  2VOP A;  1FKP B;  2O67 A;  4WIQ A;  2E5I A;  4ED1 A;  3BEG B;  3W8G A;  4L3K A;  1P27 B;  4FF4 A;  3JST A;  2KYX A;  2B63 A;  4ICL A;  5GAH U;  1SV5 A;  5EDW A;  4Q0B A;  3LP0 B;  1JVI A;  1PAU B;  5E68 A;  3GYN A;  4K5R A;  3VAH A;  4A47 A;  2J0W A;  1RHU B;  2PEB A;  1ZTW A;  5MLC V;  4DPX A;  3X1L B;  4NI2 B;  3Q8R B;  2DKO B;  4IDK B;  1NHV A;  1ZAW A;  4K2J A;  4LF8 F;  4KM8 A;  1ZAX A;  4DZ6 A;  5KG5 A;  3DU6 A;  2ZHB A;  4K2X A;  4ED2 A;  3GTY X;  3KLV A;  2XMM A;  3FSI A;  4LFA F;  2DEI A;  2LU2 A;  1RCX B;  3EE3 A;  3R5D A;  3I5A A;  3HSJ A;  2BM1 A;  4NEZ A;  5EWG A;  4W90 B;  3DOM B;  4FXV A;  2B7C B;  4MKY A;  1KRP A;  1CLF A;  3KLE A;  2IJR A;  3D28 A;  4LF9 J;  4ZIT A;  2CQ0 A;  4OYW A;  2BAN B;  3PAC A;  3NY0 A;  3UDL A;  1RCO B;  1PG5 B;  5IOT A;  1CSJ A;  2D3O R;  2E5J A;  3S15 K;  3IBC B;  2YQ0 A;  3W8P A;  2FLL A;  4OIR A;  4KAS A;  4DU8 A;  3H59 A;  1YRT A;  4LF4 F;  4LRC A;  2EFV A;  5KFK A;  1DUR A;  4QWC A;  1T05 A;  4J9U E;  4ELV A;  1DTQ A;  1Z2Z A;  2K7K A;  4PZV A;  2FTR A;  1I51 B;  2A0F B;  2KT2 A;  4F8R A;  3BBB A;  1E6Y B;  4LF5 J;  2OPR B;  5KFD A;  3S0X A;  2XYG B;  1C1B B;  1NZA A;  3BGR B;  4A3C K;  2OFG X;  3I87 A;  2XEX A;  3FMB A;  5DG8 A;  5M5W K;  3C19 A;  5B0D A;  1TQL A;  5LT5 A;  5CD4 H;  2UXB F;  2B51 A;  1KBR A;  5KG1 A;  2JA8 C;  1Y11 A;  1VHF A;  1SKS A;  1UFW A;  4NAS A;  1DQ9 A;  2CXE A;  1R7I A;  2E2H A;  5A6W A;  2IBK A;  2V8P A;  3R5B A;  3J7Y U;  3M2U B;  2IM3 A;  4N41 A;  3I0S B;  3NS6 A;  4X2B A;  3Q89 A;  1UZD A;  4DLG A;  3KJV B;  3Q8P B;  1TWC A;  3PFE A;  1IXK A;  2PPB A;  3GTJ C;  1L3K A;  3ULH A;  1NUE A;  3CSK A;  3AQO A;  1SL2 A;  3VAG A;  2BJD A;  3B4M A;  3I96 A;  3RBE A;  3CD6 S;  5DLG A;  1VRU B;  5T7L A;  1F2H A;  3MUT P;  1J27 A;  2VKR A;  4ETZ A;  3GLJ A;  4ANE A;  1TWF A;  3D2W A;  2VPW B;  3S2H C;  3FKI K;  3I4M K;  2C3M A;  3RAQ A;  1FVQ A;  4TKT A;  2AF6 A;  2HWI A;  1IBL J;  4O4R A;  1R3N A;  1GFW B;  1RT5 A;  4GTC A;  1V5I B;  3GTO K;  2R7R A;  4EK2 A;  4P52 A;  3AAW B;  2DJW A;  4Y0F A;  4UY8 T;  1TWH A;  1RHK B;  4J90 A;  4DV2 F;  1MG7 A;  2NXC A;  5DS7 A;  4E98 A;  1CPZ A;  4ZLP A;  4Y65 A;  2G1H A;  3WBZ A;  4J9O A;  2GIF A;  3F73 A;  2IDL A;  1R9T C;  4QYR A;  1SC4 B;  1TKT B;  1FVS A;  3IAS 9;  1SXL A;  1HBU A;  3MR2 A;  2BJE A;  1VC6 A;  2JL9 A;  1MN9 A;  4A3J K;  4URG A;  3MR3 A;  4O0N A;  2CQB A;  4C3H C;  3V6K A;  2UVU A;  2BOA A;  5IP9 K;  1NSQ A;  3J7Z T;  3E01 B;  5F9L A;  3C8Y A;  4DUZ F;  2HFU A;  1S48 A;  1NME B;  4KJI A;  2AJQ A;  1C2P A;  4LK1 A;  3BUE A;  3RUB L;  2CWX A;  4TLQ A;  4DSF A;  2PGC A;  2Q1L A;  1XEZ A;  3IRW P;  3LWL A;  1UVK A;  1ISE A;  1B99 A;  2EG2 A;  3RR7 A;  1OS5 A;  3IPJ A;  2VQF J;  1RTH A;  3VAF A;  1J6W A;  5KG3 A;  4PQU B;  1NH7 A;  2B7B B;  2SXL A;  4C8N A;  5JVH Q;  1VQL S;  1UJ5 A;  3SQG A;  4YEA A;  1FHT A;  2F65 A;  2Z30 B;  3C6U A;  4X65 J;  4C8Y A;  2HFV A;  3CQZ K;  2F4V J;  3IM8 A;  4A46 A;  4QW8 A;  2VBY A;  2W7A A;  2KT5 A;  1VQ4 S;  4MH8 A;  2ZDP A;  1U1K A;  1SC1 B;  2UUB F;  3BV8 A;  2CNO B;  3HFV A;  4IG0 A;  4ZS6 A;  3H3V L;  3CCT A;  4F50 A;  2R7X A;  3PYG A;  5J1E A;  1Q5V A;  3C16 B;  2ABY A;  1UWB A;  1KQK A;  2ZDO A;  5J1P A;  2Y3P A;  2PD1 A;  3JAM U;  4OZL A;  2J9C A;  4DPU A;  5GAG U;  2DK2 A;  3PYE A;  1HNZ J;  3K7R A;  1T94 A;  1TR0 A;  4ZKA A;  1SQG A;  1TWA C;  5GMD A;  2QIF A;  3ZZO A;  1EX8 A;  4DUY F;  2EVZ A;  4I2Q B;  3R5A A;  1Q8I A;  3TFH A;  3IG1 A;  2X1B A;  1SB6 A;  2DY1 A;  5L46 A;  1FKO A;  4DQP A;  1HW8 A;  4HI2 A;  3QJP A;  2VG7 A;  2EK6 A;  3JYT B;  4DR6 F;  5C44 K;  2MGZ B;  4QZV B;  3G71 S;  5C4J C;  1R0C B;  4UUW A;  2UUW A;  4A8W A;  4BC7 A;  1YIT S;  4CLU A;  4LBP A;  4NXM J;  4RLE A;  1S59 A;  4DR7 F;  4A8M P;  3KNA A;  1VBK A;  4Y52 C;  4A3D K;  4URS A;  5IYB K;  2KFZ A;  3CJK A;  2BA9 A;  4K4Z A;  2CDR B;  4ZH4 A;  3PIO Q;  4C3I C;  3I5C A;  4AL6 A;  1QTN B;  5IYC C;  1N5Q A;  1I6V A;  4TVA B;  2RH3 A;  1UFK A;  2CPE A;  4JV5 J;  2HW3 A;  4WJB A;  4LRE A;  5IP7 C;  4B9N A;  4QR1 A;  3ZTQ A;  1PO6 A;  3G9C A;  1BQX A;  1JLB A;  2W1B A;  5KG6 A;  2IRX A;  3ZTR A;  3H5S A;  3D9B A;  5GME A;  1B4S A;  2AGP A;  1U49 A;  4BY7 C;  2WBR A;  1O2A A;  5AXN A;  4PWD B;  1JJH A;  1WHX A;  1LXJ A;  1YG0 A;  3A3O B;  1X5P A;  2Y1L B;  2R4F A;  2XO6 A;  4CRJ A;  1RK8 A;  4NWB A;  2G2Z A;  2W4P A;  5IT9 Y;  3P6Y C;  1NK5 A;  2NXJ A;  1KEK A;  5DQI A;  1IM4 A;  4YB6 A;  2XLK A;  3JSY A;  2CJY B;  4DR2 F;  4HTJ A;  4XPC A;  2YNI B;  3NG8 A;  1ZPW X;  1VQN S;  2AEM A;  3CCV S;  3R6G B;  1IR0 A;  2FJE B;  2PMZ L;  1S97 A;  5J2M B;  2J6S A;  4FF1 A;  1U09 A;  3LF0 A;  4DXL A;  1JLE A;  1GXU A;  4F02 A;  1VIO A;  1FJE B;  4CTA A;  4KKO B;  1IUJ A;  3FEY B;  3ET6 B;  3BO2 A;  1Q16 B;  3ONQ A;  4J9K A;  4C2M K;  2UV8 G;  5G0R A;  3PO5 A;  5A6P A;  1YRX A;  3TI0 A;  1BQM A;  2CJQ A;  4UOH A;  2EBB A;  3PRD A;  3PYD A;  4LSZ B;  2KH9 A;  1WSR A;  1FK9 A;  4J9S A;  3GR0 A;  2VG6 A;  2E1M C;  1T03 A;  1NDC A;  1C1C B;  1S4E A;  2MB0 B;  3GFH A;  3IXQ A;  1CQM A;  2V4R A;  4K8R A;  4F4K A;  3DM2 A;  3MEC A;  1S6Q A;  3G6V A;  2O5D A;  1L3U A;  1YI2 S;  5HJX A;  1N54 B;  4A4J A;  1U45 A;  1S1V A;  4X4U A;  3K58 A;  2JA6 C;  3TAP A;  4ED6 A;  4USU A;  4RR5 A;  2QFI A;  4LUB A;  1FWK A;  3DRR A;  1RAH B;  3HKW A;  3FQK A;  4KB4 A;  3BN7 A;  1P8G A;  3I31 A;  4RKU C;  2O5J A;  2JVR A;  4KM9 A;  1TL1 B;  2VOD A;  2W2O P;  3PJ9 A;  2CDQ A;  3US5 A;  2CVI A;  1GMW D;  2MTL A;  4NML A;  4ECX A;  1NHK L;  2Y1I A;  5CQG A;  5C7P A;  2WOM B;  4WFA Q;  2RHQ B;  4G7Z A;  4C7Q A;  3OJU A;  2M88 A;  3A1Y G;  3ZO7 A;  2CW0 A;  4K5S A;  2FJX A;  1CC8 A;  4MEY A;  3JXO A;  3U7J A;  2ROE A;  4H4K C;  1ZOT A;  4ZJO A;  2NVX A;  1JJC B;  3EPG A;  2A3J A;  2WW8 A;  3VZH A;  2W7O A;  4C8K A;  2Y8Y A;  2Y0S D;  3QMQ A;  2J6U A;  4HDH A;  1LFP A;  1Q7L B;  1RDR A;  2GQC A;  4OJH A;  3TRG A;  3BS9 A;  2LA6 A;  2Z56 B;  4QOT A;  2WSF C;  3EIC A;  2PI5 A;  3WC2 A;  4UZC A;  3GTK A;  5B0A A;  5BR8 J;  4XDC A;  4X64 F;  2CFA A;  4OHW A;  3OUY B;  2IMW P;  4KO0 A;  1KLM B;  2DRA A;  3CCW A;  1D3W A;  4E2F B;  3Q86 A;  3DOL B;  3T5H A;  1KFS A;  1QE1 B;  4LFC J;  2AKW B;  3HHL B;  1HLW A;  5SZT A;  2HS4 A;  1CJU B;  4RJV A;  4W4M A;  1M5S A;  4QPT A;  2M2B A;  1G4C A;  1HYS B;  5CH7 B;  2YKP A;  3KXD A;  1RTD B;  3OSP A;  4QCL A;  3H3V D;  3ILL A;  2GHV C;  1VHI A;  2U1A A;  3W62 A;  2C28 A;  1H0H B;  4ED4 A;  4DR6 J;  1CJT B;  4KBI A;  1USO A;  2I0X A;  1MMN A;  4JI4 J;  2DO4 A;  2GQ2 A;  2ZH8 A;  1IBM F;  3K5L A;  1FDB A;  3BBF A;  2JA8 K;  2O5I A;  2HYI B;  3NOG A;  5CCM A;  4KFB B;  3W66 A;  4ZCM A;  3QT8 A;  4DL3 A;  3QAT A;  2W8L A;  2BZ2 A;  4YG2 A;  5I3P A;  2E2J C;  4WTO B;  1H6K X;  2YNF B;  1RE1 B;  3T9N A;  1YZ7 A;  2RDD A;  1NDL A;  1KOO A;  2DR5 A;  5IOR A;  5ETK A;  4TYB A;  1N4L A;  4LRB A;  3S1N K;  1D1U A;  3P4U B;  3PO2 C;  1A6L A;  1SQF A;  4RW7 B;  4U6P A;  3KYL A;  1RP5 A;  1YNJ A;  4C3J C;  2BRL A;  4PPD A;  1U1Q A;  4NA2 A;  4KMA A;  4DV0 F;  4YB1 P;  2LQ9 A;  3O3L A;  3CCE S;  5DM7 Q;  2BE2 B;  4P72 A;  4ZOS A;  3R8Y A;  1TKD A;  2V69 A;  2FHJ A;  1SH3 A;  2OEM A;  1NSK L;  1Q81 T;  2V2V A;  4KH0 B;  1TUV A;  2AYE A;  3FCH A;  3BYR A;  5KFM A;  1WDT A;  1LK7 A;  2OD6 A;  3OVA A;  1ZTT A;  1SL0 A;  2MEW A;  1TV6 B;  2GMJ A;  3RZD C;  3FEZ A;  3RZA A;  2EG1 A;  1IR2 A;  4DUT A;  1I3O B;  1T9T A;  4DR2 J;  3AXK A;  5CCL A;  5HVF A;  1HR0 F;  4B3T F;  5C4X C;  2RE1 A;  2FZG B;  1JLF B;  4HHH A;  3S2H K;  3LAN A;  4ENO A;  3M8Z A;  1Y10 A;  2XG8 A;  4OMF G;  1K0V A;  1IBK F;  2F9D A;  2R2S A;  1X4D A;  2VIC A;  4CO1 A;  3EVM A;  5HVG A;  5FJ4 A;  3IS9 A;  3HOX C;  1XZQ B;  5C42 B;  3GIR A;  4BS2 A;  4ES2 A;  4NRU A;  5EWE A;  2FUG 9;  1O2B A;  3G6Y A;  3DI6 A;  3GU0 A;  4GTF A;  2VFS A;  5K8O A;  4JP8 A;  3J80 Y;  4L76 A;  1R9T K;  3Q2T C;  1B4B A;  4OIN A;  2PMZ D;  2AD9 A;  2BR0 A;  4PG6 A;  4C3H K;  1O0P A;  4F0M A;  2I6W A;  3KG0 A;  2Y8W A;  2WVF A;  3TVZ A;  5DO2 A;  3ENW A;  2MPU A;  5ETN A;  2HG4 A;  1KFD A;  1VQS A;  3PDN A;  3J7A 1;  4OI0 A;  3M2V B;  1YHQ S;  1FKP A;  4PKD B;  4AXI A;  3GTP K;  1G2E A;  2JHE A;  2IBO A;  2EPI A;  4WCE Q;  4NLX A;  2VPX B;  4CO0 A;  1X0P A;  1GTH A;  2BE7 D;  3GR1 A;  1WIH A;  2VZ9 A;  1U48 A;  1UJ6 A;  2HRY A;  2X1F A;  3LP0 A;  1X4H A;  2AIR B;  2QX0 A;  2VAS A;  4DQI A;  5ETV A;  3SSQ A;  1RAB B;  1UEV A;  3Q8U A;  1QSS A;  3R7B B;  3AHP A;  1YBU A;  1FWP A;  2H54 B;  4NI2 A;  4NE9 C;  2DNL A;  1S0N A;  2DRD A;  2E29 A;  3SMZ A;  4IDK A;  3BF4 A;  1KVI A;  1S5Z A;  3MMA B;  3HOZ C;  2P9C A;  2MZS A;  3CJ3 A;  3R97 A;  1EET B;  4GC7 A;  1D9D A;  3GCW P;  4BWJ A;  1O5J A;  2VJU A;  1FNM A;  5E33 A;  1U1L A;  2GIQ A;  2D6F C;  3MPU B;  2DNG A;  2VH7 A;  1S1T B;  2Z0G A;  3BH7 B;  1TWA K;  1UEU A;  1ZPV A;  2EWH A;  4OJ1 A;  2A6O A;  1I1G A;  1X5T A;  3CCS S;  1ZS6 A;  1ULR A;  2XCR B;  5AXK A;  4GFQ A;  3DOM A;  2K3I A;  2ZH7 A;  2JOQ A;  1WKJ A;  1HNW F;  3U02 A;  1FWL A;  3NS7 B;  4DX7 A;  3C66 A;  2BAN A;  1F7V A;  3NCQ A;  2P6T A;  5HQL A;  3CDU A;  3PO4 A;  2PSZ A;  2OD4 A;  3A4T A;  3GJQ B;  3IWX A;  2E5H A;  1UJ4 A;  3N9U C;  1SUQ B;  1INN A;  2MSS A;  2KFN A;  1BLU A;  3HVA A;  1WF1 A;  3FCW A;  3GV7 B;  5L1K A;  2B4O A;  2ZUE A;  1E6Y A;  4C3I K;  5IYC K;  2OPR A;  3N28 A;  1SJQ A;  3N79 A;  2QJ3 A;  3GTM C;  3BGR A;  4ZP8 A;  4O3P A;  2GX8 A;  5LSL A;  1USM A;  1J5E J;  2QA2 A;  2JWN A;  4P2S A;  5KFW A;  1VLO A;  2HK3 A;  2WON B;  5IP7 K;  2H48 B;  1OQ6 A;  2VL1 A;  5C5J A;  1SIZ A;  3CD7 A;  1WEY A;  1I50 C;  3ERE D;  2FDN A;  5F8L A;  3MFH A;  4RUH A;  5KFH A;  2J7K A;  2DH9 A;  2IYG A;  4BY7 K;  2ASL A;  3P96 A;  5AE1 A;  3FDS A;  1REV B;  4QW9 A;  1UTA A;  2RIJ A;  3G86 A;  1SKW A;  5KOW A;  3M2U A;  1RAG B;  2EW9 A;  4GTD A;  3I0S A;  3M2R B;  3MEG B;  1LWX A;  1NK9 A;  3KKF A;  5LMN J;  2YWH A;  5D15 A;  4L6V 3;  4TU9 A;  3MM9 B;  1X31 C;  2VPZ B;  3KJV A;  1YTY A;  1Q82 T;  4YUD A;  4OHV A;  4FVC A;  2AJ4 A;  2YKN B;  3CIM A;  3MOZ A;  1KLN A;  3LGN A;  4DV4 J;  2GMH A;  1YJV A;  5HN0 A;  2EFN A;  1MNE A;  1VRU A;  4EZ6 A;  3D0H E;  2XZW A;  2ZJP Q;  2H4W B;  5DM6 Q;  1F3F A;  4WFY A;  2HND B;  3FZ2 A;  3HOU C;  3LW5 C;  3HM9 A;  1NHU A;  1NPP A;  2FHJ D;  1YJN S;  4M5G A;  3ZZP A;  3E8O A;  1GE9 A;  2R93 A;  4KTQ A;  1TU0 B;  3D3B J;  1VFJ A;  5ETM A;  1D0E A;  3BN4 A;  5KFP A;  4FDF A;  2NVY K;  1RKI A;  1FX4 A;  3ZXW A;  2V2Z A;  3D54 A;  2WHO A;  3TNV A;  3JB9 k;  3SI8 A;  3IA0 A;  1DBD A;  1A0O B;  2D74 B;  3U1N A;  4CLP A;  3DXJ A;  2KJW A;  1S79 A;  2Y9H A;  3GSD A;  4LFB F;  3D66 A;  1TKT A;  4ZA1 A;  4ANC A;  4FZB A;  3AH6 A;  2V6A A;  1GQE A;  5DDQ C;  4MKB A;  3E01 A;  3G4A A;  5EGY A;  4WU2 A;  2UXC J;  3HCX A;  4MIW A;  1RWX B;  3T5K A;  2WCX A;  3UNG C;  3M30 A;  1WCM C;  5AJ3 J;  3FVY A;  2H65 B;  4PQU A;  4ED7 A;  2Y0B B;  3UN5 A;  4KMU A;  3W5X A;  5TMC A;  3GII A;  1WEL A;  5KFY A;  1S77 D;  1HW9 A;  2UU9 J;  5FD1 A;  3L4K A;  5A8W B;  1RWW B;  4F67 A;  2FVC A;  1Y0H A;  1Q95 G;  1H7W A;  2MDA A;  4K4Y A;  1UVJ A;  3N3Y A;  4DX5 A;  1M90 T;  3OPK A;  2VOO A;  1X9W A;  4EI2 A;  4ZHR B;  1MN7 A;  1RBL A;  4LMZ A;  4CP5 A;  2HS3 A;  2OEJ A;  4FBT A;  2FLP A;  3M8R A;  2VFR A;  2A2D A;  1PKU A;  2K1R B;  3A8I A;  4K0K J;  3C16 A;  5KFE A;  4PXD A;  3S1R C;  3X3U A;  1HQE B;  4DN0 A;  2E1C A;  5TMF A;  4DEZ A;  4B3R J;  3QJJ A;  4HAC B;  4GKK F;  2L9W A;  3VHQ A;  1EH1 A;  3IFE A;  4HT5 A;  1VQ6 S;  4CYU B;  4I2Q A;  4YQW A;  2PFD A;  2HEK A;  2A6H A;  4XSZ A;  1N88 A;  2C1E B;  4DR3 F;  3MMJ A;  3TA0 A;  1RAF B;  2MQL A;  3FOE A;  4OYA A;  1G7C B;  2W24 A;  5BYR A;  4NCG B;  3T1Y J;  2CJX B;  1AFI A;  2XGP A;  3TX8 A;  1ITP A;  2DO0 A;  4BBY A;  3JYT A;  4YDX A;  3Q0A A;  4X6A C;  4NLD A;  2HAF A;  4KC6 A;  3M6V A;  2MGZ A;  4OZ3 A;  2F9J A;  4DQS A;  2QL9 B;  3EJM A;  3L09 A;  1U6Z A;  2OPQ B;  2L3M A;  5KT3 A;  2DD8 S;  3CB4 A;  2V9W A;  1FER A;  1RAJ A;  3DDN A;  2XY6 A;  2CUY A;  3NRB A;  3MXH P;  4I6W A;  1VC5 A;  4K50 A;  1R6V A;  1HQM A;  3PM9 A;  3CMA S;  3OBI A;  1O24 A;  1I94 F;  2R8J A;  2RQM A;  1U47 A;  2DIT A;  3MCN A;  1R0A B;  2E2J K;  2NVQ C;  5F8H A;  4X4R A;  2Z2M A;  3TQ1 A;  1EAR A;  3KK3 B;  4XDD A;  1WF2 A;  3IWL A;  3I9V 9;  2CYY A;  3RW7 A;  2BYC A;  4OZN A;  4O4G B;  2H9Z A;  2R7U A;  1AB4 A;  2YKO A;  2C2M B;  4MT1 A;  4PWD A;  1U7L A;  3PO2 K;  2OH2 A;  3FEX B;  4JI0 F;  1W26 A;  2A6E A;  3B8H A;  5HQM A;  3HT0 A;  4C3J K;  3TUI C;  3GJR B;  1HWL A;  4IQX A;  2QZ8 A;  5DRK A;  3PR4 A;  3UPF A;  1SFO A;  3SFG A;  3V4G A;  4KPC A;  1YSJ A;  3QRQ A;  2J8A A;  3H4D A;  2RHS B;  1K44 A;  2XYH B;  3HOV C;  1VDH A;  1I5O B;  4ECU A;  2YNI A;  1F5A A;  3FBE A;  4FM9 A;  3A3P B;  1XZP B;  1QD1 A;  1P1L A;  4JI7 F;  1S6O A;  2F40 A;  5D4P A;  4P74 A;  2BJ7 A;  1OQ3 A;  4P5A A;  2DGW A;  3CJS A;  2E7V A;  2LKZ A;  3KHR A;  2KXN B;  5J2M A;  1M1H A;  5J2P B;  2ASJ A;  4PG8 A;  4ZLN A;  5AT1 B;  4Y7N C;  5C4X K;  4KKO A;  3IMQ J;  3ET6 A;  3KUH A;  3NLC A;  1IE0 A;  5A8R B;  3C15 B;  1KQ4 A;  2WK4 A;  4DV7 J;  5LL6 d;  1P9Y A;  2F4F A;  3FBF A;  1JK9 B;  1M5O C;  1EJ7 L;  1B3T A;  2XY5 A;  3MPY A;  3HOX K;  3UD4 P;  1HI9 A;  4Q2L A;  4CLL A;  3QWP A;  5J2Q B;  3CJR A;  1C1C A;  4ZPB A;  3M8Q B;  5C25 B;  3AD9 C;  5JUM A;  1OJ4 A;  2KHD A;  5HL7 Q;  4OI4 A;  1Q53 A;  4G1P A;  3IO1 A;  3R7N B;  3DGP B;  2HUR A;  3D1H A;  2L08 A;  2VD3 A;  4F4X A;  1U02 A;  1LEO A;  3ZZR A;  1S9F A;  2M9K A;  4M5J A;  3KDN A;  1NK4 A;  4AUK A;  4ZPT R;  4C0O C;  4DR4 J;  2DCU B;  4OHX A;  2PT0 A;  1P1T A;  4GO5 X;  3H25 A;  1TL1 A;  2L9D A;  2JC1 A;  3DRY A;  5T14 A;  3DLJ A;  4P10 A;  1PBU A;  2DH7 A;  2WOM A;  1UWA A;  2IYI A;  2E9Z A;  2MKJ A;  2BUN A;  2Q66 A;  3NOC A;  1O6X A;  1OYD A;  3PW7 A;  3NGD A;  1IJE B;  5HAT A;  2YX1 A;  2PDA A;  2MMY A;  2F8E X;  1FFG B;  4KSE B;  1DJ0 A;  3SEO A;  1IW7 A;  2GSN A;  4Q43 A;  1VRQ C;  4GTB A;  2DGO A;  2J8S A;  3BKF A;  5HRO B;  3MM6 B;  2HGM A;  2V9K A;  3CGI A;  1FDN A;  2ZOM A;  3TZW A;  2HMI B;  5IYD C;  3GJT B;  1NKB A;  4MKV A;  3FOF A;  1WF0 A;  4HR2 A;  3TAN A;  3HSZ A;  2HHH F;  5B0F A;  1I3Q A;  4OJG A;  2PHC B;  2HWT A;  3HFZ B;  3AB2 B;  4RNO A;  2RJZ A;  3K5M A;  1S6P B;  1JXE A;  1X4E A;  5IT4 A;  2HQG A;  4N7T A;  1R8P A;  3AOB A;  2DR8 A;  4JI5 F;  3OUY A;  2QGF B;  1TL3 B;  1FA0 A;  4A8O A;  1KLM A;  2HIY A;  4DV5 F;  2MKI A;  3NS5 A;  3CDA A;  4X66 F;  2D9O A;  1VR6 A;  2AYG A;  2OKQ A;  5KG4 A;  8AT1 B;  1T3O A;  3DOL A;  3NL0 A;  1GNK A;  4CM2 A;  1QE1 A;  1RLD A;  2VDI A;  3S14 C;  1YKW A;  3KJF B;  2HK2 A;  3HHL A;  2IY5 B;  1WD6 A;  5JFE A;  3GFZ A;  3NGK A;  1CJU A;  3VWS A;  2LEA A;  3L95 X;  1Q8B A;  5LMU F;  4M5L A;  1HYS A;  3BSN A;  3S1M C;  4LF7 F;  2GC8 A;  3CMQ A;  2W9C B;  1RTD A;  1RAA B;  1Y1W C;  4BBR C;  1W2B R;  2CJ9 A;  4C11 B;  3OEP A;  1NPK A;  1GK8 A;  4YHH F;  1AYE A;  2NYH A;  3ZNJ 1;  3GTM K;  4OLO A;  1N5V A;  2P8T A;  1CJT A;  3EYZ A;  4TU8 A;  1ZZF A;  1KWM A;  2ZFZ A;  3HUL A;  2CA9 A;  1P6T A;  1KON A;  3CXC R;  4LBI A;  1SJR A;  4OLP A;  3TYT A;  4Q8F A;  2RIL A;  2XWX A;  1I50 K;  5D3G B;  4ECT A;  2AW0 A;  4UQG A;  2MQM A;  4KFB A;  2R92 A;  3I4P A;  1R8C A;  4NYO A;  1H38 A;  3CJQ A;  1EZZ B;  3GIM A;  2AX1 A;  2ZBI A;  5IT9 U;  2YNF A;  2BOP A;  4UOF A;  3VV2 B;  3S01 A;  4PXB A;  3NMR A;  1JLG B;  5KFC A;  3MD1 A;  1XMB A;  2HHS A;  4NCB A;  4JI3 J;  4MK8 A;  3QIP B;  4RW7 A;  3LPY A;  3C14 B;  2LEC A;  3HP6 A;  1T9W A;  4O23 A;  3FC9 A;  2XO7 A;  3BB5 A;  4DR5 F;  2BE2 A;  3GPA A;  4WFN Q;  2V5H G;  4MFB B;  3MGJ A;  1FEE A;  3W9I A;  4YS2 A;  4XLN A;  4Y2K A;  4PXC A;  3QZ8 A;  1WC6 A;  4ID8 A;  1RYR A;  5D0E A;  3OHB A;  5M5Y K;  3IRX B;  3TUZ C;  4U7U K;  3FKB A;  3KLH B;  1TV6 A;  4WXO A;  1V3S A;  5IZH A;  3QRR A;  2W2M P;  1KTV A;  3QAU A;  2OAU A;  2YKM B;  4P71 A;  2KM8 C;  2BKO A;  2MZT A;  4F4W A;  2IHR 1;  1JLF A;  2XNQ A;  1UET A;  2DGQ A;  2F7V A;  4ZN1 A;  1ZA1 B;  3G4C A;  4OZ1 A;  4R25 A;  3TEG A;  4N8N A;  2Z4P A;  2B43 A;  1WDD A;  3N5F A;  3M4O C;  1S99 A;  1RWK B;  1XZQ A;  5C42 A;  1C0U B;  2QEX S;  2DGX A;  4N5S A;  4XTT A;  2IA0 A;  4X4T A;  4NLQ A;  3ZTO A;  2P9E A;  4J9M A;  4LIW A;  1JJ2 R;  4DS4 A;  1XNR J;  4O2D A;  3BO4 A;  2XCA A;  2O1P A;  3VCD A;  4IH7 A;  3QFH A;  4EUV A;  1TWG A;  2C3O A;  2H4Y B;  1R6Y A;  2I2Y A;  4PEO A;  5E3Q A;  4E0D A;  1H2T Z;  4RW8 B;  2BXJ A;  2DPJ A;  1X5O A;  3M2V A;  1M1G A;  1OY6 A;  1K73 T;  5LM7 E;  5KFJ A;  1U25 A;  3AY0 A;  3HK2 A;  3KJQ B;  2HNY B;  1XNQ F;  1O25 A;  1WCM K;  2XBP A;  4J91 A;  2ZZT A;  1RHM B;  3S17 K;  5CD4 A;  1QUV A;  4NMX A;  2DHS A;  2B9Y A;  2CG8 A;  2E44 A;  4C8L A;  1QAX A;  7FDR A;  3TQE A;  4WFB Q;  2BE5 A;  4IUF A;  4CI0 B;  4ZVE A;  4ZVG A;  4WIL A;  4ZVO B;  4QJV B;  3PRV A;  5FDL B;  1KVK A;  1VYA A;  3RRH A;  1XIQ A;  2VBX A;  1TL7 B;  3H5Y A;  3MMA A;  2WB1 L;  4PWU A;  5ETR A;  2QMU B;  1ELO A;  2H1Y A;  5EWF A;  2YVS A;  3F41 A;  1J6V A;  3S1R K;  1EP4 B;  2YWE A;  3IGV A;  3KHL A;  3D7S B;  1RBO B;  4MK7 A;  2R2U A;  2XLI A;  1S1T A;  1XN9 A;  4P2M A;  2FVR A;  5B09 A;  1K1S A;  2WZ1 A;  3HJF A;  1RXO B;  2F3J A;  2E1P A;  1JNZ B;  4AQY F;  3H0G A;  4IR1 A;  4NPO A;  1XMO J;  1J6X A;  1S0M A;  4OJ3 A;  4DDF A;  4KE5 A;  2CJB A;  1NRK A;  3SCL E;  3LWM A;  3FSX A;  4RUA A;  3G4S S;  1S0V A;  5IXU A;  3GTQ A;  4ERD A;  2FIU A;  4WII A;  3H40 A;  1WC1 A;  1SUQ A;  4TU7 A;  5RUB A;  2MHE A;  4FZV A;  1B7Y B;  1LKZ A;  3G2X A;  3C6T B;  3KFW X;  1TL4 A;  4USV A;  3V6D B;  3EZO A;  5A8K B;  4DV6 J;  1YWX A;  4FNH A;  1UVL A;  2CQ4 A;  3FKI C;  5LMU J;  4DX8 H;  2K2P A;  3LOU A;  4EZ9 A;  2ZE2 B;  2C2D A;  1WOO A;  2WON A;  1BQN B;  2HFN A;  1QM9 A;  4WJ3 M;  2ROP A;  3GTO C;  3A8E A;  4MEX A;  4J9R A;  2LQB A;  2FQO A;  4ZVU B;  3M9N B;  3OL8 A;  2XMA A;  3IR7 B;  2B56 A;  4C9D A;  3OFE A;  5C24 B;  1S49 A;  2P2C B;  4PWW A;  1F9H A;  4G0U A;  4GVB B;  3GTL A;  2H3E B;  3D6T B;  3NBP B;  1KDN A;  4WJ4 A;  2VBW A;  3MAA B;  2ZKU A;  2XZT B;  1NJZ A;  3OLB A;  2IC3 B;  5CXT A;  1WI8 A;  4FXW A;  3M2R A;  3MEG A;  4U8Y A;  1Q0N A;  3LAL A;  3TWZ A;  4U9R A;  4ED0 A;  4ER8 A;  1QAI A;  3MM9 A;  1YJ7 A;  1BGW A;  3HOV K;  1NJW A;  4HYK A;  4IOA Q;  1QVF R;  2A69 A;  4DFJ A;  4FS2 A;  2ZBQ A;  4CZC A;  4F4Y A;  2YKN A;  4USW A;  5HL8 A;  1PSD A;  2JA5 C;  2OSR A;  3CME S;  3H5X A;  4ILR A;  2RVJ A;  2WW4 A;  3NXZ A;  3A13 A;  2VQE F;  4I68 A;  4KIA A;  2KL8 A;  2ALY B;  2C42 A;  4Y7N K;  4JB8 B;  4TY8 B;  2NCK L;  3OTE A;  2GAH C;  4LSN B;  3SSR A;  2HHP A;  1SH2 A;  2HND A;  3QQC D;  2KHC A;  3HJV A;  1UP1 A;  4HVZ A;  3AFG A;  2VUM C;  2OPS B;  5ETO A;  5A0Y B;  4RNH A;  4X4N A;  1F7U A;  1AW0 A;  1XR6 A;  4JI8 F;  3J80 U;  2XMJ A;  3D67 A;  4JV1 A;  3MCM A;  4J9P A;  1XC9 A;  3QGP A;  2DNQ A;  1X9S A;  4A3B C;  3VR1 A;  3TZY A;  2ZNZ A;  1OYE A;  1LWF A;  1OY8 A;  4F3Q A;  3T1H F;  4I0W A;  2KZZ A;  5IV3 A;  4AXJ A;  1YJ9 S;  2JX2 A;  4CO2 A;  1LXN A;  2LCW A;  2CZ4 A;  4X4V A;  1B0T A;  1UL3 A;  3I82 A;  3GTG C;  5JMN A;  1S9E B;  3F56 A;  2G4B A;  4A3G C;  3GSI A;  4NLS A;  2BW2 A;  4DV3 F;  4JK1 A;  2B5J B;  3I0R B;  1N36 F;  4O0I A;  2ALZ A;  1LW2 B;  5M2P A;  4G3I A;  1VMB A;  3LAK A;  1BWE A;  2XMW A;  1TK5 A;  3AT1 B;  4ZDN A;  3HHN B;  3PW5 A;  3DMJ B;  4DBQ A;  1MWZ A;  1YDL A;  5CAA A;  4YDD B;  3N0C A;  4AT1 B;  3G6X A;  4FXD A;  4CH0 S;  4FS1 A;  2ZH3 A;  4A3D C;  2ATL A;  3NWR A;  1R8H A;  5IT0 A;  4IFY B;  1H3D A;  3PHE A;  5A8W A;  4FN5 A;  3K59 A;  1G1X A;  2FHM A;  2HNZ B;  4NOH A;  4L75 A;  4RNF A;  2UXD F;  2F1F A;  3CDW A;  2FZK B;  2HKE A;  2ZH2 A;  4ZHR A;  3FJ2 A;  3UDV A;  4ZVR B;  4KAI A;  4DSI A;  5IYD K;  1RZM A;  3HX9 A;  2K06 A;  4LBH A;  3EXY A;  4EO8 A;  4DQR A;  2JA7 C;  2K1R A;  3CD0 A;  1NBE B;  2YU9 C;  3MEK A;  4RWW A;  2YH0 A;  3R1H A;  3BR8 A;  1HQE A;  4ECV A;  1CS4 B;  4K4X A;  3DU5 A;  4HAC A;  4LF6 J;  2DR6 A;  3QT6 A;  1NB7 A;  2DNR A;  4JI2 J;  4NOI A;  4CYU A;  3Q8S B;  4WKY A;  4B3M J;  2IRY A;  4K4V A;  1O2F B;  4JYA J;  1XR5 A;  1HBO B;  3S14 K;  2HIQ A;  2XS2 A;  4TN2 A;  3IBW A;  2JFK A;  3VQT A;  4NCG A;  1C0A A;  2GW8 A;  4YY3 J;  2ZC3 A;  3H8Y A;  1TP7 A;  1N32 J;  3ZZZ A;  3S1M K;  4RW6 B;  2VDH A;  3VGT A;  1BWV A;  3TFI A;  3Q8Q B;  1NPR A;  2MQ8 A;  4B9M A;  1Y1W K;  2WB1 D;  3SZZ A;  5G4D A;  1OY9 A;  4BBR K;  2PO4 A;  1LWC B;  4A48 A;  4PXE A;  5KG2 A;  4QWA A;  2YQ1 A;  2W4C A;  2C2E A;  2OPQ A;  1Z2L A;  2AU0 A;  4O44 B;  3VGV A;  1XXA A;  2C2O B;  1R8B A;  1FTR A;  1NDK A;  4FYD A;  4DR1 F;  2ZZM A;  2FVS A;  1RWU A;  1TZ0 A;  4X62 F;  5F3Z A;  1S9G B;  2JVO A;  4ZPV R;  5IM0 B;  2VFT A;  3T19 A;  4FYV B;  1R0A A;  1V9O A;  2P6S A;  5IWA J;  2NR0 A;  1JWW A;  1FRJ A;  2CQC A;  3KK3 A;  2PN6 A;  2MLX A;  1H7X A;  2MLY A;  4Z7C A;  2J0Q D;  3EQL A;  2DXF A;  4KN4 A;  1UKU A;  1GMU A;  3T02 A;  1RWN B;  4TQR A;  4JI6 F;  3ENA A;  1TKX B;  1S10 A;  2DHA A;  4O4G A;  2EFQ A;  4ZVF A;  3THV A;  1W7W A;  4I69 A;  3GIJ A;  3G6E S;  1VGY A;  2J5A A;  2KG0 A;  4QYZ J;  4WK3 A;  1HNX J;  4HDG A;  2BQU A;  4GTE A;  3DOK B;  3UO0 A;  3VZI A;  1O51 A;  2DIU A;  2FC8 A;  2ADC A;  1C0T B;  1DD5 A;  1X9M A;  5CYQ B;  4I56 A;  4LIR A;  1M5H A;  2NSB A;  2MKK A;  3I4H X;  4A93 C;  3H7H B;  2BQR A;  2HBY B;  1XZP A;  1VOM A;  2CFX A;  1BD6 A;  3DLB A;  2M52 A;  4OYM A;  5J2P A;  1FE0 A;  1DTT B;  3GB0 A;  3V5R A;  3TTG A;  2BDP A;  1XXC A;  2GVD B;  2EBE A;  2POK A;  4DL2 A;  1N5T A;  3KLI B;  1W25 A;  3RB4 A;  2HZC A;  3D1Q A;  3AXM A;  5DZ6 A;  1PJ5 A;  2MHN A;  3UWT A;  3C15 A;  5A8R A;  4I1T A;  2YX4 A;  4IG3 B;  3W7B A;  1IKV B;  2I5J B;  1FT8 A;  3M4O K;  2R7S A;  4F3O A;  4LR2 A;  1Y9O A;  3ENV A;  3MUR P;  2W2Q P;  3JQM A;  2FGO A;  5J2Q A;  1R0B G;  1KHW A;  4ZPA A;  3ZNU A;  3M8Q A;  5DDP C;  5C25 A;  4W92 B;  4TY9 A;  1DZ5 A;  3CQZ A;  3C2P A;  2GSU A;  2ZOF A;  3JTP A;  4IRD A;  2HGL A;  3DGP A;  1XK8 A;  3D4J A;  1SJ4 P;  1FJG J;  4D3G A;  1FD2 A;  1L0W A;  1SJF A;  2J0X A;  4XAK A;  3NAH A;  4A8S A;  2ACM A;  2JDJ A;  1SVD A;  2CPI A;  2R3V A;  2ZH1 A;  3HSG A;  4NA1 A;  3UVJ B;  1U2C A;  4A3L C;  1TAU A;  2GHP A;  2AJ1 A;  2ZKT A;  1KN6 A;  4RU9 A;  1RTJ B;  2R9L A;  4A3M C;  1HMV B;  2HQI A;  1MWQ A;  2VV5 A;  3PEJ A;  4JI1 F;  1GEH A;  2B0G A;  5IC4 B;  3AD7 C;  5B0G A;  4A3K C;  3QNW B;  3QYY A;  4CNZ A;  2CNK B;  2KI2 A;  4ILD A;  3UE2 A;  1S72 S;  4FYW B;  2E2I C;  2IDE A;  4RPF A;  1FI4 A;  2XY7 A;  4IH6 A;  1UPM B;  3TJA A;  1ROF A;  4OHZ A;  4BLB A;  1ZM2 A;  3EX7 B;  5HRO A;  1VQ8 S;  2OSQ A;  5AXM A;  3MR6 A;  3MM6 A;  2CPD A;  4I64 A;  1JLA B;  2HMI A;  1H72 C;  2AQ4 A;  1FJC A;  2B8Q A;  4LRA A;  4NXN J;  5KFR A;  3KK1 B;  2NPF A;  3WQP A;  3EWG A;  3MEE B;  3E51 A;  2DXE A;  4G6V B;  1U24 A;  5HI7 A;  4CH7 A;  3LO3 A;  2OHD A;  4LLG A;  3GFX A;  3S1N C;  3GE9 A;  2DIS A;  1S6P A;  2IAJ B;  1RTI B;  4DCP B;  5T41 A;  1TL3 A;  1XMQ F;  5EHH A;  4P2F A;  2Q43 A;  2PII A;  3L7O A;  1D8Z A;  1MLA A;  2ZM6 F;  3HPO A;  1K83 A;  1N34 F;  1RSC A;  1FRM A;  2R8K A;  3CAG A;  2PI4 A;  2CPY A;  3O44 A;  4OQJ A;  4WZQ A;  4YOE A;  3CVK A;  2AX0 A;  4BHQ A;  3GP9 A;  4KHM A;  1HBM B;  2DR9 A;  2YTC A;  2W9C A;  4OZJ A;  3FFI B;  4DLE A;  3PW2 A;  4ZJQ A;  2XGQ A;  4C11 A;  2UV8 A;  2BAC A;  1FNX H;  1S1W B;  3O8W A;  1B70 B;  4B3S F;  4YFK A;  3S2D C;  5AE3 A;  4ID5 B;  2ILY A;  4WPA A;  1TL5 A;  1LV5 A;  1FNO A;  3MTK A;  1IQ0 A;  1FKA F;  2AEF A;  1F93 A;  5FLM C;  5D3G A;  4R8U B;  1WHV A;  2JH3 A;  4PAB A;  5D6G A;  1DLO B;  4DSL A;  5J1N A;  4B17 A;  3UR0 A;  4LR8 A;  4HTI A;  4O3S A;  3G8S A;  3Q3Q A;  1CJK B;  3FMW A;  1GMW A;  4ZIV A;  4DR1 J;  4WK1 A;  1HD1 A;  2R7W A;  1DQA A;  3AOD A;  2B9E A;  4C2M A;  3CCL S;  1L3V A;  1K0T A;  1GXL A;  1JLG A;  3HD1 A;  2E7W A;  2Y0S L;  4B9T A;  2J6T A;  3BKU A;  2CAJ A;  3QIP A;  3C14 A;  4CLS A;  2H5I B;  4DG1 B;  4V19 X;  2CQH A;  1JMT A;  3KWM A;  2PC6 A;  3QLH B;  4ZP9 A;  2QE5 A;  2VJV A;  5K14 B;  4NLT A;  1RAD B;  3OSN A;  4KN7 A;  1VJE A;  3M30 B;  4CLZ A;  3GTP C;  2JA5 K;  4MFB A;  2NXE A;  4I2P B;  3GQC A;  4ECZ A;  4GRS A;  2HHT A;  4ZP6 A;  2BJ8 A;  3IRX A;  1XQI A;  3KLH A;  2O66 A;  3T5L A;  4KHP J;  4IFV B;  1DHM A;  4Y2M A;  1WQH A;  2JFD A;  3DFE A;  1DCH A;  3P3D A;  5H9E J;  4EBC A;  2DNM A;  1H2V Z;  2YKM A;  3BP8 C;  7FD1 A;  3LP1 B;  2X3D A;  3DNC A;  2VUM K;  4IRK A;  3HF5 A;  5DJB A;  1NND A;  4JBC A;  2BEF A;  5LXY A;  2OO4 A;  3Q2S C;  1KC8 T;  1MSW D;  4A3B K;  1N33 F;  2V8V A;  4USK A;  1S1U B;  2HQF A;  5F8J A;  3P5T L;  3AOC A;  1WKL A;  3B54 A;  1C0U A;  2RQK A;  3S1Q C;  4URQ U;  4MAK A;  4AL7 A;  4WZM A;  2XI3 A;  4LF8 J;  4PCQ A;  2UUA F;  1DAX A;  4M5D B;  2E7X A;  4ZK7 M;  1N48 A;  2YWW A;  2KU7 A;  4A3E C;  1UW9 A;  3GTG K;  2IPO B;  1HQU B;  1NZ8 A;  3RB0 A;  4P73 A;  4TQS A;  4A3G K;  2D7S A;  5FJ8 K;  5K8P A;  2G9O A;  2GZO A;  4ZVH A;  4LFA J;  2NRE A;  3BQ2 A;  1U6B A;  4RW8 A;  4KAW X;  3DLG B;  2KWA A;  4DJB A;  2CPJ A;  3TUJ C;  3O6Q A;  2RUG A;  2XS7 A;  3CPW R;  4OV1 A;  2HNY A;  1YJT A;  4OZ5 A;  2H5E A;  2UUC F;  4OI1 A;  1X7V A;  4Q44 A;  3L4B C;  2WB4 A;  1KTQ A;  3J7A N;  3OXL A;  1B4A A;  2AHO B;  1S12 A;  3R5C A;  5BJR A;  2ASD A;  5KT5 A;  1U1N A;  1U26 A;  2R42 A;  4LF4 J;  1AT1 B;  5ETP A;  3MM5 A;  3PIP Q;  4LR7 A;  2CPF A;  3NKY A;  1FXR A;  4QJV A;  2DIV A;  3R1L A;  3QX3 A;  2KVI A;  5FDL A;  5HQ8 A;  5L9X A;  1FTC A;  4EO6 A;  1YLX A;  1L3T A;  1TL7 A;  4OX7 A;  4XK8 C;  3VGS A;  2JA7 K;  2FD2 A;  2YU9 K;  5HK4 A;  1Y7P A;  2ZC4 A;  2ZBC A;  2DNZ A;  1K9M T;  1EP4 A;  2UXB J;  2RU9 A;  1VC0 A;  1N52 B;  4HH0 A;  3QO9 B;  4DFK A;  2WVB A;  2QA4 S;  3W9H A;  1VH2 A;  1RJJ A;  1PCA A;  1R89 A;  1UVN A;  1RT7 B;  2V8D A;  1T02 A;  4GTA A;  4RX6 A;  1XWL A;  3VVU A;  5HLF B;  4ATN A;  4A3I C;  2DXD A;  1VQ7 S;  2KO1 A;  2MZJ A;  3M9O B;  2CPX A;  4EBE A;  4QWE A;  3M1V B;  1XMQ J;  3Q83 A;  2NPI A;  5L9N A;  4Y28 C;  3PEH A;  1VI7 A;  2DNP A;  4DX6 A;  3C6T A;  5E0O A;  4HKQ A;  3V6D A;  5JVG Q;  5F41 A;  5A8K A;  4C8M A;  3AQP A;  2Z8Q A;  2W25 A;  5DG9 A;  5CAB A;  2ASY A;  3GTJ A;  1CUL B;  4QYZ K;  5E3R A;  4ZVP B;  1L5U A;  2ERR A;  3MR7 A;  4DV1 F;  2ZE2 A;  3HSD A;  3LAJ A;  3D3C J;  2HVE A;  1BQN A;  4ALZ A;  2NVY C;  1U2R A;  2CRL A;  4WYL A;  3G82 B;  2DRB A;  2PMW A;  3EXC X;  2V6S A;  2HQD A;  2GVZ B;  5EGH A;  1SL1 A;  5C24 A;  2Z2Z A;  1TVR B;  4GVB A;  4DFP A;  3NBP A;  2LMI A;  3RGI A;  1HI0 P;  4LSL B;  3MAA A;  2OLW A;  2B63 C;  2MKC A;  4XO0 A;  1RT4 B;  2QO3 A;  4DV2 J;  2IC3 A;  4PRF A;  4BCA A;  1EB0 A;  2MY7 A;  4I67 A;  2Z57 B;  3R5J B;  4G1Q B;  2YNH B;  1SKU B;  2LDY A;  2JRS A;  2HHX A;  3KG1 A;  1FDA A;  4A93 K;  3TJ9 A;  5C3E C;  2BAB A;  1JKH B;  2QTW A;  2LFV A;  4UOG A;  4KYZ A;  2AJ0 A;  2BRK A;  4YB5 A;  2OML A;  2V34 A;  4K4T A;  1T7P A;  1R9T A;  4G65 A;  1QLN A;  3P49 B;  4YN3 B;  1SKR A;  4F7V A;  4DUZ J;  5L8R C;  4GTL A;  3MED B;  2K3K A;  1NKC A;  1HWI A;  1AUS L;  1NO8 A;  3J81 U;  2BKN A;  4DI6 A;  4TY8 A;  1Q4R A;  3VAL A;  4LSN A;  1FFW B;  1UMJ A;  4Y34 A;  5BYQ A;  1Y5L B;  1IS1 A;  2RSQ A;  4V1A k;  4OHY A;  1FRI A;  2OPS A;  4IYQ A;  5A0Y A;  5HBM A;  3HVT B;  1GT8 A;  1KD1 T;  3HDS A;  1ZET A;  1MU2 B;  4K4W A;  3ZZY A;  1WJ9 A;  3WC0 A;  1M5V C;  4PG4 A;  2DHX A;  1X4C A;  1ZH5 A;  3M32 B;  4LF9 F;  3V6H A;  2CQ3 A;  4RWX A;  1GXT A;  3PXG a;  2UUB J;  3KUG A;  3UN3 A;  4LR9 A;  3DLK B;  4AYB L;  1D9F A;  4DL4 A;  4D3H A;  4ZP7 A;  3PX4 A;  2B4V A;  3IR6 B;  1S9E A;  1XER A;  2V94 A;  2XMU A;  1P9Q C;  3RG6 A;  4F0H A;  2B5J A;  4IR9 A;  3I0R A;  1IKW B;  4A3L K;  1TKZ B;  4DUY J;  1LW2 A;  1HBN B;  3PYF A;  4Z7Y A;  5E3P A;  4LF5 F;  1VBY A;  4A3M K;  2UVR A;  4LRF A;  3LH2 S;  3NNA A;  1TWA A;  3ADA C;  3OXF A;  2YPZ A;  2XC9 A;  3DMJ A;  1BE4 A;  1BS2 A;  5M3F K;  2YKQ A;  1JB0 C;  4A3K K;  2CJK A;  2VFU A;  4B9L A;  2B8P A;  2RS2 A;  2E2I K;  1OO0 B;  4QR2 A;  3K5O A;  3OFG A;  4IFY A;  2E2H C;  1XPP A;  2UVV A;  4NA3 A;  1IKX B;  2HNZ A;  4DR7 J;  1HHQ A;  2CJA A;  3UQS A;  2MY8 A;  1RLC L;  5D0H A;  3R3T A;  2HHQ A;  3CED A;  2I38 A;  2ZH9 A;  4H4O B;  2LLZ A;  3W65 A;  3O1L A;  3T9Z A;  2FZC B;  2C3P A;  1CC7 A;  1F3V A;  1VIS A;  1IVZ A;  1TWC C;  1YVF A;  2A1B A;  2R7Z K;  3CTR A;  2QN6 B;  3T6J A;  3S1T A;  3PVX A;  5K5M A;  4NLW A;  1CS4 A;  4BLA A;  2CQ2 A;  2EEY A;  3OR1 B;  2O01 C;  3JQJ A;  1FRL A;  5L1L A;  3NWG A;  3MCS A;  4V19 J;  2J7U A;  3TA2 A;  1NK0 A;  1RT2 B;  2A68 A;  3TX0 A;  2OP5 A;  1TWF C;  1DQ8 A;  5AXL A;  2C3Y A;  1HBO A;  3KUE A;  2IMO A;  1JOE A;  1NAQ A;  1NSA A;  4TXS A;  2R8G A;  3AJ2 A;  1JIH A;  3WX8 A;  2COL A;  1KHV A;  2ZBR A;  4P5B A;  1KQF B;  2QA1 A;  4H4M B;  1FEH A;  2OMO A;  3BR9 A;  1KR4 A;  1SBR A;  4RW9 B;  4ECS A;  1UVI A;  3D6M B;  5KFF A;  3K0J A;  1TUW A;  5LXR A;  4RW6 A;  3RBX A;  1IBL F;  1T0T V;  2WTF A;  2JEG A;  2W4D A;  1TWH C;  1S76 D;  1LWC A;  4UUX A;  4UQT A;  2RU3 A;  3S2D K;  4O44 A;  1RU0 A;  1U8S A;  3HFK A;  5IOQ A;  4F0K A;  1NK6 A;  1LWE B;  1RT6 B;  2X7I A;  3EM1 A;  1G3O A;  2MQP A;  5FLM K;  1SPB P;  3MUV P;  2LA4 A;  1S9G A;  5IM0 A;  1SC3 B;  4U8V A;  3BGF A;  1RT3 B;  4X84 A;  1TK0 A;  2DHH A;  2N4C A;  3BGO P;  4DSK A;  5E3C A;  3DLL Q;  4AE5 A;  1K8A T;  3EVO A;  4DF4 A;  5AE2 A;  4OZ0 A;  1BC6 A;  4C3L A;  1WSV A;  4KGX B;  3KDO A;  1TKX A;  1SI9 A;  5H9E K;  3KNG A;  3ELH A;  2ZH6 A;  1A7G E;  5ETT A;  4EEY A;  2D1C A;  4W98 A;  4B9V A;  2KXF A;  3QID A;  5U47 A;  3T5J A;  4GMK A;  1VBX A;  4NLV A;  3DOK A;  1RWV B;  1M5P C;  2EK1 A;  1C0T A;  2RF2 B;  3UCG A;  5CYQ A;  4WBF A;  3FBC A;  2VBZ A;  4X65 F;  3S6E A;  4ZN3 A;  2F4V F;  2JA6 A;  4KB2 A;  5D4O A;  3LTO A;  1YCL A;  5K8M A;  4O3O A;  2A2C A;  2AWZ A;  2B6A B;  4XCH A;  3UDC A;  2HVI A;  4DCJ B;  1DTT A;  2EFO A;  1QTM A;  2ZH5 A;  1RGV A;  3T3F A;  2QLB B;  2GVD A;  3KLI A;  1ZA2 B;  4UF4 A;  3OW2 R;  3TR5 A;  1HNZ F;  2KTQ A;  2RML A;  4IG3 A;  1VRT B;  2J7W A;  1IKV A;  2I5J A;  3CJ0 A;  3CT9 A;  3U1M A;  4CT9 A;  1RKJ A;  4CLY A;  4OX6 A;  4H54 A;  5D77 A;  2NXN A;  2KRR A;  4H4K A;  3S1Q K;  2NUU G;  3CCU S;  2L48 A;  2V4J B;  2XNR A;  2NYI A;  1KKH A;  4MQ9 A;  5I3Q A;  3DRS B;  4A3E K;  3EGN A;  2Q6C A;  3S16 C;  3V6J A;  4ZJL A;  4IOC Q;  3I56 S;  2MKY A;  2Z58 B;  1FE4 A;  4NXM F;  4PG7 A;  1Y1V K;  4WYW A;  1LK5 A;  4ED3 A;  4BBS C;  4X64 J;  3GON A;  3UVJ A;  2H5J B;  2XSF A;  3SV4 A;  3RYL A;  5B0E A;  4C45 A;  1RTJ A;  1KQS R;  2IIH A;  3EPI A;  1HMV A;  1B7F A;  3TOQ A;  1NB2 A;  3CO0 P;  4OYP A;  2C2N A;  4EYI B;  4JV5 F;  3QZ7 A;  2R2T A;  3S8S A;  4CLK A;  3QT5 A;  5TJ3 A;  5IC6 B;  3DN9 A;  2GGP B;  2OPP B;  2VF3 A;  3NGR A;  3M8W A;  1QAY A;  3A8J A;  1YBT A;  3WHI A;  4RMF A;  4AYB D;  4KGV B;  4OI2 A;  2ZNY A;  3HKZ L;  1RA7 A;  5KFU A;  2XCQ A;  2HGN A;  1DFD A;  3NNC A;  3D6H B;  4FF3 A;  3ISZ A;  4DF8 A;  4UZB A;  1JLA A;  3FZB A;  3PFO A;  2UP1 A;  3KK1 A;  1FF2 A;  1IBM J;  2MYF A;  2GIR A;  3MEE A;  3Q24 A;  3SBM A;  1XBW A;  2MZQ A;  1OMS A;  3HI9 A;  2XHW A;  4J5O A;  3FQL A;  4A8F A;  5DQH A;  3KHH A;  1KVJ A;  1FCA A;  2IAJ A;  1RTI A;  3GDZ A;  2BBE A;  1F9N A;  1DRZ A;  2ZWP A;  4RZR A;  2X3G A;  3NGS A;  3CJ5 A;  1D9A A;  3CNQ P;  2RS8 A;  2M8H A;  1F9E B;  3FNN A;  2VUG A;  4F25 A;  5GAD I;  4A3I K;  3BZQ A;  4N76 A;  3GEH A;  4GT9 A;  3AOA A;  5KFI A;  1F5C A;  1JQG A;  2NVT C;  1ACM B;  2LDI A;  1PAE X;  4IQM A;  1S6U A;  4DV0 J;  2P9G A;  3GJS B;  2D3O 1;  2FJD B;  3TEH B;  1U1M A;  4N47 A;  1YQH A;  1HBM A;  3W60 A;  3THT A;  2QLF B;  2VG5 B;  3MI7 X;  1HQ2 A;  3FFI A;  1U0S A;  5F0W A;  4NRT A;  1RU1 A;  1BXN A;  1S1W A;  2VA2 A;  3U1L A;  2JLG A;  2N3L A;  3EZU A;  3M7V A;  3NMA A;  3OTB A;  1TEL A;  2EXU A;  2F8H A;  5HO4 A;  4ID5 A;  1F0X A;  3WX4 A;  2V50 A;  4DL6 A;  3O5T B;  3BQ1 A;  3LPX A;  2QSF A;  4CNY A;  1HR0 J;  4B3T J;  1K47 A;  3MHY A;  2XMK A;  4KPY A;  5B08 A;  2PA3 A;  4QIG A;  4R8U A;  5I3U B;  2AGQ A;  5ETS A;  1GX6 A;  1DLO A;  1LWF B;  1SJ1 A;  4WP3 A;  4U7C A;  2MZ1 A;  3SV3 A;  5M5X K;  1FD8 A;  3N5B A;  2KM8 B;  4ITS A;  2GHW A;  2NS1 B;  4ED8 A;  1CJK A;  1IBK J;  3ORE A;  4NZ0 A;  3H20 A;  3K8V A;  3V4I B;  2RH6 A;  4CH1 A;  3VAK A;  1F1B B;  2ZWO A;  2B63 K;  2CQI A;  3SCJ E;  3M8Y A;  2J9E A;  4L3N A;  1HNI B;  2A18 A;  3SZ2 A;  1T9Y A;  4IKA A;  3LP2 B;  3CCJ S;  1DAR A;  2HVD A;  4IH5 A;  1T9V A;  4DG1 A;  1RB0 A;  5E7O B;  1F2G A;  3R5G A;  2NVX C;  3PX0 A;  3N6M A;  1BJT A;  3QLH A;  3GFY A;  1LFW A;  5F3T A;  4JV2 A;  5C3E K;  2AYB A;  2AV5 A;  2BM0 A;  2IVY A;  5K14 A;  4RUC A;  1C4A A;  3OFF A;  4X4Q A;  3RRK A;  3FUY A;  4ETX A;  3D68 A;  2LU1 A;  2IVM A;  3CUN A;  4I2P A;  2OEL A;  2R7O A;  3S17 C;  5F0U A;  1CEZ A;  3GG0 A;  3GYG A;  4IFV A;  1RHR B;  4YP3 A;  5ITH A;  3CC2 S;  3EGW B;  2BJ9 A;  1Q1K A;  5IFM A;  2DHG A;  1U2F A;  2HBZ B;  3LP1 A;  3GTK C;  2VPY B;  2HHV A;  5J2N B;  3CCM S;  2O3D A;  3N0B A;  2W2P P;  1S0O A;  3SQO P;  3GEI A;  4KV8 B;  4FYY B;  4UT4 A;  2MXY A;  4J9N A;  4KRW A;  3K5N A;  2E9R X;  4B3O B;  5BR8 F;  1SJ3 P;  3JTO A;  4DCO B;  4C6A A;  3EUN A;  2DT9 A;  3NCP A;  2KFY A;  3AB4 B;  5CA5 A;  1BMQ B;  2HFS A;  1S1U A;  2JLF A;  4N8O A;  1T8E A;  3WOD A;  2YPY A;  2CVE A;  4TYA A;  1RHQ B;  5BXI A;  1IN0 A;  3FK4 A;  4LFC F;  1ZYQ A;  3NP5 A;  4NEY A;  4M5D A;  3OPF A;  4S0M A;  3SCI E;  2KDO A;  3ZC4 A;  1HQU A;  1O8B A;  3IR5 B;  2ZIT A;  3VA7 A;  2QLX A;  4PYD A;  4USJ C;  3SZY A;  1ICE B;  2OI2 A;  2JZ5 A;  3LGM A;  1IKY B;  3IC1 A;  4MYT A;  3DLG A;  2CQD A;  2D3U A;  3OJS A;  5A2Q Y;  1HNW J;  5THW A;  3D6F B;  4HHJ A;  2CNL B;  3MDF A;  4JI4 F;  4WTY A;  4ZLL A;  4O3R A;  3KLG B;  2GAG C;  1YJU A;  1YZ6 A;  2ZJR Q;  3TW0 A;  1ZBS A;  2E2H K;  3MCO A;  5KFA A;  3VAM A;  3CCZ A;  2LQ5 A;  2MKH A;  1M5K C;  4ECR A;  4C8Z A;  1U1O A;  3DRP B;  4X4P A;  4RW4 B;  5A76 A;  4BKW A;  1VQM S;  4LJM A;  2J9D A;  2KJV A;  4QWD A;  1TWC K;  4CCH A;  1DCP A;  4ZVQ B;  1K83 K;  2PE8 A;  3MZI A;  4L74 A;  1PYT A;  5HP1 B;  3H98 A;  3TA1 A;  2OGU A;  3L4J A;  3GTM A;  1GX5 A;  5HMY A;  2CIM A;  3HOY K;  2MZR A;  1LNQ A;  4M5H A;  5D4D A;  4ZPC A;  1UV7 A;  3E2E A;  3C3L A;  1G51 A;  2AJF E;  3QO9 A;  1T11 A;  3N4W A;  2FJA B;  1ZZN A;  3CWJ A;  3NAI A;  1I50 A;  3OTO F;  3TP2 A;  5KFG A;  4FF2 A;  1TWF K;  1RT7 A;  3SDE B;  4B02 A;  3DHX A;  3RZO C;  2Q79 A;  2R7T A;  2P5V A;  2N7Y A;  2ATC B;  1WQG A;  1T3N A;  2HZA A;  3HKZ D;  5HLF A;  1WC3 A;  3T41 A;  3GZ7 A;  2IM0 A;  3SIP B;  4IOB A;  4JUZ A;  3BM7 A;  3ILO A;  3M1V A;  4LK0 A;  5E2Q A;  1NCL A;  4PQA A;  2W9A A;  3ENQ A;  1TWH K;  2JEJ A;  3NUH A;  5HAN A;  1TAQ A;  4L73 A;  3VAJ A;  2FJW A;  2M5Y A;  2WRM A;  1JJ4 A;  3MAH A;  4DL7 A;  2GSO A;  1Q5Y A;  4P7T A;  1PYS B;  4Q5V A;  1CUL A;  3A8K A;  2FY8 A;  3LPE A;  3MMB B;  4QIE A;  4FPI A;  4B08 A;  2MST A;  3HOW C;  1E6V B;  4DPT A;  4LQ3 A;  3G82 A;  3SSS A;  2I8E A;  4ZVT B;  3RB3 A;  1VQO S;  2GVZ A;  3DDI A;  3VVT A;  2DH8 A;  4F4A A;  1QSL A;  1TVR A;  2XCP A;  8ATC B;  5F8I A;  5E5N A;  2QYG A;  2EC2 A;  2MQN A;  4WE1 B;  4LSL A;  1JX4 A;  5IOS A;  3IP0 A;  2IRU A;  3T00 A;  1AZS B;  1RT4 A;  4KH1 B;  4Y00 A;  3RW6 A;  5LSO A;  1K1Q A;  3FRY A;  1PC4 A;  2WVC A;  4G1Q A;  2YNH A;  1A9N B;  2OFH X;  3GG1 A;  4LFB J;  2LQ8 A;  1JKH A;  3ITH B;  1F60 B;  2XUL A;  2LXU A;  3L9Z A;  2EBG A;  3H2L A;  2OEK A;  2W7V A;  2B4U A;  5KG0 A;  1NJY A;  2E9T A;  3MED A;  1Z1Z A;  2BJ1 A;  1OPI A;  4LVN P;  1URN A;  2OIH A;  1R27 B;  3M8P B;  4EWT A;  4PPZ A;  3PKM A;  4J3N A;  3Q23 A;  3BJY A;  3TFJ A;  4P9S A;  4OIP A;  5F8M A;  3HLU A;  3UCZ P;  3TUP A;  3HXA A;  1FX2 A;  3OL7 A;  1WCM A;  3HVT A;  1EFW A;  4ZVS B;  3L3C A;  1MU2 A;  1S7I A;  3K17 A;  3JS9 A;  4NLR A;  2YNG B;  2EKY A;  1VQK S;  9RUB A;  3IAM 9;  2VIH A;  4FKX A;  3M32 A;  3DXS X;  2HHU A;  2KVQ E;  2NXU A;  5LSR A;  2QFJ A;  4RBV A;  1HAR A;  3S16 K;  3OTD A;  3DLK A;  3CJ8 A;  4OFZ A;  2KT3 A;  4X4O A;  2GJF A;  4NLP A;  4USH A;  4USM A;  3MF5 A;  3BDP A;  3P45 B;  4OI3 A;  2LXF A;  4BBS K;  4GKK J;  3MPV A;  3K2Y A;  1IKW A;  1XTZ A;  2ZUA A;  1TKZ A;  5D4L A;  1HBN A;  2PFF B;  3GCX P;  4DR3 J;  4LQY A;  1J5E F;  2XQC A;  2HS0 A;  1T9X A;  2V68 A;  2DGT A;  2XMT A;  2NZ4 A;  3WIU A;  3GEE A;  2BE9 B;  2N3O A;  2YQ3 A;  4Q8E A;  5B0C A;  2CQG A;  1Y5N B;  2R8H A;  2D3Z A;  1AB8 A;  3BP3 A;  2C3U A;  2DR7 A;  3AA8 A;  2L9N A;  2QL5 B;  1IKX A;  4CQ1 A;  1EQ0 A;  4Y2C A;  1CQN A;  3W63 A;  1LW0 B;  4WP9 A;  3HZG A;  3PRB A;  3F44 A;  5LOQ A;  4H4O A;  4CO3 A;  4WXW A;  1WC4 A;  1NK7 A;  4PUO B;  2L41 A;  3ZZU A;  4CWB A;  2GO8 A;  4G1I A;  3QRP A;  1MML A;  1TFY A;  1APS A;  1AFJ A;  5LMN F;  2RAQ A;  2YWG A;  4HL9 A;  1I94 J;  4XPE A;  3QFW A;  4DDQ A;  3GIL A;  4R0J A;  3GMG A;  4Y3C A;  2E5G A;  3OR1 A;  2ZHA A;  2MJN A;  4DV4 F;  1IWA A;  1RT2 A;  3OL6 A;  3ILJ A;  1N5Y B;  1UEK A;  2IM2 A;  4BXX C;  1RBA A;  4KHR A;  3QWU A;  1X4G A;  3IM9 A;  4OIO A;  3GTJ K;  1HWU A;  4QIV A;  4JI0 J;  3OD2 A;  1R43 A;  2MLZ A;  1UZH A;  2NVT K;  4CLT A;  2R93 C;  4MJK A;  2CQP A;  2DGU A;  4H4M A;  1OIA A;  3OTO J;  4RW9 A;  3MMC B;  4M5M A;  2RRB A;  2ZBP A;  1MMD A;  1NXI A;  2KB2 A;  4I7F B;  4P7V A;  4YFX A;  4OYZ A;  4Z2X A;  2HFO A;  4LOW A;  2KYZ A;  1YJR A;  4G7H A;  2RT3 A;  4OYB A;  2WAQ L;  4JI7 J;  3TAM B;  1KS2 A;  3KOA A;  2D69 A;  1LWE A;  4K4S A;  1V6H A;  1RT6 A;  1UA0 A;  5E3A A;  4NLY A;  2V6U A;  2PA8 L;  1RIS A;  1CVJ A;  4IO1 A;  3J81 Y;  1X4A A;  4FKY A;  1W2I A;  1FRK A;  3JSM B;  4M63 A;  1SMY A;  3M3Y C;  3OTC A;  2GS8 A;  2HWH A;  3H4B A;  5JXS A;  5C2G A;  1N56 A;  4HEA 9;  1S4F A;  1RT3 A;  1JXV A;  5IV4 A;  1HNV B;  3E3X A;  5GAD U;  2ZHO A;  4QIF A;  2ZVI A;  3M6W A;  4WU3 A;  4F04 B;  5DG7 A;  4KY3 A;  1N8R T;  2UXC F;  4U67 Q;  1X4B A;  3W2W B;  2W01 A;  1Y4Z B;  2AMC B;  4RNM A;  5IQ6 A;  2OJ3 A;  4U7U D;  2RQ4 A;  3MM8 B;  1MRO B;  1QVG R;  1U6F A;  2NVX K;  2C2K B;  5AJ3 F;  3MUM P;  2GML A;  2VHG A;  3K89 A;  4QQB A;  2AGO A;  1HPZ B;  1TUG B;  4M5K A;  2YBV A;  4C97 A;  3TAQ A;  2RF2 A;  2UU9 F;  1WUU A;  2ZOG A;  1FES A;  4TNO A;  1D09 B;  1UAW A;  2CQ1 A;  2IJF A;  4NLO A;  3BSO A;  1Z4U A;  5HVH A;  2AP6 A;  1CG2 A;  4UW2 A;  1N0U A;  1PBA A;  2X51 A;  3Q8V A;  4ES3 A;  4OIQ A;  3M4X A;  1X0F A;  5D8H B;  1IQT A;  3OLA A;  2B6A A;  4L72 B;  3MM5 B;  3GTK K;  1B0P A;  4O3Q A;  4DPW A;  3SYZ A;  4XLP A;  4K0K F;  2XLJ A;  3M05 A;  3QSY B;  4OYO A;  1REG X;  2K8G A;  3OR2 B;  1HWK A;  1J98 A;  2RKI B;  4B3R F;  1H74 A;  4DSJ A;  2HVH A;  1VRT A;  2ACY A;  1V3Z A;  5DDR C;  2QV6 A;  2FLN A;  3MD3 A;  1WHW A;  1ZXO A;  4Y2I A;  2VON A;  3PX6 A;  1HWJ A;  2B3T B;  5CHC B;  4PYA A;  3CJT A;  4WP8 A;  2V4J A;  6FDR A;  4ZLJ A;  2W8K A;  3EZ5 A;  3MAQ A;  5DGB A;  3T1Y F;  3U27 A;  3DRS A;  2HQC A;  2DBB A;  1GTE A;  1F9F A;  2RNE A;  4M94 A;  1UPP A;  3RB6 A;  5B0B A;  2HHH J;  4FVM A;  1VCT A;  4R0E A;  1JXL A;  2QLW A;  1PGZ A;  5JJB A;  3PZP A;  4B9U A;  2LEP A;  2B9W A;  1AXQ A;  4AFF A;  4ED5 A;  2KZM A;  4JI5 J;  1F5B A;  4IO9 Q;  2NSC A;  5C4J K;  5FLX Y;  4DV5 J;  4A8Y A;  4A3F C;  2Y1J A;  2P8I A;  2PMH A;  4X66 J;  5BYS A;  3QAE A;  1KNZ A;  4DQQ A;  2HRU A;  3QGG A;  2OTL S;  3DDK A;  3SCK E;  3RU0 A;  4I6Y A;  5GVQ A;  3OV7 A;  4Y52 K;  4LT6 A;  3Q22 A;  1JLQ B;  3H2U B;  1NDP A;  3NCR A;  4CO5 A;  4QU6 A;  2RGR A;  2GGP A;  2OPP A;  2V63 A;  1FDD A;  3AH5 A;  4EYH B;  3OT9 A;  1ZBT A;  4C98 A;  3VAI A;  4DL5 A;  1C1B A;  2XYP B;  2HFZ A;  4LF7 J;  4NYP A;  1VK8 A;  3THP A;  1TK8 A;  5KG7 A;  1IWG A;  5KFL A;  2V4Q A;  4YR3 A;  1EHW A;  3IN5 A;  2VFV A;  4YHH J;  2ZUG A;  4FNI A;  1VJW A;  4KT0 C;  2Y3Y A;  3CDB A;  1WC5 A;  3ETO A;  1Y1W A;  4JV0 A;  1SFO C;  1X4F A;  4DWI A;  4NCA A;  3TZZ A;  4M1K A;  9ATC B;  3BGU A;  4OZ2 A;  2DYA A;  5I42 B;  1RU2 A;  3TVK A;  3MPW A;  3N6L A;  1SC6 A;  3HD2 A;  3PY8 A;  2NLW A;  3ZTP A;  1WTF A;  3PJW A;  1U1P A;  3RZO K;  2QMX A;  2M8D B;  2AZ1 A;  5HSP A;  1Q8K A;  4ES1 A;  1Q79 A;  3H90 A;  1D8Y A;  4LF1 A;  3K8W A;  1U0H B;  3ICL A;  4R5P B;  2JC0 A;  4I6A A;  4DV7 F;  3N0V A;  3HHK A;  4ZPD A;  4DR5 J;  2V0N A;  2VG5 A;  2DB1 A;  3MWB A;  2M4M A;  3TVY A;  4X4S A;  3MM7 B;  3B78 A;  4Y2A A;  4ECQ A;  5I4M A;  2YXL A;  2WVE A;  3JSB A;  4J9Q A;  2ZD1 B;  1FRH A;  1IBA A;  5HBM B;  1RT1 B;  1M1K T;  1FRX A;  2VB6 A;  1AUD A;  1X8D A;  2R7Q A;  4GVL A;  3HOW K;  4QBU A;  3NGU A;  2VC1 A;  4YR0 A;  1EKS A;  3L7U A;  1VK3 A;  5I3U A;  3CDE A;  2F5G A;  1RI7 A;  3BRE A;  2XSJ B;  4DR4 F;  3PTW A;  3V4I A;  2J0S D;  2JA6 K;  4ELU A;  1NLK L;  2M3D A;  4HT7 A;  3DRX A;  2H51 B;  2M7S A;  1YRU A;  5CYM B;  1HNI A;  2JEI A;  3LP2 A;  1S1X B;  1I6H C;  1RAC B;  2WAQ D;  1U8W A;  4AD6 A;  3PV8 A;  2FJB B;  2ZFH A;  2R2R A;  2V8H A;  4WF9 Q;  2GCF A;  4F2R A;  1HA1 A;  2XHC A;  2MQQ A;  4DFM A;  3R9L A;  1HHT P;  5KT4 A;  2PA8 D;  2LXI A;  1YJW S;  2EKN A;  3I4N C;  3I6P A;  3BQ0 A;  2XB2 D;  2IM1 A;  4DOZ A;  1PIL A;  2LP4 A;  3KTQ A;  2FB0 A;  4KDD A;  1I3Q C;  3B4D A;  5L39 A;  4LRD A;  2YY3 A;  3FSY A;  5L1J A;  1T9U A;  1VS3 A;  1XNQ J;  4ZMM A;  2QYC A;  4J37 A;  3POT B;  5J2N A;  1EQR A;  1NU4 A;  4A8X A;  2QMW A;  2V2K A;  1IR1 A;  3H2V E;  1J2V A;  2XI2 A;  4KV8 A;  4Z37 A;  3J81 j;  4B3O A;  4DN9 A;  2HRT A;  3DYA B;  3BYP A;  3DLE B;  3ILI A;  2Q6B A;  1VQP S;  3HHL C;  5E41 A;  3CCR S;  3DGV A;  4UST A;  2DY9 A;  1PC5 A;  2Q3P A;  2IA6 A;  4LQ9 A;  2KXH A;  1WOR A;  3A12 A;  1EIY B;  2Y1R I;  3CF5 Q;  1FXD A;  1TTH B;  3GV5 B;  3V81 B;  4QIW L;  1X60 A;  1N6Q B;  3QBC A;  5EN1 A;  2X1A A;  1IKY A;  4AQY J;  1IBC B;  1RWM B;  1SCJ B;  1J5O B;  2R92 C;  3DHW C;  3G87 A;  5HJY A;  3DC2 A;  3PO3 C;  3KLG A;  1YNN A;  3W2V B;  4DS5 A;  3RTV A;  2GA7 A;  1RHJ B;  1WG1 A;  1HD0 A;  2V6T A;  1WTB A;  2DVI A;  1RYS A;  2UVW A;  3KMQ A;  1N0V C;  3KLF B;  4KMD A;  4J9L A;  2YWK A;  3TAR A;  4F26 A;  1WHY A;  2QLJ B;  4Q45 A;  3DRP A;  2YKA A;  3OVS A;  3AA9 A;  1CJV B;  4RW4 A;  4MIA A;  1VIX A;  2U2F A;  3UNY A;  5H1S V;  4RBU A;  4JI3 F;  1JLC B;  4DMZ A;  1WOS A;  3EGV A;  4NLU A;  2BW7 A;  5EGE A;  5HP1 A;  3FKI A;  1HI1 A;  3NNH A;  1QAJ A;  3R27 A;  2FGC A;  4OX9 F;  4YR2 A;  2HLT A;  2BV3 A;  1IM6 A;  5H9F J;  4C3K A;  8RUC A;  2FHO B;  1VBZ A;  2CPH A;  2XM3 A;  2F8M A;  1FJ7 A;  4WKR A;  3KK2 B;  3BO3 A;  3GTO A;  3BGL A;  2W9B B;  1CBK A;  4BXX K;  1YIJ S;  5GMK a;  4WWS A;  3W5Y A;  3D0G E;  2RDJ A;  3SDE A;  4M1X A;  4KC5 A;  5ETQ A;  4K4U A;  2LQJ A;  2R93 K;  1U1R A;  3QGI A;  4GZY A;  3ETM A;  3LUY A;  2LVW A;  4CT8 A;  4DHV A;  4DL0 C;  4C0B A;  4ICL B;  1SV5 B;  2OTJ S;  1OSC A;  4Q0B B;  1VLY A;  3DCA A;  5CZV A;  3RZD K;  1BDF A;  1HFE L;  3SFU A;  5C2C A;  5M3M K;  3MFI A;  1UA1 A;  3PKY A;  2RB7 A;  2CWK A;  3BH6 B;  3NEK A;  4DZD A;  2BMB A;  2E1R A;  3RJM B;  3FBB A;  3M9M B;  1MWY A;  1B0V A;  4OX8 A;  1AA1 B;  3RAM A;  1YK9 A;  5KFS A;  2VQE J;  3MMB A;  1WEX A;  3AD8 C;  2JA5 A;  1VQY A;  5HMX A;  2BJ3 A;  5D0R A;  1JQW A;  3AJD A;  1TWG C;  3M3Y K;  1XNR F;  2EI5 A;  2XZD B;  1E6V A;  2FPH X;  2KG1 A;  1LQ9 A;  3P5B P;  3RAX A;  3RR8 A;  4F2S A;  3FCV A;  5KTQ A;  5DZ7 A;  4EBD A;  5SUH A;  3GV8 B;  3IWN C;  2QSW A;  4JI8 J;  2Z2Y B;  2HQ3 A;  3NGT A;  3K7A C;  2VUM A;  4ZCK A;  3IBF B;  4WE1 A;  3KLE B;  3CO9 A;  2G1D A;  2FQQ B;  2WBM A;  1AZS A;  4ZCL A;  3HXM A;  5KFQ A;  2AZ3 A;  1OPZ A;  3JAM Y;  1IQZ A;  2DCL A;  4OI6 A;  3T1H J;  4CM0 A;  5DGA A;  2QA4 G;  1G6B A;  1NKE A;  2FJV A;  5DET A;  5ETL A;  4C4W A;  3BPD A;  1HI8 A;  4ZIW A;  1I6J A;  1RA6 A;  1RWO B;  3ITH A;  5IS2 A;  4N77 A;  2NQP A;  3CC4 S;  1Y3J A;  1T05 B;  2UUT A;  4DV3 J;  4G0W A;  3UN2 A;  1DTQ B;  1ZM9 A;  1N36 J;  3GTG A;  2C22 A;  3UD3 P;  2UZA A;  2E5L F;  4GKJ F;  3HHD A;  3ISN C;  3G8T A;  5FII A;  3M8P A;  4AND A;  4KMH A;  5DQG A;  3H5U A;  4F3M A;  3UI3 A;  4WFX A;  3PCO B;  4P6Q A;  3H0G C;  2LEB A;  1H2U X;  4NL5 A;  1PJ6 A;  2K7J A;  1RTZ A;  3HOZ K;  3DKD A;  5K20 B;  4KAR A;  2N7C A;  3CE8 A;  2ZH4 A;  4K59 A;  2YNG A;  4QWB A;  1XMO F;  2R7Z C;  3RRG A;  2IFX A;  1ARO P;  4E8U A;  2R7V A;  4LJZ A;  2QC3 A;  1UVM A;  1WI6 A;  2UXD J;  1OWX A;  3FRZ A;  3GTQ C;  2LYV A;  5D4N A;  3T01 A;  2BVZ A;  1SIW B;  1WAC A;  1RQ0 A;  2ZEJ A;  2XS5 A;  5A2Q U;  2RRA A;  6FD1 A;  3BSC A;  3WZ0 A;  3QPI A;  3M8S A;  2G2O A;  1ZYR A;  5CHP A;  1LOU A;  2GNK A;  1S7H A;  5CYJ A;  1UFL A;  4DU7 A;  2JA7 A;  4P2X A;  2I9S A;  3I5B A;  1QUP A;  2YU9 A;  3I32 A;  1KP6 A;  4DV6 F;  3ZZ0 A;  4A3F K;  2V8G A;  2I1R A;  2DNY A;  2FVP A;  4UTG A;  4F36 A;  5T7L B;  2ZZN A;  2HVZ A;  2DNH A;  3R7S B;  4PG5 A;  1EK8 A;  5GAE I;  3WIV A;  1ZM4 A;  2J9D E;  4GO7 X;  3VF0 B;  3QSI A;  3HVW A;  4CIO A;  4FPR A;  4B9S A;  2CZV C;  2ZUF A;  3PJX A;  3DLH A;  4BDP A;  3GTL C;  3KJN B;  1T95 A;  1VGX A;  3D0I E;  5KT6 A;  3W61 A;  1NEE A;  1WG5 A;  1RT5 B;  1NSP A;  5GAH I;  1LW0 A;  3F0N A;  1FFS B;  1XJW B;  1SH0 A;  4C3M A;  4BY1 C;  4QIW D;  1SFO K;  1C4C A;  4PUO A;  4K7Q A;  1QY7 A;  2GV1 A;  3V2U C;  1O26 A;  3QGH A;  4X62 J;  4KR0 B;  3BBC A;  2JLE A;  1HBU B;  3N6N A;  4OL8 A;  4C0H A;  5IOL A;  5IQQ A;  2AJ2 A;  3AJ1 A;  3IGN A;  4RBT A;  4EFA C;  1Q7Y T;  3JTN A;  3HT3 A;  1WEZ A;  1N5Y A;  4I4B A;  2YWF A;  2W2N P;  4JI6 J;  3G8Q A;  3TZX A;  4M95 A;  4OX9 J;  2C2R A;  3JSR A;  4AL5 A;  4PAA A;  3CC7 S;  1DCO A;  1RTH B;  2D9P A;  2AYM A;  3SQG B;  2KKH A;  3MMC A;  2A10 A;  2NZC A;  4I7F A;  3C6U B;  3W1Y C;  1WNE A;  2QRR A;  2DTJ A;  2VKZ G;  2ZJQ Q;  3HOU K;  1U4B A;  4U96 A;  1WWH A;  2DEJ A;  3TAM A;  3T1A A;  1QDU B;  3CJ4 A;  5EX3 A;  2BX6 A;  5M2U A;  3W3S A;  3QT7 A;  3VGU A;  2W7P A;  3K57 A;  3HMJ G;  2ILZ A;  5M2R A;  3RBZ A;  4MYU A;  4CLW A;  1DY3 A;  4IG0 B;  2QL7 B;  3N01 A;  2G0C A;  1NJI T;  5J1E B;  3JSM A;  4ILM A;  1BGX T;  1BY9 A;  1UWB B;  3W64 A;  1SQE A;  2FY1 A;  1Y5I B;  4OYI A;  1VQ9 S;  4M5I A;  3UFC X;  2G2Y A;  3FHZ A;  2JJ4 D;  1HNV A;  3EDR B;  4Q2M A;  4MMO A;  3EMT A;  3W5Z A;  1M0S A;  2GQQ A;  3IG1 B;  3W2W A;  2WSC C;  4C48 A;  4M5N A;  5LJ3 Y;  1IJF B;  1I6H K;  2GFF A;  3MM8 A;  1FKO B;  1MRO A;  1Y1V C;  5KFB A;  2R8I A;  4HI1 A;  3K5P A;  3HVR A;  2V67 A;  2IJN A;  2VG7 B;  3DXB A;  5KFT A;  2DNK A;  4JOU A;  3S15 C;  2JNJ A;  1HPZ A;  4PR6 A;  3J7Y I;  2APO A;  4FYX B;  5JVO A;  3GIK A;  2VU5 A;  5KT2 A;  3I4N K;  3LQV A;  1V3R A;  4KGZ B;  4CO4 A;  4NZ6 A;  3KG4 A;  3CJK B;  1FO1 A;  4NYZ A;  3R6L B;  4J7C A;  5EUH A;  5L38 A;  4J9V A;  1I3Q K;  5DLF A;  3D1O A;  2XCO A;  2FC9 A;  2C2Z B;  4OYX A;  4JI1 J;  4A3C C;  3BPS P;  1O27 A;  4GC6 A;  1O29 A;  2HZV A;  3B6B A;  3GYX B;  3VQS A;  3OR2 A;  5D78 A;  2EFP A;  4DPO A;  1JLB B;  2FQT A;  2RKI A;  3HO1 A;  2E5L J;  5LJ5 Y;  1TMM A;  4GKJ J;  2DNO A;  2KRB A;  4LF6 F;  2HSE B;  4JI2 F;  2IVF B;  2BKP A;  3GWC A;  2ADB A;  1MW7 A;  5B7W A;  2E2I A;  4B3M F;  1EET A;  3CCQ S;  3I55 S;  2ROG A;  4JYA F;  3M6U A;  4UOC A;  2GJI A;  1V5V A; 
#chains in the Genus database with same CATH homology
 1WOS A;  3AD9 C;  1PJ6 A;  3AD8 C;  1YX2 A;  2GAH C;  1VRQ C;  5L46 A;  1WSR A;  4PAA A;  3GEH A;  3GEE A;  3TTG A;  1XZP B;  1VLO A;  1XZP A;  1WOO A;  3TFJ A;  2GAG C;  3AD7 C;  1WSV A;  4P9S A;  3A8I A;  1WOR A;  1PJ7 A;  3TFH A;  1XZQ B;  3TFI A;  1XZQ A;  3GIR A;  1WOP A;  4PAB A;  3A8K A;  1X31 C;  3GEI A;  3A8J A;  1PJ5 A;  1V5V A;  3GSI A;  3ADA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...