2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
1X31C 4PABA 4P9SA 2GAGC 1PJ7A 3A8IA 3A8KA 1VLOA 3AD9C 1XZPB 1YX2A 1VRQC 1XZQA 3TFJA 3GSIA 1PJ5A 1WOSA 3GIRA 3TFHA 1XZPA 3TFIA 3A8JA 3AD7C 3GEEA 3GEIA 3AD8C 5L46A 4PAAA 1V5VA 1PJ6A 2GAHC 1WOOA 1WOPA 1WSVA 3ADAC 1WSRA 3GEHA 3TTGA 1WORA 1XZQB
chains in the Genus database with same CATH superfamily
2YQ0A 1SUQB 1X9WA 2DY9A 4HH1A 1NHVA 4OV6A 4PCQA 2EFPA 3W60A 2F8HA 2A6OA 3M8QB 2Y0BB 3GWCA 1LWFB 5LT5A 4B3RF 1O27A 2P5VA 1C1CA 1FESA 5M3MK 2W9AA 4C3IC 1V3ZA 3DI6B 3KMSA 3TFJA 3HDSA 2EFQA 4X6AK 2QYCA 1NK0A 1XMQJ 4OIOA 4MFBA 3FEZA 3H90A 3GV8B 2A2DA 2UP1A 4KFBB 1BQMA 4I68A 1OPIA 3OR1A 2RH3A 2DNMA 2EFNA 3NGRA 4ZHRA 1M1GA 4RUAA 1U49A 2YNIA 5AE1A 2BOPA 5D4NA 3KLEB 2ADCA 3CMAS 5E41A 1BGWA 2O01C 3CVKA 1UWBA 4FYWB 1I6HK 1NZ8A 5GAHU 1UFKA 2ZH4A 1VIXA 2C2ZB 2EFVA 3AB4B 3MMAB 1ZA2B 3F41A 3CJSA 4OI4A 4X64J 3BO3A 1NB7A 1S1VA 4JB8B 5LSLA 5C44K 2QLJB 2FGOA 2MHNA 1KN6A 2C2EA 2W2PP 1ZTWA 3FFIA 1YK9A 4C0BA 5KFXA 1HHSA 3AH5A 3DLGB 4LVNP 4M5GA 1HIYA 2KVQE 3BSCA 4ZVPB 4OHVA 1LK5A 1QSSA 3LP1A 4NLVA 1NHUA 1HWIA 3GTJA 3G82A 3OJSA 1SPBP 3D54A 1HQUA 1GT8A 2DISA 3P4UB 4OMFG 1SXLA 1RWUA 2DHSA 3DLLQ 2O5DA 3D1OA 2WAQL 5MAOA 1VQYA 3AXKA 3DOMA 1RHJB 3MTKA 5J2QB 1JLGB 4A93C 3KFWX 4QWDA 3MI7X 2K1RB 1N6QB 1X7VA 2NVTK 2GMJA 4ZOSA 1IL2A 1U1OA 3M7VA 2RS8A 4U7UK 2RNEA 1IBAA 2CRLA 4UT4A 1VH2A 4O0IA 5J2NB 3FRZA 2YPYA 1CJTA 2OPPA 4DPYA 4ZPBA 3M9OB 2W9CA 1LOUA 4ZCLA 3TVKA 3OD2A 3NWGA 2DR5A 3DOKA 1YRTA 5EWGA 1A9NB 1YJ9S 4LJZA 1Y10A 2XM3A 4FVCA 3UDLA 5THWA 4L74A 5FDLB 2W8LA 1YJWS 4B9NA 2FGCA 3JTOA 4JUZA 2FC9A 4B08A 2CW0A 5GVQA 3HT0A 2ZKUA 1NAQA 2MKJA 5GADU 3FKIK 2XY6A 2CQ3A 4JV5J 2YQ1A 3LUYA 4TN2A 4BBSK 3QWPA 3KNGA 3X1LB 3GTGK 1M5VC 3MF5A 1VQPS 4Y2CA 4ED6A 1JLBB 1EAYC 1CPZA 5KFLA 1JJ2R 4MKBA 4DR7F 4PQUA 2B51A 4FXDA 1NH7A 4DL4A 2IDLA 2J0WA 2W1BA 4LQ9A 4B9SA 4N7TA 1KLNA 1C1BA 1U7LA 4RLEA 4Q5VA 4DUYF 2DRAA 4UTGA 2H48B 3S1QK 3QATA 1U0SA 2DCLA 2R7XA 3HHEA 4DV6J 2FY1A 4DL0C 2CZ9A 2WOMB 5AXNA 3VAMA 1WSVA 2B8QA 1NM2A 5CD4A 4X62J 4J9QA 2OFGX 4FNHA 1TL7A 3RZOC 1NNDA 4ENOA 3GTOA 2Z2YB 5C2GA 3P5BP 3EWGA 1Y7PA 3THPA 3NS6A 2HIYA 2MJUA 1BQNA 5C42B 3BGRA 3HD1A 5BYRA 3PIPQ 4H4MB 4M94A 4AD6A 2AU0A 3CMES 4C8KA 5IM0B 1LWEA 1FXRA 4WCEQ 1U4BA 4M5HA 3H40A 2R92K 1Y00A 1VISA 1TK5A 1TTHB 3PXGa 2DO4A 1KC8T 3IAM9 1UZDA 2JWNA 5CCLA 4FPIA 3CDAA 4Y0FA 5HLFB 3L4BC 3MM8B 4CM0A 2JC0A 2LA6A 3PG9A 2NQPA 5D0EA 3RAQA 2YWEA 2ZBQA 2DGTA 1IXKA 4DF4A 1C0TA 1MMLA 4LQ3A 3AT1B 2QC3A 4C4WA 1WCMK 3HVRA 3I4NK 4HR2A 4KMUA 3M30B 2BE2A 1IM6A 2EG2A 1K1SA 2HIQA 2UXDJ 3C16A 3R7BB 2JA6A 5ETKA 3BBFA 3DLKA 3MD1A 3PR4A 1PC4A 2EBBA 3G8TA 3LP0A 4AYBD 4HACB 2N82B 1U6BA 5IC6B 2WVBA 2C2NA 4C7QA 1NK6A 4ES2A 4QIFA 1HW9A 3GE9A 4M5JA 4EBCA 3OTOJ 1XNQF 3BYRA 2DJWA 3Q83A 1TQLA 2XG8A 4OIPA 2KJWA 1LW0A 3CWJA 5F3ZA 2E7XA 1Y1VA 3DLBA 1RCOB 5C3EK 4F0MA 2Y1IA 3U1NA 4LR2A 1N5YB 3IBFB 2KZZA 1A0OB 4QPXA 1RAJA 3GTKC 3EGNA 2EKYA 1IKXB 5D3GB 2PA3A 1XK8A 4NLYA 3NLCA 3CJ4A 3IG1A 1F5CA 4LLGA 2CPFA 4WFXA 1RBLA 1UWAA 5IP9C 1HQ2A 2E44A 1IVZA 5KFCA 1X0PA 3CE8A 5A8RB 1SKWA 1FHTA 4DZ6A 2JA5A 4C8MA 2M52A 5L1IA 2ZJQQ 2DPJA 2HHPA 2W2NP 2AX1A 3CCJS 1DY3A 1Y5NB 1RAGB 3P6YC 4OV1A 3KLGB 3A8EA 1T11A 2FHMA 3SYZA 3ZTQA 2YX1A 1RHMB 1WDTA 1RTIB 3BSAA 3M9NB 2LQJA 2LQBA 2HVDA 4J9KA 4KM8A 5ETLA 4PRFA 1N33J 4IRKA 4USTA 3PZPA 2YX7A 1ZA1B 1TU0B 1O26A 4KH0B 4H4OA 4XPEA 4LF9J 1IKYB 3G8SA 3S1RC 1TFWA 4ZVSB 5D4LA 2FPHX 4A48A 1U6FA 2GSOA 3MAHA 1SC3B 4NLPA 2IM1A 3GTJK 1RT7A 3M2UA 5B7WA 1AZSB 5HMWA 3BGOP 3GJTB 2WRMA 1LV5A 2H1YA 5HMZA 3LO3A 2MQLA 2R7OA 4PAAA 4M5LA 4DS4A 1WSRA 4ED3A 2V50A 4FNIA 1IS1A 4OI2A 3US5A 2DHAA 2A0FB 1Q5VA 1APSA 1P9YA 1J5OA 4NA3A 4KN4A 1LWCB 3JSMB 3ICLA 3CDBA 3RRKA 1DCHA 1KQ4A 1R7IA 4FF2A 4DQSA 4XSZA 2D3UA 3UI3A 1URRA 2DNNA 5KFDA 1M5OC 1T3OA 4YMEA 2IHR1 2IA0A 1FWPA 4F0HA 1I51B 1YLXA 4RR5A 2DKOB 4PYDA 3T1YF 4N77A 2YU9C 1DAXA 2O5JA 3HCXA 1VQ9S 4MEYA 4MH8A 2PT0A 3GTQA 4L3NA 2ALYB 4KGMA 5H1SV 4PUOB 1GEHA 4XPCA 5K14A 3CCWA 3G6XA 2HRYA 2DHGA 4O3QA 3E01B 3HVAA 1I1GA 1PCAA 1ZM3A 4U95A 4O2DA 4G3IA 1DBDA 2W01A 3B4DA 2HFOA 3ZXWA 2BR0A 3I0RA 1VQOS 1W2IA 3LF0A 2IRUA 3AJ2A 2EKNA 2MKSA 1HBNA 2B5JA 4G7HA 1P1TA 2H51B 2JVRA 4Y2AA 3HJVA 2FY8A 3MUMP 5JVGQ 4GFQA 2ZZNA 4K4TA 2RUSA 4G0VA 1HR0J 4WFYA 3MAAA 1WJ9A 2XO7A 2OIHA 4B3OB 3BM7A 4MIAA 5K9FA 3PX6A 3GTOK 3HMJG 3BBBA 5IQ6A 1WEXA 2UZAA 1S77D 3I31A 3MM5A 3F73A 3GV7B 1OYEA 4E8UA 2YKNA 2P9EA 3NGDA 4E98A 1NDLA 2JJ4D 1U1KA 2RKIA 3HZEA 3RBXA 3N4WA 2Q43A 1VHFA 2RQMA 5M2PA 3FRYA 1O8BA 3DXSX 2HZAA 2XYHB 4DR4J 4Q4ZA 2BJ8A 1SV5A 3ITHB 4M5KA 4ZPTR 1L3KA 3AJ1A 4F4XA 1RZMA 3ZTPA 2XS2A 4ANEA 1RABB 5IYCK 2EI5A 4PQAA 3CUNA 3CXCR 2K7KA 4FF4A 2AYMA 1XMQF 4F4ZA 2DVIA 2GQCA 4ETZA 1FRKA 4H54A 2OPSB 1BHNA 1TELA 1T03A 1YKWA 1NH8A 2I6WA 2VODA 3IC1A 3EE3A 4ZH4A 2QL9B 3AJDA 2RB7A 1ZZNA 2LEPA 2KJVA 3CC7S 2XO6A 5DM7Q 2OMLA 1VYAA 3MURP 2ILYA 3BB5A 4MYTA 3MM9B 4IOBA 4WJBA 1SKSA 2XMMA 1WOSA 4X64F 4FP9A 4PWWA 2I8EA 2JA6K 2I9SA 2A6EA 3MUTP 2CFAA 3D6MB 7AT1B 1JXLA 1HPZA 4PWDB 4RUBA 2E66A 2MQNA 4W92B 4ECWA 4EK2A 1S57A 1CJUB 2UXBJ 3AD9C 4G65A 2Q66A 1IQTA 5KFTA 2OUGA 4EBEA 3T5KA 1N52B 4MK9A 5TMCA 2HQIA 3P49B 3TAMB 1WEYA 4LFCJ 5LMUJ 1V5VA 4C0OC 4X4SA 1L0WA 3HOUC 2VU5A 5HVFA 1Y1VK 2E2HA 5IWAJ 3R3TA 3SDEB 2ZFZA 1FNMA 1V6HA 4CLTA 3PJ9A 5IXUA 2V8VA 1FERA 5KFFA 3GFHA 3GTPA 5IT9U 3DGPA 4DEZA 4Q2MA 1VQLS 3RRHA 2HS0A 2ZUEA 3DYAB 4OZLA 2AKWB 2FVQA 1JLAB 4A3BC 2DPIA 2J0SD 1CSJA 3MMLB 4FS2A 1ZZFA 3GIMA 2BYCA 4F8RA 3FBEA 1FF2A 4X4TA 4U8VA 2JA5K 5FD1A 2GIQA 1M5HA 1TVRB 3C6TA 4GTFA 1RHUB 2A18A 3JSTA 2O5IA 1XPPA 1YJUA 3M8PB 4MKYA 3HSZA 3RW7A 1ZBSA 1BY9A 1WI6A 4FF3A 3HHLB 3GIIA 1TKZA 3AD8C 4XDDA 3HXMA 1T02A 3CJRA 1FWLA 3JSRA 4JV5F 1I3OB 1N34J 1QAXA 5A6WA 4TYAA 4MJKA 4DUZJ 4C0HA 2ZITA 3C15B 2OO4A 3QWUA 1N5QA 2MPUA 3J81j 3R2DJ 1A7GE 1RWPB 2CUYA 1CEZA 2V68A 3SSSA 3S14K 4GTCA 4LSNB 3EX7B 4FBUA 2FTRA 1JLCA 4WZQA 3HVTB 5KFKA 1S48A 2B7BB 2XNRA 1X4AA 3CGIA 2XYGB 3R9LA 4B9UA 2OH2A 2DD8S 5F9LA 2ZDPA 1UL3A 4RW4A 2E1RA 1D8ZA 1F93A 5AT1B 4ZA1A 4RL1A 4OHZA 4X62F 2MY7A 2E5JA 3DNCA 1RBOB 2C2RA 5KFPA 3J80Y 3HXAA 2AGPA 2JLEA 2DB1A 4EZ9A 6FD1A 4DDQA 5BR8J 3NGTA 4A3LC 4IDKB 2VBXA 2OTJS 3VGVA 2RILA 2CQ0A 4J9PA 1PJ7A 2CQCA 2NVYC 2AZ3A 4KHMA 2SXLA 5T7LA 1B0PA 4WFNQ 3JQKA 4LT6A 3GYNA 4RUCA 2W24A 3ZNJ1 3GTMA 2HMIA 3PDNA 1MWZA 2C2DA 3MWBA 2HG4A 4TU8A 3GTQK 4LK0A 2DNPA 3MFHA 1GFWB 3WIUA 2P6TA 4FS1A 1NSKL 4YUDA 1NZAA 1VI7A 2RRBA 5ETVA 3AFGA 3AOAA 2LXIA 3M3YK 3TX8A 3RJMB 1DFDA 5U47A 4MEXA 2ZH7A 3KUHA 2FQOA 2CZ4A 1RCXB 1NPRA 5GAEU 1B7YB 4ALZA 3RZDC 1RTHA 4X4QA 3VCDA 4DU8A 5KFJA 2E5IA 4MK7A 3RB6A 2Q6CA 2UXDF 2FHJA 3TEGA 2ZH8A 3M8WA 4OJ1A 2QE5A 3F56A 5AXMA 1WC0A 2E5LJ 2HHXA 3JTNA 1B70B 4MYUA 3J7YU 1ITPA 1M1HA 4YB1P 5CCMA 1WEZA 2CVEA 2R2TA 2DR9A 1A6LA 1HI0P 4CNZA 3V6DA 2ASYA 4DSJA 2QL5B 3OTOF 1QE1A 4B3MJ 1NBEB 4AXIA 2R7ZA 1QAIA 3LA0A 4I64A 2LFVA 4QYRA 4KH1B 3GTLC 1TUGB 3TVZA 2YWKA 2KI2A 1FX4A 4A3JK 1RTDB 3HHLC 2Q1LA 2ZZTA 3O1LA 2J0XA 1E6YB 3KK1A 5GMDA 4R0EA 4LF5J 5DZ7A 4A3CK 2KFYA 3EGVA 1YRUA 1L3VA 1JQWA 1JVIA 2H5JB 3ADAC 4RW9A 2VC1A 4GKKJ 4MQ9A 5G4DA 1WHVA 2GQQA 3SFUA 2MY8A 3S15K 1FRMA 1VJQA 2GNKA 1Q82T 2GX8A 3J7Z5 3W2VA 2B7CB 3S6EA 2CQDA 2BVZA 2AHOB 1KVKA 3QJJA 4WYLA 4O4GA 1XR7A 3GV5B 2GGPA 1U1NA 3UD3P 2YNHB 4B3TJ 5TJ3A 4R5PB 1JKHA 4GTDA 3G8QA 3C6UB 1N33F 4OYZA 3KHLA 1RAFB 1YTYA 3W3SA 3GTYX 1JWWA 1RWNB 4C3HK 4LF9F 3DMJA 2YKPA 4KC6A 4NZ7A 4DV4F 2A1BA 4NLRA 3NKYA 4OIXA 1NDCA 1OSCA 3QFWA 4RNMA 4UQGA 2Z56B 3BV8A 3KHRA 5HMYA 4OJHA 4DR6F 4C6AA 1O0PA 3D0GE 3GTPK 4DV2J 3R5JB 3J81Y 2FVPA 1TL1A 3NCQA 4BLAA 3BPSP 1T94A 4WKYA 5IYDC 3BQ1A 3KHHA 3UDCA 5HQMA 3WX8A 3HJFA 1WOPA 4ZP6A 3OTEA 1WC4A 1IWAA 1YX2A 1U1MA 1H6KX 1RWKB 4ES3A 3OHBA 3FSXA 1X4CA 2RQCA 4KTQA 1PG5B 1HNZJ 3W62A 4GZYA 3SQGA 2WB4A 2LECA 2VUMC 4UOCA 1F1BB 4CRJA 2DNYA 1IQ0A 1XIQA 4LVOP 4NLTA 2PDAA 2CJYB 3RB0A 1UV7A 3G6YA 2C3MA 2MGZA 3I9V9 2YNFA 4DSEA 3LALA 2GVZA 3N6MA 1S9GA 2YKMB 3V4MA 2RDIA 4NYPA 3P96A 5J2MA 1AB8A 1NJXA 3PIOQ 3RAMA 4A8YA 2IDEA 5IOQA 3EVOA 4G1PA 1IBCB 3BP8C 1NMEB 2OMOA 2KHCA 2JVOA 4BDPA 3K5NA 1LQ9A 5CHCB 4DG1B 3RBZA 2VUGA 2E1CA 3T00A 2OPRB 2LXUA 3V81B 1RKIA 4Q0BA 1IW7A 2VFRA 1RA7A 3I82A 1Y1WC 5KG6A 1HR0F 3MR2A 4YFKA 5L9NA 3PACA 3LQVA 4Q2LA 4OI3A 2DGOA 3FQLA 4WF9Q 4NXNJ 5KFOA 4DSIA 2JDJA 2LQ5A 1JJCB 2HNZA 2XHCA 5B0BA 3V2UC 2QLBB 2VOOA 2ZJRQ 3IFEA 2GCFA 2IM0A 2AJ4A 2EFGA 5BYSA 2P8TA 2J8SA 3D6HB 1H98A 3HOWC 4I2PB 4CLZA 1FI4A 3KJNB 5B0FA 5EWEA 3AQPA 2WK4A 1S1TB 1Q86T 2MZQA 4DR4F 3EGWB 2XMJA 1BMQB 3GTMK 5KG5A 3M2RA 2J6SA 3VZHA 1QSYA 4WWSA 3TA1A 4GO5X 2F5GA 2CYYA 2DGUA 2QG9B 1NPPA 3MECB 3VVTA 2MKCA 4KO0B 2RJZA 4U67Q 1YHQS 1AYEA 2GW8A 2AJ0A 1MWYA 2CXEA 4EU0A 2WVFA 2NXJA 2VJVA 2HZCA 3N01A 4W98A 3ET6A 2VA2A 3OL7A 2FHOB 1X4GA 1XJWB 2ACMA 2BKPA 2HNYA 3DHXA 3MEEB 3H42A 2MMYA 2HK3A 5J1EB 3EVMA 3KLFA 2BA9A 4P2FA 1U2CA 3UR0A 4NLXA 1FKPA 4EO6A 2UVVA 1RT4A 4NMLA 2LYVA 4GRSA 1DQ9A 2RH6A 3DLEA 2HFUA 3CPWR 3DDNA 2AWZA 2JA7A 2OELA 2UXBF 1B4SA 2R8IA 3EXYA 3CCLS 4QJVA 2J8AA 3VVUA 4X6AC 4LFCF 1VQ4S 3CQZC 3M05A 4Y00A 1Y5IB 1K83A 2R93A 2YPZA 3UWTA 5IWAF 5CH7B 4CO1A 4L76A 3QMQA 2DNHA 1UA0A 1TWFC 2NZCA 4PR6A 2D3O1 3AH6A 2FVRA 5E3CA 4QWBA 1CBKA 1HYSA 4I4BA 1TWGC 5EX0A 1I6HC 1VLOA 3IS9B 1D3WA 4K4YA 1SFOA 4KRWA 2UUTA 1WUUA 3KJVA 4ICLB 4TVAB 4RWWA 4ZMMA 4XK8C 5I3UA 1PSDA 3MCMA 1XNRJ 2Z2ZA 3HKWA 3EGZA 1FD2A 4X4PA 3MEGB 1DHMA 3K7RA 3TRGA 3J80U 1HBMA 1GE9A 3VAGA 2IMWP 1GMWD 1KHVA 4B02A 2GIFA 2OEJA 3B8HA 1FTRA 4KB2A 2GHPA 1T9UA 3SQOP 2E29A 1DQAA 3D2WA 2JEJA 3MMCB 4G7OA 2PI5A 4TY8A 1TWHK 4IFVB 2VL1A 4A3KK 1CJVB 1N34F 1RT1A 2HWTA 2IFXA 4HDGA 4DUZF 2OJ3A 2R2SA 3PRVA 1F7VA 4ECSA 4J9RA 3S0XA 1Q8BA 4GKJF 4DR5J 5B09A 4ZP9A 5KG0A 2VFVA 2B63K 2ZM6J 3OTDA 4I56A 2GV1A 1R0AA 2E2JK 4ZS6A 1H73A 3CD0A 1PYOB 4PXCA 4L75A 4XLNA 3VGSA 2Z58B 2W4CA 3MR7A 3ZTSA 5DDOC 3RB3A 1I3QA 1S6QB 4ECQA 2W4PA 4GT9A 1QVFR 3POTA 2UUAJ 3M6WA 2QA2A 3MOJB 4CZCA 4Y52C 1HMVA 1KLMA 1HNVA 2HBRB 4RW8A 2GHVC 1TWCC 5KAKA 3BN7A 2P9CA 1HD0A 4JI6J 4M8LA 3SCJE 2BJ7A 4NLOA 4BBSC 1WG5A 4PWUA 2JZ5A 3M6XA 1QM9A 4DXLA 1DCPA 3HSJA 2LMIA 1BQMB 1HWKA 1RAHB 2AX0A 3Q8SB 3KG4A 3CC4S 1ELOA 3QLHB 4WFAQ 4ZHRB 5EDWA 3RBDA 5G0RB 2V67A 5J1PA 3DLJA 2JFKA 2XMUA 4QWCA 1S1UA 4OHXA 3NBPA 2PGCA 2PMWA 3A3NB 3S1QC 4N8OA 1RKJA 2HVZA 4NI2A 3O2IA 1KVIA 3HOYK 3CCQS 1F9HA 3V6HA 2YNGA 3TANA 1AT1B 3RZAA 3UN3A 4K4VA 4IH6A 1PKUA 4FKYA 5DJBA 2W7PA 5F9NA 2ZE2A 1UJ6A 2DH8A 3NGUA 4H4KA 4KSEB 3Q22A 3KYLA 4J3NA 4DQQA 3MEDB 2VJUA 2E5LF 3QJLA 2VG5A 3G82B 5M2UA 2R92C 3OPKA 2L3MA 3W2WA 5KFUA 3UNGC 4Q8EA 3K7AC 2CDRB 1HBOB 1XZPA 1S1WA 1UFLA 1TWAA 1HNIB 4DV7J 1RTJA 2PFFB 1BUXA 3ETOA 2R2RA 4B3MF 5C25B 4A8OA 4ZVRB 4O23A 1S4FA 2XC9A 2OKQA 5H9EJ 4F7VA 4EI2A 5A76A 5D8HB 3SEOA 2O1PA 4N5SA 4X2BA 9ATCB 4CM2A 3S17C 3SZYA 3I4NC 4M1KA 5FLMC 5A8KB 3ZC4A 4F36A 3DGVA 3I4PA 4J9UE 4LF5F 2AF6A 1F9NA 3PM9A 2OSQA 1UCNA 3PO2K 4TNOA 2V6SA 3KLIA 5JFEA 4GKKF 1YITS 3NAHA 3EQLA 2D3ZA 4AL7A 4ZJOA 1IJEB 3WIVA 4I7FA 5KOXA 4EWTA 4TU9A 3PEHA 4A8KA 2LDIA 3G9CA 3J81U 3EDQB 1NUEA 1YQHA 3FEXB 2V8GA 4YFUA 1OYDA 3KK2A 1F0XA 2W9BB 1SQEA 4BCAA 2VONA 4WBFA 3UVJA 5C3EC 2BQRA 3DLHA 2XWYA 4B3TF 4F4AA 2A6MA 1B4AA 1NKBA 1M90T 2V4JA 2IC3A 1PILA 2M4MA 2NVXA 4BY7K 2HKEA 3L7UA 2Y1RI 2V4RA 1H7WA 3IGNA 2BANB 1IQZA 2C2OB 1KQKA 4V19J 1SJFA 2BJDA 1K83K 2R93K 1SUQA 1H72C 1G7CB 1S59A 4C11A 4A3MK 2Q79A 4P71A 5KT3A 1U1RA 3M8QA 1N0VC 1DTTB 1VRUB 3BGRB 1FO1A 4ANCA 4I1TA 5HATA 4WZMA 1LWEB 4P74A 1SFOK 2B6AB 2MEWA 3PKYA 3S2HC 1X5TA 1S9FA 3M2VB 2V2ZA 5A8WA 3AOCA 3TJAA 4ZIWA 1S0MA 2HHQA 1WORA 4CO0A 1ZXOA 1WC6A 4KFBA 4NYOA 4C3JK 2J7WA 1UEVA 2N4DA 4FF1A 4UOGA 5DO2A 1HNZF 4KDDA 4ATNA 1G1XA 5E3PA 3KLEA 2JC1A 3BQ0A 2VG7A 4K59A 5F8IA 3HOXC 3TYTA 3R6GB 3F44A 1BJTA 2KM8B 3W61A 5K20B 2PI4A 2FLOA 3GTJC 2RF2B 2RU9A 4MTPA 4RNFA 1MU2B 4N56A 1MWQA 3MMAA 3DM2A 4P5AA 1AROP 2ZVSA 3I55S 3KDOA 2B43A 4CO2A 2MLZA 5M5WK 2F65A 3C16B 2V2VA 3S01A 3PVXA 3JTPA 4KATA 3DLKB 3GIRA 3H20A 4GVLA 1S97A 4QPTA 2CQBA 2BW7A 2JX2A 4LFAJ 1DZ5A 5F8JA 4F25A 5DZ6A 1VQ6S 3PFOA 2KRBA 3ENAA 1LW2A 4O3RA 1PC5A 2AYGA 1YZ6A 1BXNA 3RBEA 1RXOB 4LR8A 3I4MK 2DEJA 1HI9A 2NXEA 1FFWB 2F3JA 1LW0B 3BQ2A 1SVDA 2XNQA 1I3QK 2M7SA 2D9OA 2CZVC 4ZLNA 3C14A 5J2QA 1JLFB 1JLGA 1OQ6A 4NXNF 2K1RA 1N6QA 4ZJQA 4QIWL 2E7WA 3B82A 3NXZA 1QD1A 3QT5A 2OLWA 2HWHA 3IG1B 3ENQA 3BSOA 2XB2D 1S12A 2GMHA 5J2NA 4DJBA 2BJ3A 3ZZUA 2EPIA 5IYBC 4DR7J 2ZOGA 3H8YA 3JB9k 4URQU 1HNWJ 2LA4A 2ZNZA 2ZH5A 2H9ZA 4P9SA 3MDFA 1FNOA 1WQGA 1KQFB 5FDLA 4M5NA 3R5DA 3CF5Q 2FHKA 2C3UA 4EBDA 3HI9A 3M6UA 3SMZA 4F50A 4QYZJ 4LBHA 4C3IK 4Q45A 1JXEA 2HQCA 4F67A 5IT4A 4CO5A 3KK3A 3NNCA 1JLBA 4J9MA 2EW9A 1ZVUA 5CA5A 2XULA 4KHPJ 1SH0A 2DY1A 4LF8J 1K47A 3I32A 1QTMA 4OI1A 5ETSA 4H4OB 4ZIVA 2OEMA 2VBWA 2JSXA 1BD6A 3IN5A 4RNNA 2DIUA 3NUHA 4CT8A 3F0NA 4NX9A 4WXWA 1FD8A 3M2UB 4ECTA 3HULA 1VRQC 3R7NB 1AFIA 4QR2A 2WVEA 1JB0C 4P7TA 3OL9A 3L3CA 3GEEA 4NOIA 5IYCC 4X65F 2HFSA 3MR6A 1TR0A 1O2AA 1VQSA 3PYEA 4OYOA 1YJ7A 2ZUGA 3OT9A 4QIGA 5F8NA 5CZXA 1VOMA 2F9JA 3EMTA 4RO0A 1QTNB 2J9DE 1FA0A 4H4MA 2KM8C 2MXYA 3BSNA 1KQSR 3MOZA 4XIUA 3K5OA 3N5BA 3ENWA 5GAHI 1DLOA 3MCSA 2KB2A 2JA6C 4LQYA 5HLFA 5C4JK 4TU7A 1XNRF 1YJNS 3HF5A 1F9EB 1OWXA 3N9UC 4ZN1A 5KFYA 3H4DA 1GXLA 2D3OR 1UTAA 2LEBA 1CS4A 2KO1A 4K4UA 3NNAA 2MQPA 2N7CA 4KB4A 4HH0A 4UOFA 3M30A 4KASA 2BZ2A 5CHPA 2DO0A 2YU9A 5JJBA 2XS7A 1Y1VC 4K2XA 1Q8LA 4PG8A 2AYEA 3HM9A 2MQ8A 2XMKA 1IM4A 2X1FA 1WC5A 1HBNB 1OPZA 2XY7A 3WQPA 2J5AA 2RT3A 2R7SA 1RAAB 2C3PA 1BWVA 1X31C 4L3KA 4LIWA 1VQKS 3KLHB 2BRLA 2JL9A 2UU9J 4DR5F 1LXJA 2X1AA 1HQMA 2ZM6F 2X3DA 6FDRA 3TO8A 3MAAB 3T19A 1KTVA 2IRYA 2W8KA 2ZDOA 4NLGA 1MROA 3SSQA 2ZOMA 3L4KA 1N5YA 3CCMS 4Y7NC 5B0CA 3MM5B 1TK0A 3OJUA 2AMCB 4X4NA 2RKIB 1IKXA 2AEJA 2L9NA 5D3GA 2VFUA 4AFFA 3FKIA 5HBMB 3VHQA 1FJEB 4ID5B 4DWIA 1HD1A 4ZJLA 4ZVTB 2Y1JA 5FJ4A 3BYPA 5ETPA 4JI6F 1AB4A 1XZQB 5L9XA 5GADI 4LJMA 1AA1B 2IM2A 4OX9F 4CP5A 5KFBA 3EDRB 1U47A 5E33A 3GJQB 4OI6A 2HYIB 2F4VJ 4QZVB 1ZAWA 3JAMU 3MCNA 4QWAA 1R31A 2QT7A 4DR1J 3DRXA 1XBWA 5HSPA 4Y2IA 3KLGA 4N8NA 2EC2A 3ZZPA 4UY8T 1FXDA 3HHLD 1KOOA 1ZM2A 4ZKAA 4G7ZA 2QZ8A 3ZZ0A 3UCZP 3PW4A 3D66A 4FKXA 5DDRC 4EUVA 3QGPA 2RHQB 1RGVA 1LK7A 1VBKA 4Q5SA 2GJFA 4DPTA 1L3UA 1ZPVA 2F8MA 2V9WA 4NCBA 1VJWA 3CW2C 5IS2A 4HKQA 1JK9B 1IKYA 3AA8A 2HWIA 1SB6A 4Y2KA 5FLXU 4NLSA 2XMVA 1RAOA 3RW6A 4KGXB 1AZSA 5KTQA 1W2BR 2UUBF 2NPFA 3VV2B 3PV8A 4ZPCA 1SH2A 3CJKA 2W25A 4HI2A 4ZITA 3BDEA 5M5YK 4QQBA 1LXNA 3R5AA 1MMDA 5IFMA 4F4WA 2DIVA 2YQ3A 3CB4A 3GTQC 2MKIA 3NOGA 3BH6B 4RNOA 3FEYB 4HL9A 4R0JA 2QJ3A 3DGPB 4DV7F 1HQEB 3W9IA 3JSMA 4K7QA 4WPAA 3C2PA 2HAFA 1S5ZA 5AE3A 2IY5B 1UAWA 4FBTA 1S6PA 3QBCA 3CTRA 1MG7A 3N28A 4DCPB 2HQFA 4D3HA 1EQ0A 2KG1A 4K2JA 3PRBA 2DGXA 2JEFA 3BZQA 1KR4A 1S76D 2HAIA 2ZWPA 4RX6A 2AGOA 4IO1A 2V34A 3T9NA 5LXYA 3GTKK 4UZBA 2B8PA 4RW6B 4I0WA 2KFZA 2UUWA 2CVIA 4O3PA 3V6KA 1JNRB 5F8GA 1T9WA 2G2OA 2Y8WA 1BS2A 2ILZA 2FJVA 4L6V3 3D3CJ 3QGIA 4ECVA 4WU3A 4ZCMA 4OIRA 1RE1B 2GA7A 4OHWA 1OY8A 2AJ2A 1UJ4A 2L08A 5CXTA 1HWLA 4USUA 4KIAA 1FJGJ 2LQ9A 1SJ1A 3R2CJ 2MZTA 3K8VA 3OXFA 2V6AA 4A3FK 1R0CB 1T9YA 3D67A 3UCGA 4B3OA 3T1HJ 4NL5A 1YBAA 4RW4B 4A3CC 3N6LA 3FCHA 1R89A 1VQNS 1X4EA 4DSFA 8RUCA 2CNOB 2HBQB 4PPDA 1H38A 1HFEL 4ED1A 1M0SA 4LRBA 1NSPA 1S72S 2CQ2A 4OZJA 4WFBQ 4JP8A 1EIYB 2B0GA 2ACYA 3S15C 2RE1A 4DL3A 1ZQ1C 3M9MB 3S1RK 2W7OA 5SZTA 2CADA 3A1YG 2J9DA 3DDKA 2JEGA 4IO9Q 3ITHA 1EJ7L 3BUEA 5T7LB 1U02A 2VC0A 4PZVA 1SC4B 1F2GA 2MKYA 2VPXB 3VAHA 4F3OA 3BGUA 4IKAA 2YXLA 5I42B 4DR3J 4LIRA 2YWGA 3FCWA 4UF4A 4UOHA 4J9LA 1USMA 4WK3A 3ZZZA 1T7PA 2XHWA 1BLUA 1YCLA 2WSFC 1FDBA 1N0UA 4C3HC 3VTIA 2FJAB 4ERDA 3DXJA 3FOFA 2NVYA 3NGKA 4B3SJ 2PIIA 4KJIA 2YU9K 1ZH5A 3H2LA 2FDNA 2E2HC 2XTJP 3W5XA 3FDSA 3TI0A 3LPYA 1C4CA 4UW2A 2ASJA 2MYFA 2RHSB 4PWDA 1VK8A 3GTPC 4IOAQ 4HTIA 4XCHA 2HVEA 1CJUA 2KXHA 3BJYA 2XSFA 5LL6d 1OIAA 1U6ZA 4LFAF 3VR1A 2ZH9A 3TAMA 3H2VE 3BPDA 5AJ3J 3V6DB 4JI7J 2DNGA 2RMLA 1LFPA 3DRRB 5KT7A 3I4HX 1FE4A 4EGLA 4KKOA 4M5DB 1UEKA 1QE1B 2AEMA 4BBRK 2V69A 3SDEA 1NKCA 4CDIA 3IM8A 2CQPA 4LBIA 4ECZA 2KT5A 1ZM9A 3KKFA 3DFEA 2YWFA 3SXLA 1TKXB 1NSQA 2FZGB 2Q6BA 1DD5A 4Q43A 3DYAA 4USHA 2D41A 5F0WA 1XMOJ 1TFYA 3ILOA 4F0KA 1JLAA 4C45A 4LREA 3TW0A 3KK1B 5CABA 4I69A 2H4YB 2POKA 2HHTA 2DNQA 3M8SA 2WB1D 4MT1A 1WI8A 5IT9Y 3O8WA 2ROEA 1JJHA 2ALZA 2XGPA 4RW9B 3VGUA 5DGAA 1PYSB 1TVRA 1HNWF 2QMWA 2XCRB 4C2MC 3TEHB 4DL2A 3TR5A 1B64A 1Q0NA 3I0SB 3M8PA 3OTBA 2CQGA 2F7VA 3GIJA 4C8ZA 1CULA 4ID8A 4MKAA 2F4FA 1YJTA 5E3RA 4O4GB 1N8RT 5B0DA 5E3QA 1Z2LA 5L1JA 3I5AA 4F3MA 4HEA9 3C15A 1D8YA 3KG0A 1RWXB 4G6VB 3KLVA 4KHPF 3HFZB 1K44A 1I6JA 4LF8F 4FDFA 1VC0A 2DGWA 3EZOA 4LSNA 4FM9A 2MHEA 3HVTA 3P8BB 4RWXA 3THVA 4C8OA 1RUSA 1I94J 4ZPVR 4KGZB 2Z8QA 2BW2A 2FJXA 3GTMC 4PG7A 1FJCA 2PSZA 3S16C 4O3NA 2GO9A 3GR0A 4YFXA 5H9FK 3LAMA 5D4PA 5AE2A 1T0TV 4BY1K 4BS2A 1VRTA 3HD2A 1FK9B 1TL1B 3QSYB 4IDKA 4IG0B 4C3KA 3MHYA 3SZ2A 1WWHA 3L09A 1VBXA 3QQCD 2HVIA 3W5YA 1GAOA 5D4DA 2R8HA 4TY9A 4A3DK 3HOVK 1SQGA 4Y65A 3CCSS 2M9KA 1G51A 3A3OB 4C9DA 2I5JA 3HOZK 4JI8F 4Z7CA 2E1PA 4C3LA 4NE9C 1YNJA 1IWGA 1LFWA 2HFVA 3NOCA 5DETA 5LSOA 2WW8A 2CKWA 2AV5A 1HWJA 2R4FA 4YG2A 1FRLA 2YNFB 4A3BK 1S9GB 2DH7A 3S7RA 2RD5C 3FZBA 5FJ8K 2G2YA 3TAQA 5EGHA 2VFSA 2R7ZC 2HZVA 4BXXK 3ONQA 3SBMA 2VHGA 4DUTA 2CFXA 4AE5A 2VUMA 3EPGA 4F04B 2WVCA 3BKTA 2R7UA 1V5IB 2HURA 2RVJA 4NCGB 1JLQB 2E5HA 5KFMA 1CVJA 4NEZA 4Q0BB 2PHCB 4U6PA 2UU9F 4QIWD 1NKEA 4DFJA 4KY3A 2XBPA 4UQTA 3LAKA 5HN0A 2QLFB 2YTCA 1ACMB 2UVRA 1MN9A 4I2QA 1UW9A 3SI8A 2P6SA 1Q4RA 1U26A 2HNZB 3RRGA 3ELHA 4I6AA 2ZUAA 4HTJA 1SC6A 1FNXH 5GAGU 1FE0A 2N3LA 1WTFA 1RTDA 1P6TA 1B3TA 1FEEA 2CNNB 3OUYA 2CJXB 4ECXA 1EETA 1Z4UA 4PPZA 5LJ5Y 3T6BA 3K5LA 3DRPA 3OFGA 3QGHA 2CNKB 1Q16B 4YOEA 2HQGA 3VA7A 1BQXA 3UPFA 1Y3JA 2JA8C 1RTZA 3W9JA 5KG7A 1LWXA 4FZVA 3DKDA 2F4VF 4CLSA 4DV4J 3QIPA 2MJNA 4CLKA 2QSWA 4DR1F 2NVYK 1Q78A 3IRXA 3QZ8A 1S1XA 3G71S 1TKDA 3THTA 4ED0A 4JK1A 3ET6B 1SIZA 3HHDA 3FUYA 2OGUA 1HBUB 3RUBL 1HKAA 4DR6J 1RT3B 1UZHA 2YNHA 3KTQA 1PIEA 1PAUB 2HNYB 4CH1A 1R8AA 2L48A 1AW0A 3C6UA 3QFHA 3E3XA 1FKPB 4OX7A 2Z57B 1RT4B 2R7WA 3LH2S 4CLFA 2K7JA 2EVZA 3DLEB 2HGLA 3DOLB 1VQ7S 1NJIT 4YN3B 1IKWA 3OL8A 2VICA 1ULRA 1WTBA 2R8KA 2WVDA 3P45B 2GIRA 5JUMA 4FN5A 4KB7A 3VALA 4J91A 3AA9A 2KFNA 1TL4A 4ED4A 4BC7A 2V8DA 1UEUA 2NVQC 3ISNC 1TK8A 4QU6A 1UP1A 3OLBA 3K5PA 2WSEC 4Z7YA 3SV4A 4B9VA 1DQ8A 3WBZA 1HYSB 4DSKA 5CJ9A 3UR3C 2OPQB 2V63A 2H5EA 1R9TA 1K8AT 3Q8RB 2CJKA 1VJEA 4ZPAA 1X4BA 3BGLA 5F8HA 2AEFA 2WONB 5GAEI 1WQHA 5L1KA 1TKTB 5AXLA 4BHQA 1H2VZ 3P5TL 5RUBA 3A8IA 1R0BG 4AL5A 4XSXA 2D69A 3DC2A 4TKTA 3TUPA 4M5IA 3PKMA 1GH8A 1BDFA 3G4SS 1L3TA 1UVNA 2RGRA 1XXAA 4MMOA 2E2IA 1EP4B 3G4CA 1JLEB 3GEHA 3OR2B 1R43A 3GFXA 3ZZYA 3A8KA 2C3YA 3J7YI 4ZVQB 2FJWA 2HBYB 4TY8B 2CQHA 4CWBA 5C24B 1XERA 1N5SA 4WP9A 1SC1B 2H54B 2MQQA 1TV6B 3MUVP 4FVMA 2QA4G 1VC6A 3NG8A 2DNKA 2NLWA 4ZP7A 3M4OC 2CPJA 2I38A 1NU4A 2RDDA 4USJC 4DG1A 2UV8A 2QSFA 5KG2A 2A10A 1R0AB 4YS2A 4RPFA 1Y4ZB 1FJGF 2KWAA 8ATCB 2PEBA 1U2FA 2VKRA 4LF4F 3JSBA 2RUGA 3PX0A 3JQJA 3TFIA 3T1HF 3NWRA 2XCOA 2Y0SD 3POTB 1GXTA 3GJRB 1HMVB 2DTJA 2H3EB 4MIWA 2B3TB 3IWLA 4RW8B 3BO4A 1NK5A 3Q8VA 3NGSA 1RWOB 2L41A 3MAQA 3CJ8A 3LANA 3U02A 3IAS9 4ZLPA 2HFNA 5KT6A 3KUGA 5IZHA 1S1TA 4NWBA 5A0YB 1SL1A 2CQIA 3RR8A 3GSIA 3ERED 2AJFE 1C2PA 1SH3A 1WHXA 2YH0A 4KAWX 3MECA 5EGYA 3TUJC 3H0PA 4DR3F 3H0GC 1RADB 3KJQB 1RISA 5I4MA 1EI6A 3C3LA 1K1QA 3GIKA 1S1UB 2JA7C 4BY7C 5IYDK 1TWCA 3OXLA 4NI2B 2LQ8A 3I6PA 2IYIA 4G0UA 1AUDA 1T9VA 4PXDA 3OW2R 3UN5A 4B3SF 3BR8A 4HLBA 3B4MA 1U2RA 4ECYA 4ZLJA 4GVBA 1K83C 2R93C 5J1NA 3WDOA 2Q3PA 3ZZTA 5J1EA 1I5OB 1SJ3P 2ZE2B 3IPJA 5HJYA 1EKSA 1J6VA 2VUMK 5HQLA 1S49A 2ASLA 1OO0B 4AL6A 2O66A 1U8SA 1INNA 1HLWA 1UVLA 1RWWB 1NK4A 4CLLA 4WJ4A 3EJMA 3SSRA 2YVSA 2CA9A 1SFOC 3W2WB 2NXUA 1RLCL 5AJ3F 2K06A 4JI7F 2IAJB 2VPYB 4RW7B 1S1WB 2PMHA 4C3JC 4C8LA 3PO4A 1O5JA 3MMBB 1V9OA 3MM6B 2E5GA 5CQGA 2G0CA 2ROPA 1JX4A 3TUIC 1EZZB 4N47A 4P10A 3GCXP 3BN4A 3IS9A 4FXWA 4DI6A 2Z30B 2J0QD 3OBIA 1M5SA 2J76E 4CLYA 3PJWA 3QPIA 3ZTOA 3T01A 2R7RA 1XMOF 2XMAA 2LEAA 1P9QC 1BGXT 2JH3A 1U48A 4RU2A 1ZS6A 1J5EJ 4URSA 4GKJJ 3R1HA 5ETNA 4QW8A 4KV8A 2ABYA 4A3EK 3MEGA 3KLIB 3BP3A 1HNXJ 3IRWP 1BE4A 3HOWK 2J7UA 1EX8A 5IC4B 1U1LA 4K0KJ 1WD6A 1G4CA 1H0HB 4O4RA 3U27A 3NCRA 3LP2B 3MMCA 5KFVA 3Q23A 3KK2B 5LSRA 4NEYA 3R6LB 4HHUA 5EGEA 4IFVA 1U0HB 2D7SA 4CTAA 3LAPA 1I3QC 1CC8A 1CJVA 2ZD1B 2YBVA 2HQ3A 2XGQA 3VAKA 1MNEA 5HROB 1REVA 1Z2ZA 4NZ0A 3CDEA 2BRKA 1KNZA 2V4JB 5LMNF 2CPZA 5DG7A 1MMNA 1OSDA 2ZBCA 1HHTP 5C7PA 3OSNA 2ZEJA 1UVIA 2ZWOA 2NYIA 2BXJA 3IM9A 2HHUA 2MLXA 3CD5A 4JI3J 1I94F 4ED5A 5C2CA 5FIIA 1RT2A 3CSKA 1KBRA 1SMYA 4C11B 4J9SA 3G2XA 4JI5J 4OINA 4QR0A 1SJ4P 3LAJA 2FUG9 2MSTA 2ZKTA 3UFCX 2IVYA 3FBCA 2EWHA 3G6VA 4DCOB 4Z2XA 2BKNA 4ZCKA 3NNHA 2NYHA 3Q8UA 4XO0A 4JI2J 3D0IE 3D9BA 1R9TK 4KC5A 1HWUA 2MSSA 4YY3F 5A8WB 2X3GA 2HNDB 4GC6A 3CQZK 4QR1A 4G1QB 4QIVA 4A4JA 2QLXA 2I2YA 4PG4A 3QLHA 4ELVA 1X9SA 4H4KC 1L3SA 1N5VA 1WKJA 1TWFK 3BGFA 5G0RA 1RU0A 3ULHA 1UJ5A 1IBLJ 3TA0A 2VG7B 3VQSA 5D0RA 2E2IK 1TWGK 4PEOA 4DPUA 4O44A 1Y0HA 2G13A 4AUKA 4WILA 5CYMB 1RI7A 3DM2B 2G2ZA 4ILLA 3LW5C 4OI0A 1X5SA 1PGZA 4IQXA 2BQUA 4WIQA 4IFYB 4F4YA 5D15A 3CJTA 3S1MC 1TWAC 1FRXA 4CNYA 3S1NC 4LFBJ 2PE8A 1E6VB 1T3NA 1I6VA 4YFNA 5T41A 2P5MA 3MEDA 5M2RA 2QL7B 1LW2B 4ZPDA 2KU7A 4KMHA 2Z0GA 1DRZA 1Q81T 3OSPA 3FMWA 3N3YA 1VCTA 4KN7A 2V4QA 1ZYQA 1ZBTA 1FJ7A 1HBOA 2I0XA 4ED8A 3D28A 1D9FA 1HNIA 1IBKF 2CQ1A 3TZWA 3L9ZA 1CJKA 3C14B 5C4JC 5K5MA 5C25A 2IPOB 4QIEA 1R8BA 3ZNUA 5B08A 1K0VA 5ETQA 1N88A 2NSCA 1C0UB 3DXBA 2JNJA 4IG3B 3FMBA 4ER8A 1Z1ZA 2B9WA 2IJFA 2VBYA 3T5JA 3Q2SC 4LMZA 1S0OA 3IA0A 1Q79A 4RU9A 2V2KA 4HHJA 4CLPA 5A8KA 4F2RA 3MD3A 1TWHA 2CNLB 2VASA 2M8HA 1W26A 3K59A 1IUJA 2OI2A 4HT5A 3O5TB 4IH5A 2AT1B 1QAYA 3PO3K 3Q0AA 5F8MA 3AXMA 3V4IA 4ZVGA 1I50A 4Y52K 3ZZOA 2QMXA 4ZVEA 4DV1J 2HS3A 1USOA 2NVXC 3H3VL 2B63A 1TWCK 4B9TA 2QMUB 2VG6A 4WTOB 2CWXA 4DHVA 3A4TA 4BWMA 1VLYA 3OLAA 2DNZA 4A8XA 3GU0A 4BWJA 4I67A 2W9BA 3RG6A 3KK3B 2P2CB 1QDUB 2BE9B 4M95A 2XI2A 3NMRA 3PRDA 5IV3A 3E2EA 2BQ3A 1VBZA 2XMWA 3DRSB 2BX6A 2GSUA 2MQMA 2M8DB 4O3SA 3AD7C 5IP7K 2R8GA 4Y6IA 1OS5A 3D68A 2BANA 1WIHA 2V6TA 4CI0B 1GK8A 1ZTTA 3Q8QB 3UW1A 1AFJA 1NPKA 3NS5A 4CT9A 2EEYA 5F0UA 2C2MB 4KAIA 3TVYA 1N36J 3GR1A 3T3FA 2IVFB 1IKVB 1TL3B 4P7VA 1DTTA 2GAGC 2IYGA 2QX0A 2RQKA 1VRUA 4OX6A 4EMDA 4CH7A 4CH0S 1MLAA 1N56A 4LK1A 1Y9OA 2F40A 2XI3A 2E9ZA 3DHWC 4YEAA 4KBIA 1ROFA 1K73T 1NJZA 2P9GA 5CAAA 2B6AA 3N79A 2IRXA 3K17A 1SBRA 4MKVA 3WX4A 1KVJA 3M2VA 4DFPA 4DR2J 1X4DA 4PABA 3K7AK 1SI9A 2VA3A 1X9MA 1DLOB 5DG8A 2C22A 4BLBA 2KTQA 5EWFA 2GFFA 3R1LA 2KH9A 3BDPA 4GTAA 1FEHA 3CT9A 2V8PA 2J9CA 3BEGB 3HX9A 4AQYJ 3CNQP 5CYQB 5HP1A 3O44A 4S0MA 2PMZD 2KYXA 1WHYA 1NSAA 4DV5J 4DFMA 5M5XK 5F8LA 2RRNA 3JS9A 5LJ3Y 2QGFB 1CS4B 2RF2A 2O67A 5E68A 3LPXA 1HW8A 1MU2A 3S17K 5FLMK 4KPCA 4LRFA 4DX8H 1R8PA 3QAEA 2XLIA 4BC9A 3ENVA 4TLRA 2CJ9A 2FZKB 1QSLA 4LSLB 3D5MA 3PHEA 5HVHA 4DLGA 3EZ5A 3UCUP 1CC7A 2MQOA 4R8UB 2DGQA 4M1XA 3EM1A 3H5SA 1Q8KA 3D4JA 4W90B 2BUNA 4U96A 3GB0A 3ISZA 3GPAA 4A46A 4U7CA 2YH1A 2MKHA 3M8YA 2ZFHA 3UDEA 5DDQC 1MROB 2ZZMA 1T05B 1IR2A 3OFFA 1W25A 1WC3A 4WP3A 3M32B 1JLFA 1PJ6A 1Q95G 3FZ2A 3CO0P 1TAUA 1RJJA 2KT2A 3QSIA 3JYTB 1CQMA 1LEOA 5HL7Q 2HPUA 1T8EA 1FDDA 2BJ9A 3O6QA 2IJNA 3PHTA 4RUHA 1M5PC 1MSWD 3K58A 1VIOA 2KYZA 4ZLLA 4RBUA 4J90A 4A8QA 1DTQB 4RBTA 2GQ2A 3FVYA 3CDUA 3WHIA 3VGTA 1YIJS 2OTLS 5J2PB 3ZFVA 2KDOA 2C3OA 3NMAA 5B0GA 3T5LA 3QT8A 4PXEA 1YSJA 4C98A 3H7HB 1F7UA 1X4FA 5D0GA 3BS9A 4DX5A 4CYUA 3D6FB 1VS3A 4A3FC 4X65J 2HW3A 3S2HK 1KEKA 1RK8A 3WODA 3ZO7A 1K0TA 1O51A 5EX3A 1TMMA 1RT6B 3HVWA 1J2VA 1VMBA 2QV6A 3IMQJ 2GO8A 4DL5A 4K4XA 1VQ8S 2N3OA 1UPPA 2CG4A 2AGQA 4DL6A 3CCRS 4LRAA 4UUWA 3LWMA 2HFZA 3HOXK 2V2QA 2U1AA 3GYGA 4N41A 2XYPB 2HSEB 5L38A 1O24A 5A2QU 2WTFA 4FYYB 4CCHA 3CJKB 2B4UA 1KOHA 5C44C 1EB0A 3G4AA 2KHDA 3T1AA 2W7VA 3GILA 4BKWA 2UUCJ 2FZCB 4XDCA 4A3GK 4FYXB 3PX4A 3V4GA 5DG9A 4C48A 2DCUB 4YP3A 1XR5A 2I1RA 4KT0C 4ILDA 3HZGA 2XLJA 4I6WA 2ASDA 2DNLA 4ES1A 1J6WA 1S6PB 2CJBA 2LU1A 2GVDB 3MPUB 4LF1A 4DCJB 3EICA 2RU3A 2L9DA 1RT5B 1S7HA 3M1VA 1RSCA 1F5AA 1R8HA 3UD5A 1I50K 3OFHA 3CD7A 1J5EF 1FKOB 5E3AA 2NVTC 1LKZA 1S4EA 3Q8PB 2XEXA 3KG1A 1F6TA 3H25A 5HJXA 1UVKA 5A6PA 1EH1A 2PO4A 4F02A 1HNXF 1PAEX 4F2SA 3IR7B 3HSDA 2HGNA 5IYBK 4K0KF 2QN6B 1FTCA 3LGHA 3T41A 4BBRC 3IBCB 3TARA 2ATLA 4DQRA 2FHJD 4KM9A 4XLPA 2DGVA 4KGVB 3UE2A 5KFSA 4GC7A 5I3PA 3P3DA 3SCLE 3FHZA 1C1CB 3KLHA 2YWWA 1RWVB 1Q1KA 2OFHX 2XSJA 1GXUA 3FKIC 1UPMB 5BXIA 4K4SA 4K50A 3MEKA 4OX9J 4CO3A 3HHNB 3GTGC 2E1AA 4MFBB 2R3VA 4QW9A 4EZ6A 2E9RX 2HQDA 5K8OA 2FIUA 2N4CA 3PW5A 2B4VA 2ZHOA 5LOQA 2DXDA 3OR1B 4D3GA 4WK1A 4F4KA 1UFWA 3UQSA 3GG1A 1RBAA 4JI3F 1YDLA 2YKOA 4K4WA 1QLNA 1VK3A 2YNIB 1S9EA 2QFIA 3ILJA 2DR8A 4JI5F 2C28A 1UWBB 3J7A1 4IH7A 5C4XK 2KT3A 2EK6A 5HBMA 4Q8FA 2BMBA 4ID5A 4NPOA 5HAOA 1F60B 3S2DK 3BKFA 1RU2A 4JI2F 1U1QA 1XZQA 2GSNA 1S1VB 3I9ZA 5DGBA 5IORA 3C46A 2XCAA 4HT7A 1URNA 4A3IK 4JI0J 2GC8A 2M88A 4BBYA 3FFIB 4A8WA 4DX6A 1U09A 1SIWB 3I96A 3H5UA 1JOEA 1S79A 1VC5A 2B9EA 3MM7A 1PJ5A 2UUBJ 2FD2A 1QJHA 4NLQA 2KRRA 2R7QA 1IBLF 2QLWA 3LP1B 3R5GA 2B4OA 3X3UA 5SUHA 1HQUB 2BKOA 2M5YA 1SL0A 2NR0A 5EHHA 1TMJA 2LLZA 1NRKA 3H98A 3JAMY 2CAJA 3Q86A 3RYLA 2X51A 4ZPWR 4JYAJ 1F9FA 3GMGA 3HKZL 3PW2A 3DOMB 4NXMJ 4ED2A 2WBRA 8AT1B 2NXCA 2E9TA 3BH7B 4BY1C 4LRCA 4PKDB 1RHRB 1IN0A 1YRXA 4B9LA 4LFBF 2DH9A 2PN6A 4LUBA 2R8JA 4USKA 4V19X 1N5TA 3CC2S 2QFJA 2BACA 4JV2A 1WCMC 1CJTB 1YG0A 2OPPB 2ZHBA 2W9CB 2B4PA 1VHIA 2PEHA 4A3DC 3TOQA 3HOVC 3IP0A 1FKAF 4KKOB 3WC0A 1YZ7A 3DOKB 1EARA 1AUSL 5B0EA 5FLXY 1RB0A 4YB5A 2KZMA 3HOZC 4P2XA 3CIZA 3LGNA 4QBUA 3DCAA 3G86A 4IRCA 4YR2A 2G1HA 2BEFA 4USWA 1HQEA 1UETA 5KFAA 4NA1A 2IVMA 4OYPA 1NEEA 4A8SA 3RU0A 2WB1L 4FXVA 4X84A 4MAKA 1T95A 3QO9A 2MZSA 1U25A 1GX5A 3Q2TC 2U2FA 1PYTA 4PQUB 4BXXC 4OZ2A 4P73A 5EN1A 4Y7NK 3UN2A 2CPDA 2MTLA 2OHDA 1C1BB 5BYQA 3ISND 3ETMA 3OQ2A 3KUEA 2FJEB 2WHOA 1ZAVA 2NXNA 4RW6A 4WE1A 3FJ2A 3TQEA 4AT1B 3QRRA 1CULB 3CCVS 4DV1F 4WU2A 2X1BA 3FKBA 4OHYA 2V6UA 3A8JA 1KWMA 2YKQA 1DCOA 1UKUA 3HPOA 4W4MA 1TL7B 1O29A 5KFRA 5ITHA 3AOBA 3GZ7A 4CLWA 5HO4A 6AT1B 2MB0B 4ANDA 4URGA 2LXFA 4EYIB 1BQNB 1LWFA 4C2MA 4DDFA 4P72A 2ZH2A 3W65A 2AD9A 3OFEA 2HHHJ 3DI6A 2IM3A 4LRDA 5F41A 4DBQA 2G0JA 5K8PA 1B0VA 1TAQA 2NZ4A 2VQFJ 2NPIA 3TWZA 4TQSA 4LF7J 2FLLA 4DQPA 4DV6F 2HVHA 1RDRA 4LSZB 1V3SA 2X7IA 1IE0A 5AXKA 1WF2A 3L7OA 2M70A 4IYQA 2KXNB 3E51A 2CDQA 4TQRA 1VRTB 3J7ZT 1N36F 2LCWA 2ZOFA 1GMWA 5HVGA 1U45A 5JMNA 1C0TB 3PW0A 3V5RA 1U8WA 1FDNA 2DT9A 2CPEA 1GMVA 2BE2B 5GMKa 2R42A 4X66J 1Q53A 5L46A 1NCLA 2JLFA 1TP7A 3TZXA 3GG0A 4QCLA 3VQTA 2RIJA 3CJ3A 4DR2F 5I42A 4PXBA 4P2MA 2I5JB 2H5IB 3C8YA 3DLGA 3CAGA 3LP0B 2Y9HA 1HL6A 1NJWA 1MW7A 4J7CA 4AQYF 3K89A 4J9VA 1U24A 4DV5F 3KDNA 3U1MA 4LBPA 2J9EA 3W8PA 3GP9A 2DXFA 4ZVFA 2VPZB 4DPOA 1X4HA 2KXFA 4C8YA 4NA2A 1D9DA 2K3KA 4U8YA 1OY6A 4YB7A 4OLPA 4WKRA 3HT3A 1YWXA 1GMUA 1GQEA 2WAQD 3MPDA 1T9TA 2XMTA 4F26A 4ZK7M 1D0EA 1YVFA 2PC6A 2JEIA 4KMDA 1Y3KA 5CZVA 2FYXA 3MPWA 1WF0A 3JQMA 2BM1A 3DRRA 1DJ0A 4M5DA 4I2QB 3I5BA 3OTCA 3K2YA 1N48A 4QU7A 2HK2A 7FD1A 3UNYA 2UXCJ 1TKXA 3GTKA 4DMZA 2A6HA 4NASA 3OUYB 5DS7A 5I3QA 4RKUC 2ERRA 1EETB 4GO7X 4QOTA 3H3VD 4OJ3A 3HK2A 5EUHA 2VQEJ 1J98A 5IT0A 1SQFA 4RJVA 3GDZA 3DRPB 3TZZA 3D1HA 4WIIA 4FPRA 3GTOC 1FDAA 3M8RA 2QEXS 3TNVA 4WYWA 3CCUS 4NMXA 4NRUA 3U1LA 3OVAA 4C97A 1GX6A 4PG6A 4YDXA 3Q89A 2F63A 5F3TA 3I0SA 3QIPB 4J5OA 5JVHQ 3RTVA 2XQCA 4DF8A 1JIHA 3IRXB 1RT7B 1VFJA 2WOMA 3NCPA 3KOAA 1S1XB 2DHHA 3MZIA 4NOHA 5KFNA 3UO0A 2EG1A 2LU2A 1TUWA 1KFDA 3VAFA 5LXRA 3FK4A 1YNNA 1J5OB 3CEDA 3HSGA 4XAKA 1QUVA 3R5BA 5C42A 4ELUA 1WQFA 2P8IA 3AHPA 2OD6A 5IM0A 1EHWA 4CLUA 1IKWB 2LKZA 1N4LA 3NEKA 2OSRA 4EEYA 1IBMJ 1WDDA 2E2HK 4LOWA 5E7OB 1B7FA 4JI8J 1UW4A 2KG0A 1EQRA 1IR0A 2HGMA 3CJ2A 3OPFA 3LOUA 3CCZA 1XC9A 2W2OP 1XEZA 1FXLA 2HLTA 4U9RA 3FSIA 2R2UA 3QX3A 1P27B 4A93K 3MM8A 3H4BA 2D6FC 1M1KT 2UUCF 1FK9A 4IG0A 5K14B 1S99A 1X8DA 4DV3J 4YB6A 1RYSA 3W5ZA 2NSBA 1X5OA 1P8GA 3DDIA 2EC0A 1CG2A 2WCXA 2DR7A 4KGKA 3I0RB 1P1LA 1UVMA 1R6YA 2IBOA 1HI8A 4YHHJ 2B5JB 4RZRA 2B9YA 2GAHC 4EO8A 5JXSA 4HACA 5D0HA 4JV1A 2C2KB 4GTLA 2YWHA 2N7YA 2ZC4A 2V5HG 1YJVA 3PJXA 2OAUA 5IV4A 3I87A 3UDVA 4NRTA 1C4AA 2F1FA 4UZCA 4LF2A 1Q7YT 4KPYA 2JA5C 2PA8L 3A12A 3H2UB 4OLOA 1HI1A 4OYMA 2BE5A 2YKNB 2F9DA 4C2MK 4DN0A 4K8RA 5KOWA 1YBUA 4NCGA 1JLQA 3BREA 1NK8A 4UUXA 2FJDB 2RAQA 2A68A 3NL0A 1SV5B 1H74A 2Y0SL 1JXVA 3RZOK 4JOUA 5A8RA 3W9HA 3PEJA 2XZDB 1YJRA 3N5FA 4NLDA 4A3EC 3IBWA 1JMTA 3PYGA 4IRDA 1T03B 2LVWA 3CCES 3S14C 2G0IA 2ZVIA 1JQGA 1K9MT 4DS5A 4ZP8A 3MR5A 2MZJA 5D4OA 4RMFA 1RTIA 5HANA 4IR1A 3FCVA 2VFTA 3TQ1A 3OL6A 3W64A 3S16K 3ILLA 2CFAB 2BOAA 2EBEA 5KG1A 1HPZB 1R6VA 2GS8A 2QA1A 1R3NA 1ZPWX 4JI1J 4E2FB 3BF4A 2A69A 4JI0F 3QGGA 5KT2A 2UVWA 3OV7A 3FBFA 2GMLA 3AODA 3HLUA 1RAIB 4YR0A 4OYBA 3IO1A 4AH6A 2C42A 2Z4PA 1WC1A 1D1UA 2PD1A 4DV0J 2ZBRA 1HBUA 1AXQA 2H65B 1RT3A 1FFGB 3AQOA 3TUZC 4GVBB 1VQMS 3E8OA 4JYAF 1LWCA 3H0GA 4Y34A 4NXMF 3G6ES 4OZ5A 3DOLA 3M3YC 3HO1A 2PPBA 3M4XA 1R9TC 3BR9A 3RR7A 4JI4J 4KQZA 5LMUF 1QUPA 2R7ZK 1OJ4A 3DU6A 3TJ9A 3N0CA 2RRAA 2XCPA 3Q24A 3GJSB 2F8EX 4TXSA 4OZ1A 2J6TA 1S0NA 3C6TB 3GEIA 3D1QA 2NREA 4PUOA 2JOQA 1Y11A 2HRUA 1ZM4A 4QWEA 2V0NA 3PNIA 3IXQA 3E01A 2E2IC 2M3DA 1N32J 3FSYA 3W7BA 2ZNYA 4ZVOB 1TKZB 2OPQA 5HQ8A 5GMEA 5IP9K 2BDPA 1QY7A 2UV8G 1Y5LB 4RBVA 3IR6B 2GZOA 3L7PA 3K57A 3NP5A 1X5PA 4YDDB 3CD6S 1GTHA 5L39A 2WONA 4KV8B 1TKTA 1NDKA 2XZTB 3QZ7A 1HARA 3QIDA 4Z37A 2Y1LB 3TZYA 1KS2A 1JLCB 2AYBA 4A3JC 1RACB 1EP4A 4LF4J 1JLEA 3Q3QA 3MGJA 3OR2A 2VB6A 5D6GA 4UY85 1GTEA 1X60A 2K2PA 3LGMA 5HI7A 3EUNA 5C24A 4CTAB 2HRTA 4PG5A 3EPIA 1TV6A 1NXIA 4DZDA 1KONA 2VDHA 3H59A 4EFAC 1NK9A 3QRQA 5E5NA 1REVB 5DRKA 2JA8K 3H5XA 4ELTA 4DQIA 1C0AA 4B17A 3RB4A 4HHHA 1R8CA 1ISEA 3QT6A 2CPIA 2M2BA 3CJQA 3VAIA 2HHHF 4J9OA 4MIBA 5GAGI 5IOTA 5B0AA 1B0TA 4ZN3A 3QJPA 4RNHA 2VQFF 4LF7F 2EXUA 1REGX 3C66A 3FC9A 2HMIB 3W63A 4YQWA 1RT2B 2BV3A 3PO3C 2QYGA 3EXCX 2VPWB 1RYRA 1ZETA 3MR3A 5D78A 4EYHB 3VWSA 2OPSA 3R5CA 1WG1A 1DARA 4X4OA 1DURA 4F3QA 4P52A 5BR8F 2A2CA 1SJQA 4USIA 4ZVUB 4L72B 1WELA 3DRYA 3TX0A 1F2HA 3MM9A 1RTHB 2LP4A 5A0YA 3VZIA 1KTQA 4NLWA 4X66F 2IIHA 2NVQK 4ILMA 2XY5A 2JLGA 3OVBA 1H7XA 1UMJA 1XMBA 4CIOA 3N6NA 1RU1A 5BJRA 3HKZD 1X0FA 3QNWB 2DEIA 2D74B 5IP7C 1XXBA 5ETTA 4O44B 1EK8A 1EQMA 3HFKA 3PTWA 3UD4P 1QAJA 2QO3A 2NUHA 4HVZA 3TFHA 1KSPA 3CJ5A 2D1CA 2DITA 2ZC3A 1W7WA 1D9AA 5H9EK 3O3LA 2Y8YA 2ROGA 2MDAA 4KARA 4DX7A 1O2BA 5KT4A 3SCIE 1YGYA 3SZZA 2CJQA 4LF6J 3W66A 3D0HE 4DLEA 4K5SA 3ZZRA 4JBCA 3TP2A 4OQJA 2CPYA 2M0GB 4KR0B 1LNQA 5KG3A 1BWEA 2IAJA 3EZUA 4RW7A 3KNAA 2G4BA 2AIRB 3I56S 1EFWA 2VZ9A 3M4OK 3MMBA 2ZJPQ 4IUFA 3MM6A 1CJKB 4HYKA 3W2VB 3S8SA 3RAXA 3GTLA 2UXCF 3WZ0A 1S6UA 3R27A 4ZVHA 2IMOA 3WC2A 3HHLA 2OEKA 3PW7A 2RQ4A 3PR5B 4IOCQ 1HHQA 2GGPB 2ZBPA 1FWKA 3LWLA 1JKHB 2DNOA 2VQEF 1VQ5S 3HP6A 4ITSA 1NB2A 3R97A 4HI1A 3V4IB 5LMNJ 3GONA 1VGYA 4ETXA 2FVCA 3DU5A 1F5BA 2MLYA 1OY9A 2R9LA 2BJ1A 1GNKA 2NS1B 5KFGA 1OMSA 2VG6B 3DMJB 1CLFA 2BM0A 5E0OA 1R27B 1XQIA 1SKUB 2A3JA 2E1MC 3LP2A 4OYXA 4J37A 1U0HA 5ADZA 3JSYA 1YI2S 2ZD1A 2PFDA 4B3RJ 3K8WA 2BBEA 3D7SB 5JVOA 3I5CA 1G6BA 5HROA 1TUVA 3H0GK 2VF3A 2DBBA 4C3MA 2IA6A 4B9MA 2RDJA 4ECUA 4X4VA 2X1GA 2JA7K 7FDRA 1FX2A 3JXOA 5LM7E 1JNZB 4DSLA 4U7UD 2XS5A 3T5HA 4YY3J 2HHSA 2VH7A 1XXCA 5TMFA 1QVGR 1RQ0A 3HOUK 3N0BA 2DK2A 2JFDA 4NYZA 2NUUG 1FRJA 5KT5A 2KVIA 4K4ZA 1IBMF 3BKUA 3B78A 4OX8A 1O2FB 3SQGB 3MCOA 4J9NA 2BE7D 5H9FJ 1Q5YA 1XN9A 3B54A 4DV2F 1V3RA 5IQQA 1KP6A 2MGZB 5KG4A 2Y3PA 3KJFB 2COLA 1L5UA 4DV3F 1VR6A 2FQTA 2GVZB 2AJQA 5D77A 2KN4A 2HNDA 1H2TZ 3R7SB 5J2MB 1WHWA 4G1QA 1KKHA 2KKHA 2R7VA 4WP8A 3M6VA 2VIHA 3OREA 2EK1A 2PMZL 1B4BA 1D09B 4DFKA 3TAPA 5ETMA 4YHHF 2FLPA 3BO2A 5HP1B 4M63A 2G9OA 3QAUA 3TTGA 3SCKE 2B9XA 1WACA 5DQIA 2ZH3A 3IWXA 2EBGA 4KMAA 3M8ZA 4OL8A 1MN7A 2H4WB 4A8FA 5CYMA 3NAIA 2OD4A 4V1Ak 3PY8A 3NRBA 3CCTA 3Q8YA 3QT7A 3FOEA 9RUBA 2QTWA 2WBMA 1IBKJ 4IFYA 2GHWA 4DPXA 2CPHA 4AYBL 2YX4A 1KHWA 1Q8IA 2O3DA 1PBAA 4O0NA 5DQGA 1KD1T 4GTBA 1E6VA 3ILIA 4A3GC 1T9XA 2K3IA 4CQ1A 5HK4A 2WW4A 3A3PB 2APOA 2GJIA 4JV0A 4KHRA 4YR3A 2J6UA 2CIMA 1E6YA 2QRRA 1FRIA 1Y1WA 3KWMA 5C5JA 1TWHC 3CO9A 1RWMB 4C8NA 2XWXA 3M2RB 4A3KC 2CQ4A 1F3VA 1NJYA 3MFIA 2DXEA 1I50C 2VBZA 4A3LK 4QYZK 2B63C 1C0UA 1RHKB 2DGSA 4IG3A 2E2JC 1B99A 4OYAA 4DL7A 5CD4H 2CPXA 4Y3CA 3FGVA 1FCAA 4A47A 3OVSA 4WTYA 3KHGA 2V94A 2MZRA 4GMKA 4R5PA 1WKKA 4OZ0A 4TYBA 3H5YA 3KLFB 3W8GA 1WF1A 4DU7A 2DNRA 1S7IA 4ZDNA 4DUYJ 3GLJA 1RAEB 2AZ1A 5DDPC 5T14A 4FYDA 1VGXA 2XLKA 1RA6A 4WXOA 4JI1F 3HHKA 3RGIA 1HA1A 1S0VA 1SCJB 4KYZA 4KE5A 4CYUB 4X4UA 3NY0A 4USVA 4QJVB 4OFZA 2HS4A 3RZDK 5KFWA 5KFHA 3PCOB 4PYAA 5HMXA 1KFSA 1O6XA 5K8MA 2OP5A 3AAWB 4DV0F 3FQKA 4M5MA 2CG8A 4L73A 4P2SA 3V6JA 3J7AN 3LTOA 3T9ZA 3DRSA 3NS7B 4NZ6A 4OYIA 5C4XC 2EFOA 2HBZB 3SFGA 2XCQA 2DR6A 1FT8A 2CWKA 1PBUA 1H2UX 3K0JA 3HOYC 3FBBA 3AB2B 3KJVB 2YY3A 3S2DC 2JRSA 5DLGA 3C19A 1U1PA 3CQZA 5I3UB 4JI4F 5MLCV 3D6TB 4MK8A 3S1MK 2DHXA 4BLGA 1TWAK 3HFVA 2ADBA 3QYYA 1Q7LB 4A3IC 3S1NK 1SL2A 1IKVA 2DRDA 1TL3A 4ZCIA 1NK7A 2AQ4A 1TWFA 2E7VA 1HBMB 1WKLA 4A8MP 3GTLK 4CO4A 1WOOA 5L8RC 1TWGA 2L9WA 2Z2MA 1YBTA 1N32F 2WSCC 1XR6A 2YKMA 3G87A 1WNEA 2FQQB 3FNNA 4OJGA 2JHEA 1RT1B 4HDHA 3M1VB 4DOZA 4TLQA 4Q44A 5ETRA 5KFZA 2C1EB 4WFZA 1UA1A 5CYQA 4R25A 2K8GA 5IOLA 1OQ3A 2PA8D 2OPRA 3AY0A 1FVSA 2W2MP 5KFEA 1XNQJ 3V81A 4OZNA 4XTTA 3VF0B 1NO8A 4G0WA 3EYZA 2GJ2A 4OYWA 3GQCA 1KQGB 4USMA 2ATCB 3CIMA 1XWLA 2RSQA 3KXDA 2R7TA 1NDPA 2LDYA 4LSLA 3PO2C 1PO6A 1KLMB 1EKRA 4X4RA 1HNVB 3L4JA 2HLUA 4R8UA 2FLNA 2NVXK 3S1TA 1ZAXA 5E2QA 2HEKA 5DLFA 2XSJB 4FYVB 5KFIA 2W4DA 1SKRA 4I2PA 3LPEA 2IBKA 3GSDA 5ETOA 3MPYA 4P5BA 2HHWA 1J6XA 4I6YA 1KRPA 3GCWP 4LR9A 3CULA 3OHAA 1IR1A 3U7JA 1T05A 2DRBA 3MXHP 4ECRA 4WJ3M 4OZ3A 2YKAA 2CJAA 3SIPB 3M32A 5KFQA 4Y2MA 4DN9A 1S9EB 2W7AA 3IWNC 4KO0A 2UUAF 2AW0A 2KL8A 4P75A 2MZ1A 3MMJA 3NBPB 1SJRA 4GTEA 4DPWA 3JYTA 2J7KA 2RS2A 4E0DA 3L95X 1F3FA 2FB0A 1NHKL 3CMQA 3GTGA 2QIFA 1G3OA 2FJBB 2YNGB 2Z2LA 1RHQB 1DTQA 3TJ8A 3MEEA 3B6BA 4A3MC 5J2PA 4G1IA 3PO5A 3A13A 1TZ0A 4P6QA 1G2EA 3MM7B 2NCKL 1WG4A 2V8HA 2ZH6A 3W1YC 3TA2A 3PFEA 2VG5B 4N76A 4AXJA 2B56A 3SV3A 1RP5A 5HL8A 2Y3YA 3OEPA 1RT6A 1VBYA 3R8YA 1XZPB 1IJFB 5CYJA 4Y28C 3T6JA 2QA4S 2W2QP 1RTJB 3GFZA 3CDWA 4K5RA 2ZUFA 2DYAA 4Q7AA 2BABA 5M3FK 2V9KA 2G1DA 2FC8A 3BBCA 2IJRA 3T1YJ 2FVSA 1O25A 2VOPA 3OXGA 1CQNA 4NLUA 3QRPA 1Y1WK 5K8NA 3PYFA 2R92A 4LF6F 4ICLA 1RLDA 2VV5A 2D9PA 4OIQA 1O28A 3D3BJ 2WZ1A 1J27A 1S6OA 1ZOTA 3N0VA 3EVWA 3G96A 1N54B 3ZTRA 1FFSB 2AJ1A 1H3DA 5A2QY 1FRHA 1ICEB 4FZBA 4I7FB 2BJEA 2VD3A 3GYXB 1KDNA 1M5KC 2VKZG 2MKKA 1WCMA 3I4MC 4O3OA 2XZWA 2ZBIA 1S10A 2GVDA 3MPVA 4IR9A 3K5MA 3QO9B 2VDIA 3KMQA 2ZH1A 3UVJB 4ED7A 5DQHA 1RT5A 1UVJA 3IGVA 3T02A 2UVUA 2HHVA 1JJ4A 4NCAA 5L1LA 1FKOA 2AP6A 3PYDA 2IC3B 1BC6A 1TL5A 4WE1B 3DN9A 4LR7A 3VAJA 3IR5B 5DM6Q 1VDHA 4ILRA 3MTJA 4IQMA 1ZYRA 5IOSA 2ZHAA 3GFYA 1XTZA 1NLKL 1S6QA 3CJ0A 1FVQA
chains in the Genus database with same CATH topology
1X31C 4PABA 4P9SA 2GAGC 1PJ7A 3A8IA 3A8KA 1VLOA 3AD9C 1XZPB 1YX2A 1VRQC 1XZQA 3TFJA 3GSIA 1PJ5A 1WOSA 3GIRA 3TFHA 1XZPA 3TFIA 3A8JA 3AD7C 3GEEA 3GEIA 3AD8C 5L46A 4PAAA 1V5VA 1PJ6A 2GAHC 1WOOA 1WOPA 1WSVA 3ADAC 1WSRA 3GEHA 3TTGA 1WORA 1XZQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X31 C;  4PAB A;  4P9S A;  2GAG C;  1PJ7 A;  3A8I A;  3A8K A;  1VLO A;  3AD9 C;  1XZP B;  1YX2 A;  1VRQ C;  1XZQ A;  3TFJ A;  3GSI A;  1PJ5 A;  1WOS A;  3GIR A;  3TFH A;  1XZP A;  3TFI A;  3A8J A;  3AD7 C;  3GEE A;  3GEI A;  3AD8 C;  5L46 A;  4PAA A;  1V5V A;  1PJ6 A;  2GAH C;  1WOO A;  1WOP A;  1WSV A;  3ADA C;  1WSR A;  3GEH A;  3TTG A;  1WOR A;  1XZQ B; 
#chains in the Genus database with same CATH topology
 2YQ0 A;  1SUQ B;  1X9W A;  2DY9 A;  4HH1 A;  1NHV A;  4OV6 A;  4PCQ A;  2EFP A;  3W60 A;  2F8H A;  2A6O A;  3M8Q B;  2Y0B B;  3GWC A;  1LWF B;  5LT5 A;  4B3R F;  1O27 A;  2P5V A;  1C1C A;  1FES A;  5M3M K;  2W9A A;  4C3I C;  1V3Z A;  3DI6 B;  3KMS A;  3TFJ A;  3HDS A;  2EFQ A;  4X6A K;  2QYC A;  1NK0 A;  1XMQ J;  4OIO A;  4MFB A;  3FEZ A;  3H90 A;  3GV8 B;  2A2D A;  2UP1 A;  4KFB B;  1BQM A;  4I68 A;  1OPI A;  3OR1 A;  2RH3 A;  2DNM A;  2EFN A;  3NGR A;  4ZHR A;  1M1G A;  4RUA A;  1U49 A;  2YNI A;  5AE1 A;  2BOP A;  5D4N A;  3KLE B;  2ADC A;  3CMA S;  5E41 A;  1BGW A;  2O01 C;  3CVK A;  1UWB A;  4FYW B;  1I6H K;  1NZ8 A;  5GAH U;  1UFK A;  2ZH4 A;  1VIX A;  2C2Z B;  2EFV A;  3AB4 B;  3MMA B;  1ZA2 B;  3F41 A;  3CJS A;  4OI4 A;  4X64 J;  3BO3 A;  1NB7 A;  1S1V A;  4JB8 B;  5LSL A;  5C44 K;  2QLJ B;  2FGO A;  2MHN A;  1KN6 A;  2C2E A;  2W2P P;  1ZTW A;  3FFI A;  1YK9 A;  4C0B A;  5KFX A;  1HHS A;  3AH5 A;  3DLG B;  4LVN P;  4M5G A;  1HIY A;  2KVQ E;  3BSC A;  4ZVP B;  4OHV A;  1LK5 A;  1QSS A;  3LP1 A;  4NLV A;  1NHU A;  1HWI A;  3GTJ A;  3G82 A;  3OJS A;  1SPB P;  3D54 A;  1HQU A;  1GT8 A;  2DIS A;  3P4U B;  4OMF G;  1SXL A;  1RWU A;  2DHS A;  3DLL Q;  2O5D A;  3D1O A;  2WAQ L;  5MAO A;  1VQY A;  3AXK A;  3DOM A;  1RHJ B;  3MTK A;  5J2Q B;  1JLG B;  4A93 C;  3KFW X;  4QWD A;  3MI7 X;  2K1R B;  1N6Q B;  1X7V A;  2NVT K;  2GMJ A;  4ZOS A;  1IL2 A;  1U1O A;  3M7V A;  2RS8 A;  4U7U K;  2RNE A;  1IBA A;  2CRL A;  4UT4 A;  1VH2 A;  4O0I A;  5J2N B;  3FRZ A;  2YPY A;  1CJT A;  2OPP A;  4DPY A;  4ZPB A;  3M9O B;  2W9C A;  1LOU A;  4ZCL A;  3TVK A;  3OD2 A;  3NWG A;  2DR5 A;  3DOK A;  1YRT A;  5EWG A;  1A9N B;  1YJ9 S;  4LJZ A;  1Y10 A;  2XM3 A;  4FVC A;  3UDL A;  5THW A;  4L74 A;  5FDL B;  2W8L A;  1YJW S;  4B9N A;  2FGC A;  3JTO A;  4JUZ A;  2FC9 A;  4B08 A;  2CW0 A;  5GVQ A;  3HT0 A;  2ZKU A;  1NAQ A;  2MKJ A;  5GAD U;  3FKI K;  2XY6 A;  2CQ3 A;  4JV5 J;  2YQ1 A;  3LUY A;  4TN2 A;  4BBS K;  3QWP A;  3KNG A;  3X1L B;  3GTG K;  1M5V C;  3MF5 A;  1VQP S;  4Y2C A;  4ED6 A;  1JLB B;  1EAY C;  1CPZ A;  5KFL A;  1JJ2 R;  4MKB A;  4DR7 F;  4PQU A;  2B51 A;  4FXD A;  1NH7 A;  4DL4 A;  2IDL A;  2J0W A;  2W1B A;  4LQ9 A;  4B9S A;  4N7T A;  1KLN A;  1C1B A;  1U7L A;  4RLE A;  4Q5V A;  4DUY F;  2DRA A;  4UTG A;  2H48 B;  3S1Q K;  3QAT A;  1U0S A;  2DCL A;  2R7X A;  3HHE A;  4DV6 J;  2FY1 A;  4DL0 C;  2CZ9 A;  2WOM B;  5AXN A;  3VAM A;  1WSV A;  2B8Q A;  1NM2 A;  5CD4 A;  4X62 J;  4J9Q A;  2OFG X;  4FNH A;  1TL7 A;  3RZO C;  1NND A;  4ENO A;  3GTO A;  2Z2Y B;  5C2G A;  3P5B P;  3EWG A;  1Y7P A;  3THP A;  3NS6 A;  2HIY A;  2MJU A;  1BQN A;  5C42 B;  3BGR A;  3HD1 A;  5BYR A;  3PIP Q;  4H4M B;  4M94 A;  4AD6 A;  2AU0 A;  3CME S;  4C8K A;  5IM0 B;  1LWE A;  1FXR A;  4WCE Q;  1U4B A;  4M5H A;  3H40 A;  2R92 K;  1Y00 A;  1VIS A;  1TK5 A;  1TTH B;  3PXG a;  2DO4 A;  1KC8 T;  3IAM 9;  1UZD A;  2JWN A;  5CCL A;  4FPI A;  3CDA A;  4Y0F A;  5HLF B;  3L4B C;  3MM8 B;  4CM0 A;  2JC0 A;  2LA6 A;  3PG9 A;  2NQP A;  5D0E A;  3RAQ A;  2YWE A;  2ZBQ A;  2DGT A;  1IXK A;  4DF4 A;  1C0T A;  1MML A;  4LQ3 A;  3AT1 B;  2QC3 A;  4C4W A;  1WCM K;  3HVR A;  3I4N K;  4HR2 A;  4KMU A;  3M30 B;  2BE2 A;  1IM6 A;  2EG2 A;  1K1S A;  2HIQ A;  2UXD J;  3C16 A;  3R7B B;  2JA6 A;  5ETK A;  3BBF A;  3DLK A;  3MD1 A;  3PR4 A;  1PC4 A;  2EBB A;  3G8T A;  3LP0 A;  4AYB D;  4HAC B;  2N82 B;  1U6B A;  5IC6 B;  2WVB A;  2C2N A;  4C7Q A;  1NK6 A;  4ES2 A;  4QIF A;  1HW9 A;  3GE9 A;  4M5J A;  4EBC A;  3OTO J;  1XNQ F;  3BYR A;  2DJW A;  3Q83 A;  1TQL A;  2XG8 A;  4OIP A;  2KJW A;  1LW0 A;  3CWJ A;  5F3Z A;  2E7X A;  1Y1V A;  3DLB A;  1RCO B;  5C3E K;  4F0M A;  2Y1I A;  3U1N A;  4LR2 A;  1N5Y B;  3IBF B;  2KZZ A;  1A0O B;  4QPX A;  1RAJ A;  3GTK C;  3EGN A;  2EKY A;  1IKX B;  5D3G B;  2PA3 A;  1XK8 A;  4NLY A;  3NLC A;  3CJ4 A;  3IG1 A;  1F5C A;  4LLG A;  2CPF A;  4WFX A;  1RBL A;  1UWA A;  5IP9 C;  1HQ2 A;  2E44 A;  1IVZ A;  5KFC A;  1X0P A;  3CE8 A;  5A8R B;  1SKW A;  1FHT A;  4DZ6 A;  2JA5 A;  4C8M A;  2M52 A;  5L1I A;  2ZJQ Q;  2DPJ A;  2HHP A;  2W2N P;  2AX1 A;  3CCJ S;  1DY3 A;  1Y5N B;  1RAG B;  3P6Y C;  4OV1 A;  3KLG B;  3A8E A;  1T11 A;  2FHM A;  3SYZ A;  3ZTQ A;  2YX1 A;  1RHM B;  1WDT A;  1RTI B;  3BSA A;  3M9N B;  2LQJ A;  2LQB A;  2HVD A;  4J9K A;  4KM8 A;  5ETL A;  4PRF A;  1N33 J;  4IRK A;  4UST A;  3PZP A;  2YX7 A;  1ZA1 B;  1TU0 B;  1O26 A;  4KH0 B;  4H4O A;  4XPE A;  4LF9 J;  1IKY B;  3G8S A;  3S1R C;  1TFW A;  4ZVS B;  5D4L A;  2FPH X;  4A48 A;  1U6F A;  2GSO A;  3MAH A;  1SC3 B;  4NLP A;  2IM1 A;  3GTJ K;  1RT7 A;  3M2U A;  5B7W A;  1AZS B;  5HMW A;  3BGO P;  3GJT B;  2WRM A;  1LV5 A;  2H1Y A;  5HMZ A;  3LO3 A;  2MQL A;  2R7O A;  4PAA A;  4M5L A;  4DS4 A;  1WSR A;  4ED3 A;  2V50 A;  4FNI A;  1IS1 A;  4OI2 A;  3US5 A;  2DHA A;  2A0F B;  1Q5V A;  1APS A;  1P9Y A;  1J5O A;  4NA3 A;  4KN4 A;  1LWC B;  3JSM B;  3ICL A;  3CDB A;  3RRK A;  1DCH A;  1KQ4 A;  1R7I A;  4FF2 A;  4DQS A;  4XSZ A;  2D3U A;  3UI3 A;  1URR A;  2DNN A;  5KFD A;  1M5O C;  1T3O A;  4YME A;  2IHR 1;  2IA0 A;  1FWP A;  4F0H A;  1I51 B;  1YLX A;  4RR5 A;  2DKO B;  4PYD A;  3T1Y F;  4N77 A;  2YU9 C;  1DAX A;  2O5J A;  3HCX A;  1VQ9 S;  4MEY A;  4MH8 A;  2PT0 A;  3GTQ A;  4L3N A;  2ALY B;  4KGM A;  5H1S V;  4PUO B;  1GEH A;  4XPC A;  5K14 A;  3CCW A;  3G6X A;  2HRY A;  2DHG A;  4O3Q A;  3E01 B;  3HVA A;  1I1G A;  1PCA A;  1ZM3 A;  4U95 A;  4O2D A;  4G3I A;  1DBD A;  2W01 A;  3B4D A;  2HFO A;  3ZXW A;  2BR0 A;  3I0R A;  1VQO S;  1W2I A;  3LF0 A;  2IRU A;  3AJ2 A;  2EKN A;  2MKS A;  1HBN A;  2B5J A;  4G7H A;  1P1T A;  2H51 B;  2JVR A;  4Y2A A;  3HJV A;  2FY8 A;  3MUM P;  5JVG Q;  4GFQ A;  2ZZN A;  4K4T A;  2RUS A;  4G0V A;  1HR0 J;  4WFY A;  3MAA A;  1WJ9 A;  2XO7 A;  2OIH A;  4B3O B;  3BM7 A;  4MIA A;  5K9F A;  3PX6 A;  3GTO K;  3HMJ G;  3BBB A;  5IQ6 A;  1WEX A;  2UZA A;  1S77 D;  3I31 A;  3MM5 A;  3F73 A;  3GV7 B;  1OYE A;  4E8U A;  2YKN A;  2P9E A;  3NGD A;  4E98 A;  1NDL A;  2JJ4 D;  1U1K A;  2RKI A;  3HZE A;  3RBX A;  3N4W A;  2Q43 A;  1VHF A;  2RQM A;  5M2P A;  3FRY A;  1O8B A;  3DXS X;  2HZA A;  2XYH B;  4DR4 J;  4Q4Z A;  2BJ8 A;  1SV5 A;  3ITH B;  4M5K A;  4ZPT R;  1L3K A;  3AJ1 A;  4F4X A;  1RZM A;  3ZTP A;  2XS2 A;  4ANE A;  1RAB B;  5IYC K;  2EI5 A;  4PQA A;  3CUN A;  3CXC R;  2K7K A;  4FF4 A;  2AYM A;  1XMQ F;  4F4Z A;  2DVI A;  2GQC A;  4ETZ A;  1FRK A;  4H54 A;  2OPS B;  1BHN A;  1TEL A;  1T03 A;  1YKW A;  1NH8 A;  2I6W A;  2VOD A;  3IC1 A;  3EE3 A;  4ZH4 A;  2QL9 B;  3AJD A;  2RB7 A;  1ZZN A;  2LEP A;  2KJV A;  3CC7 S;  2XO6 A;  5DM7 Q;  2OML A;  1VYA A;  3MUR P;  2ILY A;  3BB5 A;  4MYT A;  3MM9 B;  4IOB A;  4WJB A;  1SKS A;  2XMM A;  1WOS A;  4X64 F;  4FP9 A;  4PWW A;  2I8E A;  2JA6 K;  2I9S A;  2A6E A;  3MUT P;  2CFA A;  3D6M B;  7AT1 B;  1JXL A;  1HPZ A;  4PWD B;  4RUB A;  2E66 A;  2MQN A;  4W92 B;  4ECW A;  4EK2 A;  1S57 A;  1CJU B;  2UXB J;  3AD9 C;  4G65 A;  2Q66 A;  1IQT A;  5KFT A;  2OUG A;  4EBE A;  3T5K A;  1N52 B;  4MK9 A;  5TMC A;  2HQI A;  3P49 B;  3TAM B;  1WEY A;  4LFC J;  5LMU J;  1V5V A;  4C0O C;  4X4S A;  1L0W A;  3HOU C;  2VU5 A;  5HVF A;  1Y1V K;  2E2H A;  5IWA J;  3R3T A;  3SDE B;  2ZFZ A;  1FNM A;  1V6H A;  4CLT A;  3PJ9 A;  5IXU A;  2V8V A;  1FER A;  5KFF A;  3GFH A;  3GTP A;  5IT9 U;  3DGP A;  4DEZ A;  4Q2M A;  1VQL S;  3RRH A;  2HS0 A;  2ZUE A;  3DYA B;  4OZL A;  2AKW B;  2FVQ A;  1JLA B;  4A3B C;  2DPI A;  2J0S D;  1CSJ A;  3MML B;  4FS2 A;  1ZZF A;  3GIM A;  2BYC A;  4F8R A;  3FBE A;  1FF2 A;  4X4T A;  4U8V A;  2JA5 K;  5FD1 A;  2GIQ A;  1M5H A;  1TVR B;  3C6T A;  4GTF A;  1RHU B;  2A18 A;  3JST A;  2O5I A;  1XPP A;  1YJU A;  3M8P B;  4MKY A;  3HSZ A;  3RW7 A;  1ZBS A;  1BY9 A;  1WI6 A;  4FF3 A;  3HHL B;  3GII A;  1TKZ A;  3AD8 C;  4XDD A;  3HXM A;  1T02 A;  3CJR A;  1FWL A;  3JSR A;  4JV5 F;  1I3O B;  1N34 J;  1QAX A;  5A6W A;  4TYA A;  4MJK A;  4DUZ J;  4C0H A;  2ZIT A;  3C15 B;  2OO4 A;  3QWU A;  1N5Q A;  2MPU A;  3J81 j;  3R2D J;  1A7G E;  1RWP B;  2CUY A;  1CEZ A;  2V68 A;  3SSS A;  3S14 K;  4GTC A;  4LSN B;  3EX7 B;  4FBU A;  2FTR A;  1JLC A;  4WZQ A;  3HVT B;  5KFK A;  1S48 A;  2B7B B;  2XNR A;  1X4A A;  3CGI A;  2XYG B;  3R9L A;  4B9U A;  2OH2 A;  2DD8 S;  5F9L A;  2ZDP A;  1UL3 A;  4RW4 A;  2E1R A;  1D8Z A;  1F93 A;  5AT1 B;  4ZA1 A;  4RL1 A;  4OHZ A;  4X62 F;  2MY7 A;  2E5J A;  3DNC A;  1RBO B;  2C2R A;  5KFP A;  3J80 Y;  3HXA A;  2AGP A;  2JLE A;  2DB1 A;  4EZ9 A;  6FD1 A;  4DDQ A;  5BR8 J;  3NGT A;  4A3L C;  4IDK B;  2VBX A;  2OTJ S;  3VGV A;  2RIL A;  2CQ0 A;  4J9P A;  1PJ7 A;  2CQC A;  2NVY C;  2AZ3 A;  4KHM A;  2SXL A;  5T7L A;  1B0P A;  4WFN Q;  3JQK A;  4LT6 A;  3GYN A;  4RUC A;  2W24 A;  3ZNJ 1;  3GTM A;  2HMI A;  3PDN A;  1MWZ A;  2C2D A;  3MWB A;  2HG4 A;  4TU8 A;  3GTQ K;  4LK0 A;  2DNP A;  3MFH A;  1GFW B;  3WIU A;  2P6T A;  4FS1 A;  1NSK L;  4YUD A;  1NZA A;  1VI7 A;  2RRB A;  5ETV A;  3AFG A;  3AOA A;  2LXI A;  3M3Y K;  3TX8 A;  3RJM B;  1DFD A;  5U47 A;  4MEX A;  2ZH7 A;  3KUH A;  2FQO A;  2CZ4 A;  1RCX B;  1NPR A;  5GAE U;  1B7Y B;  4ALZ A;  3RZD C;  1RTH A;  4X4Q A;  3VCD A;  4DU8 A;  5KFJ A;  2E5I A;  4MK7 A;  3RB6 A;  2Q6C A;  2UXD F;  2FHJ A;  3TEG A;  2ZH8 A;  3M8W A;  4OJ1 A;  2QE5 A;  3F56 A;  5AXM A;  1WC0 A;  2E5L J;  2HHX A;  3JTN A;  1B70 B;  4MYU A;  3J7Y U;  1ITP A;  1M1H A;  4YB1 P;  5CCM A;  1WEZ A;  2CVE A;  2R2T A;  2DR9 A;  1A6L A;  1HI0 P;  4CNZ A;  3V6D A;  2ASY A;  4DSJ A;  2QL5 B;  3OTO F;  1QE1 A;  4B3M J;  1NBE B;  4AXI A;  2R7Z A;  1QAI A;  3LA0 A;  4I64 A;  2LFV A;  4QYR A;  4KH1 B;  3GTL C;  1TUG B;  3TVZ A;  2YWK A;  2KI2 A;  1FX4 A;  4A3J K;  1RTD B;  3HHL C;  2Q1L A;  2ZZT A;  3O1L A;  2J0X A;  1E6Y B;  3KK1 A;  5GMD A;  4R0E A;  4LF5 J;  5DZ7 A;  4A3C K;  2KFY A;  3EGV A;  1YRU A;  1L3V A;  1JQW A;  1JVI A;  2H5J B;  3ADA C;  4RW9 A;  2VC1 A;  4GKK J;  4MQ9 A;  5G4D A;  1WHV A;  2GQQ A;  3SFU A;  2MY8 A;  3S15 K;  1FRM A;  1VJQ A;  2GNK A;  1Q82 T;  2GX8 A;  3J7Z 5;  3W2V A;  2B7C B;  3S6E A;  2CQD A;  2BVZ A;  2AHO B;  1KVK A;  3QJJ A;  4WYL A;  4O4G A;  1XR7 A;  3GV5 B;  2GGP A;  1U1N A;  3UD3 P;  2YNH B;  4B3T J;  5TJ3 A;  4R5P B;  1JKH A;  4GTD A;  3G8Q A;  3C6U B;  1N33 F;  4OYZ A;  3KHL A;  1RAF B;  1YTY A;  3W3S A;  3GTY X;  1JWW A;  1RWN B;  4C3H K;  4LF9 F;  3DMJ A;  2YKP A;  4KC6 A;  4NZ7 A;  4DV4 F;  2A1B A;  4NLR A;  3NKY A;  4OIX A;  1NDC A;  1OSC A;  3QFW A;  4RNM A;  4UQG A;  2Z56 B;  3BV8 A;  3KHR A;  5HMY A;  4OJH A;  4DR6 F;  4C6A A;  1O0P A;  3D0G E;  3GTP K;  4DV2 J;  3R5J B;  3J81 Y;  2FVP A;  1TL1 A;  3NCQ A;  4BLA A;  3BPS P;  1T94 A;  4WKY A;  5IYD C;  3BQ1 A;  3KHH A;  3UDC A;  5HQM A;  3WX8 A;  3HJF A;  1WOP A;  4ZP6 A;  3OTE A;  1WC4 A;  1IWA A;  1YX2 A;  1U1M A;  1H6K X;  1RWK B;  4ES3 A;  3OHB A;  3FSX A;  1X4C A;  2RQC A;  4KTQ A;  1PG5 B;  1HNZ J;  3W62 A;  4GZY A;  3SQG A;  2WB4 A;  2LEC A;  2VUM C;  4UOC A;  1F1B B;  4CRJ A;  2DNY A;  1IQ0 A;  1XIQ A;  4LVO P;  4NLT A;  2PDA A;  2CJY B;  3RB0 A;  1UV7 A;  3G6Y A;  2C3M A;  2MGZ A;  3I9V 9;  2YNF A;  4DSE A;  3LAL A;  2GVZ A;  3N6M A;  1S9G A;  2YKM B;  3V4M A;  2RDI A;  4NYP A;  3P96 A;  5J2M A;  1AB8 A;  1NJX A;  3PIO Q;  3RAM A;  4A8Y A;  2IDE A;  5IOQ A;  3EVO A;  4G1P A;  1IBC B;  3BP8 C;  1NME B;  2OMO A;  2KHC A;  2JVO A;  4BDP A;  3K5N A;  1LQ9 A;  5CHC B;  4DG1 B;  3RBZ A;  2VUG A;  2E1C A;  3T00 A;  2OPR B;  2LXU A;  3V81 B;  1RKI A;  4Q0B A;  1IW7 A;  2VFR A;  1RA7 A;  3I82 A;  1Y1W C;  5KG6 A;  1HR0 F;  3MR2 A;  4YFK A;  5L9N A;  3PAC A;  3LQV A;  4Q2L A;  4OI3 A;  2DGO A;  3FQL A;  4WF9 Q;  4NXN J;  5KFO A;  4DSI A;  2JDJ A;  2LQ5 A;  1JJC B;  2HNZ A;  2XHC A;  5B0B A;  3V2U C;  2QLB B;  2VOO A;  2ZJR Q;  3IFE A;  2GCF A;  2IM0 A;  2AJ4 A;  2EFG A;  5BYS A;  2P8T A;  2J8S A;  3D6H B;  1H98 A;  3HOW C;  4I2P B;  4CLZ A;  1FI4 A;  3KJN B;  5B0F A;  5EWE A;  3AQP A;  2WK4 A;  1S1T B;  1Q86 T;  2MZQ A;  4DR4 F;  3EGW B;  2XMJ A;  1BMQ B;  3GTM K;  5KG5 A;  3M2R A;  2J6S A;  3VZH A;  1QSY A;  4WWS A;  3TA1 A;  4GO5 X;  2F5G A;  2CYY A;  2DGU A;  2QG9 B;  1NPP A;  3MEC B;  3VVT A;  2MKC A;  4KO0 B;  2RJZ A;  4U67 Q;  1YHQ S;  1AYE A;  2GW8 A;  2AJ0 A;  1MWY A;  2CXE A;  4EU0 A;  2WVF A;  2NXJ A;  2VJV A;  2HZC A;  3N01 A;  4W98 A;  3ET6 A;  2VA2 A;  3OL7 A;  2FHO B;  1X4G A;  1XJW B;  2ACM A;  2BKP A;  2HNY A;  3DHX A;  3MEE B;  3H42 A;  2MMY A;  2HK3 A;  5J1E B;  3EVM A;  3KLF A;  2BA9 A;  4P2F A;  1U2C A;  3UR0 A;  4NLX A;  1FKP A;  4EO6 A;  2UVV A;  1RT4 A;  4NML A;  2LYV A;  4GRS A;  1DQ9 A;  2RH6 A;  3DLE A;  2HFU A;  3CPW R;  3DDN A;  2AWZ A;  2JA7 A;  2OEL A;  2UXB F;  1B4S A;  2R8I A;  3EXY A;  3CCL S;  4QJV A;  2J8A A;  3VVU A;  4X6A C;  4LFC F;  1VQ4 S;  3CQZ C;  3M05 A;  4Y00 A;  1Y5I B;  1K83 A;  2R93 A;  2YPZ A;  3UWT A;  5IWA F;  5CH7 B;  4CO1 A;  4L76 A;  3QMQ A;  2DNH A;  1UA0 A;  1TWF C;  2NZC A;  4PR6 A;  2D3O 1;  3AH6 A;  2FVR A;  5E3C A;  4QWB A;  1CBK A;  1HYS A;  4I4B A;  1TWG C;  5EX0 A;  1I6H C;  1VLO A;  3IS9 B;  1D3W A;  4K4Y A;  1SFO A;  4KRW A;  2UUT A;  1WUU A;  3KJV A;  4ICL B;  4TVA B;  4RWW A;  4ZMM A;  4XK8 C;  5I3U A;  1PSD A;  3MCM A;  1XNR J;  2Z2Z A;  3HKW A;  3EGZ A;  1FD2 A;  4X4P A;  3MEG B;  1DHM A;  3K7R A;  3TRG A;  3J80 U;  1HBM A;  1GE9 A;  3VAG A;  2IMW P;  1GMW D;  1KHV A;  4B02 A;  2GIF A;  2OEJ A;  3B8H A;  1FTR A;  4KB2 A;  2GHP A;  1T9U A;  3SQO P;  2E29 A;  1DQA A;  3D2W A;  2JEJ A;  3MMC B;  4G7O A;  2PI5 A;  4TY8 A;  1TWH K;  4IFV B;  2VL1 A;  4A3K K;  1CJV B;  1N34 F;  1RT1 A;  2HWT A;  2IFX A;  4HDG A;  4DUZ F;  2OJ3 A;  2R2S A;  3PRV A;  1F7V A;  4ECS A;  4J9R A;  3S0X A;  1Q8B A;  4GKJ F;  4DR5 J;  5B09 A;  4ZP9 A;  5KG0 A;  2VFV A;  2B63 K;  2ZM6 J;  3OTD A;  4I56 A;  2GV1 A;  1R0A A;  2E2J K;  4ZS6 A;  1H73 A;  3CD0 A;  1PYO B;  4PXC A;  4L75 A;  4XLN A;  3VGS A;  2Z58 B;  2W4C A;  3MR7 A;  3ZTS A;  5DDO C;  3RB3 A;  1I3Q A;  1S6Q B;  4ECQ A;  2W4P A;  4GT9 A;  1QVF R;  3POT A;  2UUA J;  3M6W A;  2QA2 A;  3MOJ B;  4CZC A;  4Y52 C;  1HMV A;  1KLM A;  1HNV A;  2HBR B;  4RW8 A;  2GHV C;  1TWC C;  5KAK A;  3BN7 A;  2P9C A;  1HD0 A;  4JI6 J;  4M8L A;  3SCJ E;  2BJ7 A;  4NLO A;  4BBS C;  1WG5 A;  4PWU A;  2JZ5 A;  3M6X A;  1QM9 A;  4DXL A;  1DCP A;  3HSJ A;  2LMI A;  1BQM B;  1HWK A;  1RAH B;  2AX0 A;  3Q8S B;  3KG4 A;  3CC4 S;  1ELO A;  3QLH B;  4WFA Q;  4ZHR B;  5EDW A;  3RBD A;  5G0R B;  2V67 A;  5J1P A;  3DLJ A;  2JFK A;  2XMU A;  4QWC A;  1S1U A;  4OHX A;  3NBP A;  2PGC A;  2PMW A;  3A3N B;  3S1Q C;  4N8O A;  1RKJ A;  2HVZ A;  4NI2 A;  3O2I A;  1KVI A;  3HOY K;  3CCQ S;  1F9H A;  3V6H A;  2YNG A;  3TAN A;  1AT1 B;  3RZA A;  3UN3 A;  4K4V A;  4IH6 A;  1PKU A;  4FKY A;  5DJB A;  2W7P A;  5F9N A;  2ZE2 A;  1UJ6 A;  2DH8 A;  3NGU A;  4H4K A;  4KSE B;  3Q22 A;  3KYL A;  4J3N A;  4DQQ A;  3MED B;  2VJU A;  2E5L F;  3QJL A;  2VG5 A;  3G82 B;  5M2U A;  2R92 C;  3OPK A;  2L3M A;  3W2W A;  5KFU A;  3UNG C;  4Q8E A;  3K7A C;  2CDR B;  1HBO B;  1XZP A;  1S1W A;  1UFL A;  1TWA A;  1HNI B;  4DV7 J;  1RTJ A;  2PFF B;  1BUX A;  3ETO A;  2R2R A;  4B3M F;  5C25 B;  4A8O A;  4ZVR B;  4O23 A;  1S4F A;  2XC9 A;  2OKQ A;  5H9E J;  4F7V A;  4EI2 A;  5A76 A;  5D8H B;  3SEO A;  2O1P A;  4N5S A;  4X2B A;  9ATC B;  4CM2 A;  3S17 C;  3SZY A;  3I4N C;  4M1K A;  5FLM C;  5A8K B;  3ZC4 A;  4F36 A;  3DGV A;  3I4P A;  4J9U E;  4LF5 F;  2AF6 A;  1F9N A;  3PM9 A;  2OSQ A;  1UCN A;  3PO2 K;  4TNO A;  2V6S A;  3KLI A;  5JFE A;  4GKK F;  1YIT S;  3NAH A;  3EQL A;  2D3Z A;  4AL7 A;  4ZJO A;  1IJE B;  3WIV A;  4I7F A;  5KOX A;  4EWT A;  4TU9 A;  3PEH A;  4A8K A;  2LDI A;  3G9C A;  3J81 U;  3EDQ B;  1NUE A;  1YQH A;  3FEX B;  2V8G A;  4YFU A;  1OYD A;  3KK2 A;  1F0X A;  2W9B B;  1SQE A;  4BCA A;  2VON A;  4WBF A;  3UVJ A;  5C3E C;  2BQR A;  3DLH A;  2XWY A;  4B3T F;  4F4A A;  2A6M A;  1B4A A;  1NKB A;  1M90 T;  2V4J A;  2IC3 A;  1PIL A;  2M4M A;  2NVX A;  4BY7 K;  2HKE A;  3L7U A;  2Y1R I;  2V4R A;  1H7W A;  3IGN A;  2BAN B;  1IQZ A;  2C2O B;  1KQK A;  4V19 J;  1SJF A;  2BJD A;  1K83 K;  2R93 K;  1SUQ A;  1H72 C;  1G7C B;  1S59 A;  4C11 A;  4A3M K;  2Q79 A;  4P71 A;  5KT3 A;  1U1R A;  3M8Q A;  1N0V C;  1DTT B;  1VRU B;  3BGR B;  1FO1 A;  4ANC A;  4I1T A;  5HAT A;  4WZM A;  1LWE B;  4P74 A;  1SFO K;  2B6A B;  2MEW A;  3PKY A;  3S2H C;  1X5T A;  1S9F A;  3M2V B;  2V2Z A;  5A8W A;  3AOC A;  3TJA A;  4ZIW A;  1S0M A;  2HHQ A;  1WOR A;  4CO0 A;  1ZXO A;  1WC6 A;  4KFB A;  4NYO A;  4C3J K;  2J7W A;  1UEV A;  2N4D A;  4FF1 A;  4UOG A;  5DO2 A;  1HNZ F;  4KDD A;  4ATN A;  1G1X A;  5E3P A;  3KLE A;  2JC1 A;  3BQ0 A;  2VG7 A;  4K59 A;  5F8I A;  3HOX C;  3TYT A;  3R6G B;  3F44 A;  1BJT A;  2KM8 B;  3W61 A;  5K20 B;  2PI4 A;  2FLO A;  3GTJ C;  2RF2 B;  2RU9 A;  4MTP A;  4RNF A;  1MU2 B;  4N56 A;  1MWQ A;  3MMA A;  3DM2 A;  4P5A A;  1ARO P;  2ZVS A;  3I55 S;  3KDO A;  2B43 A;  4CO2 A;  2MLZ A;  5M5W K;  2F65 A;  3C16 B;  2V2V A;  3S01 A;  3PVX A;  3JTP A;  4KAT A;  3DLK B;  3GIR A;  3H20 A;  4GVL A;  1S97 A;  4QPT A;  2CQB A;  2BW7 A;  2JX2 A;  4LFA J;  1DZ5 A;  5F8J A;  4F25 A;  5DZ6 A;  1VQ6 S;  3PFO A;  2KRB A;  3ENA A;  1LW2 A;  4O3R A;  1PC5 A;  2AYG A;  1YZ6 A;  1BXN A;  3RBE A;  1RXO B;  4LR8 A;  3I4M K;  2DEJ A;  1HI9 A;  2NXE A;  1FFW B;  2F3J A;  1LW0 B;  3BQ2 A;  1SVD A;  2XNQ A;  1I3Q K;  2M7S A;  2D9O A;  2CZV C;  4ZLN A;  3C14 A;  5J2Q A;  1JLF B;  1JLG A;  1OQ6 A;  4NXN F;  2K1R A;  1N6Q A;  4ZJQ A;  4QIW L;  2E7W A;  3B82 A;  3NXZ A;  1QD1 A;  3QT5 A;  2OLW A;  2HWH A;  3IG1 B;  3ENQ A;  3BSO A;  2XB2 D;  1S12 A;  2GMH A;  5J2N A;  4DJB A;  2BJ3 A;  3ZZU A;  2EPI A;  5IYB C;  4DR7 J;  2ZOG A;  3H8Y A;  3JB9 k;  4URQ U;  1HNW J;  2LA4 A;  2ZNZ A;  2ZH5 A;  2H9Z A;  4P9S A;  3MDF A;  1FNO A;  1WQG A;  1KQF B;  5FDL A;  4M5N A;  3R5D A;  3CF5 Q;  2FHK A;  2C3U A;  4EBD A;  3HI9 A;  3M6U A;  3SMZ A;  4F50 A;  4QYZ J;  4LBH A;  4C3I K;  4Q45 A;  1JXE A;  2HQC A;  4F67 A;  5IT4 A;  4CO5 A;  3KK3 A;  3NNC A;  1JLB A;  4J9M A;  2EW9 A;  1ZVU A;  5CA5 A;  2XUL A;  4KHP J;  1SH0 A;  2DY1 A;  4LF8 J;  1K47 A;  3I32 A;  1QTM A;  4OI1 A;  5ETS A;  4H4O B;  4ZIV A;  2OEM A;  2VBW A;  2JSX A;  1BD6 A;  3IN5 A;  4RNN A;  2DIU A;  3NUH A;  4CT8 A;  3F0N A;  4NX9 A;  4WXW A;  1FD8 A;  3M2U B;  4ECT A;  3HUL A;  1VRQ C;  3R7N B;  1AFI A;  4QR2 A;  2WVE A;  1JB0 C;  4P7T A;  3OL9 A;  3L3C A;  3GEE A;  4NOI A;  5IYC C;  4X65 F;  2HFS A;  3MR6 A;  1TR0 A;  1O2A A;  1VQS A;  3PYE A;  4OYO A;  1YJ7 A;  2ZUG A;  3OT9 A;  4QIG A;  5F8N A;  5CZX A;  1VOM A;  2F9J A;  3EMT A;  4RO0 A;  1QTN B;  2J9D E;  1FA0 A;  4H4M A;  2KM8 C;  2MXY A;  3BSN A;  1KQS R;  3MOZ A;  4XIU A;  3K5O A;  3N5B A;  3ENW A;  5GAH I;  1DLO A;  3MCS A;  2KB2 A;  2JA6 C;  4LQY A;  5HLF A;  5C4J K;  4TU7 A;  1XNR F;  1YJN S;  3HF5 A;  1F9E B;  1OWX A;  3N9U C;  4ZN1 A;  5KFY A;  3H4D A;  1GXL A;  2D3O R;  1UTA A;  2LEB A;  1CS4 A;  2KO1 A;  4K4U A;  3NNA A;  2MQP A;  2N7C A;  4KB4 A;  4HH0 A;  4UOF A;  3M30 A;  4KAS A;  2BZ2 A;  5CHP A;  2DO0 A;  2YU9 A;  5JJB A;  2XS7 A;  1Y1V C;  4K2X A;  1Q8L A;  4PG8 A;  2AYE A;  3HM9 A;  2MQ8 A;  2XMK A;  1IM4 A;  2X1F A;  1WC5 A;  1HBN B;  1OPZ A;  2XY7 A;  3WQP A;  2J5A A;  2RT3 A;  2R7S A;  1RAA B;  2C3P A;  1BWV A;  1X31 C;  4L3K A;  4LIW A;  1VQK S;  3KLH B;  2BRL A;  2JL9 A;  2UU9 J;  4DR5 F;  1LXJ A;  2X1A A;  1HQM A;  2ZM6 F;  2X3D A;  6FDR A;  3TO8 A;  3MAA B;  3T19 A;  1KTV A;  2IRY A;  2W8K A;  2ZDO A;  4NLG A;  1MRO A;  3SSQ A;  2ZOM A;  3L4K A;  1N5Y A;  3CCM S;  4Y7N C;  5B0C A;  3MM5 B;  1TK0 A;  3OJU A;  2AMC B;  4X4N A;  2RKI B;  1IKX A;  2AEJ A;  2L9N A;  5D3G A;  2VFU A;  4AFF A;  3FKI A;  5HBM B;  3VHQ A;  1FJE B;  4ID5 B;  4DWI A;  1HD1 A;  4ZJL A;  4ZVT B;  2Y1J A;  5FJ4 A;  3BYP A;  5ETP A;  4JI6 F;  1AB4 A;  1XZQ B;  5L9X A;  5GAD I;  4LJM A;  1AA1 B;  2IM2 A;  4OX9 F;  4CP5 A;  5KFB A;  3EDR B;  1U47 A;  5E33 A;  3GJQ B;  4OI6 A;  2HYI B;  2F4V J;  4QZV B;  1ZAW A;  3JAM U;  3MCN A;  4QWA A;  1R31 A;  2QT7 A;  4DR1 J;  3DRX A;  1XBW A;  5HSP A;  4Y2I A;  3KLG A;  4N8N A;  2EC2 A;  3ZZP A;  4UY8 T;  1FXD A;  3HHL D;  1KOO A;  1ZM2 A;  4ZKA A;  4G7Z A;  2QZ8 A;  3ZZ0 A;  3UCZ P;  3PW4 A;  3D66 A;  4FKX A;  5DDR C;  4EUV A;  3QGP A;  2RHQ B;  1RGV A;  1LK7 A;  1VBK A;  4Q5S A;  2GJF A;  4DPT A;  1L3U A;  1ZPV A;  2F8M A;  2V9W A;  4NCB A;  1VJW A;  3CW2 C;  5IS2 A;  4HKQ A;  1JK9 B;  1IKY A;  3AA8 A;  2HWI A;  1SB6 A;  4Y2K A;  5FLX U;  4NLS A;  2XMV A;  1RAO A;  3RW6 A;  4KGX B;  1AZS A;  5KTQ A;  1W2B R;  2UUB F;  2NPF A;  3VV2 B;  3PV8 A;  4ZPC A;  1SH2 A;  3CJK A;  2W25 A;  4HI2 A;  4ZIT A;  3BDE A;  5M5Y K;  4QQB A;  1LXN A;  3R5A A;  1MMD A;  5IFM A;  4F4W A;  2DIV A;  2YQ3 A;  3CB4 A;  3GTQ C;  2MKI A;  3NOG A;  3BH6 B;  4RNO A;  3FEY B;  4HL9 A;  4R0J A;  2QJ3 A;  3DGP B;  4DV7 F;  1HQE B;  3W9I A;  3JSM A;  4K7Q A;  4WPA A;  3C2P A;  2HAF A;  1S5Z A;  5AE3 A;  2IY5 B;  1UAW A;  4FBT A;  1S6P A;  3QBC A;  3CTR A;  1MG7 A;  3N28 A;  4DCP B;  2HQF A;  4D3H A;  1EQ0 A;  2KG1 A;  4K2J A;  3PRB A;  2DGX A;  2JEF A;  3BZQ A;  1KR4 A;  1S76 D;  2HAI A;  2ZWP A;  4RX6 A;  2AGO A;  4IO1 A;  2V34 A;  3T9N A;  5LXY A;  3GTK K;  4UZB A;  2B8P A;  4RW6 B;  4I0W A;  2KFZ A;  2UUW A;  2CVI A;  4O3P A;  3V6K A;  1JNR B;  5F8G A;  1T9W A;  2G2O A;  2Y8W A;  1BS2 A;  2ILZ A;  2FJV A;  4L6V 3;  3D3C J;  3QGI A;  4ECV A;  4WU3 A;  4ZCM A;  4OIR A;  1RE1 B;  2GA7 A;  4OHW A;  1OY8 A;  2AJ2 A;  1UJ4 A;  2L08 A;  5CXT A;  1HWL A;  4USU A;  4KIA A;  1FJG J;  2LQ9 A;  1SJ1 A;  3R2C J;  2MZT A;  3K8V A;  3OXF A;  2V6A A;  4A3F K;  1R0C B;  1T9Y A;  3D67 A;  3UCG A;  4B3O A;  3T1H J;  4NL5 A;  1YBA A;  4RW4 B;  4A3C C;  3N6L A;  3FCH A;  1R89 A;  1VQN S;  1X4E A;  4DSF A;  8RUC A;  2CNO B;  2HBQ B;  4PPD A;  1H38 A;  1HFE L;  4ED1 A;  1M0S A;  4LRB A;  1NSP A;  1S72 S;  2CQ2 A;  4OZJ A;  4WFB Q;  4JP8 A;  1EIY B;  2B0G A;  2ACY A;  3S15 C;  2RE1 A;  4DL3 A;  1ZQ1 C;  3M9M B;  3S1R K;  2W7O A;  5SZT A;  2CAD A;  3A1Y G;  2J9D A;  3DDK A;  2JEG A;  4IO9 Q;  3ITH A;  1EJ7 L;  3BUE A;  5T7L B;  1U02 A;  2VC0 A;  4PZV A;  1SC4 B;  1F2G A;  2MKY A;  2VPX B;  3VAH A;  4F3O A;  3BGU A;  4IKA A;  2YXL A;  5I42 B;  4DR3 J;  4LIR A;  2YWG A;  3FCW A;  4UF4 A;  4UOH A;  4J9L A;  1USM A;  4WK3 A;  3ZZZ A;  1T7P A;  2XHW A;  1BLU A;  1YCL A;  2WSF C;  1FDB A;  1N0U A;  4C3H C;  3VTI A;  2FJA B;  4ERD A;  3DXJ A;  3FOF A;  2NVY A;  3NGK A;  4B3S J;  2PII A;  4KJI A;  2YU9 K;  1ZH5 A;  3H2L A;  2FDN A;  2E2H C;  2XTJ P;  3W5X A;  3FDS A;  3TI0 A;  3LPY A;  1C4C A;  4UW2 A;  2ASJ A;  2MYF A;  2RHS B;  4PWD A;  1VK8 A;  3GTP C;  4IOA Q;  4HTI A;  4XCH A;  2HVE A;  1CJU A;  2KXH A;  3BJY A;  2XSF A;  5LL6 d;  1OIA A;  1U6Z A;  4LFA F;  3VR1 A;  2ZH9 A;  3TAM A;  3H2V E;  3BPD A;  5AJ3 J;  3V6D B;  4JI7 J;  2DNG A;  2RML A;  1LFP A;  3DRR B;  5KT7 A;  3I4H X;  1FE4 A;  4EGL A;  4KKO A;  4M5D B;  1UEK A;  1QE1 B;  2AEM A;  4BBR K;  2V69 A;  3SDE A;  1NKC A;  4CDI A;  3IM8 A;  2CQP A;  4LBI A;  4ECZ A;  2KT5 A;  1ZM9 A;  3KKF A;  3DFE A;  2YWF A;  3SXL A;  1TKX B;  1NSQ A;  2FZG B;  2Q6B A;  1DD5 A;  4Q43 A;  3DYA A;  4USH A;  2D41 A;  5F0W A;  1XMO J;  1TFY A;  3ILO A;  4F0K A;  1JLA A;  4C45 A;  4LRE A;  3TW0 A;  3KK1 B;  5CAB A;  4I69 A;  2H4Y B;  2POK A;  2HHT A;  2DNQ A;  3M8S A;  2WB1 D;  4MT1 A;  1WI8 A;  5IT9 Y;  3O8W A;  2ROE A;  1JJH A;  2ALZ A;  2XGP A;  4RW9 B;  3VGU A;  5DGA A;  1PYS B;  1TVR A;  1HNW F;  2QMW A;  2XCR B;  4C2M C;  3TEH B;  4DL2 A;  3TR5 A;  1B64 A;  1Q0N A;  3I0S B;  3M8P A;  3OTB A;  2CQG A;  2F7V A;  3GIJ A;  4C8Z A;  1CUL A;  4ID8 A;  4MKA A;  2F4F A;  1YJT A;  5E3R A;  4O4G B;  1N8R T;  5B0D A;  5E3Q A;  1Z2L A;  5L1J A;  3I5A A;  4F3M A;  4HEA 9;  3C15 A;  1D8Y A;  3KG0 A;  1RWX B;  4G6V B;  3KLV A;  4KHP F;  3HFZ B;  1K44 A;  1I6J A;  4LF8 F;  4FDF A;  1VC0 A;  2DGW A;  3EZO A;  4LSN A;  4FM9 A;  2MHE A;  3HVT A;  3P8B B;  4RWX A;  3THV A;  4C8O A;  1RUS A;  1I94 J;  4ZPV R;  4KGZ B;  2Z8Q A;  2BW2 A;  2FJX A;  3GTM C;  4PG7 A;  1FJC A;  2PSZ A;  3S16 C;  4O3N A;  2GO9 A;  3GR0 A;  4YFX A;  5H9F K;  3LAM A;  5D4P A;  5AE2 A;  1T0T V;  4BY1 K;  4BS2 A;  1VRT A;  3HD2 A;  1FK9 B;  1TL1 B;  3QSY B;  4IDK A;  4IG0 B;  4C3K A;  3MHY A;  3SZ2 A;  1WWH A;  3L09 A;  1VBX A;  3QQC D;  2HVI A;  3W5Y A;  1GAO A;  5D4D A;  2R8H A;  4TY9 A;  4A3D K;  3HOV K;  1SQG A;  4Y65 A;  3CCS S;  2M9K A;  1G51 A;  3A3O B;  4C9D A;  2I5J A;  3HOZ K;  4JI8 F;  4Z7C A;  2E1P A;  4C3L A;  4NE9 C;  1YNJ A;  1IWG A;  1LFW A;  2HFV A;  3NOC A;  5DET A;  5LSO A;  2WW8 A;  2CKW A;  2AV5 A;  1HWJ A;  2R4F A;  4YG2 A;  1FRL A;  2YNF B;  4A3B K;  1S9G B;  2DH7 A;  3S7R A;  2RD5 C;  3FZB A;  5FJ8 K;  2G2Y A;  3TAQ A;  5EGH A;  2VFS A;  2R7Z C;  2HZV A;  4BXX K;  3ONQ A;  3SBM A;  2VHG A;  4DUT A;  2CFX A;  4AE5 A;  2VUM A;  3EPG A;  4F04 B;  2WVC A;  3BKT A;  2R7U A;  1V5I B;  2HUR A;  2RVJ A;  4NCG B;  1JLQ B;  2E5H A;  5KFM A;  1CVJ A;  4NEZ A;  4Q0B B;  2PHC B;  4U6P A;  2UU9 F;  4QIW D;  1NKE A;  4DFJ A;  4KY3 A;  2XBP A;  4UQT A;  3LAK A;  5HN0 A;  2QLF B;  2YTC A;  1ACM B;  2UVR A;  1MN9 A;  4I2Q A;  1UW9 A;  3SI8 A;  2P6S A;  1Q4R A;  1U26 A;  2HNZ B;  3RRG A;  3ELH A;  4I6A A;  2ZUA A;  4HTJ A;  1SC6 A;  1FNX H;  5GAG U;  1FE0 A;  2N3L A;  1WTF A;  1RTD A;  1P6T A;  1B3T A;  1FEE A;  2CNN B;  3OUY A;  2CJX B;  4ECX A;  1EET A;  1Z4U A;  4PPZ A;  5LJ5 Y;  3T6B A;  3K5L A;  3DRP A;  3OFG A;  3QGH A;  2CNK B;  1Q16 B;  4YOE A;  2HQG A;  3VA7 A;  1BQX A;  3UPF A;  1Y3J A;  2JA8 C;  1RTZ A;  3W9J A;  5KG7 A;  1LWX A;  4FZV A;  3DKD A;  2F4V F;  4CLS A;  4DV4 J;  3QIP A;  2MJN A;  4CLK A;  2QSW A;  4DR1 F;  2NVY K;  1Q78 A;  3IRX A;  3QZ8 A;  1S1X A;  3G71 S;  1TKD A;  3THT A;  4ED0 A;  4JK1 A;  3ET6 B;  1SIZ A;  3HHD A;  3FUY A;  2OGU A;  1HBU B;  3RUB L;  1HKA A;  4DR6 J;  1RT3 B;  1UZH A;  2YNH A;  3KTQ A;  1PIE A;  1PAU B;  2HNY B;  4CH1 A;  1R8A A;  2L48 A;  1AW0 A;  3C6U A;  3QFH A;  3E3X A;  1FKP B;  4OX7 A;  2Z57 B;  1RT4 B;  2R7W A;  3LH2 S;  4CLF A;  2K7J A;  2EVZ A;  3DLE B;  2HGL A;  3DOL B;  1VQ7 S;  1NJI T;  4YN3 B;  1IKW A;  3OL8 A;  2VIC A;  1ULR A;  1WTB A;  2R8K A;  2WVD A;  3P45 B;  2GIR A;  5JUM A;  4FN5 A;  4KB7 A;  3VAL A;  4J91 A;  3AA9 A;  2KFN A;  1TL4 A;  4ED4 A;  4BC7 A;  2V8D A;  1UEU A;  2NVQ C;  3ISN C;  1TK8 A;  4QU6 A;  1UP1 A;  3OLB A;  3K5P A;  2WSE C;  4Z7Y A;  3SV4 A;  4B9V A;  1DQ8 A;  3WBZ A;  1HYS B;  4DSK A;  5CJ9 A;  3UR3 C;  2OPQ B;  2V63 A;  2H5E A;  1R9T A;  1K8A T;  3Q8R B;  2CJK A;  1VJE A;  4ZPA A;  1X4B A;  3BGL A;  5F8H A;  2AEF A;  2WON B;  5GAE I;  1WQH A;  5L1K A;  1TKT B;  5AXL A;  4BHQ A;  1H2V Z;  3P5T L;  5RUB A;  3A8I A;  1R0B G;  4AL5 A;  4XSX A;  2D69 A;  3DC2 A;  4TKT A;  3TUP A;  4M5I A;  3PKM A;  1GH8 A;  1BDF A;  3G4S S;  1L3T A;  1UVN A;  2RGR A;  1XXA A;  4MMO A;  2E2I A;  1EP4 B;  3G4C A;  1JLE B;  3GEH A;  3OR2 B;  1R43 A;  3GFX A;  3ZZY A;  3A8K A;  2C3Y A;  3J7Y I;  4ZVQ B;  2FJW A;  2HBY B;  4TY8 B;  2CQH A;  4CWB A;  5C24 B;  1XER A;  1N5S A;  4WP9 A;  1SC1 B;  2H54 B;  2MQQ A;  1TV6 B;  3MUV P;  4FVM A;  2QA4 G;  1VC6 A;  3NG8 A;  2DNK A;  2NLW A;  4ZP7 A;  3M4O C;  2CPJ A;  2I38 A;  1NU4 A;  2RDD A;  4USJ C;  4DG1 A;  2UV8 A;  2QSF A;  5KG2 A;  2A10 A;  1R0A B;  4YS2 A;  4RPF A;  1Y4Z B;  1FJG F;  2KWA A;  8ATC B;  2PEB A;  1U2F A;  2VKR A;  4LF4 F;  3JSB A;  2RUG A;  3PX0 A;  3JQJ A;  3TFI A;  3T1H F;  3NWR A;  2XCO A;  2Y0S D;  3POT B;  1GXT A;  3GJR B;  1HMV B;  2DTJ A;  2H3E B;  4MIW A;  2B3T B;  3IWL A;  4RW8 B;  3BO4 A;  1NK5 A;  3Q8V A;  3NGS A;  1RWO B;  2L41 A;  3MAQ A;  3CJ8 A;  3LAN A;  3U02 A;  3IAS 9;  4ZLP A;  2HFN A;  5KT6 A;  3KUG A;  5IZH A;  1S1T A;  4NWB A;  5A0Y B;  1SL1 A;  2CQI A;  3RR8 A;  3GSI A;  3ERE D;  2AJF E;  1C2P A;  1SH3 A;  1WHX A;  2YH0 A;  4KAW X;  3MEC A;  5EGY A;  3TUJ C;  3H0P A;  4DR3 F;  3H0G C;  1RAD B;  3KJQ B;  1RIS A;  5I4M A;  1EI6 A;  3C3L A;  1K1Q A;  3GIK A;  1S1U B;  2JA7 C;  4BY7 C;  5IYD K;  1TWC A;  3OXL A;  4NI2 B;  2LQ8 A;  3I6P A;  2IYI A;  4G0U A;  1AUD A;  1T9V A;  4PXD A;  3OW2 R;  3UN5 A;  4B3S F;  3BR8 A;  4HLB A;  3B4M A;  1U2R A;  4ECY A;  4ZLJ A;  4GVB A;  1K83 C;  2R93 C;  5J1N A;  3WDO A;  2Q3P A;  3ZZT A;  5J1E A;  1I5O B;  1SJ3 P;  2ZE2 B;  3IPJ A;  5HJY A;  1EKS A;  1J6V A;  2VUM K;  5HQL A;  1S49 A;  2ASL A;  1OO0 B;  4AL6 A;  2O66 A;  1U8S A;  1INN A;  1HLW A;  1UVL A;  1RWW B;  1NK4 A;  4CLL A;  4WJ4 A;  3EJM A;  3SSR A;  2YVS A;  2CA9 A;  1SFO C;  3W2W B;  2NXU A;  1RLC L;  5AJ3 F;  2K06 A;  4JI7 F;  2IAJ B;  2VPY B;  4RW7 B;  1S1W B;  2PMH A;  4C3J C;  4C8L A;  3PO4 A;  1O5J A;  3MMB B;  1V9O A;  3MM6 B;  2E5G A;  5CQG A;  2G0C A;  2ROP A;  1JX4 A;  3TUI C;  1EZZ B;  4N47 A;  4P10 A;  3GCX P;  3BN4 A;  3IS9 A;  4FXW A;  4DI6 A;  2Z30 B;  2J0Q D;  3OBI A;  1M5S A;  2J76 E;  4CLY A;  3PJW A;  3QPI A;  3ZTO A;  3T01 A;  2R7R A;  1XMO F;  2XMA A;  2LEA A;  1P9Q C;  1BGX T;  2JH3 A;  1U48 A;  4RU2 A;  1ZS6 A;  1J5E J;  4URS A;  4GKJ J;  3R1H A;  5ETN A;  4QW8 A;  4KV8 A;  2ABY A;  4A3E K;  3MEG A;  3KLI B;  3BP3 A;  1HNX J;  3IRW P;  1BE4 A;  3HOW K;  2J7U A;  1EX8 A;  5IC4 B;  1U1L A;  4K0K J;  1WD6 A;  1G4C A;  1H0H B;  4O4R A;  3U27 A;  3NCR A;  3LP2 B;  3MMC A;  5KFV A;  3Q23 A;  3KK2 B;  5LSR A;  4NEY A;  3R6L B;  4HHU A;  5EGE A;  4IFV A;  1U0H B;  2D7S A;  4CTA A;  3LAP A;  1I3Q C;  1CC8 A;  1CJV A;  2ZD1 B;  2YBV A;  2HQ3 A;  2XGQ A;  3VAK A;  1MNE A;  5HRO B;  1REV A;  1Z2Z A;  4NZ0 A;  3CDE A;  2BRK A;  1KNZ A;  2V4J B;  5LMN F;  2CPZ A;  5DG7 A;  1MMN A;  1OSD A;  2ZBC A;  1HHT P;  5C7P A;  3OSN A;  2ZEJ A;  1UVI A;  2ZWO A;  2NYI A;  2BXJ A;  3IM9 A;  2HHU A;  2MLX A;  3CD5 A;  4JI3 J;  1I94 F;  4ED5 A;  5C2C A;  5FII A;  1RT2 A;  3CSK A;  1KBR A;  1SMY A;  4C11 B;  4J9S A;  3G2X A;  4JI5 J;  4OIN A;  4QR0 A;  1SJ4 P;  3LAJ A;  2FUG 9;  2MST A;  2ZKT A;  3UFC X;  2IVY A;  3FBC A;  2EWH A;  3G6V A;  4DCO B;  4Z2X A;  2BKN A;  4ZCK A;  3NNH A;  2NYH A;  3Q8U A;  4XO0 A;  4JI2 J;  3D0I E;  3D9B A;  1R9T K;  4KC5 A;  1HWU A;  2MSS A;  4YY3 F;  5A8W B;  2X3G A;  2HND B;  4GC6 A;  3CQZ K;  4QR1 A;  4G1Q B;  4QIV A;  4A4J A;  2QLX A;  2I2Y A;  4PG4 A;  3QLH A;  4ELV A;  1X9S A;  4H4K C;  1L3S A;  1N5V A;  1WKJ A;  1TWF K;  3BGF A;  5G0R A;  1RU0 A;  3ULH A;  1UJ5 A;  1IBL J;  3TA0 A;  2VG7 B;  3VQS A;  5D0R A;  2E2I K;  1TWG K;  4PEO A;  4DPU A;  4O44 A;  1Y0H A;  2G13 A;  4AUK A;  4WIL A;  5CYM B;  1RI7 A;  3DM2 B;  2G2Z A;  4ILL A;  3LW5 C;  4OI0 A;  1X5S A;  1PGZ A;  4IQX A;  2BQU A;  4WIQ A;  4IFY B;  4F4Y A;  5D15 A;  3CJT A;  3S1M C;  1TWA C;  1FRX A;  4CNY A;  3S1N C;  4LFB J;  2PE8 A;  1E6V B;  1T3N A;  1I6V A;  4YFN A;  5T41 A;  2P5M A;  3MED A;  5M2R A;  2QL7 B;  1LW2 B;  4ZPD A;  2KU7 A;  4KMH A;  2Z0G A;  1DRZ A;  1Q81 T;  3OSP A;  3FMW A;  3N3Y A;  1VCT A;  4KN7 A;  2V4Q A;  1ZYQ A;  1ZBT A;  1FJ7 A;  1HBO A;  2I0X A;  4ED8 A;  3D28 A;  1D9F A;  1HNI A;  1IBK F;  2CQ1 A;  3TZW A;  3L9Z A;  1CJK A;  3C14 B;  5C4J C;  5K5M A;  5C25 A;  2IPO B;  4QIE A;  1R8B A;  3ZNU A;  5B08 A;  1K0V A;  5ETQ A;  1N88 A;  2NSC A;  1C0U B;  3DXB A;  2JNJ A;  4IG3 B;  3FMB A;  4ER8 A;  1Z1Z A;  2B9W A;  2IJF A;  2VBY A;  3T5J A;  3Q2S C;  4LMZ A;  1S0O A;  3IA0 A;  1Q79 A;  4RU9 A;  2V2K A;  4HHJ A;  4CLP A;  5A8K A;  4F2R A;  3MD3 A;  1TWH A;  2CNL B;  2VAS A;  2M8H A;  1W26 A;  3K59 A;  1IUJ A;  2OI2 A;  4HT5 A;  3O5T B;  4IH5 A;  2AT1 B;  1QAY A;  3PO3 K;  3Q0A A;  5F8M A;  3AXM A;  3V4I A;  4ZVG A;  1I50 A;  4Y52 K;  3ZZO A;  2QMX A;  4ZVE A;  4DV1 J;  2HS3 A;  1USO A;  2NVX C;  3H3V L;  2B63 A;  1TWC K;  4B9T A;  2QMU B;  2VG6 A;  4WTO B;  2CWX A;  4DHV A;  3A4T A;  4BWM A;  1VLY A;  3OLA A;  2DNZ A;  4A8X A;  3GU0 A;  4BWJ A;  4I67 A;  2W9B A;  3RG6 A;  3KK3 B;  2P2C B;  1QDU B;  2BE9 B;  4M95 A;  2XI2 A;  3NMR A;  3PRD A;  5IV3 A;  3E2E A;  2BQ3 A;  1VBZ A;  2XMW A;  3DRS B;  2BX6 A;  2GSU A;  2MQM A;  2M8D B;  4O3S A;  3AD7 C;  5IP7 K;  2R8G A;  4Y6I A;  1OS5 A;  3D68 A;  2BAN A;  1WIH A;  2V6T A;  4CI0 B;  1GK8 A;  1ZTT A;  3Q8Q B;  3UW1 A;  1AFJ A;  1NPK A;  3NS5 A;  4CT9 A;  2EEY A;  5F0U A;  2C2M B;  4KAI A;  3TVY A;  1N36 J;  3GR1 A;  3T3F A;  2IVF B;  1IKV B;  1TL3 B;  4P7V A;  1DTT A;  2GAG C;  2IYG A;  2QX0 A;  2RQK A;  1VRU A;  4OX6 A;  4EMD A;  4CH7 A;  4CH0 S;  1MLA A;  1N56 A;  4LK1 A;  1Y9O A;  2F40 A;  2XI3 A;  2E9Z A;  3DHW C;  4YEA A;  4KBI A;  1ROF A;  1K73 T;  1NJZ A;  2P9G A;  5CAA A;  2B6A A;  3N79 A;  2IRX A;  3K17 A;  1SBR A;  4MKV A;  3WX4 A;  1KVJ A;  3M2V A;  4DFP A;  4DR2 J;  1X4D A;  4PAB A;  3K7A K;  1SI9 A;  2VA3 A;  1X9M A;  1DLO B;  5DG8 A;  2C22 A;  4BLB A;  2KTQ A;  5EWF A;  2GFF A;  3R1L A;  2KH9 A;  3BDP A;  4GTA A;  1FEH A;  3CT9 A;  2V8P A;  2J9C A;  3BEG B;  3HX9 A;  4AQY J;  3CNQ P;  5CYQ B;  5HP1 A;  3O44 A;  4S0M A;  2PMZ D;  2KYX A;  1WHY A;  1NSA A;  4DV5 J;  4DFM A;  5M5X K;  5F8L A;  2RRN A;  3JS9 A;  5LJ3 Y;  2QGF B;  1CS4 B;  2RF2 A;  2O67 A;  5E68 A;  3LPX A;  1HW8 A;  1MU2 A;  3S17 K;  5FLM K;  4KPC A;  4LRF A;  4DX8 H;  1R8P A;  3QAE A;  2XLI A;  4BC9 A;  3ENV A;  4TLR A;  2CJ9 A;  2FZK B;  1QSL A;  4LSL B;  3D5M A;  3PHE A;  5HVH A;  4DLG A;  3EZ5 A;  3UCU P;  1CC7 A;  2MQO A;  4R8U B;  2DGQ A;  4M1X A;  3EM1 A;  3H5S A;  1Q8K A;  3D4J A;  4W90 B;  2BUN A;  4U96 A;  3GB0 A;  3ISZ A;  3GPA A;  4A46 A;  4U7C A;  2YH1 A;  2MKH A;  3M8Y A;  2ZFH A;  3UDE A;  5DDQ C;  1MRO B;  2ZZM A;  1T05 B;  1IR2 A;  3OFF A;  1W25 A;  1WC3 A;  4WP3 A;  3M32 B;  1JLF A;  1PJ6 A;  1Q95 G;  3FZ2 A;  3CO0 P;  1TAU A;  1RJJ A;  2KT2 A;  3QSI A;  3JYT B;  1CQM A;  1LEO A;  5HL7 Q;  2HPU A;  1T8E A;  1FDD A;  2BJ9 A;  3O6Q A;  2IJN A;  3PHT A;  4RUH A;  1M5P C;  1MSW D;  3K58 A;  1VIO A;  2KYZ A;  4ZLL A;  4RBU A;  4J90 A;  4A8Q A;  1DTQ B;  4RBT A;  2GQ2 A;  3FVY A;  3CDU A;  3WHI A;  3VGT A;  1YIJ S;  2OTL S;  5J2P B;  3ZFV A;  2KDO A;  2C3O A;  3NMA A;  5B0G A;  3T5L A;  3QT8 A;  4PXE A;  1YSJ A;  4C98 A;  3H7H B;  1F7U A;  1X4F A;  5D0G A;  3BS9 A;  4DX5 A;  4CYU A;  3D6F B;  1VS3 A;  4A3F C;  4X65 J;  2HW3 A;  3S2H K;  1KEK A;  1RK8 A;  3WOD A;  3ZO7 A;  1K0T A;  1O51 A;  5EX3 A;  1TMM A;  1RT6 B;  3HVW A;  1J2V A;  1VMB A;  2QV6 A;  3IMQ J;  2GO8 A;  4DL5 A;  4K4X A;  1VQ8 S;  2N3O A;  1UPP A;  2CG4 A;  2AGQ A;  4DL6 A;  3CCR S;  4LRA A;  4UUW A;  3LWM A;  2HFZ A;  3HOX K;  2V2Q A;  2U1A A;  3GYG A;  4N41 A;  2XYP B;  2HSE B;  5L38 A;  1O24 A;  5A2Q U;  2WTF A;  4FYY B;  4CCH A;  3CJK B;  2B4U A;  1KOH A;  5C44 C;  1EB0 A;  3G4A A;  2KHD A;  3T1A A;  2W7V A;  3GIL A;  4BKW A;  2UUC J;  2FZC B;  4XDC A;  4A3G K;  4FYX B;  3PX4 A;  3V4G A;  5DG9 A;  4C48 A;  2DCU B;  4YP3 A;  1XR5 A;  2I1R A;  4KT0 C;  4ILD A;  3HZG A;  2XLJ A;  4I6W A;  2ASD A;  2DNL A;  4ES1 A;  1J6W A;  1S6P B;  2CJB A;  2LU1 A;  2GVD B;  3MPU B;  4LF1 A;  4DCJ B;  3EIC A;  2RU3 A;  2L9D A;  1RT5 B;  1S7H A;  3M1V A;  1RSC A;  1F5A A;  1R8H A;  3UD5 A;  1I50 K;  3OFH A;  3CD7 A;  1J5E F;  1FKO B;  5E3A A;  2NVT C;  1LKZ A;  1S4E A;  3Q8P B;  2XEX A;  3KG1 A;  1F6T A;  3H25 A;  5HJX A;  1UVK A;  5A6P A;  1EH1 A;  2PO4 A;  4F02 A;  1HNX F;  1PAE X;  4F2S A;  3IR7 B;  3HSD A;  2HGN A;  5IYB K;  4K0K F;  2QN6 B;  1FTC A;  3LGH A;  3T41 A;  4BBR C;  3IBC B;  3TAR A;  2ATL A;  4DQR A;  2FHJ D;  4KM9 A;  4XLP A;  2DGV A;  4KGV B;  3UE2 A;  5KFS A;  4GC7 A;  5I3P A;  3P3D A;  3SCL E;  3FHZ A;  1C1C B;  3KLH A;  2YWW A;  1RWV B;  1Q1K A;  2OFH X;  2XSJ A;  1GXU A;  3FKI C;  1UPM B;  5BXI A;  4K4S A;  4K50 A;  3MEK A;  4OX9 J;  4CO3 A;  3HHN B;  3GTG C;  2E1A A;  4MFB B;  2R3V A;  4QW9 A;  4EZ6 A;  2E9R X;  2HQD A;  5K8O A;  2FIU A;  2N4C A;  3PW5 A;  2B4V A;  2ZHO A;  5LOQ A;  2DXD A;  3OR1 B;  4D3G A;  4WK1 A;  4F4K A;  1UFW A;  3UQS A;  3GG1 A;  1RBA A;  4JI3 F;  1YDL A;  2YKO A;  4K4W A;  1QLN A;  1VK3 A;  2YNI B;  1S9E A;  2QFI A;  3ILJ A;  2DR8 A;  4JI5 F;  2C28 A;  1UWB B;  3J7A 1;  4IH7 A;  5C4X K;  2KT3 A;  2EK6 A;  5HBM A;  4Q8F A;  2BMB A;  4ID5 A;  4NPO A;  5HAO A;  1F60 B;  3S2D K;  3BKF A;  1RU2 A;  4JI2 F;  1U1Q A;  1XZQ A;  2GSN A;  1S1V B;  3I9Z A;  5DGB A;  5IOR A;  3C46 A;  2XCA A;  4HT7 A;  1URN A;  4A3I K;  4JI0 J;  2GC8 A;  2M88 A;  4BBY A;  3FFI B;  4A8W A;  4DX6 A;  1U09 A;  1SIW B;  3I96 A;  3H5U A;  1JOE A;  1S79 A;  1VC5 A;  2B9E A;  3MM7 A;  1PJ5 A;  2UUB J;  2FD2 A;  1QJH A;  4NLQ A;  2KRR A;  2R7Q A;  1IBL F;  2QLW A;  3LP1 B;  3R5G A;  2B4O A;  3X3U A;  5SUH A;  1HQU B;  2BKO A;  2M5Y A;  1SL0 A;  2NR0 A;  5EHH A;  1TMJ A;  2LLZ A;  1NRK A;  3H98 A;  3JAM Y;  2CAJ A;  3Q86 A;  3RYL A;  2X51 A;  4ZPW R;  4JYA J;  1F9F A;  3GMG A;  3HKZ L;  3PW2 A;  3DOM B;  4NXM J;  4ED2 A;  2WBR A;  8AT1 B;  2NXC A;  2E9T A;  3BH7 B;  4BY1 C;  4LRC A;  4PKD B;  1RHR B;  1IN0 A;  1YRX A;  4B9L A;  4LFB F;  2DH9 A;  2PN6 A;  4LUB A;  2R8J A;  4USK A;  4V19 X;  1N5T A;  3CC2 S;  2QFJ A;  2BAC A;  4JV2 A;  1WCM C;  1CJT B;  1YG0 A;  2OPP B;  2ZHB A;  2W9C B;  2B4P A;  1VHI A;  2PEH A;  4A3D C;  3TOQ A;  3HOV C;  3IP0 A;  1FKA F;  4KKO B;  3WC0 A;  1YZ7 A;  3DOK B;  1EAR A;  1AUS L;  5B0E A;  5FLX Y;  1RB0 A;  4YB5 A;  2KZM A;  3HOZ C;  4P2X A;  3CIZ A;  3LGN A;  4QBU A;  3DCA A;  3G86 A;  4IRC A;  4YR2 A;  2G1H A;  2BEF A;  4USW A;  1HQE A;  1UET A;  5KFA A;  4NA1 A;  2IVM A;  4OYP A;  1NEE A;  4A8S A;  3RU0 A;  2WB1 L;  4FXV A;  4X84 A;  4MAK A;  1T95 A;  3QO9 A;  2MZS A;  1U25 A;  1GX5 A;  3Q2T C;  2U2F A;  1PYT A;  4PQU B;  4BXX C;  4OZ2 A;  4P73 A;  5EN1 A;  4Y7N K;  3UN2 A;  2CPD A;  2MTL A;  2OHD A;  1C1B B;  5BYQ A;  3ISN D;  3ETM A;  3OQ2 A;  3KUE A;  2FJE B;  2WHO A;  1ZAV A;  2NXN A;  4RW6 A;  4WE1 A;  3FJ2 A;  3TQE A;  4AT1 B;  3QRR A;  1CUL B;  3CCV S;  4DV1 F;  4WU2 A;  2X1B A;  3FKB A;  4OHY A;  2V6U A;  3A8J A;  1KWM A;  2YKQ A;  1DCO A;  1UKU A;  3HPO A;  4W4M A;  1TL7 B;  1O29 A;  5KFR A;  5ITH A;  3AOB A;  3GZ7 A;  4CLW A;  5HO4 A;  6AT1 B;  2MB0 B;  4AND A;  4URG A;  2LXF A;  4EYI B;  1BQN B;  1LWF A;  4C2M A;  4DDF A;  4P72 A;  2ZH2 A;  3W65 A;  2AD9 A;  3OFE A;  2HHH J;  3DI6 A;  2IM3 A;  4LRD A;  5F41 A;  4DBQ A;  2G0J A;  5K8P A;  1B0V A;  1TAQ A;  2NZ4 A;  2VQF J;  2NPI A;  3TWZ A;  4TQS A;  4LF7 J;  2FLL A;  4DQP A;  4DV6 F;  2HVH A;  1RDR A;  4LSZ B;  1V3S A;  2X7I A;  1IE0 A;  5AXK A;  1WF2 A;  3L7O A;  2M70 A;  4IYQ A;  2KXN B;  3E51 A;  2CDQ A;  4TQR A;  1VRT B;  3J7Z T;  1N36 F;  2LCW A;  2ZOF A;  1GMW A;  5HVG A;  1U45 A;  5JMN A;  1C0T B;  3PW0 A;  3V5R A;  1U8W A;  1FDN A;  2DT9 A;  2CPE A;  1GMV A;  2BE2 B;  5GMK a;  2R42 A;  4X66 J;  1Q53 A;  5L46 A;  1NCL A;  2JLF A;  1TP7 A;  3TZX A;  3GG0 A;  4QCL A;  3VQT A;  2RIJ A;  3CJ3 A;  4DR2 F;  5I42 A;  4PXB A;  4P2M A;  2I5J B;  2H5I B;  3C8Y A;  3DLG A;  3CAG A;  3LP0 B;  2Y9H A;  1HL6 A;  1NJW A;  1MW7 A;  4J7C A;  4AQY F;  3K89 A;  4J9V A;  1U24 A;  4DV5 F;  3KDN A;  3U1M A;  4LBP A;  2J9E A;  3W8P A;  3GP9 A;  2DXF A;  4ZVF A;  2VPZ B;  4DPO A;  1X4H A;  2KXF A;  4C8Y A;  4NA2 A;  1D9D A;  2K3K A;  4U8Y A;  1OY6 A;  4YB7 A;  4OLP A;  4WKR A;  3HT3 A;  1YWX A;  1GMU A;  1GQE A;  2WAQ D;  3MPD A;  1T9T A;  2XMT A;  4F26 A;  4ZK7 M;  1D0E A;  1YVF A;  2PC6 A;  2JEI A;  4KMD A;  1Y3K A;  5CZV A;  2FYX A;  3MPW A;  1WF0 A;  3JQM A;  2BM1 A;  3DRR A;  1DJ0 A;  4M5D A;  4I2Q B;  3I5B A;  3OTC A;  3K2Y A;  1N48 A;  4QU7 A;  2HK2 A;  7FD1 A;  3UNY A;  2UXC J;  1TKX A;  3GTK A;  4DMZ A;  2A6H A;  4NAS A;  3OUY B;  5DS7 A;  5I3Q A;  4RKU C;  2ERR A;  1EET B;  4GO7 X;  4QOT A;  3H3V D;  4OJ3 A;  3HK2 A;  5EUH A;  2VQE J;  1J98 A;  5IT0 A;  1SQF A;  4RJV A;  3GDZ A;  3DRP B;  3TZZ A;  3D1H A;  4WII A;  4FPR A;  3GTO C;  1FDA A;  3M8R A;  2QEX S;  3TNV A;  4WYW A;  3CCU S;  4NMX A;  4NRU A;  3U1L A;  3OVA A;  4C97 A;  1GX6 A;  4PG6 A;  4YDX A;  3Q89 A;  2F63 A;  5F3T A;  3I0S A;  3QIP B;  4J5O A;  5JVH Q;  3RTV A;  2XQC A;  4DF8 A;  1JIH A;  3IRX B;  1RT7 B;  1VFJ A;  2WOM A;  3NCP A;  3KOA A;  1S1X B;  2DHH A;  3MZI A;  4NOH A;  5KFN A;  3UO0 A;  2EG1 A;  2LU2 A;  1TUW A;  1KFD A;  3VAF A;  5LXR A;  3FK4 A;  1YNN A;  1J5O B;  3CED A;  3HSG A;  4XAK A;  1QUV A;  3R5B A;  5C42 A;  4ELU A;  1WQF A;  2P8I A;  3AHP A;  2OD6 A;  5IM0 A;  1EHW A;  4CLU A;  1IKW B;  2LKZ A;  1N4L A;  3NEK A;  2OSR A;  4EEY A;  1IBM J;  1WDD A;  2E2H K;  4LOW A;  5E7O B;  1B7F A;  4JI8 J;  1UW4 A;  2KG0 A;  1EQR A;  1IR0 A;  2HGM A;  3CJ2 A;  3OPF A;  3LOU A;  3CCZ A;  1XC9 A;  2W2O P;  1XEZ A;  1FXL A;  2HLT A;  4U9R A;  3FSI A;  2R2U A;  3QX3 A;  1P27 B;  4A93 K;  3MM8 A;  3H4B A;  2D6F C;  1M1K T;  2UUC F;  1FK9 A;  4IG0 A;  5K14 B;  1S99 A;  1X8D A;  4DV3 J;  4YB6 A;  1RYS A;  3W5Z A;  2NSB A;  1X5O A;  1P8G A;  3DDI A;  2EC0 A;  1CG2 A;  2WCX A;  2DR7 A;  4KGK A;  3I0R B;  1P1L A;  1UVM A;  1R6Y A;  2IBO A;  1HI8 A;  4YHH J;  2B5J B;  4RZR A;  2B9Y A;  2GAH C;  4EO8 A;  5JXS A;  4HAC A;  5D0H A;  4JV1 A;  2C2K B;  4GTL A;  2YWH A;  2N7Y A;  2ZC4 A;  2V5H G;  1YJV A;  3PJX A;  2OAU A;  5IV4 A;  3I87 A;  3UDV A;  4NRT A;  1C4A A;  2F1F A;  4UZC A;  4LF2 A;  1Q7Y T;  4KPY A;  2JA5 C;  2PA8 L;  3A12 A;  3H2U B;  4OLO A;  1HI1 A;  4OYM A;  2BE5 A;  2YKN B;  2F9D A;  4C2M K;  4DN0 A;  4K8R A;  5KOW A;  1YBU A;  4NCG A;  1JLQ A;  3BRE A;  1NK8 A;  4UUX A;  2FJD B;  2RAQ A;  2A68 A;  3NL0 A;  1SV5 B;  1H74 A;  2Y0S L;  1JXV A;  3RZO K;  4JOU A;  5A8R A;  3W9H A;  3PEJ A;  2XZD B;  1YJR A;  3N5F A;  4NLD A;  4A3E C;  3IBW A;  1JMT A;  3PYG A;  4IRD A;  1T03 B;  2LVW A;  3CCE S;  3S14 C;  2G0I A;  2ZVI A;  1JQG A;  1K9M T;  4DS5 A;  4ZP8 A;  3MR5 A;  2MZJ A;  5D4O A;  4RMF A;  1RTI A;  5HAN A;  4IR1 A;  3FCV A;  2VFT A;  3TQ1 A;  3OL6 A;  3W64 A;  3S16 K;  3ILL A;  2CFA B;  2BOA A;  2EBE A;  5KG1 A;  1HPZ B;  1R6V A;  2GS8 A;  2QA1 A;  1R3N A;  1ZPW X;  4JI1 J;  4E2F B;  3BF4 A;  2A69 A;  4JI0 F;  3QGG A;  5KT2 A;  2UVW A;  3OV7 A;  3FBF A;  2GML A;  3AOD A;  3HLU A;  1RAI B;  4YR0 A;  4OYB A;  3IO1 A;  4AH6 A;  2C42 A;  2Z4P A;  1WC1 A;  1D1U A;  2PD1 A;  4DV0 J;  2ZBR A;  1HBU A;  1AXQ A;  2H65 B;  1RT3 A;  1FFG B;  3AQO A;  3TUZ C;  4GVB B;  1VQM S;  3E8O A;  4JYA F;  1LWC A;  3H0G A;  4Y34 A;  4NXM F;  3G6E S;  4OZ5 A;  3DOL A;  3M3Y C;  3HO1 A;  2PPB A;  3M4X A;  1R9T C;  3BR9 A;  3RR7 A;  4JI4 J;  4KQZ A;  5LMU F;  1QUP A;  2R7Z K;  1OJ4 A;  3DU6 A;  3TJ9 A;  3N0C A;  2RRA A;  2XCP A;  3Q24 A;  3GJS B;  2F8E X;  4TXS A;  4OZ1 A;  2J6T A;  1S0N A;  3C6T B;  3GEI A;  3D1Q A;  2NRE A;  4PUO A;  2JOQ A;  1Y11 A;  2HRU A;  1ZM4 A;  4QWE A;  2V0N A;  3PNI A;  3IXQ A;  3E01 A;  2E2I C;  2M3D A;  1N32 J;  3FSY A;  3W7B A;  2ZNY A;  4ZVO B;  1TKZ B;  2OPQ A;  5HQ8 A;  5GME A;  5IP9 K;  2BDP A;  1QY7 A;  2UV8 G;  1Y5L B;  4RBV A;  3IR6 B;  2GZO A;  3L7P A;  3K57 A;  3NP5 A;  1X5P A;  4YDD B;  3CD6 S;  1GTH A;  5L39 A;  2WON A;  4KV8 B;  1TKT A;  1NDK A;  2XZT B;  3QZ7 A;  1HAR A;  3QID A;  4Z37 A;  2Y1L B;  3TZY A;  1KS2 A;  1JLC B;  2AYB A;  4A3J C;  1RAC B;  1EP4 A;  4LF4 J;  1JLE A;  3Q3Q A;  3MGJ A;  3OR2 A;  2VB6 A;  5D6G A;  4UY8 5;  1GTE A;  1X60 A;  2K2P A;  3LGM A;  5HI7 A;  3EUN A;  5C24 A;  4CTA B;  2HRT A;  4PG5 A;  3EPI A;  1TV6 A;  1NXI A;  4DZD A;  1KON A;  2VDH A;  3H59 A;  4EFA C;  1NK9 A;  3QRQ A;  5E5N A;  1REV B;  5DRK A;  2JA8 K;  3H5X A;  4ELT A;  4DQI A;  1C0A A;  4B17 A;  3RB4 A;  4HHH A;  1R8C A;  1ISE A;  3QT6 A;  2CPI A;  2M2B A;  3CJQ A;  3VAI A;  2HHH F;  4J9O A;  4MIB A;  5GAG I;  5IOT A;  5B0A A;  1B0T A;  4ZN3 A;  3QJP A;  4RNH A;  2VQF F;  4LF7 F;  2EXU A;  1REG X;  3C66 A;  3FC9 A;  2HMI B;  3W63 A;  4YQW A;  1RT2 B;  2BV3 A;  3PO3 C;  2QYG A;  3EXC X;  2VPW B;  1RYR A;  1ZET A;  3MR3 A;  5D78 A;  4EYH B;  3VWS A;  2OPS A;  3R5C A;  1WG1 A;  1DAR A;  4X4O A;  1DUR A;  4F3Q A;  4P52 A;  5BR8 F;  2A2C A;  1SJQ A;  4USI A;  4ZVU B;  4L72 B;  1WEL A;  3DRY A;  3TX0 A;  1F2H A;  3MM9 A;  1RTH B;  2LP4 A;  5A0Y A;  3VZI A;  1KTQ A;  4NLW A;  4X66 F;  2IIH A;  2NVQ K;  4ILM A;  2XY5 A;  2JLG A;  3OVB A;  1H7X A;  1UMJ A;  1XMB A;  4CIO A;  3N6N A;  1RU1 A;  5BJR A;  3HKZ D;  1X0F A;  3QNW B;  2DEI A;  2D74 B;  5IP7 C;  1XXB A;  5ETT A;  4O44 B;  1EK8 A;  1EQM A;  3HFK A;  3PTW A;  3UD4 P;  1QAJ A;  2QO3 A;  2NUH A;  4HVZ A;  3TFH A;  1KSP A;  3CJ5 A;  2D1C A;  2DIT A;  2ZC3 A;  1W7W A;  1D9A A;  5H9E K;  3O3L A;  2Y8Y A;  2ROG A;  2MDA A;  4KAR A;  4DX7 A;  1O2B A;  5KT4 A;  3SCI E;  1YGY A;  3SZZ A;  2CJQ A;  4LF6 J;  3W66 A;  3D0H E;  4DLE A;  4K5S A;  3ZZR A;  4JBC A;  3TP2 A;  4OQJ A;  2CPY A;  2M0G B;  4KR0 B;  1LNQ A;  5KG3 A;  1BWE A;  2IAJ A;  3EZU A;  4RW7 A;  3KNA A;  2G4B A;  2AIR B;  3I56 S;  1EFW A;  2VZ9 A;  3M4O K;  3MMB A;  2ZJP Q;  4IUF A;  3MM6 A;  1CJK B;  4HYK A;  3W2V B;  3S8S A;  3RAX A;  3GTL A;  2UXC F;  3WZ0 A;  1S6U A;  3R27 A;  4ZVH A;  2IMO A;  3WC2 A;  3HHL A;  2OEK A;  3PW7 A;  2RQ4 A;  3PR5 B;  4IOC Q;  1HHQ A;  2GGP B;  2ZBP A;  1FWK A;  3LWL A;  1JKH B;  2DNO A;  2VQE F;  1VQ5 S;  3HP6 A;  4ITS A;  1NB2 A;  3R97 A;  4HI1 A;  3V4I B;  5LMN J;  3GON A;  1VGY A;  4ETX A;  2FVC A;  3DU5 A;  1F5B A;  2MLY A;  1OY9 A;  2R9L A;  2BJ1 A;  1GNK A;  2NS1 B;  5KFG A;  1OMS A;  2VG6 B;  3DMJ B;  1CLF A;  2BM0 A;  5E0O A;  1R27 B;  1XQI A;  1SKU B;  2A3J A;  2E1M C;  3LP2 A;  4OYX A;  4J37 A;  1U0H A;  5ADZ A;  3JSY A;  1YI2 S;  2ZD1 A;  2PFD A;  4B3R J;  3K8W A;  2BBE A;  3D7S B;  5JVO A;  3I5C A;  1G6B A;  5HRO A;  1TUV A;  3H0G K;  2VF3 A;  2DBB A;  4C3M A;  2IA6 A;  4B9M A;  2RDJ A;  4ECU A;  4X4V A;  2X1G A;  2JA7 K;  7FDR A;  1FX2 A;  3JXO A;  5LM7 E;  1JNZ B;  4DSL A;  4U7U D;  2XS5 A;  3T5H A;  4YY3 J;  2HHS A;  2VH7 A;  1XXC A;  5TMF A;  1QVG R;  1RQ0 A;  3HOU K;  3N0B A;  2DK2 A;  2JFD A;  4NYZ A;  2NUU G;  1FRJ A;  5KT5 A;  2KVI A;  4K4Z A;  1IBM F;  3BKU A;  3B78 A;  4OX8 A;  1O2F B;  3SQG B;  3MCO A;  4J9N A;  2BE7 D;  5H9F J;  1Q5Y A;  1XN9 A;  3B54 A;  4DV2 F;  1V3R A;  5IQQ A;  1KP6 A;  2MGZ B;  5KG4 A;  2Y3P A;  3KJF B;  2COL A;  1L5U A;  4DV3 F;  1VR6 A;  2FQT A;  2GVZ B;  2AJQ A;  5D77 A;  2KN4 A;  2HND A;  1H2T Z;  3R7S B;  5J2M B;  1WHW A;  4G1Q A;  1KKH A;  2KKH A;  2R7V A;  4WP8 A;  3M6V A;  2VIH A;  3ORE A;  2EK1 A;  2PMZ L;  1B4B A;  1D09 B;  4DFK A;  3TAP A;  5ETM A;  4YHH F;  2FLP A;  3BO2 A;  5HP1 B;  4M63 A;  2G9O A;  3QAU A;  3TTG A;  3SCK E;  2B9X A;  1WAC A;  5DQI A;  2ZH3 A;  3IWX A;  2EBG A;  4KMA A;  3M8Z A;  4OL8 A;  1MN7 A;  2H4W B;  4A8F A;  5CYM A;  3NAI A;  2OD4 A;  4V1A k;  3PY8 A;  3NRB A;  3CCT A;  3Q8Y A;  3QT7 A;  3FOE A;  9RUB A;  2QTW A;  2WBM A;  1IBK J;  4IFY A;  2GHW A;  4DPX A;  2CPH A;  4AYB L;  2YX4 A;  1KHW A;  1Q8I A;  2O3D A;  1PBA A;  4O0N A;  5DQG A;  1KD1 T;  4GTB A;  1E6V A;  3ILI A;  4A3G C;  1T9X A;  2K3I A;  4CQ1 A;  5HK4 A;  2WW4 A;  3A3P B;  2APO A;  2GJI A;  4JV0 A;  4KHR A;  4YR3 A;  2J6U A;  2CIM A;  1E6Y A;  2QRR A;  1FRI A;  1Y1W A;  3KWM A;  5C5J A;  1TWH C;  3CO9 A;  1RWM B;  4C8N A;  2XWX A;  3M2R B;  4A3K C;  2CQ4 A;  1F3V A;  1NJY A;  3MFI A;  2DXE A;  1I50 C;  2VBZ A;  4A3L K;  4QYZ K;  2B63 C;  1C0U A;  1RHK B;  2DGS A;  4IG3 A;  2E2J C;  1B99 A;  4OYA A;  4DL7 A;  5CD4 H;  2CPX A;  4Y3C A;  3FGV A;  1FCA A;  4A47 A;  3OVS A;  4WTY A;  3KHG A;  2V94 A;  2MZR A;  4GMK A;  4R5P A;  1WKK A;  4OZ0 A;  4TYB A;  3H5Y A;  3KLF B;  3W8G A;  1WF1 A;  4DU7 A;  2DNR A;  1S7I A;  4ZDN A;  4DUY J;  3GLJ A;  1RAE B;  2AZ1 A;  5DDP C;  5T14 A;  4FYD A;  1VGX A;  2XLK A;  1RA6 A;  4WXO A;  4JI1 F;  3HHK A;  3RGI A;  1HA1 A;  1S0V A;  1SCJ B;  4KYZ A;  4KE5 A;  4CYU B;  4X4U A;  3NY0 A;  4USV A;  4QJV B;  4OFZ A;  2HS4 A;  3RZD K;  5KFW A;  5KFH A;  3PCO B;  4PYA A;  5HMX A;  1KFS A;  1O6X A;  5K8M A;  2OP5 A;  3AAW B;  4DV0 F;  3FQK A;  4M5M A;  2CG8 A;  4L73 A;  4P2S A;  3V6J A;  3J7A N;  3LTO A;  3T9Z A;  3DRS A;  3NS7 B;  4NZ6 A;  4OYI A;  5C4X C;  2EFO A;  2HBZ B;  3SFG A;  2XCQ A;  2DR6 A;  1FT8 A;  2CWK A;  1PBU A;  1H2U X;  3K0J A;  3HOY C;  3FBB A;  3AB2 B;  3KJV B;  2YY3 A;  3S2D C;  2JRS A;  5DLG A;  3C19 A;  1U1P A;  3CQZ A;  5I3U B;  4JI4 F;  5MLC V;  3D6T B;  4MK8 A;  3S1M K;  2DHX A;  4BLG A;  1TWA K;  3HFV A;  2ADB A;  3QYY A;  1Q7L B;  4A3I C;  3S1N K;  1SL2 A;  1IKV A;  2DRD A;  1TL3 A;  4ZCI A;  1NK7 A;  2AQ4 A;  1TWF A;  2E7V A;  1HBM B;  1WKL A;  4A8M P;  3GTL K;  4CO4 A;  1WOO A;  5L8R C;  1TWG A;  2L9W A;  2Z2M A;  1YBT A;  1N32 F;  2WSC C;  1XR6 A;  2YKM A;  3G87 A;  1WNE A;  2FQQ B;  3FNN A;  4OJG A;  2JHE A;  1RT1 B;  4HDH A;  3M1V B;  4DOZ A;  4TLQ A;  4Q44 A;  5ETR A;  5KFZ A;  2C1E B;  4WFZ A;  1UA1 A;  5CYQ A;  4R25 A;  2K8G A;  5IOL A;  1OQ3 A;  2PA8 D;  2OPR A;  3AY0 A;  1FVS A;  2W2M P;  5KFE A;  1XNQ J;  3V81 A;  4OZN A;  4XTT A;  3VF0 B;  1NO8 A;  4G0W A;  3EYZ A;  2GJ2 A;  4OYW A;  3GQC A;  1KQG B;  4USM A;  2ATC B;  3CIM A;  1XWL A;  2RSQ A;  3KXD A;  2R7T A;  1NDP A;  2LDY A;  4LSL A;  3PO2 C;  1PO6 A;  1KLM B;  1EKR A;  4X4R A;  1HNV B;  3L4J A;  2HLU A;  4R8U A;  2FLN A;  2NVX K;  3S1T A;  1ZAX A;  5E2Q A;  2HEK A;  5DLF A;  2XSJ B;  4FYV B;  5KFI A;  2W4D A;  1SKR A;  4I2P A;  3LPE A;  2IBK A;  3GSD A;  5ETO A;  3MPY A;  4P5B A;  2HHW A;  1J6X A;  4I6Y A;  1KRP A;  3GCW P;  4LR9 A;  3CUL A;  3OHA A;  1IR1 A;  3U7J A;  1T05 A;  2DRB A;  3MXH P;  4ECR A;  4WJ3 M;  4OZ3 A;  2YKA A;  2CJA A;  3SIP B;  3M32 A;  5KFQ A;  4Y2M A;  4DN9 A;  1S9E B;  2W7A A;  3IWN C;  4KO0 A;  2UUA F;  2AW0 A;  2KL8 A;  4P75 A;  2MZ1 A;  3MMJ A;  3NBP B;  1SJR A;  4GTE A;  4DPW A;  3JYT A;  2J7K A;  2RS2 A;  4E0D A;  3L95 X;  1F3F A;  2FB0 A;  1NHK L;  3CMQ A;  3GTG A;  2QIF A;  1G3O A;  2FJB B;  2YNG B;  2Z2L A;  1RHQ B;  1DTQ A;  3TJ8 A;  3MEE A;  3B6B A;  4A3M C;  5J2P A;  4G1I A;  3PO5 A;  3A13 A;  1TZ0 A;  4P6Q A;  1G2E A;  3MM7 B;  2NCK L;  1WG4 A;  2V8H A;  2ZH6 A;  3W1Y C;  3TA2 A;  3PFE A;  2VG5 B;  4N76 A;  4AXJ A;  2B56 A;  3SV3 A;  1RP5 A;  5HL8 A;  2Y3Y A;  3OEP A;  1RT6 A;  1VBY A;  3R8Y A;  1XZP B;  1IJF B;  5CYJ A;  4Y28 C;  3T6J A;  2QA4 S;  2W2Q P;  1RTJ B;  3GFZ A;  3CDW A;  4K5R A;  2ZUF A;  2DYA A;  4Q7A A;  2BAB A;  5M3F K;  2V9K A;  2G1D A;  2FC8 A;  3BBC A;  2IJR A;  3T1Y J;  2FVS A;  1O25 A;  2VOP A;  3OXG A;  1CQN A;  4NLU A;  3QRP A;  1Y1W K;  5K8N A;  3PYF A;  2R92 A;  4LF6 F;  4ICL A;  1RLD A;  2VV5 A;  2D9P A;  4OIQ A;  1O28 A;  3D3B J;  2WZ1 A;  1J27 A;  1S6O A;  1ZOT A;  3N0V A;  3EVW A;  3G96 A;  1N54 B;  3ZTR A;  1FFS B;  2AJ1 A;  1H3D A;  5A2Q Y;  1FRH A;  1ICE B;  4FZB A;  4I7F B;  2BJE A;  2VD3 A;  3GYX B;  1KDN A;  1M5K C;  2VKZ G;  2MKK A;  1WCM A;  3I4M C;  4O3O A;  2XZW A;  2ZBI A;  1S10 A;  2GVD A;  3MPV A;  4IR9 A;  3K5M A;  3QO9 B;  2VDI A;  3KMQ A;  2ZH1 A;  3UVJ B;  4ED7 A;  5DQH A;  1RT5 A;  1UVJ A;  3IGV A;  3T02 A;  2UVU A;  2HHV A;  1JJ4 A;  4NCA A;  5L1L A;  1FKO A;  2AP6 A;  3PYD A;  2IC3 B;  1BC6 A;  1TL5 A;  4WE1 B;  3DN9 A;  4LR7 A;  3VAJ A;  3IR5 B;  5DM6 Q;  1VDH A;  4ILR A;  3MTJ A;  4IQM A;  1ZYR A;  5IOS A;  2ZHA A;  3GFY A;  1XTZ A;  1NLK L;  1S6Q A;  3CJ0 A;  1FVQ A; 
#chains in the Genus database with same CATH homology
 1X31 C;  4PAB A;  4P9S A;  2GAG C;  1PJ7 A;  3A8I A;  3A8K A;  1VLO A;  3AD9 C;  1XZP B;  1YX2 A;  1VRQ C;  1XZQ A;  3TFJ A;  3GSI A;  1PJ5 A;  1WOS A;  3GIR A;  3TFH A;  1XZP A;  3TFI A;  3A8J A;  3AD7 C;  3GEE A;  3GEI A;  3AD8 C;  5L46 A;  4PAA A;  1V5V A;  1PJ6 A;  2GAH C;  1WOO A;  1WOP A;  1WSV A;  3ADA C;  1WSR A;  3GEH A;  3TTG A;  1WOR A;  1XZQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...