2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
1WSVA 3AD7C 3GEEA 3GEIA 1WOOA 1VLOA 3TTGA 3ADAC 1X31C 1WOPA 2GAGC 1PJ6A 1XZPA 3AD9C 1VRQC 5L46A 4PAAA 1WSRA 3GEHA 1XZQB 4P9SA 1WOSA 2GAHC 1V5VA 3TFJA 3A8IA 3GSIA 1PJ7A 3TFIA 1XZPB 3A8JA 4PABA 1WORA 3AD8C 3A8KA 3TFHA 1YX2A 3GIRA 1PJ5A 1XZQA
chains in the Genus database with same CATH superfamily
4F4YA 1BE4A 2V6UA 5F8HA 2B5JA 1TWCK 2MKSA 5ETSA 2OSQA 1NJYA 1EETA 4P9SA 1F1BB 1LWCA 5HP1A 1KVIA 4EUVA 3T19A 3VQSA 3BGOP 1FKPB 1MSWD 4KKOA 1HYSA 2XSFA 3AA8A 3BN7A 3GEIA 3T00A 4Y3CA 5EX0A 3DRRB 1BLUA 2ZH8A 3I87A 1PYTA 1HQUB 2AMCB 3OXFA 1IXKA 4B3RF 2NREA 4J90A 5DG7A 4FZVA 3DDKA 1DBDA 4M95A 1IJEB 4N41A 2OJ3A 3OL9A 3BGUA 3S2HC 3JSMA 2R7SA 3RUBL 3A3OB 3GV7B 3N0CA 2EK1A 2IJNA 2FJWA 1S99A 4J5OA 2DEIA 2MZRA 4O3SA 3N5BA 3IO1A 2WBRA 3H98A 3M8PA 1WEZA 2VQEJ 2CZ9A 2UXBJ 1RSCA 4GTEA 5C3EK 3QO9B 1UPPA 3EXYA 4ECUA 3M8RA 5E41A 4I2PB 1SB6A 1FTCA 2W4CA 2F3JA 1CJUA 4FXWA 1ZAXA 1R9TA 2AYMA 2OI2A 2W9AA 4DSIA 1GXUA 2YNFA 1YJUA 2XYGB 3C2PA 3ITHA 3T9NA 4EWTA 1TFYA 3EVMA 5A0YB 3FJ2A 1OSCA 1DZ5A 2DKOB 1SFOA 5J1EA 2LQ5A 2RRNA 3OQ2A 2ZH7A 3M8QB 3EICA 5F8JA 2FHOB 1S1XA 2VC0A 3M6UA 4OZ5A 2YQ3A 4UOCA 3UI3A 3GIKA 5J2NB 3H59A 5KOWA 3G2XA 1OYDA 2P8IA 2RU3A 2V2QA 3MEKA 3G6XA 1D8YA 1N5YA 2DVIA 2HHXA 3KLEA 3BO2A 2RNEA 1UKUA 3C19A 2XMTA 1LKZA 1UJ4A 4A93K 4ES1A 2M2BA 1RWMB 2WB1D 1S1UA 3EMTA 2J7KA 2GIRA 2VUGA 4X4QA 2CQ3A 4NCAA 3N6MA 1RLDA 2QEXS 3TEGA 4GVBB 3RBZA 1S6PB 4IRKA 4BHQA 4WJ4A 4AXIA 2HQDA 3U7JA 5I3UB 2N7CA 4NMLA 3HI9A 5LSLA 1UWBB 1S9GB 3PYFA 2QFJA 4N77A 4URGA 3R1LA 2RDIA 3HOZK 2BQ3A 1SV5B 1IM4A 3DOLA 4AE5A 2HLTA 1XNRJ 4OX7A 2OPSA 2E5GA 4A3IK 3BGLA 3OUYA 2MSSA 3QAUA 5M2PA 2PPBA 4QWBA 2W8KA 4FNIA 2YQ0A 2LQ8A 3LP1A 3Q8VA 1XIQA 2OD6A 4DXLA 1WEYA 3IBFB 2HK3A 2JEFA 1RHMB 4JOUA 4BXXK 5K20B 3NGTA 4KDDA 4J9UE 2QL9B 1Y3JA 3AH6A 1U1QA 1FD8A 2VG7A 2VQEF 1VQNS 2UXBF 2V2VA 2DEJA 4AH6A 2CQBA 2WW4A 1LW0A 5ETLA 3BKTA 3S8SA 3QLHA 4HL9A 3ZTQA 2CNLB 2Y8WA 1J98A 3W60A 1K9MT 1ZBSA 3CDAA 2BKNA 3OBIA 1U6BA 1I50K 4EZ9A 4OYWA 3L4JA 1X0FA 1RZMA 2G2YA 1QAYA 4KATA 3HOWK 1AB8A 3BF4A 4MK9A 4ECRA 1IBKF 3OPKA 4KHRA 3GTGK 3QYYA 2AT1B 2AF6A 3IC1A 1QE1A 3NBPB 1WWHA 4GKKJ 4OIRA 1M5KC 3ZTSA 2EXUA 4FXVA 1IKWB 3E01A 4HI2A 2DPJA 1LOUA 2V5HG 5JUMA 1S7IA 2MZ1A 1RISA 1HNZJ 4ZCLA 1S1VA 2DXDA 3BSNA 1S6UA 3BDEA 3NG8A 1RAFB 1V3RA 2DR6A 1GXTA 4Q0BB 1U0HB 1YJTA 4EYHB 4EGLA 3V4MA 1A0OB 1EZZB 5IP7K 2VPWB 4KPCA 4XO0A 5ETMA 3HOZC 4DCJB 3TX8A 4ZJQA 3HK2A 3CDWA 1KTQA 1CQNA 5KFXA 3W63A 4FYWB 4A3IC 1USOA 1XNRF 1JLBA 1JJCB 2DRDA 4DLGA 4X4TA 2C2RA 4GTAA 1C2PA 2CPEA 3UDCA 3MAHA 3PR5B 4DV6J 2DNGA 1K83A 1CG2A 1M1HA 5IORA 3AXKA 2X1BA 3Q8YA 4X6AC 1GX5A 4DSKA 5GAGU 2VUMK 3AJDA 3HKZD 1FJCA 5M3MK 4BXXC 3WODA 1NJZA 3BEGB 3ZC4A 3QIDA 3K58A 1KHWA 4EO6A 4YB6A 3NEKA 2V8PA 3FRZA 2NXNA 4L76A 3LP2A 4LF9J 2R2RA 4N76A 4C0HA 4ZLNA 3MAAA 2MLZA 4CH7A 2PD1A 1REVA 1VQMS 4GT9A 4BLBA 3EJMA 4OZ1A 3TI0A 1V5IB 3IFEA 3Q8SB 1T9VA 3TVYA 2VHGA 3EDQB 1VGXA 1I50C 4PR6A 1TR0A 2V4RA 1GQEA 3HOWC 3NRBA 3K5LA 5CYMA 1U7LA 3BGRB 3S7RA 5M2RA 1QY7A 1S79A 2BRLA 4QIWD 4RLEA 1UVJA 3AY0A 4B3SJ 2YXLA 5J2MB 2CDRB 3GTOA 3CW2C 4GKKF 2KYZA 4WWSA 4CLSA 3N4WA 1HWUA 2MKHA 3D6HB 3SZZA 1VHIA 1HNZF 1TL1A 1DFDA 3GCWP 4NWBA 4NA1A 1Q8KA 2VICA 2FHMA 3V6DA 4C3IK 3K59A 2C42A 3G9CA 4B9TA 3P6YC 1WC1A 5AXKA 1M5OC 3X3UA 2AJ2A 3TZWA 5E3RA 3SSSA 2AIRB 2K3IA 2OTLS 3AHPA 2G2ZA 2MKIA 3TZYA 5DLFA 3DRYA 1U24A 4LK1A 1FRHA 3CJKA 2G13A 3GJRB 2BUNA 2Z2LA 1OY6A 3OW2R 5L1LA 3GTLA 3HZGA 5IT4A 1TL7B 5CXTA 5D77A 2HLUA 4DV6F 3CO9A 3GTMK 1HQEB 3JXOA 3QPIA 4Y2MA 2BABA 1PYSB 1JVIA 4M5DB 5ETKA 1TMMA 2AWZA 3PJ9A 1X9SA 5HLFA 2HWHA 1G51A 4P5AA 4LF9F 1PAEX 1K44A 4CO5A 2EC2A 3EVOA 1WC3A 5LXYA 2ROPA 4NRUA 4ICLA 3BM7A 4ED4A 4Y28C 5D3GB 2OTJS 1HQMA 4P52A 1KQ4A 3H0GK 2Q66A 1R3NA 1RCOB 1XZQA 2BJ7A 2B4OA 3C15B 5LM7E 3T6JA 2F8HA 1WCMA 1F9NA 2ILZA 2Z57B 5LOQA 1HPZB 1DCOA 2H65B 3CMES 2CG8A 4NLWA 1FNMA 4QWEA 1YLXA 3JQKA 1S9EA 1R8CA 3PO5A 2C3PA 4LR8A 4B3SF 1U2CA 2Q6BA 4NI2B 3ILLA 3PM9A 5EGHA 1LXNA 3GTKC 4ID8A 4HDHA 4F0KA 1DQ8A 3HD2A 2W2OP 4A3FK 1XZPA 4DZDA 2KM8B 2E66A 4M5KA 3GFZA 1REGX 1RXOB 1T0TV 4WXWA 3KYLA 3CC4S 3O8WA 5ETRA 2HAIA 5CYJA 1U4BA 3BBFA 4LREA 1IKYB 2ZBIA 3U27A 3W62A 2N3LA 1UFLA 2H4YB 2CPHA 2B3TB 3NWRA 1UVLA 1PSDA 3E51A 5C42A 1H7XA 1E6YA 4JI4J 1WG1A 1RBAA 2CQ4A 2LEAA 1FKAF 1FX4A 3THVA 4X4VA 3FBFA 2J7WA 5IT0A 3GTMC 2I1RA 4O3OA 3S14K 1FNOA 4KMAA 4CDIA 2EKNA 1UZHA 1UA1A 2E1AA 4ZJLA 3G4SS 3H2UB 2WSEC 2J9DE 3BBBA 3HT3A 3MM8A 1RTHA 2GSOA 1ZOTA 1DCPA 1I6HK 1NMEB 3QX3A 1M5VC 2W25A 2H3EB 3QRPA 1UTAA 3OSNA 4DG1A 1BQNA 4O44A 5KFNA 5IS2A 1NK8A 4JI7J 4LFAJ 5EX3A 3SV3A 4Q2LA 3NNAA 4FPRA 2X3DA 2LFVA 4JI1J 2JH3A 3PRDA 3WHIA 3CJ3A 2ZUFA 1VRQC 2ABYA 1VFJA 4F4ZA 3QJJA 4AL5A 3W2VB 2NVXA 4PQAA 2IYIA 3QWUA 3S1NK 4FBTA 2EG1A 3AQPA 1FESA 4TU9A 1XNQJ 4RUHA 4JP8A 3BYPA 1T9UA 3DGVA 2HK2A 5C24B 2XQCA 2BKPA 3BQ2A 2PMWA 1PKUA 2V68A 2JHEA 3NMAA 1RBLA 1CJKB 3AXMA 4J9SA 4K4UA 3C6UA 3ZO7A 1UCNA 4TNOA 2Z56B 1ZPWX 3QSYB 2HRTA 3A8EA 1H98A 3M3YK 4C3LA 4L3NA 1B7YB 4LF5J 2C2NA 1H72C 4K8RA 4Y6IA 1MLAA 2MQ8A 3OSPA 4USTA 1FD2A 1AW0A 4Q5VA 2YX1A 1T05B 3ERED 2E7XA 1BMQB 4WP3A 2E7VA 5FD1A 4LF8J 2UVUA 4UQTA 4NLVA 1B0PA 5DLGA 5MLCV 1N33J 4WE1B 1Y7PA 2E1PA 1GFWB 3IPJA 2ZHOA 2CJQA 2I5JA 3AB2B 4JI4F 2E5JA 5IYDK 4ED6A 1KOHA 3CNQP 4CM0A 2M3DA 2GQ2A 2LXIA 1R0AB 2MLXA 1ACMB 1ICEB 4HKQA 1OY8A 3LAMA 3OD2A 3MWBA 3UR3C 2WVCA 3FMBA 3V4IB 2LCWA 4HT7A 5JXSA 4KR0B 2F65A 1V3SA 5LSOA 3V6JA 1CJVA 3T9ZA 1I6HC 3OV7A 3N01A 3ILOA 2IHR1 5CZVA 1RHJB 1CEZA 2HZAA 4DPWA 5KFOA 4KFBB 4U96A 1UFKA 5KFQA 3IBWA 4EMDA 4PRFA 4DX8H 1KWMA 4JI7F 1CSJA 1KOOA 4LFAF 2QC3A 3BBCA 1HNVB 3GIRA 4JI1F 1X8DA 1GK8A 3MPYA 1SI9A 2YKMB 4DU8A 1S6QB 2UVRA 5TMFA 4IOAQ 1XC9A 1GT8A 1G6BA 3MECA 2PEBA 2R93A 2MZQA 4AT1B 4WJBA 5BJRA 4K0KJ 1RT4B 3UD4P 2ZZNA 3MCOA 3KXDA 4DSEA 1XNQF 3R6LB 3LP0B 1TL3B 1NUEA 2QN6B 4G1PA 4M63A 2L9DA 4CI0B 1RWKB 3B82A 1LWFB 1VRUA 4JK1A 3ZFVA 2I0XA 3EYZA 3AOCA 3ZZYA 1UETA 1RT2A 4NCBA 4LF5F 1GXLA 3UO0A 3IRXA 3M8QA 4M5NA 3R27A 3K89A 2OGUA 2JC0A 4JI0J 4LF8F 2EFPA 5FLMC 3I96A 2QV6A 1N33F 4EBCA 2RF2A 5IYDC 1U47A 1WHVA 1L0WA 1VOMA 4K59A 3T6BA 4CLUA 3FEYB 5C4JC 5HL8A 3DLJA 3IA0A 4DUZJ 4LR7A 3KUHA 1MN9A 2QL7B 2A68A 3MEEB 3M2VB 3HOXK 3QRQA 4L3KA 5CH7B 4HHUA 2VFVA 2BM0A 1S6PA 3CJ8A 3GJQB 4LQ3A 2YWGA 3KFWX 4LMZA 4C2MA 4IQMA 1HMVB 1T3OA 5KFKA 2E5HA 4OYXA 2KXFA 4ILMA 2PDAA 4FN5A 1OS5A 1ZYQA 4I0WA 5I3PA 2CJKA 3GTPA 1ZZNA 1XJWB 4O4RA 1FKOB 2ADCA 2FLPA 1RTJB 3TAPA 2UV8A 4K50A 1OWXA 2CWXA 1KSPA 3FVYA 1JLCA 1K83C 4I68A 3I4NK 3DRPB 4IH6A 2BR0A 1TKTB 3P5BP 3KLGB 1HI1A 2JRSA 2VBXA 4J91A 3AH5A 5J2PB 3W3SA 2DGUA 2B63A 4PUOB 4GVLA 1TKDA 3SZ2A 3OVAA 2BEFA 5K5MA 3RZDC 4RW4B 5A8RB 3G4CA 1U02A 2YKAA 4B3OB 4IOCQ 4K0KF 1WIHA 1EIYB 2VFRA 4ELUA 4DV3J 3G86A 1QD1A 4ILRA 2WOMB 3IMQJ 2HFOA 4F4WA 2IY5B 3FMWA 2D74B 4KO0A 2ZFZA 2GMHA 1QDUB 3KJNB 1W25A 5FJ4A 4A4JA 4RNHA 3BV8A 2E2JK 4A46A 2B6AB 1RK8A 2JA7K 3CDEA 2RQMA 5KT4A 3KG4A 2G2OA 3M2RA 1CQMA 2YPYA 3IXQA 3GONA 2XCRB 4M1KA 4I2QB 2D41A 2Q1LA 1VH2A 4O23A 3T1YF 4N5SA 3IM9A 1MROA 3R5DA 3BH7B 2ZM6J 4JI0F 3JS9A 2ZD1A 1ZETA 2FZKB 4BLGA 1NK7A 5GAGI 3DXBA 1SCJB 4PXEA 2XCAA 3NGDA 1P1TA 4DUZF 1J6WA 3HOXC 2BE2B 2QIFA 2YX4A 4C8OA 4QWCA 4A3KK 3AA9A 3U1LA 3NGUA 4RBVA 2QLXA 2C28A 2FJXA 1VQKS 1T3NA 2BJDA 3OFEA 2MZJA 2EC0A 1P8GA 1RB0A 4QR2A 2JA5A 3CJRA 2BDPA 1HNXJ 2XI2A 1F6TA 3O6QA 1WTFA 4USHA 1KQFB 5T7LA 2CVIA 3LPEA 3WC0A 1VQ4S 2JEJA 5DDQC 3C46A 3I32A 2GX8A 4KMUA 3LAPA 2CQPA 3LH2S 4I56A 1SQGA 2V9WA 2UVWA 4DX6A 2YNHA 5GMDA 4UY8T 5KFBA 3MCNA 3GTLC 4HEA9 2HG4A 4QU7A 2CQ1A 2BJ9A 2W8LA 3FFIB 3TJ9A 1XMBA 4LRCA 1JB0C 4IG3A 3UVJB 2NVTK 3W8GA 3R1HA 1S4EA 2E2HA 5KG6A 4LRAA 1NM2A 3C16B 4LRBA 5HJYA 2NCKL 4DV3F 1FO1A 3N9UC 4OIOA 4G1QA 2R2UA 4OI4A 2O01C 4DL0C 1WCMC 4DL4A 2IAJB 2E2JC 5IZHA 2RRAA 3ISZA 2VH7A 2EBGA 2JA7C 2YU9K 4P10A 1R8PA 2XMKA 3I4MC 1FJ7A 3R7NB 2UVVA 1RADB 3SDEA 3J7A1 1NBEB 3HM9A 1EP4B 3DU5A 2UUCJ 1Y00A 1L5UA 4L73A 4XCHA 3GYGA 2ZM6F 5AXMA 1RT5B 4QCLA 5KAKA 3DLEA 1RA6A 5J2MA 2OP5A 3DLHA 1IW7A 2MLYA 4X65J 1NSKL 3NY0A 5FDLA 4FVMA 2XGPA 3H5SA 1FDNA 6FD1A 1ZXOA 4GC6A 2GAHC 3SZYA 2R9LA 2HHVA 4QJVB 1R43A 1DCHA 3AJ2A 1HNXF 4ERDA 3D6TB 3SSQA 2OPRB 7AT1B 1M1KT 2HKEA 5CHCB 4I64A 4PWWA 4ECWA 3AJ1A 4Q2MA 2R7RA 3HFZB 4H4MB 3X1LB 4F8RA 5HSPA 1FFGB 2W7OA 3QGHA 3T41A 1NKEA 2IC3B 4IDKB 2PA8D 4C3HK 1IKVB 2Z0GA 5HATA 3U1MA 1HQEA 4LFBJ 1HBMB 1T02A 2CG4A 5I3QA 3W2WB 3H40A 4NLGA 1RT1B 2ACMA 2ROGA 2JX2A 3S16K 5I42A 3R5JB 4FZBA 3D54A 3RR7A 5M3FK 2JLEA 3TZZA 2FB0A 4XAKA 1UEVA 1MMDA 5A8KB 2GVDB 4DR6J 2PC6A 2DNLA 4MYTA 3CMQA 2BOPA 3OFGA 1WC6A 4C8KA 1QAXA 5D3GA 2P9EA 3GMGA 2E5IA 2J0XA 2YU9C 2W7PA 3P96A 4NPOA 5DGAA 2BX6A 5CD4A 5F8GA 3K5PA 4A3EK 2CYYA 3BS9A 5E0OA 1TL5A 1F7VA 1J5OB 2BE5A 4QPTA 1BD6A 2ZC4A 3VALA 2UUCF 4DL6A 2MZSA 2GW8A 3BR8A 1NSPA 4FP9A 3HHLB 3ETOA 3GTJK 4NXMJ 1VYAA 1NB2A 3RG6A 1WF0A 4RUBA 3DU6A 3ET6B 4HR2A 4F25A 2XO6A 4X65F 3DLGA 1RA7A 4R5PB 3QT7A 3M1VB 4F04B 4KGMA 2W2QP 2LA4A 3C66A 1DRZA 1WOPA 2LU1A 1Q81T 2VOOA 2VA2A 4G3IA 5CYQA 1NRKA 1TV6A 1WUUA 1B7FA 5K8OA 2D1CA 3JYTB 3RBEA 3KK3A 2BJ3A 4LVOP 2GSNA 2WCXA 3VF0B 4CTAA 4WFAQ 3DLKB 2C2DA 4PXDA 3O1LA 4OV1A 7FDRA 3K17A 3ADAC 4PPZA 1TK5A 2XY7A 2VPXB 2IRYA 2ZH6A 2OIHA 5LT5A 1U1RA 5AXLA 2PMZL 2CUYA 2LXUA 2PI4A 3PX6A 2RQCA 1CVJA 2A10A 4OINA 5B0CA 2DNNA 3OFFA 3R7SB 3ZZUA 2AX1A 1SKSA 3GWCA 4NLYA 5IWAJ 4OYMA 1HBUA 5D0EA 2LEPA 2DO0A 2HNYB 3GV8B 3GFHA 3F56A 4LFBF 2NPFA 2FJBB 3TYTA 3KG1A 4OZNA 1ZTTA 4QWAA 2QX0A 2XS5A 2FLLA 5HANA 4ZS6A 1GMWD 3ZZZA 3VVUA 1K73T 2B9WA 4DR6F 2CQ2A 3GTPK 3L09A 5U47A 3R5CA 2ATLA 1NDKA 3N28A 3M30A 3G8QA 2V6AA 4PAAA 3JSBA 3T3FA 4DOZA 2JA6K 1TWHK 4PXBA 2YWHA 4XPCA 2C3OA 2XO7A 1HNIA 1AFIA 2E5LF 4ES3A 1W2IA 4Z7YA 2AU0A 3H42A 4W4MA 2G9OA 2EFOA 3TA1A 3WX8A 2B63K 3W5ZA 3PW4A 2YKNB 3UN2A 4UW2A 2R93C 3V5RA 1S59A 3NKYA 1NK5A 4BS2A 4J9PA 4IR1A 1N0UA 1J2VA 1O2AA 4CLFA 4JYAJ 5KTQA 1XK8A 4NXMF 1DTQB 5G0RB 1Y1VA 4RW8B 2HQGA 5T41A 2F8MA 5C24A 1Y9OA 3CJ0A 2P9GA 1UVIA 1V3ZA 4NEZA 4ED5A 1UWAA 2MGZA 1RT3A 2FUG9 3OL8A 4P74A 3M8SA 2Z2ZA 2BACA 4Y2CA 3HOYK 1VRTB 4DHVA 3GFXA 2AJ4A 4DWIA 3IAS9 1T05A 5KFYA 4KV8B 3MMAA 1CS4A 5GADI 4L72B 2P6TA 5EWFA 1C0TB 1VISA 3A13A 4V19X 1GX6A 3W7BA 1VQ7S 4C7QA 3GIIA 3MUTP 1NB7A 3BO4A 4DL7A 2CIMA 1GMUA 1XMOJ 3DRSB 1N88A 2VKZG 2FVCA 2XEXA 3CD7A 3IS9A 1YJWS 2V2KA 1X4DA 5IWAF 1FRIA 1QTNB 3DCAA 2PFDA 2F4VJ 4ED7A 2BV3A 2LDYA 4UY85 2F4FA 5DJBA 4FS2A 2IMWP 2CFAB 2VPZB 3H2LA 3ZZTA 4ZPWR 1W2BR 1SH2A 1WKJA 5KFEA 1WD6A 1JLAB 4XDCA 3J80Y 3IM8A 1NDCA 2RHSB 4DUYJ 3GTPC 3PCOB 4DEZA 3DFEA 4KFBA 3Q23A 2CDQA 3DYAA 1ZAWA 2KZMA 1DJ0A 2JA6C 2CPIA 1OQ6A 2I8EA 1TWHC 1JJ2R 3GTQA 3JSRA 1S4FA 3M4OC 2QA1A 1HD1A 1HNVA 4K4XA 3OR2B 4F50A 1S48A 1U6ZA 2B63C 4CT9A 2VFTA 4L75A 1RT7A 4ZVGA 1X0PA 2ZDPA 1S6QA 4KHMA 4P5BA 5FJ8K 3J80U 3DHWC 2E2HK 1NLKL 1WHYA 3QGPA 3GDZA 5EGYA 5JVGQ 3HO1A 4BY1C 1SL1A 2XCOA 2F9DA 3OTDA 3A3PB 4JYAF 1XXCA 4Y34A 3ZTOA 2HFVA 3PX4A 2C2MB 2QRRA 4I7FA 3GV5B 3WIVA 2AGPA 5IV3A 1TL3A 4KY3A 4LLGA 3RB6A 2HFNA 2DT9A 1AA1B 2CW0A 2B9YA 2JDJA 1KLMB 2E44A 2H5EA 3NUHA 3HD1A 2HNDB 3HOYC 4JI8J 5KFFA 5EGEA 4Y2IA 3TFIA 1YJVA 1NK4A 5IOSA 5GAHU 1WF1A 2UXCJ 2JA8K 2FGCA 3JTPA 3UDVA 3DOKA 3D0IE 4P2SA 4LUBA 1Q95G 2ZH9A 2ZBRA 1NHVA 5IYBK 4RNMA 4DR2J 3BJYA 3G82B 1HBOB 2XY6A 5CABA 1A6LA 4QYZJ 2LU2A 3LOUA 3I4PA 3H2VE 2DH7A 3VAKA 3H3VL 4AD6A 2JA5C 3CC2S 5B0EA 2W9CA 3TA0A 2I9SA 3EPGA 2F4VF 4FVCA 3DXJA 1SJFA 2V34A 2VL1A 5KFGA 1PJ5A 1HI9A 3AD7C 2KKHA 1F2GA 1DARA 4DUYF 4DV7J 3N0VA 4NCGA 2RT3A 1ZM9A 1HLWA 3CQZK 1SJRA 3RJMB 1RE1B 1JLFB 3NGKA 3H4BA 1RTJA 2ZHAA 1LWEB 5J2QA 4H4OB 5CAAA 4QW8A 4MKVA 1VK8A 3M7VA 3MMBB 3OXGA 2PMHA 4KASA 1LW2A 2NQPA 2E2HC 2DBBA 3T5LA 2PEHA 1Q86T 2C22A 4ECTA 2GNKA 2LXFA 5CCLA 1TKXA 2JC1A 1S0MA 3LGMA 3KLHB 3NLCA 3CMAS 2WOMA 4K7QA 3HVRA 5GAEU 1ZYRA 2NUUG 3BPDA 2IVMA 3MEGB 3AD9C 2LLZA 4DFPA 2BVZA 2OPQA 4A48A 3T5HA 3KJFB 4ZP8A 4XLNA 4J9VA 4Y52K 1X4EA 1VLOA 3PJWA 4JI8F 1ZZFA 3VCDA 4B02A 6AT1B 2HMIB 3UN5A 4FYYB 2UXCF 3LGHA 3DKDA 4L6V3 4A8SA 2MJUA 2JLGA 3PW0A 4AYBL 1YGYA 4QZVB 1N54B 2Y1IA 4RU2A 3CGIA 3MOZA 4E0DA 2L48A 5AT1B 1HI0P 2G1DA 3SV4A 2QYCA 1BHNA 4W98A 4DR2F 4K5RA 1TVRA 2Y1RI 4RU9A 4PPDA 5HO4A 4RZRA 2DIVA 3EE3A 5HVGA 1DHMA 1Q79A 2JLFA 3BGFA 4F3QA 1VQ8S 4FKYA 4QR0A 1SQFA 2QL5B 4JI3J 2IM1A 2MYFA 1RABB 1UJ6A 3BQ0A 4ZP6A 3N3YA 4YUDA 3JSTA 2VBZA 2Q79A 2SXLA 1S10A 2O66A 3A4TA 2RDJA 4DV7F 4TU7A 1S76D 4YB1P 1HBNB 3MTJA 3VQTA 3BREA 3CQZC 2MY7A 4QYRA 1J6XA 1EQRA 5DQGA 1TUGB 3HPOA 1FT8A 3FSXA 4ILLA 1Y11A 2FJVA 2CPZA 4ZOSA 2DK2A 1OPIA 1PJ6A 1RHQB 5I4MA 2R7ZK 2EBBA 1Y4ZB 2XLKA 1BGWA 1MW7A 2ROEA 1QAJA 5DDOC 3M32B 2FZGB 3S1RK 3T5KA 1Q53A 3F44A 1L3SA 1EQ0A 3QZ8A 1M1GA 1K47A 1O8BA 1VCTA 5K8NA 2X3GA 2DNHA 4ZVRB 3NOCA 3US5A 3MXHP 2V4JB 4OHXA 1F60B 1WI6A 3CCZA 2DPIA 2BBEA 4PG4A 3L4KA 4WXOA 3A1YG 2YY3A 3I5AA 3CB4A 3DM2B 1ZBTA 4Y52C 1N36J 5E3AA 3MEDB 3POTA 4J9LA 4K2XA 5HJXA 1WC5A 4ZCIA 1TWAA 1D9FA 5LJ3Y 1IQTA 2H1YA 5HBMB 3FCHA 3ZZOA 2DGQA 4OHVA 4RW6B 2B4UA 2DB1A 1HARA 4DV2J 3FBCA 2E7WA 3I0RA 1Y1VK 4KSEB 5IQ6A 3CD5A 4FPIA 3M9OB 1AUDA 2ZZMA 4ZITA 1UW9A 3EVWA 5G4DA 4K4ZA 1YJRA 2EVZA 3PHEA 5HI7A 3G71S 2XZTB 1TTHB 3M4XA 2BANA 4JI3F 5DM6Q 4W90B 2HHPA 4TYBA 2YH1A 4MKBA 3S17C 5KFIA 4C3JC 5C25B 3S1MC 4OFZA 4C97A 1X9MA 3UNYA 2AJQA 2JOQA 1YTYA 1SIWB 2IPOB 5HROB 1F5CA 3QAEA 1HWJA 1FEEA 3PRBA 4DF8A 3M2UB 4DZ6A 3EGWB 2R92A 3HSDA 1FE4A 2PSZA 1GE9A 4RNFA 1NHKL 2MSTA 3KJQB 3EX7B 2BE9B 2HFZA 1C1BA 1Y3KA 4U9RA 4IKAA 3S1RC 1RAHB 1U0SA 3GTYX 2DR7A 4J7CA 3W2WA 1P9QC 3CCES 1HR0J 4ZVPB 2HEKA 3LW5C 3JTOA 1YJ7A 4RWXA 5THWA 1WC0A 4GTBA 4DL5A 5F8LA 5A8KA 4MIBA 3UDLA 1NDPA 1FE0A 1SPBP 3DMJA 4Y2KA 3OTEA 5D0HA 3M6XA 2Y0SD 1N36F 3OTCA 1EJ7L 5CZXA 2B4VA 2DNZA 2HWIA 2Z58B 1P27B 1JX4A 2DR8A 2DNKA 3MF5A 3VV2B 3CJSA 2X1AA 4A8XA 3UNGC 3FHZA 1FFWB 2WONB 4LFCJ 2HRYA 2Y3YA 2NS1B 2VJUA 1Y1VC 2KXNB 4DV2F 3HSGA 4N7TA 4NA2A 1JLEB 4CCHA 2P6SA 4WFYA 4DMZA 3G6VA 3JSYA 4A3MC 1KKHA 2B56A 4X84A 4M94A 4WP8A 1WJ9A 4WK3A 2VF3A 4RWWA 4CRJA 1OJ4A 2XI3A 3VHQA 3OL6A 3MGJA 5B0FA 3PKMA 4K4SA 4RW7A 1XERA 2BJEA 1D9DA 3HXAA 1BQMA 4DQRA 4P6QA 1CULB 3J7ZT 1JXVA 4CP5A 2AJFE 4EBEA 4ENOA 3TTGA 1Z2LA 4OZJA 2GGPB 1C4CA 3VGUA 4DR5J 4TVAB 2RIJA 3CEDA 5FIIA 1OPZA 3PXGa 5HMYA 2B4PA 3HOUC 3MTKA 2VBYA 4C11B 2Y1JA 2IDEA 1NSQA 2VBWA 2HQCA 3M8YA 1G2EA 1U2RA 3S2HK 2KJVA 2KFNA 3D5MA 4OJ3A 1QTMA 1VJQA 1HR0F 2MHNA 4F2SA 2Y9HA 1UV7A 3U1NA 2F7VA 3UWTA 1KEKA 2J0SD 2EBEA 2ZEJA 1JIHA 4USKA 3BSAA 1B0VA 3GTQC 4USIA 5B0DA 1KTVA 4BLAA 3RW6A 3UFCX 5KG5A 4B08A 3EGVA 3RBDA 2H5IB 3OVSA 4G65A 2C1EB 3BKFA 2M8DB 4J9RA 4O4GB 2JJ4D 4DU7A 1SL0A 4CZCA 4U7CA 1VC0A 9RUBA 1S0VA 2J76E 3HT0A 4LFCF 4HHJA 1SIZA 3ONQA 4YG2A 4EYIB 4ECVA 2VPYB 4MFBB 1DTQA 4MYUA 1IBLJ 2BYCA 2IRUA 3MAQA 2RKIB 2V69A 2CPXA 3SQGB 5D4OA 2DY1A 4U7UD 5E3CA 4MEXA 1NSAA 4KGXB 3D3BJ 1KC8T 4URQU 2XMMA 3PG9A 3GJSB 3K2YA 5CJ9A 5IXUA 1VRTA 2CKWA 4ZA1A 1H3DA 1T8EA 4YY3J 1R8AA 5KFRA 5HN0A 2KT3A 2AP6A 3AOAA 3BUEA 1HA1A 1FCAA 1QLNA 3NS6A 4DR5F 2IBOA 3TP2A 3IG1A 3KOAA 2HBYB 1SUQA 4OLPA 4AL7A 5DZ7A 1YIJS 3AFGA 2QMUB 1IBCB 5D0GA 1T9XA 3CC7S 2M0GB 4Y00A 2KI2A 2Q43A 4ID5B 4XSXA 1KLNA 3CCTA 2WVFA 2AJ1A 3I4HX 3EUNA 5GMEA 3TAQA 2CFAA 3LPXA 8ATCB 1CC7A 1LEOA 2DXFA 2GJ2A 3MR7A 4G7OA 4ZPCA 1IBAA 3AAWB 4M5IA 2XMAA 3I82A 4NX9A 1B4AA 4M5JA 2HVEA 3KK1B 2VG5B 1X4AA 1YVFA 3QFWA 3TQEA 4LSNA 3MFHA 5KFPA 5GAHI 3DC2A 1WG5A 3OVBA 1MMNA 4ZPTR 3OHBA 2AQ4A 4N56A 4FYDA 1RTDA 3MUMP 4C45A 1H2TZ 4TY8A 4ZVEA 2NVYK 3D6FB 5F8IA 3D67A 4RR5A 1TZ0A 3H90A 2FQOA 5IM0A 2VIHA 1RHRB 1FTRA 1DLOB 3THTA 3MCMA 4HTJA 2KHDA 1TKZA 1BXNA 3TFJA 1RAJA 4QBUA 2B5JB 4YN3B 4A8FA 2DNRA 1JQGA 3LTOA 1EETB 2P2CB 4DS5A 3HHNB 3W64A 1LWCB 3W1YC 5HP1B 4KBIA 3SBMA 2XG8A 4KKOB 3CCMS 3MM6A 1NKBA 4Q8FA 1KLMA 4B17A 4EFAC 3GJTB 1R8HA 3CCJS 2Z2MA 2CQ0A 4WKYA 3Q22A 3GEEA 1FK9A 5H9FK 4X4OA 2XHWA 1X31C 2RQKA 4YY3F 2DY9A 3UE2A 3JSMB 2OO4A 3KG0A 4LIRA 2GHPA 3VGSA 2DNPA 1NNDA 2Q6CA 4M5GA 4UUXA 3HJVA 4QYZK 1WQFA 4KAIA 1PC5A 3I5CA 3QMQA 3M8PB 4USUA 2ASYA 4ATNA 2RJZA 1DTTA 4X4RA 1FJGJ 3GQCA 4V1Ak 3TUZC 1CJUB 4CLYA 1DY3A 4C8LA 2G1HA 4KMHA 3PIPQ 2CJXB 2YNFB 4X6AK 2YWKA 3I0SA 3ITHB 1Y1WA 4GZYA 1S6OA 1NPPA 4OI6A 5GAEI 2L3MA 4USJC 2E2IA 3Q8RB 1FRJA 1FEHA 1H0HB 5J1EB 4LSLB 3GR1A 4C8YA 8AT1B 3GLJA 3NNCA 1S1XB 3H25A 4GMKA 2H5JB 1SC1B 4KIAA 2HVZA 2XGQA 3KHHA 2DIUA 1JLGA 3QGGA 2ZOGA 1VLYA 1N5YB 5KG4A 3N0BA 3KLEB 2DISA 2FVPA 1ZA2B 4CM2A 2LYVA 4RJVA 2MKJA 2G0IA 4CIOA 4Q43A 4WIQA 5KFVA 4CO4A 2KRRA 3TOQA 3RBXA 4H4OA 2DH9A 2NVYC 3OXLA 4OQJA 4ANEA 1YBTA 5DDRC 4DSFA 2EW9A 5HMZA 4UZCA 4KT0C 4TLRA 3PTWA 3KLHA 2WAQD 3NMRA 3CCQS 1XWLA 4AYBD 1ZTWA 2OFHX 1WKLA 2PFFB 3BO3A 2N7YA 2PIIA 3PDNA 2EEYA 3K8VA 1PGZA 1WHWA 2VFSA 4OZ3A 1TWFA 5D0RA 2XS7A 2OPSB 1TU0B 2G4BA 2WB1L 1SH0A 1TWAC 3DI6A 3W9JA 2XZWA 3EQLA 3OUYB 1FDAA 2H9ZA 4UF4A 2KG1A 2C3YA 1U6FA 4TLQA 3FCVA 3KWMA 1TK8A 2IVYA 3FCWA 2HMIA 1SVDA 3LP1B 4DPTA 4D3HA 4X2BA 3SXLA 5ETTA 4QOTA 4MIAA 4ZIWA 1X9WA 2QA4S 1KDNA 2VG7B 4R8UA 2MEWA 3G6YA 1EQMA 5AE1A 1FJGF 4DCPB 1JNRB 1LW0B 2V94A 3J7Z5 4KGZB 2ILYA 3OT9A 4XTTA 2R8KA 2DNOA 3N5FA 2PE8A 3C6TB 5L9NA 3TWZA 5E33A 4HACA 3EWGA 4DS4A 2GJFA 1N34J 3R2CJ 4ELVA 1T11A 2ZE2A 2FJAB 3MR2A 3ZTRA 3AT1B 4I6YA 1H2UX 3HLUA 2OFGX 2R92C 3PO2K 1QE1B 3HVAA 2UUBJ 2HHQA 4LQ9A 3DDIA 1X5PA 3E01B 4KN4A 2KU7A 4E2FB 5B09A 4MEYA 2IRXA 4ZHRB 3S15C 5HL7Q 5IC6B 2W01A 1JLQA 2XWYA 1Z2ZA 2JNJA 3IRWP 1A7GE 4AQYJ 1PC4A 4Z7CA 1S1VB 2DHXA 3WC2A 3M32A 3KK2A 4WPAA 2A3JA 2J7UA 1FF2A 1SMYA 5IYCC 2GVZA 2IIHA 2QFIA 3GTKK 4RL1A 1NH8A 1JJHA 1K8AT 3K5NA 3KJVA 1TWCA 2AX0A 1T94A 4F4XA 2EFGA 4LK0A 3ZZRA 3W9IA 4J9OA 1IR1A 5JVHQ 5EHHA 2HS4A 4HI1A 4ZN3A 1XQIA 1JLBB 1JQWA 1BQXA 1U09A 2J6UA 3K57A 4OIPA 1RHKB 5KFJA 4Z37A 2M88A 5L39A 2WVBA 3BP3A 3MM5A 5KT2A 2UXDJ 3HVTA 2V8GA 3B4MA 1M90T 2A6MA 4JI2J 4GO7X 1YBUA 4YDXA 4YOEA 1RWOB 2GCFA 3MAAB 3RZOK 1FHTA 1REVB 3HFVA 1AZSA 2GA7A 1RTIA 2C2KB 1VBKA 1D0EA 1XR6A 2XZDB 2FC9A 5IQQA 3M6VA 2V4QA 1M5HA 4EO8A 1VI7A 5KFDA 3FRYA 3VAMA 4A3DK 4CLWA 1BJTA 4LOWA 1KVJA 3EPIA 3KKFA 2RVJA 5AXNA 5HMXA 3HKZL 1KQGB 4Y7NK 1N34F 3HHKA 1CJTA 1UVKA 2ZJRQ 1U1KA 3RYLA 2OEKA 3PO2C 3MM9A 3VZIA 3KLVA 4KAWX 2K06A 4DQPA 3O44A 3RB3A 2WBMA 2MB0B 2OHDA 2KG0A 2UUBF 5ETVA 2O67A 3M2UA 2ZH3A 2KVQE 1EKSA 2XMVA 3L9ZA 5C4XK 3H0PA 3OREA 1ELOA 2GQCA 1T03B 1TL1B 1P9YA 4AQYF 2VASA 2RH3A 1S1WA 4OYBA 3FOEA 1U2FA 4KM8A 2HNZA 3V6DB 3PO3C 1LV5A 1L3UA 4O3PA 4C98A 4FF4A 2K2PA 1RT6A 4PQUA 1R9TK 4QIWL 4A3CK 1IKXA 4LSZB 4J9NA 3GG1A 1HD0A 1AB4A 3HSZA 4CLPA 1ULRA 2H4WB 4ER8A 3DGPA 3R6GB 2IYGA 1B4SA 2CJ9A 1SFOK 2DNYA 3R5BA 1MU2A 1MNEA 2IDLA 1WOOA 2DGVA 3RRHA 2RD5C 2KB2A 4JUZA 3S1TA 2RGRA 1SKRA 3BPSP 4GFQA 2NXEA 3MR5A 2LP4A 4KB4A 4YB7A 4C3MA 1IR2A 2R2TA 2MHEA 2UXDF 3QFHA 1GTEA 1JKHA 1GMWA 1UFWA 2J9CA 3IWNC 3BQ1A 1LK7A 1JNZB 4KN7A 4CYUA 1X4CA 1JLEA 4JI2F 1R31A 3RZOC 2UP1A 1PJ7A 2PA3A 4OHYA 2COLA 1KVKA 5K14A 3G4AA 2Q3PA 3MMJA 2LECA 3W9HA 3VWSA 4L74A 2FIUA 1XZQB 3IP0A 2DR5A 2IJFA 1AXQA 4A3DC 4GTCA 1FRXA 4IFYA 5ITHA 5D4NA 4Y7NC 2WZ1A 3HHLD 5LXRA 2N3OA 3SCLE 1WDDA 3RAXA 1WACA 5BXIA 1ITPA 1I50A 1S9EB 5KT6A 2ZUGA 2J6SA 1VBXA 5L1IA 4XSZA 2OMOA 4OIXA 3QNWB 3GTGA 2R8HA 1Q4RA 2NR0A 3MURP 1NPRA 2Y0BB 2WVDA 4MAKA 1YBAA 1I6JA 5C4XC 5F41A 5DGBA 4J37A 2ZBCA 5J1PA 4H54A 1XZPB 1RU0A 4RW9A 2VV5A 3IBCB 2UUWA 2WB4A 4WK1A 4K5SA 1HHSA 5A8WA 3OR1A 3RW7A 2W4PA 2WSCC 1R9TC 2XCQA 4NLXA 4A3CC 3EXCX 2D6FC 1D8ZA 1C0UA 1KONA 5E5NA 1WELA 3MZIA 1LWXA 4YQWA 1Q7YT 3BDPA 3KLFA 4O3NA 3KLIA 4KGKA 1SFOC 3CT9A 5C42B 1E6YB 1E6VA 2FQTA 1L3TA 1N6QA 3IGVA 4IQXA 4PG6A 3FDSA 3QJPA 1HNWJ 3CD0A 3FSIA 2P5VA 2M52A 4QW9A 1HHTP 4O4GA 3TAMB 1FNXH 5KG3A 1SQEA 2RU9A 1XBWA 5FLMK 2VUMA 2HGNA 4F3MA 4PWUA 1RAOA 3MR6A 1FERA 5J1NA 5LSRA 2W9BA 1BS2A 1LFWA 4AFFA 4M5MA 4C6AA 2F8EX 2VODA 2F40A 5C4JK 3MM8B 1RTHB 4K2JA 4RX6A 2VB6A 4DG1B 1BQNB 2QLBB 4O44B 9ATCB 5KFTA 4IFVA 4NLTA 1P1LA 4NZ6A 1ZH5A 4ILDA 3PVXA 1NPKA 4BBYA 4TQRA 1EHWA 1S77D 2OH2A 1TL4A 4YP3A 2CZ4A 3QSIA 2ALYB 1I3OB 1L3KA 2CQCA 1TELA 3HX9A 3HXMA 2OMLA 4ZVSB 4TU8A 1FKPA 5HAOA 1WOSA 2BOAA 4GTLA 2CQDA 2AEJA 3TVKA 5GADU 3DRRA 1O27A 2HBRB 1HQUA 5MAOA 1K83K 2JL9A 3HF5A 4OJGA 4KGVB 1MN7A 4P72A 4IG0B 5HVFA 3Q2TC 5CHPA 3C6UB 4JI5J 2HFSA 1RWVB 2E2IC 1R27B 4OYOA 2R7UA 5A76A 1D9AA 3RZDK 3QT5A 4LR9A 3QO9A 5BYSA 4LJZA 2DH8A 3QT8A 3KMQA 4I2PA 2RS2A 1U8WA 5C7PA 4Q4ZA 3FBBA 4BBSC 4RKUC 2FJDB 1XR7A 4GO5X 1DQ9A 1NCLA 3ISND 3KK1A 2KRBA 2OELA 4LBIA 5F3TA 5A0YA 3MFIA 1UJ5A 2I5JB 2POKA 2HVHA 1AFJA 1M5PC 3K7AC 5BYQA 2V0NA 2QE5A 1S0NA 4DV5J 1XTZA 5F9LA 1HNWF 2KHCA 2LVWA 4W92B 4HYKA 2ZBQA 3SCKE 3PFEA 5J2NA 4ED8A 1GEHA 1LFPA 2W2MP 1VJEA 3GTMA 3TW0A 3DLBA 2J8AA 3GTOK 2C2OB 1F9EB 1HHQA 4BY7C 1CJVB 4A3LC 2ZNZA 1RAIB 3TJAA 4CQ1A 2QLFB 3S0XA 2DHGA 2JFKA 1XMQJ 4DCOB 3P5TL 4TQSA 1TWFC 4GVBA 1YWXA 3MD3A 4FF3A 3VGVA 3H0GA 1J5EJ 5I3UA 5K9FA 1V9OA 2QTWA 1UWBA 3TNVA 1S9GA 4DL2A 1U1LA 4WFBQ 1SV5A 3HHEA 1IBMJ 2NVQC 1D1UA 3MECB 3I31A 3PKYA 3L95X 4YB5A 2R7OA 3GTLK 2YNGB 2AGOA 3VAFA 1IS1A 1U48A 1TAUA 4U67Q 4A8QA 4DR3J 4UQGA 5K8PA 1O28A 1YZ7A 1VRUB 4JI5F 4S0MA 4B9LA 2R4FA 4OIQA 2DXEA 4DQSA 1MWYA 1PAUB 1RT2B 5AE3A 1NO8A 1KD1T 2KT5A 4LSLA 1ISEA 1ZA1B 3BN4A 3D9BA 2GJIA 2X1GA 3IRXB 1RI7A 5DS7A 4Q8EA 2BJ8A 2YWWA 4RBTA 3PV8A 1FJEB 1RDRA 3PNIA 1PYOB 1IBKJ 3NS7B 5HVHA 1WCMK 5KT7A 2CJYB 2F5GA 4U95A 2RF2B 3GCXP 3QRRA 3GFYA 3I4MK 1URNA 4Y0FA 1RYSA 1XN9A 4IOBA 4B9VA 1IL2A 1XPPA 4C0OC 4DV5F 2M8HA 3HVWA 5LMNJ 2O3DA 5GVQA 3LUYA 2P8TA 3CPWR 1XR5A 2CPDA 1M0SA 2IFXA 3GTOC 4P7TA 2GMJA 4MT1A 1VQLS 3NBPA 2O1PA 2MZTA 5CD4H 3GB0A 5KFLA 3EGNA 1F2HA 1OSDA 1IKWA 3QT6A 1Q5YA 4MK8A 1TWCC 5DQHA 2Y1LB 4A3JK 1S97A 1WC4A 2WRMA 3R5AA 4FYXB 3RRGA 5AJ3J 1Y5IB 2W4DA 1XMQF 3FUYA 1U26A 2KVIA 4FF2A 2BRKA 3TRGA 1NHUA 4ANDA 4WYLA 3MMCB 1KHVA 5HMWA 3F0NA 2N4CA 5DO2A 1YJ9S 3OJUA 2QGFB 4Q0BA 5ADZA 4WKRA 4XPEA 1U0HA 5F3ZA 2R7VA 1JLCB 1J5EF 2AJ0A 3FQKA 2M7SA 4HT5A 4RUCA 4CH1A 2VU5A 3SI8A 2W1BA 3H5UA 2QLWA 1ZS6A 1IBMF 2MQOA 2DHAA 1MMLA 1YZ6A 2OUGA 5C3EC 1KP6A 4DR3F 2DRBA 4KO0B 2LQBA 2BQUA 3V2UC 2D3ZA 5ETQA 2DNMA 3MPWA 1MWZA 3DHXA 3C6TA 2R8IA 1FRLA 3M2RB 2CQGA 2EFNA 1Q7LB 2RB7A 2QYGA 2ZJPQ 2BQRA 3TARA 1QVGR 3JB9k 1VIXA 2B51A 1Q8LA 4ITSA 1MROB 2HHWA 3C3LA 1X4GA 3HZEA 1I1GA 2CJAA 1LK5A 3GPAA 1U1NA 2ZD1B 4Q5SA 1F93A 2VZ9A 3FKBA 4A93C 2DJWA 2GAGC 4WU2A 2M9KA 4DR7J 5CA5A 4ZHRA 1JOEA 1T9WA 2B8PA 2NVXK 1ZQ1C 2GSUA 5KT5A 3HJFA 2A0FB 2ZZTA 3BGRA 5LMNF 1RGVA 2VA3A 3D28A 1NAQA 4PYAA 2PT0A 4KJIA 4UOFA 5C2GA 3R2DJ 1N8RT 2KYXA 2IM2A 3CJTA 1HWKA 3L4BC 2B8QA 4HH1A 4A3JC 5T7LB 4A8YA 4I6WA 2JVOA 4DDFA 5JJBA 3LQVA 4D3GA 1O25A 5AJ3F 3ILJA 3TUIC 3HHDA 2K8GA 2VD3A 4IH5A 2YNHB 1IQ0A 4DQQA 3BB5A 1TAQA 5B7WA 2M4MA 4J9QA 4OI0A 5BYRA 2UZAA 4U8VA 4WYWA 1X5SA 3GILA 2V6SA 3CDUA 4BC7A 2MQMA 3OL7A 4IG3B 1AT1B 3I55S 4OYPA 2MQQA 4KH0B 2JEIA 5HQLA 2FVRA 1R0BG 3LANA 4DX7A 2D3O1 2YWFA 5TJ3A 1TL7A 2HQIA 1X4HA 2XM3A 4G1QB 2BW2A 1HI8A 1WHXA 3PW2A 2BMBA 1B0TA 1N5SA 2AZ1A 4M5DA 3G8TA 3RZAA 3VZHA 4NZ0A 4CLZA 3I56S 4G1IA 3CJ5A 3NXZA 8RUCA 3FOFA 5M5WK 3GR0A 3SDEB 3VA7A 1UAWA 1YRUA 1RBOB 1VGYA 2CADA 4KRWA 1RJJA 4ZCKA 3GTGC 2R8JA 4IO9Q 4M8LA 3C15A 3BZQA 3SCJE 1N56A 4NZ7A 3DLEB 4PCQA 2EG2A 2HBZB 1HPZA 2KDOA 2NVXC 3HP6A 4ZDNA 4DR7F 4XK8C 4DPXA 4F67A 2HYIB 1KNZA 4IR9A 2D7SA 3WBZA 5FDLB 3ZXWA 1T03A 2CQIA 2D9PA 1Q16B 2YNIB 1UZDA 2R93K 3TR5A 2U1AA 2K3KA 4NI2A 1Q5VA 4LIWA 1VJWA 2XS2A 1Q1KA 4PG7A 5IP7C 4KH1B 3NGRA 2NSBA 1RU1A 1A9NB 2L41A 1XXAA 4LT6A 2JWNA 5E3QA 3BH6B 3NL0A 5F8MA 4DR4J 5EDWA 2LKZA 3RR8A 1Y0HA 3SEOA 3PHTA 5GMKa 3W61A 2CXEA 4USVA 4BCAA 1IWGA 1RUSA 4OHZA 4ALZA 1IKYA 4KB7A 3IAM9 2GZOA 1U45A 2VUMC 2YX7A 2LDIA 3RTVA 2FQQB 3EZ5A 4DV4J 2JVRA 1Q8IA 1Z1ZA 3DRXA 4CNZA 5I42B 1LQ9A 2FHJD 1SC4B 1BC6A 2D69A 2C3MA 1WF2A 2P9CA 3GE9A 1Q82T 4OZ2A 5JMNA 3UCZP 1IQZA 2HZVA 1JK9B 2ATCB 3Q86A 2WVEA 2GHVC 4YMEA 2HHTA 3R97A 4FXDA 3CSKA 2HHUA 4C2MK 3S2DK 4X64J 2PA8L 4LF1A 3BSCA 5HQMA 4RO0A 2JA7A 4NLRA 2YBVA 3B78A 1IN0A 2K7KA 4GTFA 2H51B 3B6BA 4R25A 3KMSA 2J9DA 1AUSL 4ZVQB 4OZ0A 5E7OB 1XEZA 2HURA 3BR9A 3GSIA 2DCUB 1HKAA 5BR8J 3K5MA 1S1TB 5L38A 3M4OK 2HBQB 3ICLA 1R89A 1SL2A 1WKKA 4A3GK 3DDNA 3DLGB 5EUHA 1UP1A 3W2VA 3KDOA 3NWGA 3QQCD 5KFZA 3GYNA 3CJ4A 4C3IC 2LA6A 2R7TA 5CYQB 1TV6B 3EDRB 4NYPA 4BY1K 2AKWB 3KK3B 4CTAB 4LF7J 3FEZA 3R5GA 2W2PP 1F5AA 4IRDA 3Q24A 4NLPA 4WBFA 1CJKA 3GIMA 2KFYA 3MI7X 2MY8A 4ZCMA 3PYEA 4PWDB 4Z2XA 2R42A 4DN9A 3GSDA 4DR4F 4G0VA 3UN3A 4WTYA 3PW7A 4ED2A 4CLLA 3RU0A 3LPYA 1ZVUA 1WNEA 3W8PA 3AQOA 3TFHA 2MDAA 4OI1A 4ZK7M 3AB4B 4ANCA 1HBUB 3W65A 2XYPB 3TAMA 4WE1A 3Q8PB 1VQ6S 1RAAB 5DETA 3FBEA 3LA0A 1FFSB 4DV4F 4OJHA 2J0QD 2CNKB 3O3LA 4C8MA 2YKQA 4E98A 2V9KA 1B3TA 1VHFA 1R0AA 1B64A 4N8OA 1D3WA 3MPVA 2XY5A 2ZDOA 5KFWA 3H0GC 2IBKA 3FQLA 1YSJA 1SXLA 3M30B 4K4TA 2JA5K 3NCPA 4C2MC 3S2DC 4FM9A 1VIOA 3V4IA 3D1HA 2NXJA 4X4NA 2V50A 4X64F 4WZQA 2YU9A 1HNIB 4ZVUB 4LF4J 1B70B 3DOMB 4NLQA 3NNHA 2XYHB 4MMOA 1W7WA 4FF1A 5T14A 2HPUA 4YFNA 2RILA 4DDQA 4USWA 2VDIA 3OFHA 3K5OA 3P8BB 4BBRK 3Q8QB 2E1CA 1BDFA 2ERRA 5BR8F 4I6AA 4A3GC 4UOGA 4DPYA 2JZ5A 1TK0A 4A3FC 3L7UA 2ZBPA 3CCUS 4CLKA 4IG0A 2YKMA 2GMLA 3MOJB 1GTHA 2G0JA 2RH6A 2MGZB 1N52B 3NCQA 1RT3B 3ELHA 2HW3A 2AYBA 3G96A 1RT4A 3W66A 3SYZA 2FPHX 3OTOJ 2EFQA 2B0GA 1Q0NA 4LF7F 3RGIA 5B0AA 1NU4A 2O5DA 2ZWPA 1KRPA 3LP0A 1F0XA 3MMAB 1CS4B 3RAMA 2MKYA 3ENVA 1LWFA 2MQPA 4PG5A 4A3BK 3CF5Q 3FKIA 3VAJA 4UT4A 4C0BA 1FXLA 4ZPAA 2PGCA 4PG8A 2G0CA 3KHLA 1U49A 3S14C 4B9SA 3IS9B 1SJ1A 1H7WA 4OX9J 2DGTA 3QWPA 2DGXA 4NYOA 3VR1A 5H9FJ 4OI3A 1VBYA 5LJ5Y 3I9V9 4KE5A 3W5YA 3P3DA 1XMOF 2Y3PA 4JB8B 4ZH4A 2K7JA 4MJKA 2CZVC 3MEEA 3M2VA 3P4UB 4AUKA 5KG2A 1UW4A 2YQ1A 1RCXB 3DYAB 3S01A 2KO1A 1PILA 2RSQA 1ZM4A 4EK2A 1RWWB 3DNCA 4NOHA 1O51A 3B54A 1HMVA 1O2FB 4MTPA 3EM1A 3IWXA 5F9NA 4LF4F 3QGIA 1RT7B 3L7PA 3M8WA 5B08A 3IN5A 4U6PA 1FKOA 2BA9A 4BBRC 3S1NC 2GQQA 1WQGA 3K0JA 3TX0A 2YNGA 3S6EA 1L3VA 4NEYA 4A8OA 3DRPA 3L3CA 3GTJA 4Q7AA 2H48B 4I7FB 1TKTA 3B8HA 3KLGA 2VDHA 2J0WA 4KMDA 5J2PA 3K8WA 5H1SV 4PUOA 4PKDB 3V6HA 1MG7A 1U8SA 1VC6A 1RKIA 3M3YC 4RW4A 4UTGA 5A8RA 4F4KA 4J3NA 1USMA 2PHCB 4HTIA 3N79A 1Y5NB 2OLWA 1DURA 3TUPA 4B3OA 2B43A 3OTOF 1TUVA 1GNKA 2MQNA 3T1YJ 2YPZA 1UVNA 1VK3A 3GU0A 2O5JA 4A3BC 3IWLA 3DOKB 4LBPA 3KNGA 4CO1A 4PABA 1S5ZA 2B6AA 4B9NA 1NDLA 2AYEA 2N4DA 3CDBA 3M9MB 2F1FA 1HWLA 2DD8S 1G7CB 4I67A 1J6VA 1DAXA 3L7OA 2R8GA 4I2QA 2ZHBA 4DSJA 5RUBA 3MR3A 4YFUA 4OX9F 3RB4A 2W9CB 4U8YA 3KTQA 2MKKA 1SJQA 3WQPA 2VKRA 4OV6A 3F73A 4NMXA 3CJQA 4NLOA 1FWPA 4FDFA 4LR2A 2XHCA 3IGNA 4NCGB 2BE2A 2ASDA 3Q0AA 3E3XA 3CCSS 3I6PA 1C0AA 5IFMA 1O6XA 4V19J 3D6MB 5D4PA 4USMA 3MMCA 2KTQA 3TUJC 1QM9A 2M5YA 3MMLB 2HWTA 7FD1A 2WTFA 5J2QB 2JA6A 4DJBA 1TWHA 3LAKA 4QIFA 3S17K 4H4KA 3D1OA 4C3JK 3CD6S 3S1MK 1LW2B 3V6KA 5B0GA 2NXCA 2R3VA 1U25A 1QJHA 2ZH5A 1TKXB 2WSFC 4DR1J 1SBRA 3D68A 3FFIA 4OYZA 3SQOP 1SH3A 1IR0A 1GAOA 2XWXA 5L1JA 4O3RA 3R8YA 4M1XA 2ZKUA 2OPPB 3UVJA 1BUXA 4KQZA 6FDRA 2OPQB 2RAQA 4P71A 1IE0A 1NZAA 1N5TA 3ZZ0A 1YHQS 2VG6B 2A6HA 3QIPB 4Q44A 2FGOA 1YQHA 3SSRA 4JBCA 3C16A 4DF4A 5KG7A 1H73A 2KJWA 2E1MC 3RB0A 3EGZA 1OO0B 4ECSA 3ENWA 2DYAA 5L8RC 3Q8UA 2BZ2A 2IAJA 2HGMA 4UZBA 1Q78A 2O5IA 3PRVA 2FDNA 4U7UK 1TVRB 1WG4A 2VJVA 5CCMA 4FS1A 1EP4A 3EZOA 2OEMA 4A8MP 3M05A 2ZOMA 3J81Y 1S57A 5LMUJ 1H38A 2XCPA 2AHOB 3CUNA 1RT5A 3LF0A 2W24A 3D7SB 1X4BA 3H5XA 3FNNA 4TXSA 4CLTA 3T01A 2KM8C 1YITS 4C8NA 4A3MK 2KZZA 3D1QA 1G4CA 1OMSA 4HH0A 4ZVFA 2ZWOA 2ZOFA 3NOGA 3JTNA 1WEXA 1KS2A 4QJVA 2UUAJ 3SCIE 2V63A 5M5YK 3LAJA 1SKWA 2NZ4A 2K1RB 2I2YA 4YHHJ 3I4NC 2X7IA 3J81U 5EWGA 4WF9Q 5C44K 1F5BA 4IO1A 2OPRA 2I6WA 1DD5A 2DNQA 1JJ4A 3GIJA 3SIPB 3UD5A 2U2FA 2Z8QA 1XXBA 4H4MA 4WFXA 1UEUA 2ZUEA 5F8NA 2X51A 3JQJA 2GO9A 3PJXA 1CPZA 5D15A 3G6ES 5KT3A 3HDSA 1SKUB 2A1BA 5M5XK 3HSJA 2QA4G 3FSYA 4DR1F 4EBDA 3HOUK 1JXLA 2IC3A 3QATA 4IDKA 2XLIA 1VC5A 2HVIA 1IKVA 1KFSA 1KN6A 4DL3A 3PYDA 1HBMA 3ZNJ1 2FVQA 4TYAA 1FWKA 4OX8A 2AEFA 1RT1A 3N6NA 4JV1A 3THPA 3MPUB 4TN2A 2CPFA 3POTB 1SC6A 3HMJG 3VAIA 4DFKA 2QJ3A 2GVDA 4G0WA 2B7CB 2IM0A 4XDDA 4X66J 5H9EJ 1AYEA 4GKJJ 2EK6A 2E29A 3GTQK 3MHYA 3PR4A 3I0RB 1KR4A 1WI8A 2KWAA 4DFMA 3VGTA 3D4JA 1K1SA 4M5LA 2CFXA 5DRKA 4PXCA 5IT9Y 1UMJA 5IP9K 2J8SA 1VS3A 2BW7A 1J5OA 4NLSA 4QR1A 4A3KC 2A6EA 1FVSA 1KFDA 2MXYA 4OX6A 2YNIA 3H4DA 5LMUF 2V67A 2BANB 3A8IA 3HHLA 4YR3A 4A8KA 1O26A 1MWQA 1C1CB 1X60A 1YNJA 3CULA 2PMZD 3ET6A 5L9XA 4CNYA 4R5PA 3M1VA 5EWEA 2AZ3A 5ETOA 2J6TA 2GHWA 3PIOQ 5M2UA 1OIAA 5IT9U 4Q45A 3FKIK 3ZZPA 1NKCA 1IVZA 2ZC3A 3CQZA 3JQMA 4P75A 2UUAF 3JYTA 1ROFA 5C44C 1T7PA 4KC5A 5ETNA 4YHHF 3V81B 3DLKA 3E8OA 1X4FA 4KHPJ 3PX0A 3U02A 4I4BA 5K8MA 1CC8A 2OEJA 4F36A 1C1BB 2XULA 3ZTPA 3BKUA 3UW1A 4AXJA 2NVTC 3V4GA 3MM7B 2XTJP 2MJNA 3NP5A 4WFNQ 3WDOA 4DV1J 1RTZA 2NLWA 1WSRA 1RAGB 1VQPS 4C3KA 4ZIVA 4ED3A 4KTQA 2AEMA 4DBQA 4ZMMA 2RQ4A 3SFUA 1GH8A 4RBUA 2HNYA 3ENAA 4LF6J 3DMJB 2H54B 1OYEA 1F9FA 1I3QA 4ZJOA 3FK4A 2FYXA 5EN1A 2E5LJ 4NXNJ 4YR0A 4DFJA 5SUHA 2CNNB 4X66F 1BWEA 4AL6A 3P49B 4GKJF 2E9TA 3BSOA 1RAEB 4ZVTB 3FC9A 5IOLA 2FLNA 3CCWA 3G87A 5IP9C 1S1TA 1RWNB 2WK4A 4G7HA 2Z2YB 1VQOS 4K4WA 2RE1A 4OJ1A 5AE2A 3J7YU 4P73A 4ZPVR 2YKNA 3PO4A 3PEJA 2Y0SL 2CAJA 4WIIA 2B7BB 1H2VZ 4RW7B 3C14B 2MKCA 4GRSA 4QIGA 4YDDB 5IV4A 1BQMB 1EX8A 2PN6A 5G0RA 2NYIA 4RW8A 4R0JA 4QU6A 4K4VA 2KH9A 4Y65A 1JXEA 1FA0A 1WTBA 1M5SA 2DHHA 4FYVB 4O0IA 4NLDA 2IVFB 4Y2AA 3FKIC 1R6YA 2JFDA 1G1XA 1T9YA 3H5YA 4PWDA 4J9MA 3UDEA 3WZ0A 4PZVA 4F0HA 1URRA 3FZBA 2XMWA 1YG0A 2D3UA 4MH8A 3B4DA 2BE7D 3JAMY 4C3HC 3LO3A 1YCLA 4KHPF 4KV8A 2R7ZA 3R3TA 1C0TA 2FD2A 1U1PA 3S16C 1W26A 3DN9A 4DV1F 2E9ZA 5DM7Q 4B9MA 4LRDA 2NSCA 3D66A 3VVTA 4G6VB 3DRSA 1S7HA 2KL8A 3FZ2A 1FXDA 2ZH2A 4IRCA 1FXRA 2D9OA 3A8KA 3GP9A 2DGWA 2DHSA 5KFUA 4MKYA 4QIVA 1VQ5S 1S9FA 4X4PA 2ZNYA 1YKWA 3T1HJ 1QVFR 1R0CB 1YI2S 3P45B 3K7RA 4B3MJ 4ELTA 4LF6F 3JAMU 4MK7A 4A3EC 2XB2D 1JLAA 2N82B 1RU2A 5JVOA 3D3CJ 3J81j 4HLBA 1I5OB 5TMCA 3DOMA 3UPFA 1Y10A 4NXNF 1QAIA 3OTBA 2ZUAA 5KG1A 4A8WA 3T02A 3CCVS 2DCLA 3GTJC 4CH0S 4WZMA 1EI6A 2XSJB 3OLAA 2EWHA 3OR2A 2AW0A 2AD9A 4NOIA 3PYGA 2QT7A 1EFWA 2VC1A 4A47A 2FY1A 4MIWA 1F9HA 3H20A 1DQAA 2Y8YA 1CBKA 3FGVA 4BC9A 4QQBA 2R7QA 5D78A 4I1TA 1EARA 2A69A 1RP5A 1NZ8A 2NPIA 2UV8G 1H6KX 3S1QK 1TQLA 1YRXA 2HZCA 3GZ7A 1RWXB 1IBLF 1PBAA 3NS5A 4I69A 4LVNP 2ASJA 2V8HA 4IH7A 2EFVA 4WU3A 4UOHA 1HYSB 4ED0A 2ZFHA 4QIEA 3H3VD 4KPYA 3A8JA 1TWAK 2HNDA 4OMFG 2FLOA 3IG1B 1FWLA 2MTLA 4WFZA 1SUQB 2APOA 2BKOA 4NYZA 2HIYA 2DITA 4QPXA 2PI5A 2OKQA 2NUHA 3Q83A 4LRFA 4WTOB 4BWMA 5D8HB 1O29A 1O24A 1NH7A 4EI2A 1EAYC 3G82A 1B99A 1HBOA 1YNNA 3NAHA 4EZ6A 2XBPA 4LQYA 3R7BB 3RRKA 5KFSA 2W7VA 3T1HF 3CCRS 2ALZA 4B9UA 2QO3A 4B3MF 4LSNB 1UA0A 1VDHA 3TEHB 2OSRA 3O2IA 4H4KC 1TP7A 2M70A 2Z4PA 4DX5A 4M5HA 1RTDB 2XNQA 3TQ1A 3N6LA 4TY8B 1YJNS 2MQLA 3KUGA 1WQHA 5SZTA 3MDFA 3DXSX 2ZH4A 1PG5B 5IM0B 1EB0A 4ETXA 4WJ3M 2V8VA 3CE8A 4ETZA 1JLFA 2R92K 1TKZB 2ASLA 2L08A 4C8ZA 1YRTA 3CIMA 4CO3A 1U1OA 1LWEA 2C2EA 2YVSA 2IA0A 1NK0A 1S1UB 3S15K 1J27A 4RUAA 3MMBA 3BYRA 3A12A 5F0WA 2XMUA 4RNOA 2XNRA 3MM6B 3ILIA 3PY8A 1OQ3A 4O3QA 3MUVP 2CVEA 4F7VA 2FY8A 1UVMA 3S1QC 2F9JA 3EZUA 2FZCB 4JV0A 5IYCK 3H7HB 1TWGA 3CWJA 2UU9J 2B9EA 1RYRA 1U1MA 1FK9B 1S0OA 4MQ9A 3AODA 2HS3A 1Z4UA 3MEGA 4KC6A 3DOLB 3LALA 4BDPA 5A6PA 4B3TJ 3TO8A 1NXIA 2CRLA 1DTTB 3CVKA 2QA2A 2QSFA 3LGNA 4R0EA 3AD8C 4PYDA 1QUVA 2CJBA 2GO8A 4XIUA 2GC8A 4G0UA 1YX2A 3CO0P 1QSLA 1I6VA 3T5JA 1TUWA 3IR6B 2WW8A 4DUTA 3I0SB 1EH1A 1ZM2A 3MD1A 1EK8A 4DV0J 3QZ7A 5DZ6A 4ES2A 1KQSR 2ZH1A 5DDPC 2RUGA 3QLHB 1K1QA 2YWEA 1EKRA 1JLGB 4HHHA 2HHSA 2WHOA 1IM6A 3E2EA 5F0UA 2FVSA 1F7UA 2D3OR 1NK9A 5L46A 2DGOA 3TA2A 3M8ZA 2IA6A 1LNQA 4P7VA 4P2XA 1HBNA 3HOVK 2RDDA 4CWBA 1T9TA 1ZAVA 2EKYA 1OY9A 4ECYA 5KFAA 1GMVA 4ZPBA 1RACB 1C4AA 5D6GA 2OAUA 1NJXA 2ZKTA 2LQJA 4F26A 1VQ9S 3H8YA 2A18A 2FTRA 2C2ZB 4RPFA 4ZVOB 2VOPA 3TZXA 2VONA 2HAFA 1S12A 2OPPA 1S49A 4DLEA 4N8NA 4RNNA 4OYIA 1I3QK 3VTIA 1QSSA 1HIYA 3PO3K 2LQ9A 3DI6B 2VG6A 2JEGA 3QIPA 4CO0A 2LEBA 5DG9A 2JSXA 3CCLS 1TFWA 3RAQA 4YR2A 2RUSA 2E9RX 3KDNA 2A2DA 1VR6A 2W7AA 2UU9F 2V4JA 2J9EA 4F3OA 4C48A 2JA8C 2BM1A 5IOQA 1TMJA 2AYGA 1I51B 2ZJQQ 4OZLA 3UCUP 2WAQL 1PIEA 3DM2A 2XC9A 4B3TF 3MEDA 5IYBC 1K0TA 4R8UB 1QUPA 4ZPDA 1HQ2A 3KNAA 2DTJA 2DGSA 4ECZA 1RKJA 5E3PA 2AGQA 1D09B 3T1AA 1APSA 1INNA 4URSA 5HBMA 4QWDA 4WILA 3HHLC 4RMFA 4RW6A 2BXJA 4CT8A 4IUFA 1SC3B 3PFOA 2HQ3A 3A3NB 4WP9A 4DV0F 3LP2B 1ZPVA 3I5BA 5LL6d 1F3VA 1YDLA 4HACB 3CTRA 3SMZA 4OHWA 2ZVIA 1P6TA 4ZKAA 2RHQB 4F4AA 3R9LA 2ZE2B 1SJ4P 5C2CA 1HFEL 5KFHA 1PCAA 4NASA 2ADBA 3HCXA 4X4UA 1Y5LB 4F0MA 1IWAA 1N5QA 2K1RA 3UD3P 5HK4A 1X5TA 4JV5J 5IOTA 3MCSA 4HDGA 5CQGA 4YEAA 5C25A 3UQSA 3HOVC 5HQ8A 5CYMB 1JLQB 1FI4A 2E1RA 3J7AN 3WIUA 4TKTA 1YK9A 2NVYA 4X4SA 3CIZA 3KK2B 5HROA 2DO4A 1I94J 2QMXA 1UPMB 2FJEB 3TJ8A 2GVZB 2MPUA 2NZCA 2FC8A 1IUJA 1VQSA 3KJVB 1PO6A 2GIFA 4DPUA 4K4YA 3F41A 3Q2SC 1I3QC 4YFKA 1NK6A 4JI6J 4CO2A 5H9EK 2ZITA 4X62J 5L1KA 2IMOA 1KBRA 1CLFA 1VBZA 1RQ0A 4KARA 1UL3A 1O5JA 1R6VA 4OLOA 1N0VC 4N47A 2RRBA 3MM5B 2FHJA 3HVTB 4DN0A 4DSLA 2HQFA 1QSYA 3AOBA 3CJKB 1NEEA 2F63A 1FDBA 3BP8C 4XLPA 4NLUA 2CPJA 4NRTA 2DR9A 4PEOA 1N4LA 5D4LA 4NL5A 4ZP9A 1FRMA 1AZSB 1IJFB 5D4DA 4O2DA 1FVQA 1RTIB 4DI6A 2CNOB 2WONA 2R7XA 3D0HE 4ZLJA 3D0GE 1JWWA 5HLFB 3VAHA 3TVZA 1C1CA 1RLCL 2FHKA 1WDTA 3Q3QA 1N32J 3VAGA 4ED1A 4KM9A 4ICLB 2C3UA 2RS8A 4FNHA 1CJTB 4P2MA 3ENQA 3SFGA 2V8DA 3D2WA 3MM9B 1NJWA 3PACA 2KFZA 4C4WA 1RHUB 4LJMA 3V81A 2R7ZC 2GFFA 4JV5F 3HULA 4DQIA 4OYAA 2ACYA 4UUWA 5IC4B 1CULA 2HGLA 1V5VA 2I38A 1N5VA 4EEYA 3HKWA 1S1WB 2KN4A 3MM7A 2B9XA 4NA3A 2GGPA 2HNZB 3J7YI 1BGXT 4OL8A 5DG8A 4KYZA 3G8SA 2ZVSA 1G3OA 1I94F 2CPYA 3ISNC 2KT2A 4HVZA 1RT6B 4PQUB 3GEHA 1H74A 5E2QA 1IKXB 4C11A 2W2NP 1UEKA 2IM3A 2HHHJ 2LMIA 3CAGA 4YFXA 3NGSA 1WORA 1Y1WK 2YKOA 2YH0A 1ZM3A 2VFUA 1O0PA 3DGPB 2E2IK 2NXUA 4KB2A 1Q8BA 4DPOA 4JI6F 1MU2B 4ECQA 1S72S 2AV5A 3ULHA 4E8UA 2XLJA 3IR5B 3OLBA 1X7VA 3PEHA 1AROP 3MPDA 4X62F 2VQFJ 1HWIA 3LWMA 3KHGA 2EI5A 2QG9B 4BBSK 3OEPA 2NYHA 5B0BA 1RWPB 3KHRA 2YTCA 2DRAA 3C8YA 1JKHB 3QBCA 1X5OA 2RMLA 4IYQA 2L9WA 2CWKA 4ZVHA 2EPIA 1B4BA 3PW5A 5KFCA 1HL6A 4CYUB 4GTDA 3K7AK 3NAIA 2V6TA 1FX2A 4ZLLA 3OHAA 5K14B 1VQYA 1RWUA 4TY9A 2Z30B 1HW9A 2QLJB 3C14A 3FEXB 1FRKA 4FBUA 1SJ3P 2HIQA 4IFYB 3GYXB 1TWGK 4BY7K 2CQHA 5DQIA 1HW8A 4MFBA 5ETPA 2KXHA 4A3LK 3WX4A 5FLXY 3QJLA 2HFUA 2QZ8A 1N32F 3UR0A 2RKIA 3CJ2A 2XMJA 2J5AA 2X1FA 3SQGA 4JV2A 1TWFK 2A6OA 3NCRA 1VMBA 2MMYA 3GG0A 2P5MA 2YKPA 4EU0A 3LWLA 2GIQA 3O5TB 4B3RJ 2R7WA 4C9DA 3KUEA 2PO4A 1PBUA 2QMWA 4RW9B 3OJSA 4F02A 3W5XA 4LBHA 3PZPA 3M6WA 3HFKA 5A8WB 3OR1B 4YS2A 2NVQK 4O0NA 5E68A 1N48A 5FLXU 2BJ1A 2A2CA 3UCGA 4F2RA 1JMTA 3GTKA 4OI2A 1C0UB 1Y1WC 3M9NB 4ZN1A 2HHHF 3KLFB 1O2BA 1R8BA 5A2QY 4ID5A 1V6HA 3KLIB 3Q89A 1LXJA 5KFMA 1E6VB 1WSVA 1N6QB 2GV1A 5A6WA 2HRUA 2GS8A 1R7IA 1T95A 1KQKA 4G7ZA 5JFEA 1F3FA 4MKAA 2HVDA 4ZP7A 1FDDA 4FKXA 3OPFA 4ZLPA 2L9NA 2VQFF 4J9KA 1BWVA 4WCEQ 2VG5A 4GC7A 3IR7B 5KG0A 5KOXA 2HSEB 2XSJA 4P2FA 4ECXA 2W9BB 5A2QU 1NJIT 2V2ZA 2OD4A 4BWJA 2UUTA 2IJRA 3DLLQ 1BY9A 2QSWA 5C5JA 1DLOA 4IFVB 4BKWA 2CA9A 4LF2A 4NE9C 3TANA 2R2SA 1TWGC 3I9ZA 2HS0A 3ETMA 3ZNUA 1K0VA 3CXCR
chains in the Genus database with same CATH topology
1WSVA 3AD7C 3GEEA 3GEIA 1WOOA 1VLOA 3TTGA 3ADAC 1X31C 1WOPA 2GAGC 1PJ6A 1XZPA 3AD9C 1VRQC 5L46A 4PAAA 1WSRA 3GEHA 1XZQB 4P9SA 1WOSA 2GAHC 1V5VA 3TFJA 3A8IA 3GSIA 1PJ7A 3TFIA 1XZPB 3A8JA 4PABA 1WORA 3AD8C 3A8KA 3TFHA 1YX2A 3GIRA 1PJ5A 1XZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSV A;  3AD7 C;  3GEE A;  3GEI A;  1WOO A;  1VLO A;  3TTG A;  3ADA C;  1X31 C;  1WOP A;  2GAG C;  1PJ6 A;  1XZP A;  3AD9 C;  1VRQ C;  5L46 A;  4PAA A;  1WSR A;  3GEH A;  1XZQ B;  4P9S A;  1WOS A;  2GAH C;  1V5V A;  3TFJ A;  3A8I A;  3GSI A;  1PJ7 A;  3TFI A;  1XZP B;  3A8J A;  4PAB A;  1WOR A;  3AD8 C;  3A8K A;  3TFH A;  1YX2 A;  3GIR A;  1PJ5 A;  1XZQ A; 
#chains in the Genus database with same CATH topology
 4F4Y A;  1BE4 A;  2V6U A;  5F8H A;  2B5J A;  1TWC K;  2MKS A;  5ETS A;  2OSQ A;  1NJY A;  1EET A;  4P9S A;  1F1B B;  1LWC A;  5HP1 A;  1KVI A;  4EUV A;  3T19 A;  3VQS A;  3BGO P;  1FKP B;  1MSW D;  4KKO A;  1HYS A;  2XSF A;  3AA8 A;  3BN7 A;  3GEI A;  3T00 A;  4Y3C A;  5EX0 A;  3DRR B;  1BLU A;  2ZH8 A;  3I87 A;  1PYT A;  1HQU B;  2AMC B;  3OXF A;  1IXK A;  4B3R F;  2NRE A;  4J90 A;  5DG7 A;  4FZV A;  3DDK A;  1DBD A;  4M95 A;  1IJE B;  4N41 A;  2OJ3 A;  3OL9 A;  3BGU A;  3S2H C;  3JSM A;  2R7S A;  3RUB L;  3A3O B;  3GV7 B;  3N0C A;  2EK1 A;  2IJN A;  2FJW A;  1S99 A;  4J5O A;  2DEI A;  2MZR A;  4O3S A;  3N5B A;  3IO1 A;  2WBR A;  3H98 A;  3M8P A;  1WEZ A;  2VQE J;  2CZ9 A;  2UXB J;  1RSC A;  4GTE A;  5C3E K;  3QO9 B;  1UPP A;  3EXY A;  4ECU A;  3M8R A;  5E41 A;  4I2P B;  1SB6 A;  1FTC A;  2W4C A;  2F3J A;  1CJU A;  4FXW A;  1ZAX A;  1R9T A;  2AYM A;  2OI2 A;  2W9A A;  4DSI A;  1GXU A;  2YNF A;  1YJU A;  2XYG B;  3C2P A;  3ITH A;  3T9N A;  4EWT A;  1TFY A;  3EVM A;  5A0Y B;  3FJ2 A;  1OSC A;  1DZ5 A;  2DKO B;  1SFO A;  5J1E A;  2LQ5 A;  2RRN A;  3OQ2 A;  2ZH7 A;  3M8Q B;  3EIC A;  5F8J A;  2FHO B;  1S1X A;  2VC0 A;  3M6U A;  4OZ5 A;  2YQ3 A;  4UOC A;  3UI3 A;  3GIK A;  5J2N B;  3H59 A;  5KOW A;  3G2X A;  1OYD A;  2P8I A;  2RU3 A;  2V2Q A;  3MEK A;  3G6X A;  1D8Y A;  1N5Y A;  2DVI A;  2HHX A;  3KLE A;  3BO2 A;  2RNE A;  1UKU A;  3C19 A;  2XMT A;  1LKZ A;  1UJ4 A;  4A93 K;  4ES1 A;  2M2B A;  1RWM B;  2WB1 D;  1S1U A;  3EMT A;  2J7K A;  2GIR A;  2VUG A;  4X4Q A;  2CQ3 A;  4NCA A;  3N6M A;  1RLD A;  2QEX S;  3TEG A;  4GVB B;  3RBZ A;  1S6P B;  4IRK A;  4BHQ A;  4WJ4 A;  4AXI A;  2HQD A;  3U7J A;  5I3U B;  2N7C A;  4NML A;  3HI9 A;  5LSL A;  1UWB B;  1S9G B;  3PYF A;  2QFJ A;  4N77 A;  4URG A;  3R1L A;  2RDI A;  3HOZ K;  2BQ3 A;  1SV5 B;  1IM4 A;  3DOL A;  4AE5 A;  2HLT A;  1XNR J;  4OX7 A;  2OPS A;  2E5G A;  4A3I K;  3BGL A;  3OUY A;  2MSS A;  3QAU A;  5M2P A;  2PPB A;  4QWB A;  2W8K A;  4FNI A;  2YQ0 A;  2LQ8 A;  3LP1 A;  3Q8V A;  1XIQ A;  2OD6 A;  4DXL A;  1WEY A;  3IBF B;  2HK3 A;  2JEF A;  1RHM B;  4JOU A;  4BXX K;  5K20 B;  3NGT A;  4KDD A;  4J9U E;  2QL9 B;  1Y3J A;  3AH6 A;  1U1Q A;  1FD8 A;  2VG7 A;  2VQE F;  1VQN S;  2UXB F;  2V2V A;  2DEJ A;  4AH6 A;  2CQB A;  2WW4 A;  1LW0 A;  5ETL A;  3BKT A;  3S8S A;  3QLH A;  4HL9 A;  3ZTQ A;  2CNL B;  2Y8W A;  1J98 A;  3W60 A;  1K9M T;  1ZBS A;  3CDA A;  2BKN A;  3OBI A;  1U6B A;  1I50 K;  4EZ9 A;  4OYW A;  3L4J A;  1X0F A;  1RZM A;  2G2Y A;  1QAY A;  4KAT A;  3HOW K;  1AB8 A;  3BF4 A;  4MK9 A;  4ECR A;  1IBK F;  3OPK A;  4KHR A;  3GTG K;  3QYY A;  2AT1 B;  2AF6 A;  3IC1 A;  1QE1 A;  3NBP B;  1WWH A;  4GKK J;  4OIR A;  1M5K C;  3ZTS A;  2EXU A;  4FXV A;  1IKW B;  3E01 A;  4HI2 A;  2DPJ A;  1LOU A;  2V5H G;  5JUM A;  1S7I A;  2MZ1 A;  1RIS A;  1HNZ J;  4ZCL A;  1S1V A;  2DXD A;  3BSN A;  1S6U A;  3BDE A;  3NG8 A;  1RAF B;  1V3R A;  2DR6 A;  1GXT A;  4Q0B B;  1U0H B;  1YJT A;  4EYH B;  4EGL A;  3V4M A;  1A0O B;  1EZZ B;  5IP7 K;  2VPW B;  4KPC A;  4XO0 A;  5ETM A;  3HOZ C;  4DCJ B;  3TX8 A;  4ZJQ A;  3HK2 A;  3CDW A;  1KTQ A;  1CQN A;  5KFX A;  3W63 A;  4FYW B;  4A3I C;  1USO A;  1XNR F;  1JLB A;  1JJC B;  2DRD A;  4DLG A;  4X4T A;  2C2R A;  4GTA A;  1C2P A;  2CPE A;  3UDC A;  3MAH A;  3PR5 B;  4DV6 J;  2DNG A;  1K83 A;  1CG2 A;  1M1H A;  5IOR A;  3AXK A;  2X1B A;  3Q8Y A;  4X6A C;  1GX5 A;  4DSK A;  5GAG U;  2VUM K;  3AJD A;  3HKZ D;  1FJC A;  5M3M K;  4BXX C;  3WOD A;  1NJZ A;  3BEG B;  3ZC4 A;  3QID A;  3K58 A;  1KHW A;  4EO6 A;  4YB6 A;  3NEK A;  2V8P A;  3FRZ A;  2NXN A;  4L76 A;  3LP2 A;  4LF9 J;  2R2R A;  4N76 A;  4C0H A;  4ZLN A;  3MAA A;  2MLZ A;  4CH7 A;  2PD1 A;  1REV A;  1VQM S;  4GT9 A;  4BLB A;  3EJM A;  4OZ1 A;  3TI0 A;  1V5I B;  3IFE A;  3Q8S B;  1T9V A;  3TVY A;  2VHG A;  3EDQ B;  1VGX A;  1I50 C;  4PR6 A;  1TR0 A;  2V4R A;  1GQE A;  3HOW C;  3NRB A;  3K5L A;  5CYM A;  1U7L A;  3BGR B;  3S7R A;  5M2R A;  1QY7 A;  1S79 A;  2BRL A;  4QIW D;  4RLE A;  1UVJ A;  3AY0 A;  4B3S J;  2YXL A;  5J2M B;  2CDR B;  3GTO A;  3CW2 C;  4GKK F;  2KYZ A;  4WWS A;  4CLS A;  3N4W A;  1HWU A;  2MKH A;  3D6H B;  3SZZ A;  1VHI A;  1HNZ F;  1TL1 A;  1DFD A;  3GCW P;  4NWB A;  4NA1 A;  1Q8K A;  2VIC A;  2FHM A;  3V6D A;  4C3I K;  3K59 A;  2C42 A;  3G9C A;  4B9T A;  3P6Y C;  1WC1 A;  5AXK A;  1M5O C;  3X3U A;  2AJ2 A;  3TZW A;  5E3R A;  3SSS A;  2AIR B;  2K3I A;  2OTL S;  3AHP A;  2G2Z A;  2MKI A;  3TZY A;  5DLF A;  3DRY A;  1U24 A;  4LK1 A;  1FRH A;  3CJK A;  2G13 A;  3GJR B;  2BUN A;  2Z2L A;  1OY6 A;  3OW2 R;  5L1L A;  3GTL A;  3HZG A;  5IT4 A;  1TL7 B;  5CXT A;  5D77 A;  2HLU A;  4DV6 F;  3CO9 A;  3GTM K;  1HQE B;  3JXO A;  3QPI A;  4Y2M A;  2BAB A;  1PYS B;  1JVI A;  4M5D B;  5ETK A;  1TMM A;  2AWZ A;  3PJ9 A;  1X9S A;  5HLF A;  2HWH A;  1G51 A;  4P5A A;  4LF9 F;  1PAE X;  1K44 A;  4CO5 A;  2EC2 A;  3EVO A;  1WC3 A;  5LXY A;  2ROP A;  4NRU A;  4ICL A;  3BM7 A;  4ED4 A;  4Y28 C;  5D3G B;  2OTJ S;  1HQM A;  4P52 A;  1KQ4 A;  3H0G K;  2Q66 A;  1R3N A;  1RCO B;  1XZQ A;  2BJ7 A;  2B4O A;  3C15 B;  5LM7 E;  3T6J A;  2F8H A;  1WCM A;  1F9N A;  2ILZ A;  2Z57 B;  5LOQ A;  1HPZ B;  1DCO A;  2H65 B;  3CME S;  2CG8 A;  4NLW A;  1FNM A;  4QWE A;  1YLX A;  3JQK A;  1S9E A;  1R8C A;  3PO5 A;  2C3P A;  4LR8 A;  4B3S F;  1U2C A;  2Q6B A;  4NI2 B;  3ILL A;  3PM9 A;  5EGH A;  1LXN A;  3GTK C;  4ID8 A;  4HDH A;  4F0K A;  1DQ8 A;  3HD2 A;  2W2O P;  4A3F K;  1XZP A;  4DZD A;  2KM8 B;  2E66 A;  4M5K A;  3GFZ A;  1REG X;  1RXO B;  1T0T V;  4WXW A;  3KYL A;  3CC4 S;  3O8W A;  5ETR A;  2HAI A;  5CYJ A;  1U4B A;  3BBF A;  4LRE A;  1IKY B;  2ZBI A;  3U27 A;  3W62 A;  2N3L A;  1UFL A;  2H4Y B;  2CPH A;  2B3T B;  3NWR A;  1UVL A;  1PSD A;  3E51 A;  5C42 A;  1H7X A;  1E6Y A;  4JI4 J;  1WG1 A;  1RBA A;  2CQ4 A;  2LEA A;  1FKA F;  1FX4 A;  3THV A;  4X4V A;  3FBF A;  2J7W A;  5IT0 A;  3GTM C;  2I1R A;  4O3O A;  3S14 K;  1FNO A;  4KMA A;  4CDI A;  2EKN A;  1UZH A;  1UA1 A;  2E1A A;  4ZJL A;  3G4S S;  3H2U B;  2WSE C;  2J9D E;  3BBB A;  3HT3 A;  3MM8 A;  1RTH A;  2GSO A;  1ZOT A;  1DCP A;  1I6H K;  1NME B;  3QX3 A;  1M5V C;  2W25 A;  2H3E B;  3QRP A;  1UTA A;  3OSN A;  4DG1 A;  1BQN A;  4O44 A;  5KFN A;  5IS2 A;  1NK8 A;  4JI7 J;  4LFA J;  5EX3 A;  3SV3 A;  4Q2L A;  3NNA A;  4FPR A;  2X3D A;  2LFV A;  4JI1 J;  2JH3 A;  3PRD A;  3WHI A;  3CJ3 A;  2ZUF A;  1VRQ C;  2ABY A;  1VFJ A;  4F4Z A;  3QJJ A;  4AL5 A;  3W2V B;  2NVX A;  4PQA A;  2IYI A;  3QWU A;  3S1N K;  4FBT A;  2EG1 A;  3AQP A;  1FES A;  4TU9 A;  1XNQ J;  4RUH A;  4JP8 A;  3BYP A;  1T9U A;  3DGV A;  2HK2 A;  5C24 B;  2XQC A;  2BKP A;  3BQ2 A;  2PMW A;  1PKU A;  2V68 A;  2JHE A;  3NMA A;  1RBL A;  1CJK B;  3AXM A;  4J9S A;  4K4U A;  3C6U A;  3ZO7 A;  1UCN A;  4TNO A;  2Z56 B;  1ZPW X;  3QSY B;  2HRT A;  3A8E A;  1H98 A;  3M3Y K;  4C3L A;  4L3N A;  1B7Y B;  4LF5 J;  2C2N A;  1H72 C;  4K8R A;  4Y6I A;  1MLA A;  2MQ8 A;  3OSP A;  4UST A;  1FD2 A;  1AW0 A;  4Q5V A;  2YX1 A;  1T05 B;  3ERE D;  2E7X A;  1BMQ B;  4WP3 A;  2E7V A;  5FD1 A;  4LF8 J;  2UVU A;  4UQT A;  4NLV A;  1B0P A;  5DLG A;  5MLC V;  1N33 J;  4WE1 B;  1Y7P A;  2E1P A;  1GFW B;  3IPJ A;  2ZHO A;  2CJQ A;  2I5J A;  3AB2 B;  4JI4 F;  2E5J A;  5IYD K;  4ED6 A;  1KOH A;  3CNQ P;  4CM0 A;  2M3D A;  2GQ2 A;  2LXI A;  1R0A B;  2MLX A;  1ACM B;  1ICE B;  4HKQ A;  1OY8 A;  3LAM A;  3OD2 A;  3MWB A;  3UR3 C;  2WVC A;  3FMB A;  3V4I B;  2LCW A;  4HT7 A;  5JXS A;  4KR0 B;  2F65 A;  1V3S A;  5LSO A;  3V6J A;  1CJV A;  3T9Z A;  1I6H C;  3OV7 A;  3N01 A;  3ILO A;  2IHR 1;  5CZV A;  1RHJ B;  1CEZ A;  2HZA A;  4DPW A;  5KFO A;  4KFB B;  4U96 A;  1UFK A;  5KFQ A;  3IBW A;  4EMD A;  4PRF A;  4DX8 H;  1KWM A;  4JI7 F;  1CSJ A;  1KOO A;  4LFA F;  2QC3 A;  3BBC A;  1HNV B;  3GIR A;  4JI1 F;  1X8D A;  1GK8 A;  3MPY A;  1SI9 A;  2YKM B;  4DU8 A;  1S6Q B;  2UVR A;  5TMF A;  4IOA Q;  1XC9 A;  1GT8 A;  1G6B A;  3MEC A;  2PEB A;  2R93 A;  2MZQ A;  4AT1 B;  4WJB A;  5BJR A;  4K0K J;  1RT4 B;  3UD4 P;  2ZZN A;  3MCO A;  3KXD A;  4DSE A;  1XNQ F;  3R6L B;  3LP0 B;  1TL3 B;  1NUE A;  2QN6 B;  4G1P A;  4M63 A;  2L9D A;  4CI0 B;  1RWK B;  3B82 A;  1LWF B;  1VRU A;  4JK1 A;  3ZFV A;  2I0X A;  3EYZ A;  3AOC A;  3ZZY A;  1UET A;  1RT2 A;  4NCB A;  4LF5 F;  1GXL A;  3UO0 A;  3IRX A;  3M8Q A;  4M5N A;  3R27 A;  3K89 A;  2OGU A;  2JC0 A;  4JI0 J;  4LF8 F;  2EFP A;  5FLM C;  3I96 A;  2QV6 A;  1N33 F;  4EBC A;  2RF2 A;  5IYD C;  1U47 A;  1WHV A;  1L0W A;  1VOM A;  4K59 A;  3T6B A;  4CLU A;  3FEY B;  5C4J C;  5HL8 A;  3DLJ A;  3IA0 A;  4DUZ J;  4LR7 A;  3KUH A;  1MN9 A;  2QL7 B;  2A68 A;  3MEE B;  3M2V B;  3HOX K;  3QRQ A;  4L3K A;  5CH7 B;  4HHU A;  2VFV A;  2BM0 A;  1S6P A;  3CJ8 A;  3GJQ B;  4LQ3 A;  2YWG A;  3KFW X;  4LMZ A;  4C2M A;  4IQM A;  1HMV B;  1T3O A;  5KFK A;  2E5H A;  4OYX A;  2KXF A;  4ILM A;  2PDA A;  4FN5 A;  1OS5 A;  1ZYQ A;  4I0W A;  5I3P A;  2CJK A;  3GTP A;  1ZZN A;  1XJW B;  4O4R A;  1FKO B;  2ADC A;  2FLP A;  1RTJ B;  3TAP A;  2UV8 A;  4K50 A;  1OWX A;  2CWX A;  1KSP A;  3FVY A;  1JLC A;  1K83 C;  4I68 A;  3I4N K;  3DRP B;  4IH6 A;  2BR0 A;  1TKT B;  3P5B P;  3KLG B;  1HI1 A;  2JRS A;  2VBX A;  4J91 A;  3AH5 A;  5J2P B;  3W3S A;  2DGU A;  2B63 A;  4PUO B;  4GVL A;  1TKD A;  3SZ2 A;  3OVA A;  2BEF A;  5K5M A;  3RZD C;  4RW4 B;  5A8R B;  3G4C A;  1U02 A;  2YKA A;  4B3O B;  4IOC Q;  4K0K F;  1WIH A;  1EIY B;  2VFR A;  4ELU A;  4DV3 J;  3G86 A;  1QD1 A;  4ILR A;  2WOM B;  3IMQ J;  2HFO A;  4F4W A;  2IY5 B;  3FMW A;  2D74 B;  4KO0 A;  2ZFZ A;  2GMH A;  1QDU B;  3KJN B;  1W25 A;  5FJ4 A;  4A4J A;  4RNH A;  3BV8 A;  2E2J K;  4A46 A;  2B6A B;  1RK8 A;  2JA7 K;  3CDE A;  2RQM A;  5KT4 A;  3KG4 A;  2G2O A;  3M2R A;  1CQM A;  2YPY A;  3IXQ A;  3GON A;  2XCR B;  4M1K A;  4I2Q B;  2D41 A;  2Q1L A;  1VH2 A;  4O23 A;  3T1Y F;  4N5S A;  3IM9 A;  1MRO A;  3R5D A;  3BH7 B;  2ZM6 J;  4JI0 F;  3JS9 A;  2ZD1 A;  1ZET A;  2FZK B;  4BLG A;  1NK7 A;  5GAG I;  3DXB A;  1SCJ B;  4PXE A;  2XCA A;  3NGD A;  1P1T A;  4DUZ F;  1J6W A;  3HOX C;  2BE2 B;  2QIF A;  2YX4 A;  4C8O A;  4QWC A;  4A3K K;  3AA9 A;  3U1L A;  3NGU A;  4RBV A;  2QLX A;  2C28 A;  2FJX A;  1VQK S;  1T3N A;  2BJD A;  3OFE A;  2MZJ A;  2EC0 A;  1P8G A;  1RB0 A;  4QR2 A;  2JA5 A;  3CJR A;  2BDP A;  1HNX J;  2XI2 A;  1F6T A;  3O6Q A;  1WTF A;  4USH A;  1KQF B;  5T7L A;  2CVI A;  3LPE A;  3WC0 A;  1VQ4 S;  2JEJ A;  5DDQ C;  3C46 A;  3I32 A;  2GX8 A;  4KMU A;  3LAP A;  2CQP A;  3LH2 S;  4I56 A;  1SQG A;  2V9W A;  2UVW A;  4DX6 A;  2YNH A;  5GMD A;  4UY8 T;  5KFB A;  3MCN A;  3GTL C;  4HEA 9;  2HG4 A;  4QU7 A;  2CQ1 A;  2BJ9 A;  2W8L A;  3FFI B;  3TJ9 A;  1XMB A;  4LRC A;  1JB0 C;  4IG3 A;  3UVJ B;  2NVT K;  3W8G A;  3R1H A;  1S4E A;  2E2H A;  5KG6 A;  4LRA A;  1NM2 A;  3C16 B;  4LRB A;  5HJY A;  2NCK L;  4DV3 F;  1FO1 A;  3N9U C;  4OIO A;  4G1Q A;  2R2U A;  4OI4 A;  2O01 C;  4DL0 C;  1WCM C;  4DL4 A;  2IAJ B;  2E2J C;  5IZH A;  2RRA A;  3ISZ A;  2VH7 A;  2EBG A;  2JA7 C;  2YU9 K;  4P10 A;  1R8P A;  2XMK A;  3I4M C;  1FJ7 A;  3R7N B;  2UVV A;  1RAD B;  3SDE A;  3J7A 1;  1NBE B;  3HM9 A;  1EP4 B;  3DU5 A;  2UUC J;  1Y00 A;  1L5U A;  4L73 A;  4XCH A;  3GYG A;  2ZM6 F;  5AXM A;  1RT5 B;  4QCL A;  5KAK A;  3DLE A;  1RA6 A;  5J2M A;  2OP5 A;  3DLH A;  1IW7 A;  2MLY A;  4X65 J;  1NSK L;  3NY0 A;  5FDL A;  4FVM A;  2XGP A;  3H5S A;  1FDN A;  6FD1 A;  1ZXO A;  4GC6 A;  2GAH C;  3SZY A;  2R9L A;  2HHV A;  4QJV B;  1R43 A;  1DCH A;  3AJ2 A;  1HNX F;  4ERD A;  3D6T B;  3SSQ A;  2OPR B;  7AT1 B;  1M1K T;  2HKE A;  5CHC B;  4I64 A;  4PWW A;  4ECW A;  3AJ1 A;  4Q2M A;  2R7R A;  3HFZ B;  4H4M B;  3X1L B;  4F8R A;  5HSP A;  1FFG B;  2W7O A;  3QGH A;  3T41 A;  1NKE A;  2IC3 B;  4IDK B;  2PA8 D;  4C3H K;  1IKV B;  2Z0G A;  5HAT A;  3U1M A;  1HQE A;  4LFB J;  1HBM B;  1T02 A;  2CG4 A;  5I3Q A;  3W2W B;  3H40 A;  4NLG A;  1RT1 B;  2ACM A;  2ROG A;  2JX2 A;  3S16 K;  5I42 A;  3R5J B;  4FZB A;  3D54 A;  3RR7 A;  5M3F K;  2JLE A;  3TZZ A;  2FB0 A;  4XAK A;  1UEV A;  1MMD A;  5A8K B;  2GVD B;  4DR6 J;  2PC6 A;  2DNL A;  4MYT A;  3CMQ A;  2BOP A;  3OFG A;  1WC6 A;  4C8K A;  1QAX A;  5D3G A;  2P9E A;  3GMG A;  2E5I A;  2J0X A;  2YU9 C;  2W7P A;  3P96 A;  4NPO A;  5DGA A;  2BX6 A;  5CD4 A;  5F8G A;  3K5P A;  4A3E K;  2CYY A;  3BS9 A;  5E0O A;  1TL5 A;  1F7V A;  1J5O B;  2BE5 A;  4QPT A;  1BD6 A;  2ZC4 A;  3VAL A;  2UUC F;  4DL6 A;  2MZS A;  2GW8 A;  3BR8 A;  1NSP A;  4FP9 A;  3HHL B;  3ETO A;  3GTJ K;  4NXM J;  1VYA A;  1NB2 A;  3RG6 A;  1WF0 A;  4RUB A;  3DU6 A;  3ET6 B;  4HR2 A;  4F25 A;  2XO6 A;  4X65 F;  3DLG A;  1RA7 A;  4R5P B;  3QT7 A;  3M1V B;  4F04 B;  4KGM A;  2W2Q P;  2LA4 A;  3C66 A;  1DRZ A;  1WOP A;  2LU1 A;  1Q81 T;  2VOO A;  2VA2 A;  4G3I A;  5CYQ A;  1NRK A;  1TV6 A;  1WUU A;  1B7F A;  5K8O A;  2D1C A;  3JYT B;  3RBE A;  3KK3 A;  2BJ3 A;  4LVO P;  2GSN A;  2WCX A;  3VF0 B;  4CTA A;  4WFA Q;  3DLK B;  2C2D A;  4PXD A;  3O1L A;  4OV1 A;  7FDR A;  3K17 A;  3ADA C;  4PPZ A;  1TK5 A;  2XY7 A;  2VPX B;  2IRY A;  2ZH6 A;  2OIH A;  5LT5 A;  1U1R A;  5AXL A;  2PMZ L;  2CUY A;  2LXU A;  2PI4 A;  3PX6 A;  2RQC A;  1CVJ A;  2A10 A;  4OIN A;  5B0C A;  2DNN A;  3OFF A;  3R7S B;  3ZZU A;  2AX1 A;  1SKS A;  3GWC A;  4NLY A;  5IWA J;  4OYM A;  1HBU A;  5D0E A;  2LEP A;  2DO0 A;  2HNY B;  3GV8 B;  3GFH A;  3F56 A;  4LFB F;  2NPF A;  2FJB B;  3TYT A;  3KG1 A;  4OZN A;  1ZTT A;  4QWA A;  2QX0 A;  2XS5 A;  2FLL A;  5HAN A;  4ZS6 A;  1GMW D;  3ZZZ A;  3VVU A;  1K73 T;  2B9W A;  4DR6 F;  2CQ2 A;  3GTP K;  3L09 A;  5U47 A;  3R5C A;  2ATL A;  1NDK A;  3N28 A;  3M30 A;  3G8Q A;  2V6A A;  4PAA A;  3JSB A;  3T3F A;  4DOZ A;  2JA6 K;  1TWH K;  4PXB A;  2YWH A;  4XPC A;  2C3O A;  2XO7 A;  1HNI A;  1AFI A;  2E5L F;  4ES3 A;  1W2I A;  4Z7Y A;  2AU0 A;  3H42 A;  4W4M A;  2G9O A;  2EFO A;  3TA1 A;  3WX8 A;  2B63 K;  3W5Z A;  3PW4 A;  2YKN B;  3UN2 A;  4UW2 A;  2R93 C;  3V5R A;  1S59 A;  3NKY A;  1NK5 A;  4BS2 A;  4J9P A;  4IR1 A;  1N0U A;  1J2V A;  1O2A A;  4CLF A;  4JYA J;  5KTQ A;  1XK8 A;  4NXM F;  1DTQ B;  5G0R B;  1Y1V A;  4RW8 B;  2HQG A;  5T41 A;  2F8M A;  5C24 A;  1Y9O A;  3CJ0 A;  2P9G A;  1UVI A;  1V3Z A;  4NEZ A;  4ED5 A;  1UWA A;  2MGZ A;  1RT3 A;  2FUG 9;  3OL8 A;  4P74 A;  3M8S A;  2Z2Z A;  2BAC A;  4Y2C A;  3HOY K;  1VRT B;  4DHV A;  3GFX A;  2AJ4 A;  4DWI A;  3IAS 9;  1T05 A;  5KFY A;  4KV8 B;  3MMA A;  1CS4 A;  5GAD I;  4L72 B;  2P6T A;  5EWF A;  1C0T B;  1VIS A;  3A13 A;  4V19 X;  1GX6 A;  3W7B A;  1VQ7 S;  4C7Q A;  3GII A;  3MUT P;  1NB7 A;  3BO4 A;  4DL7 A;  2CIM A;  1GMU A;  1XMO J;  3DRS B;  1N88 A;  2VKZ G;  2FVC A;  2XEX A;  3CD7 A;  3IS9 A;  1YJW S;  2V2K A;  1X4D A;  5IWA F;  1FRI A;  1QTN B;  3DCA A;  2PFD A;  2F4V J;  4ED7 A;  2BV3 A;  2LDY A;  4UY8 5;  2F4F A;  5DJB A;  4FS2 A;  2IMW P;  2CFA B;  2VPZ B;  3H2L A;  3ZZT A;  4ZPW R;  1W2B R;  1SH2 A;  1WKJ A;  5KFE A;  1WD6 A;  1JLA B;  4XDC A;  3J80 Y;  3IM8 A;  1NDC A;  2RHS B;  4DUY J;  3GTP C;  3PCO B;  4DEZ A;  3DFE A;  4KFB A;  3Q23 A;  2CDQ A;  3DYA A;  1ZAW A;  2KZM A;  1DJ0 A;  2JA6 C;  2CPI A;  1OQ6 A;  2I8E A;  1TWH C;  1JJ2 R;  3GTQ A;  3JSR A;  1S4F A;  3M4O C;  2QA1 A;  1HD1 A;  1HNV A;  4K4X A;  3OR2 B;  4F50 A;  1S48 A;  1U6Z A;  2B63 C;  4CT9 A;  2VFT A;  4L75 A;  1RT7 A;  4ZVG A;  1X0P A;  2ZDP A;  1S6Q A;  4KHM A;  4P5B A;  5FJ8 K;  3J80 U;  3DHW C;  2E2H K;  1NLK L;  1WHY A;  3QGP A;  3GDZ A;  5EGY A;  5JVG Q;  3HO1 A;  4BY1 C;  1SL1 A;  2XCO A;  2F9D A;  3OTD A;  3A3P B;  4JYA F;  1XXC A;  4Y34 A;  3ZTO A;  2HFV A;  3PX4 A;  2C2M B;  2QRR A;  4I7F A;  3GV5 B;  3WIV A;  2AGP A;  5IV3 A;  1TL3 A;  4KY3 A;  4LLG A;  3RB6 A;  2HFN A;  2DT9 A;  1AA1 B;  2CW0 A;  2B9Y A;  2JDJ A;  1KLM B;  2E44 A;  2H5E A;  3NUH A;  3HD1 A;  2HND B;  3HOY C;  4JI8 J;  5KFF A;  5EGE A;  4Y2I A;  3TFI A;  1YJV A;  1NK4 A;  5IOS A;  5GAH U;  1WF1 A;  2UXC J;  2JA8 K;  2FGC A;  3JTP A;  3UDV A;  3DOK A;  3D0I E;  4P2S A;  4LUB A;  1Q95 G;  2ZH9 A;  2ZBR A;  1NHV A;  5IYB K;  4RNM A;  4DR2 J;  3BJY A;  3G82 B;  1HBO B;  2XY6 A;  5CAB A;  1A6L A;  4QYZ J;  2LU2 A;  3LOU A;  3I4P A;  3H2V E;  2DH7 A;  3VAK A;  3H3V L;  4AD6 A;  2JA5 C;  3CC2 S;  5B0E A;  2W9C A;  3TA0 A;  2I9S A;  3EPG A;  2F4V F;  4FVC A;  3DXJ A;  1SJF A;  2V34 A;  2VL1 A;  5KFG A;  1PJ5 A;  1HI9 A;  3AD7 C;  2KKH A;  1F2G A;  1DAR A;  4DUY F;  4DV7 J;  3N0V A;  4NCG A;  2RT3 A;  1ZM9 A;  1HLW A;  3CQZ K;  1SJR A;  3RJM B;  1RE1 B;  1JLF B;  3NGK A;  3H4B A;  1RTJ A;  2ZHA A;  1LWE B;  5J2Q A;  4H4O B;  5CAA A;  4QW8 A;  4MKV A;  1VK8 A;  3M7V A;  3MMB B;  3OXG A;  2PMH A;  4KAS A;  1LW2 A;  2NQP A;  2E2H C;  2DBB A;  3T5L A;  2PEH A;  1Q86 T;  2C22 A;  4ECT A;  2GNK A;  2LXF A;  5CCL A;  1TKX A;  2JC1 A;  1S0M A;  3LGM A;  3KLH B;  3NLC A;  3CMA S;  2WOM A;  4K7Q A;  3HVR A;  5GAE U;  1ZYR A;  2NUU G;  3BPD A;  2IVM A;  3MEG B;  3AD9 C;  2LLZ A;  4DFP A;  2BVZ A;  2OPQ A;  4A48 A;  3T5H A;  3KJF B;  4ZP8 A;  4XLN A;  4J9V A;  4Y52 K;  1X4E A;  1VLO A;  3PJW A;  4JI8 F;  1ZZF A;  3VCD A;  4B02 A;  6AT1 B;  2HMI B;  3UN5 A;  4FYY B;  2UXC F;  3LGH A;  3DKD A;  4L6V 3;  4A8S A;  2MJU A;  2JLG A;  3PW0 A;  4AYB L;  1YGY A;  4QZV B;  1N54 B;  2Y1I A;  4RU2 A;  3CGI A;  3MOZ A;  4E0D A;  2L48 A;  5AT1 B;  1HI0 P;  2G1D A;  3SV4 A;  2QYC A;  1BHN A;  4W98 A;  4DR2 F;  4K5R A;  1TVR A;  2Y1R I;  4RU9 A;  4PPD A;  5HO4 A;  4RZR A;  2DIV A;  3EE3 A;  5HVG A;  1DHM A;  1Q79 A;  2JLF A;  3BGF A;  4F3Q A;  1VQ8 S;  4FKY A;  4QR0 A;  1SQF A;  2QL5 B;  4JI3 J;  2IM1 A;  2MYF A;  1RAB B;  1UJ6 A;  3BQ0 A;  4ZP6 A;  3N3Y A;  4YUD A;  3JST A;  2VBZ A;  2Q79 A;  2SXL A;  1S10 A;  2O66 A;  3A4T A;  2RDJ A;  4DV7 F;  4TU7 A;  1S76 D;  4YB1 P;  1HBN B;  3MTJ A;  3VQT A;  3BRE A;  3CQZ C;  2MY7 A;  4QYR A;  1J6X A;  1EQR A;  5DQG A;  1TUG B;  3HPO A;  1FT8 A;  3FSX A;  4ILL A;  1Y11 A;  2FJV A;  2CPZ A;  4ZOS A;  2DK2 A;  1OPI A;  1PJ6 A;  1RHQ B;  5I4M A;  2R7Z K;  2EBB A;  1Y4Z B;  2XLK A;  1BGW A;  1MW7 A;  2ROE A;  1QAJ A;  5DDO C;  3M32 B;  2FZG B;  3S1R K;  3T5K A;  1Q53 A;  3F44 A;  1L3S A;  1EQ0 A;  3QZ8 A;  1M1G A;  1K47 A;  1O8B A;  1VCT A;  5K8N A;  2X3G A;  2DNH A;  4ZVR B;  3NOC A;  3US5 A;  3MXH P;  2V4J B;  4OHX A;  1F60 B;  1WI6 A;  3CCZ A;  2DPI A;  2BBE A;  4PG4 A;  3L4K A;  4WXO A;  3A1Y G;  2YY3 A;  3I5A A;  3CB4 A;  3DM2 B;  1ZBT A;  4Y52 C;  1N36 J;  5E3A A;  3MED B;  3POT A;  4J9L A;  4K2X A;  5HJX A;  1WC5 A;  4ZCI A;  1TWA A;  1D9F A;  5LJ3 Y;  1IQT A;  2H1Y A;  5HBM B;  3FCH A;  3ZZO A;  2DGQ A;  4OHV A;  4RW6 B;  2B4U A;  2DB1 A;  1HAR A;  4DV2 J;  3FBC A;  2E7W A;  3I0R A;  1Y1V K;  4KSE B;  5IQ6 A;  3CD5 A;  4FPI A;  3M9O B;  1AUD A;  2ZZM A;  4ZIT A;  1UW9 A;  3EVW A;  5G4D A;  4K4Z A;  1YJR A;  2EVZ A;  3PHE A;  5HI7 A;  3G71 S;  2XZT B;  1TTH B;  3M4X A;  2BAN A;  4JI3 F;  5DM6 Q;  4W90 B;  2HHP A;  4TYB A;  2YH1 A;  4MKB A;  3S17 C;  5KFI A;  4C3J C;  5C25 B;  3S1M C;  4OFZ A;  4C97 A;  1X9M A;  3UNY A;  2AJQ A;  2JOQ A;  1YTY A;  1SIW B;  2IPO B;  5HRO B;  1F5C A;  3QAE A;  1HWJ A;  1FEE A;  3PRB A;  4DF8 A;  3M2U B;  4DZ6 A;  3EGW B;  2R92 A;  3HSD A;  1FE4 A;  2PSZ A;  1GE9 A;  4RNF A;  1NHK L;  2MST A;  3KJQ B;  3EX7 B;  2BE9 B;  2HFZ A;  1C1B A;  1Y3K A;  4U9R A;  4IKA A;  3S1R C;  1RAH B;  1U0S A;  3GTY X;  2DR7 A;  4J7C A;  3W2W A;  1P9Q C;  3CCE S;  1HR0 J;  4ZVP B;  2HEK A;  3LW5 C;  3JTO A;  1YJ7 A;  4RWX A;  5THW A;  1WC0 A;  4GTB A;  4DL5 A;  5F8L A;  5A8K A;  4MIB A;  3UDL A;  1NDP A;  1FE0 A;  1SPB P;  3DMJ A;  4Y2K A;  3OTE A;  5D0H A;  3M6X A;  2Y0S D;  1N36 F;  3OTC A;  1EJ7 L;  5CZX A;  2B4V A;  2DNZ A;  2HWI A;  2Z58 B;  1P27 B;  1JX4 A;  2DR8 A;  2DNK A;  3MF5 A;  3VV2 B;  3CJS A;  2X1A A;  4A8X A;  3UNG C;  3FHZ A;  1FFW B;  2WON B;  4LFC J;  2HRY A;  2Y3Y A;  2NS1 B;  2VJU A;  1Y1V C;  2KXN B;  4DV2 F;  3HSG A;  4N7T A;  4NA2 A;  1JLE B;  4CCH A;  2P6S A;  4WFY A;  4DMZ A;  3G6V A;  3JSY A;  4A3M C;  1KKH A;  2B56 A;  4X84 A;  4M94 A;  4WP8 A;  1WJ9 A;  4WK3 A;  2VF3 A;  4RWW A;  4CRJ A;  1OJ4 A;  2XI3 A;  3VHQ A;  3OL6 A;  3MGJ A;  5B0F A;  3PKM A;  4K4S A;  4RW7 A;  1XER A;  2BJE A;  1D9D A;  3HXA A;  1BQM A;  4DQR A;  4P6Q A;  1CUL B;  3J7Z T;  1JXV A;  4CP5 A;  2AJF E;  4EBE A;  4ENO A;  3TTG A;  1Z2L A;  4OZJ A;  2GGP B;  1C4C A;  3VGU A;  4DR5 J;  4TVA B;  2RIJ A;  3CED A;  5FII A;  1OPZ A;  3PXG a;  5HMY A;  2B4P A;  3HOU C;  3MTK A;  2VBY A;  4C11 B;  2Y1J A;  2IDE A;  1NSQ A;  2VBW A;  2HQC A;  3M8Y A;  1G2E A;  1U2R A;  3S2H K;  2KJV A;  2KFN A;  3D5M A;  4OJ3 A;  1QTM A;  1VJQ A;  1HR0 F;  2MHN A;  4F2S A;  2Y9H A;  1UV7 A;  3U1N A;  2F7V A;  3UWT A;  1KEK A;  2J0S D;  2EBE A;  2ZEJ A;  1JIH A;  4USK A;  3BSA A;  1B0V A;  3GTQ C;  4USI A;  5B0D A;  1KTV A;  4BLA A;  3RW6 A;  3UFC X;  5KG5 A;  4B08 A;  3EGV A;  3RBD A;  2H5I B;  3OVS A;  4G65 A;  2C1E B;  3BKF A;  2M8D B;  4J9R A;  4O4G B;  2JJ4 D;  4DU7 A;  1SL0 A;  4CZC A;  4U7C A;  1VC0 A;  9RUB A;  1S0V A;  2J76 E;  3HT0 A;  4LFC F;  4HHJ A;  1SIZ A;  3ONQ A;  4YG2 A;  4EYI B;  4ECV A;  2VPY B;  4MFB B;  1DTQ A;  4MYU A;  1IBL J;  2BYC A;  2IRU A;  3MAQ A;  2RKI B;  2V69 A;  2CPX A;  3SQG B;  5D4O A;  2DY1 A;  4U7U D;  5E3C A;  4MEX A;  1NSA A;  4KGX B;  3D3B J;  1KC8 T;  4URQ U;  2XMM A;  3PG9 A;  3GJS B;  3K2Y A;  5CJ9 A;  5IXU A;  1VRT A;  2CKW A;  4ZA1 A;  1H3D A;  1T8E A;  4YY3 J;  1R8A A;  5KFR A;  5HN0 A;  2KT3 A;  2AP6 A;  3AOA A;  3BUE A;  1HA1 A;  1FCA A;  1QLN A;  3NS6 A;  4DR5 F;  2IBO A;  3TP2 A;  3IG1 A;  3KOA A;  2HBY B;  1SUQ A;  4OLP A;  4AL7 A;  5DZ7 A;  1YIJ S;  3AFG A;  2QMU B;  1IBC B;  5D0G A;  1T9X A;  3CC7 S;  2M0G B;  4Y00 A;  2KI2 A;  2Q43 A;  4ID5 B;  4XSX A;  1KLN A;  3CCT A;  2WVF A;  2AJ1 A;  3I4H X;  3EUN A;  5GME A;  3TAQ A;  2CFA A;  3LPX A;  8ATC B;  1CC7 A;  1LEO A;  2DXF A;  2GJ2 A;  3MR7 A;  4G7O A;  4ZPC A;  1IBA A;  3AAW B;  4M5I A;  2XMA A;  3I82 A;  4NX9 A;  1B4A A;  4M5J A;  2HVE A;  3KK1 B;  2VG5 B;  1X4A A;  1YVF A;  3QFW A;  3TQE A;  4LSN A;  3MFH A;  5KFP A;  5GAH I;  3DC2 A;  1WG5 A;  3OVB A;  1MMN A;  4ZPT R;  3OHB A;  2AQ4 A;  4N56 A;  4FYD A;  1RTD A;  3MUM P;  4C45 A;  1H2T Z;  4TY8 A;  4ZVE A;  2NVY K;  3D6F B;  5F8I A;  3D67 A;  4RR5 A;  1TZ0 A;  3H90 A;  2FQO A;  5IM0 A;  2VIH A;  1RHR B;  1FTR A;  1DLO B;  3THT A;  3MCM A;  4HTJ A;  2KHD A;  1TKZ A;  1BXN A;  3TFJ A;  1RAJ A;  4QBU A;  2B5J B;  4YN3 B;  4A8F A;  2DNR A;  1JQG A;  3LTO A;  1EET B;  2P2C B;  4DS5 A;  3HHN B;  3W64 A;  1LWC B;  3W1Y C;  5HP1 B;  4KBI A;  3SBM A;  2XG8 A;  4KKO B;  3CCM S;  3MM6 A;  1NKB A;  4Q8F A;  1KLM A;  4B17 A;  4EFA C;  3GJT B;  1R8H A;  3CCJ S;  2Z2M A;  2CQ0 A;  4WKY A;  3Q22 A;  3GEE A;  1FK9 A;  5H9F K;  4X4O A;  2XHW A;  1X31 C;  2RQK A;  4YY3 F;  2DY9 A;  3UE2 A;  3JSM B;  2OO4 A;  3KG0 A;  4LIR A;  2GHP A;  3VGS A;  2DNP A;  1NND A;  2Q6C A;  4M5G A;  4UUX A;  3HJV A;  4QYZ K;  1WQF A;  4KAI A;  1PC5 A;  3I5C A;  3QMQ A;  3M8P B;  4USU A;  2ASY A;  4ATN A;  2RJZ A;  1DTT A;  4X4R A;  1FJG J;  3GQC A;  4V1A k;  3TUZ C;  1CJU B;  4CLY A;  1DY3 A;  4C8L A;  2G1H A;  4KMH A;  3PIP Q;  2CJX B;  2YNF B;  4X6A K;  2YWK A;  3I0S A;  3ITH B;  1Y1W A;  4GZY A;  1S6O A;  1NPP A;  4OI6 A;  5GAE I;  2L3M A;  4USJ C;  2E2I A;  3Q8R B;  1FRJ A;  1FEH A;  1H0H B;  5J1E B;  4LSL B;  3GR1 A;  4C8Y A;  8AT1 B;  3GLJ A;  3NNC A;  1S1X B;  3H25 A;  4GMK A;  2H5J B;  1SC1 B;  4KIA A;  2HVZ A;  2XGQ A;  3KHH A;  2DIU A;  1JLG A;  3QGG A;  2ZOG A;  1VLY A;  1N5Y B;  5KG4 A;  3N0B A;  3KLE B;  2DIS A;  2FVP A;  1ZA2 B;  4CM2 A;  2LYV A;  4RJV A;  2MKJ A;  2G0I A;  4CIO A;  4Q43 A;  4WIQ A;  5KFV A;  4CO4 A;  2KRR A;  3TOQ A;  3RBX A;  4H4O A;  2DH9 A;  2NVY C;  3OXL A;  4OQJ A;  4ANE A;  1YBT A;  5DDR C;  4DSF A;  2EW9 A;  5HMZ A;  4UZC A;  4KT0 C;  4TLR A;  3PTW A;  3KLH A;  2WAQ D;  3NMR A;  3CCQ S;  1XWL A;  4AYB D;  1ZTW A;  2OFH X;  1WKL A;  2PFF B;  3BO3 A;  2N7Y A;  2PII A;  3PDN A;  2EEY A;  3K8V A;  1PGZ A;  1WHW A;  2VFS A;  4OZ3 A;  1TWF A;  5D0R A;  2XS7 A;  2OPS B;  1TU0 B;  2G4B A;  2WB1 L;  1SH0 A;  1TWA C;  3DI6 A;  3W9J A;  2XZW A;  3EQL A;  3OUY B;  1FDA A;  2H9Z A;  4UF4 A;  2KG1 A;  2C3Y A;  1U6F A;  4TLQ A;  3FCV A;  3KWM A;  1TK8 A;  2IVY A;  3FCW A;  2HMI A;  1SVD A;  3LP1 B;  4DPT A;  4D3H A;  4X2B A;  3SXL A;  5ETT A;  4QOT A;  4MIA A;  4ZIW A;  1X9W A;  2QA4 S;  1KDN A;  2VG7 B;  4R8U A;  2MEW A;  3G6Y A;  1EQM A;  5AE1 A;  1FJG F;  4DCP B;  1JNR B;  1LW0 B;  2V94 A;  3J7Z 5;  4KGZ B;  2ILY A;  3OT9 A;  4XTT A;  2R8K A;  2DNO A;  3N5F A;  2PE8 A;  3C6T B;  5L9N A;  3TWZ A;  5E33 A;  4HAC A;  3EWG A;  4DS4 A;  2GJF A;  1N34 J;  3R2C J;  4ELV A;  1T11 A;  2ZE2 A;  2FJA B;  3MR2 A;  3ZTR A;  3AT1 B;  4I6Y A;  1H2U X;  3HLU A;  2OFG X;  2R92 C;  3PO2 K;  1QE1 B;  3HVA A;  2UUB J;  2HHQ A;  4LQ9 A;  3DDI A;  1X5P A;  3E01 B;  4KN4 A;  2KU7 A;  4E2F B;  5B09 A;  4MEY A;  2IRX A;  4ZHR B;  3S15 C;  5HL7 Q;  5IC6 B;  2W01 A;  1JLQ A;  2XWY A;  1Z2Z A;  2JNJ A;  3IRW P;  1A7G E;  4AQY J;  1PC4 A;  4Z7C A;  1S1V B;  2DHX A;  3WC2 A;  3M32 A;  3KK2 A;  4WPA A;  2A3J A;  2J7U A;  1FF2 A;  1SMY A;  5IYC C;  2GVZ A;  2IIH A;  2QFI A;  3GTK K;  4RL1 A;  1NH8 A;  1JJH A;  1K8A T;  3K5N A;  3KJV A;  1TWC A;  2AX0 A;  1T94 A;  4F4X A;  2EFG A;  4LK0 A;  3ZZR A;  3W9I A;  4J9O A;  1IR1 A;  5JVH Q;  5EHH A;  2HS4 A;  4HI1 A;  4ZN3 A;  1XQI A;  1JLB B;  1JQW A;  1BQX A;  1U09 A;  2J6U A;  3K57 A;  4OIP A;  1RHK B;  5KFJ A;  4Z37 A;  2M88 A;  5L39 A;  2WVB A;  3BP3 A;  3MM5 A;  5KT2 A;  2UXD J;  3HVT A;  2V8G A;  3B4M A;  1M90 T;  2A6M A;  4JI2 J;  4GO7 X;  1YBU A;  4YDX A;  4YOE A;  1RWO B;  2GCF A;  3MAA B;  3RZO K;  1FHT A;  1REV B;  3HFV A;  1AZS A;  2GA7 A;  1RTI A;  2C2K B;  1VBK A;  1D0E A;  1XR6 A;  2XZD B;  2FC9 A;  5IQQ A;  3M6V A;  2V4Q A;  1M5H A;  4EO8 A;  1VI7 A;  5KFD A;  3FRY A;  3VAM A;  4A3D K;  4CLW A;  1BJT A;  4LOW A;  1KVJ A;  3EPI A;  3KKF A;  2RVJ A;  5AXN A;  5HMX A;  3HKZ L;  1KQG B;  4Y7N K;  1N34 F;  3HHK A;  1CJT A;  1UVK A;  2ZJR Q;  1U1K A;  3RYL A;  2OEK A;  3PO2 C;  3MM9 A;  3VZI A;  3KLV A;  4KAW X;  2K06 A;  4DQP A;  3O44 A;  3RB3 A;  2WBM A;  2MB0 B;  2OHD A;  2KG0 A;  2UUB F;  5ETV A;  2O67 A;  3M2U A;  2ZH3 A;  2KVQ E;  1EKS A;  2XMV A;  3L9Z A;  5C4X K;  3H0P A;  3ORE A;  1ELO A;  2GQC A;  1T03 B;  1TL1 B;  1P9Y A;  4AQY F;  2VAS A;  2RH3 A;  1S1W A;  4OYB A;  3FOE A;  1U2F A;  4KM8 A;  2HNZ A;  3V6D B;  3PO3 C;  1LV5 A;  1L3U A;  4O3P A;  4C98 A;  4FF4 A;  2K2P A;  1RT6 A;  4PQU A;  1R9T K;  4QIW L;  4A3C K;  1IKX A;  4LSZ B;  4J9N A;  3GG1 A;  1HD0 A;  1AB4 A;  3HSZ A;  4CLP A;  1ULR A;  2H4W B;  4ER8 A;  3DGP A;  3R6G B;  2IYG A;  1B4S A;  2CJ9 A;  1SFO K;  2DNY A;  3R5B A;  1MU2 A;  1MNE A;  2IDL A;  1WOO A;  2DGV A;  3RRH A;  2RD5 C;  2KB2 A;  4JUZ A;  3S1T A;  2RGR A;  1SKR A;  3BPS P;  4GFQ A;  2NXE A;  3MR5 A;  2LP4 A;  4KB4 A;  4YB7 A;  4C3M A;  1IR2 A;  2R2T A;  2MHE A;  2UXD F;  3QFH A;  1GTE A;  1JKH A;  1GMW A;  1UFW A;  2J9C A;  3IWN C;  3BQ1 A;  1LK7 A;  1JNZ B;  4KN7 A;  4CYU A;  1X4C A;  1JLE A;  4JI2 F;  1R31 A;  3RZO C;  2UP1 A;  1PJ7 A;  2PA3 A;  4OHY A;  2COL A;  1KVK A;  5K14 A;  3G4A A;  2Q3P A;  3MMJ A;  2LEC A;  3W9H A;  3VWS A;  4L74 A;  2FIU A;  1XZQ B;  3IP0 A;  2DR5 A;  2IJF A;  1AXQ A;  4A3D C;  4GTC A;  1FRX A;  4IFY A;  5ITH A;  5D4N A;  4Y7N C;  2WZ1 A;  3HHL D;  5LXR A;  2N3O A;  3SCL E;  1WDD A;  3RAX A;  1WAC A;  5BXI A;  1ITP A;  1I50 A;  1S9E B;  5KT6 A;  2ZUG A;  2J6S A;  1VBX A;  5L1I A;  4XSZ A;  2OMO A;  4OIX A;  3QNW B;  3GTG A;  2R8H A;  1Q4R A;  2NR0 A;  3MUR P;  1NPR A;  2Y0B B;  2WVD A;  4MAK A;  1YBA A;  1I6J A;  5C4X C;  5F41 A;  5DGB A;  4J37 A;  2ZBC A;  5J1P A;  4H54 A;  1XZP B;  1RU0 A;  4RW9 A;  2VV5 A;  3IBC B;  2UUW A;  2WB4 A;  4WK1 A;  4K5S A;  1HHS A;  5A8W A;  3OR1 A;  3RW7 A;  2W4P A;  2WSC C;  1R9T C;  2XCQ A;  4NLX A;  4A3C C;  3EXC X;  2D6F C;  1D8Z A;  1C0U A;  1KON A;  5E5N A;  1WEL A;  3MZI A;  1LWX A;  4YQW A;  1Q7Y T;  3BDP A;  3KLF A;  4O3N A;  3KLI A;  4KGK A;  1SFO C;  3CT9 A;  5C42 B;  1E6Y B;  1E6V A;  2FQT A;  1L3T A;  1N6Q A;  3IGV A;  4IQX A;  4PG6 A;  3FDS A;  3QJP A;  1HNW J;  3CD0 A;  3FSI A;  2P5V A;  2M52 A;  4QW9 A;  1HHT P;  4O4G A;  3TAM B;  1FNX H;  5KG3 A;  1SQE A;  2RU9 A;  1XBW A;  5FLM K;  2VUM A;  2HGN A;  4F3M A;  4PWU A;  1RAO A;  3MR6 A;  1FER A;  5J1N A;  5LSR A;  2W9B A;  1BS2 A;  1LFW A;  4AFF A;  4M5M A;  4C6A A;  2F8E X;  2VOD A;  2F40 A;  5C4J K;  3MM8 B;  1RTH B;  4K2J A;  4RX6 A;  2VB6 A;  4DG1 B;  1BQN B;  2QLB B;  4O44 B;  9ATC B;  5KFT A;  4IFV A;  4NLT A;  1P1L A;  4NZ6 A;  1ZH5 A;  4ILD A;  3PVX A;  1NPK A;  4BBY A;  4TQR A;  1EHW A;  1S77 D;  2OH2 A;  1TL4 A;  4YP3 A;  2CZ4 A;  3QSI A;  2ALY B;  1I3O B;  1L3K A;  2CQC A;  1TEL A;  3HX9 A;  3HXM A;  2OML A;  4ZVS B;  4TU8 A;  1FKP A;  5HAO A;  1WOS A;  2BOA A;  4GTL A;  2CQD A;  2AEJ A;  3TVK A;  5GAD U;  3DRR A;  1O27 A;  2HBR B;  1HQU A;  5MAO A;  1K83 K;  2JL9 A;  3HF5 A;  4OJG A;  4KGV B;  1MN7 A;  4P72 A;  4IG0 B;  5HVF A;  3Q2T C;  5CHP A;  3C6U B;  4JI5 J;  2HFS A;  1RWV B;  2E2I C;  1R27 B;  4OYO A;  2R7U A;  5A76 A;  1D9A A;  3RZD K;  3QT5 A;  4LR9 A;  3QO9 A;  5BYS A;  4LJZ A;  2DH8 A;  3QT8 A;  3KMQ A;  4I2P A;  2RS2 A;  1U8W A;  5C7P A;  4Q4Z A;  3FBB A;  4BBS C;  4RKU C;  2FJD B;  1XR7 A;  4GO5 X;  1DQ9 A;  1NCL A;  3ISN D;  3KK1 A;  2KRB A;  2OEL A;  4LBI A;  5F3T A;  5A0Y A;  3MFI A;  1UJ5 A;  2I5J B;  2POK A;  2HVH A;  1AFJ A;  1M5P C;  3K7A C;  5BYQ A;  2V0N A;  2QE5 A;  1S0N A;  4DV5 J;  1XTZ A;  5F9L A;  1HNW F;  2KHC A;  2LVW A;  4W92 B;  4HYK A;  2ZBQ A;  3SCK E;  3PFE A;  5J2N A;  4ED8 A;  1GEH A;  1LFP A;  2W2M P;  1VJE A;  3GTM A;  3TW0 A;  3DLB A;  2J8A A;  3GTO K;  2C2O B;  1F9E B;  1HHQ A;  4BY7 C;  1CJV B;  4A3L C;  2ZNZ A;  1RAI B;  3TJA A;  4CQ1 A;  2QLF B;  3S0X A;  2DHG A;  2JFK A;  1XMQ J;  4DCO B;  3P5T L;  4TQS A;  1TWF C;  4GVB A;  1YWX A;  3MD3 A;  4FF3 A;  3VGV A;  3H0G A;  1J5E J;  5I3U A;  5K9F A;  1V9O A;  2QTW A;  1UWB A;  3TNV A;  1S9G A;  4DL2 A;  1U1L A;  4WFB Q;  1SV5 A;  3HHE A;  1IBM J;  2NVQ C;  1D1U A;  3MEC B;  3I31 A;  3PKY A;  3L95 X;  4YB5 A;  2R7O A;  3GTL K;  2YNG B;  2AGO A;  3VAF A;  1IS1 A;  1U48 A;  1TAU A;  4U67 Q;  4A8Q A;  4DR3 J;  4UQG A;  5K8P A;  1O28 A;  1YZ7 A;  1VRU B;  4JI5 F;  4S0M A;  4B9L A;  2R4F A;  4OIQ A;  2DXE A;  4DQS A;  1MWY A;  1PAU B;  1RT2 B;  5AE3 A;  1NO8 A;  1KD1 T;  2KT5 A;  4LSL A;  1ISE A;  1ZA1 B;  3BN4 A;  3D9B A;  2GJI A;  2X1G A;  3IRX B;  1RI7 A;  5DS7 A;  4Q8E A;  2BJ8 A;  2YWW A;  4RBT A;  3PV8 A;  1FJE B;  1RDR A;  3PNI A;  1PYO B;  1IBK J;  3NS7 B;  5HVH A;  1WCM K;  5KT7 A;  2CJY B;  2F5G A;  4U95 A;  2RF2 B;  3GCX P;  3QRR A;  3GFY A;  3I4M K;  1URN A;  4Y0F A;  1RYS A;  1XN9 A;  4IOB A;  4B9V A;  1IL2 A;  1XPP A;  4C0O C;  4DV5 F;  2M8H A;  3HVW A;  5LMN J;  2O3D A;  5GVQ A;  3LUY A;  2P8T A;  3CPW R;  1XR5 A;  2CPD A;  1M0S A;  2IFX A;  3GTO C;  4P7T A;  2GMJ A;  4MT1 A;  1VQL S;  3NBP A;  2O1P A;  2MZT A;  5CD4 H;  3GB0 A;  5KFL A;  3EGN A;  1F2H A;  1OSD A;  1IKW A;  3QT6 A;  1Q5Y A;  4MK8 A;  1TWC C;  5DQH A;  2Y1L B;  4A3J K;  1S97 A;  1WC4 A;  2WRM A;  3R5A A;  4FYX B;  3RRG A;  5AJ3 J;  1Y5I B;  2W4D A;  1XMQ F;  3FUY A;  1U26 A;  2KVI A;  4FF2 A;  2BRK A;  3TRG A;  1NHU A;  4AND A;  4WYL A;  3MMC B;  1KHV A;  5HMW A;  3F0N A;  2N4C A;  5DO2 A;  1YJ9 S;  3OJU A;  2QGF B;  4Q0B A;  5ADZ A;  4WKR A;  4XPE A;  1U0H A;  5F3Z A;  2R7V A;  1JLC B;  1J5E F;  2AJ0 A;  3FQK A;  2M7S A;  4HT5 A;  4RUC A;  4CH1 A;  2VU5 A;  3SI8 A;  2W1B A;  3H5U A;  2QLW A;  1ZS6 A;  1IBM F;  2MQO A;  2DHA A;  1MML A;  1YZ6 A;  2OUG A;  5C3E C;  1KP6 A;  4DR3 F;  2DRB A;  4KO0 B;  2LQB A;  2BQU A;  3V2U C;  2D3Z A;  5ETQ A;  2DNM A;  3MPW A;  1MWZ A;  3DHX A;  3C6T A;  2R8I A;  1FRL A;  3M2R B;  2CQG A;  2EFN A;  1Q7L B;  2RB7 A;  2QYG A;  2ZJP Q;  2BQR A;  3TAR A;  1QVG R;  3JB9 k;  1VIX A;  2B51 A;  1Q8L A;  4ITS A;  1MRO B;  2HHW A;  3C3L A;  1X4G A;  3HZE A;  1I1G A;  2CJA A;  1LK5 A;  3GPA A;  1U1N A;  2ZD1 B;  4Q5S A;  1F93 A;  2VZ9 A;  3FKB A;  4A93 C;  2DJW A;  2GAG C;  4WU2 A;  2M9K A;  4DR7 J;  5CA5 A;  4ZHR A;  1JOE A;  1T9W A;  2B8P A;  2NVX K;  1ZQ1 C;  2GSU A;  5KT5 A;  3HJF A;  2A0F B;  2ZZT A;  3BGR A;  5LMN F;  1RGV A;  2VA3 A;  3D28 A;  1NAQ A;  4PYA A;  2PT0 A;  4KJI A;  4UOF A;  5C2G A;  3R2D J;  1N8R T;  2KYX A;  2IM2 A;  3CJT A;  1HWK A;  3L4B C;  2B8Q A;  4HH1 A;  4A3J C;  5T7L B;  4A8Y A;  4I6W A;  2JVO A;  4DDF A;  5JJB A;  3LQV A;  4D3G A;  1O25 A;  5AJ3 F;  3ILJ A;  3TUI C;  3HHD A;  2K8G A;  2VD3 A;  4IH5 A;  2YNH B;  1IQ0 A;  4DQQ A;  3BB5 A;  1TAQ A;  5B7W A;  2M4M A;  4J9Q A;  4OI0 A;  5BYR A;  2UZA A;  4U8V A;  4WYW A;  1X5S A;  3GIL A;  2V6S A;  3CDU A;  4BC7 A;  2MQM A;  3OL7 A;  4IG3 B;  1AT1 B;  3I55 S;  4OYP A;  2MQQ A;  4KH0 B;  2JEI A;  5HQL A;  2FVR A;  1R0B G;  3LAN A;  4DX7 A;  2D3O 1;  2YWF A;  5TJ3 A;  1TL7 A;  2HQI A;  1X4H A;  2XM3 A;  4G1Q B;  2BW2 A;  1HI8 A;  1WHX A;  3PW2 A;  2BMB A;  1B0T A;  1N5S A;  2AZ1 A;  4M5D A;  3G8T A;  3RZA A;  3VZH A;  4NZ0 A;  4CLZ A;  3I56 S;  4G1I A;  3CJ5 A;  3NXZ A;  8RUC A;  3FOF A;  5M5W K;  3GR0 A;  3SDE B;  3VA7 A;  1UAW A;  1YRU A;  1RBO B;  1VGY A;  2CAD A;  4KRW A;  1RJJ A;  4ZCK A;  3GTG C;  2R8J A;  4IO9 Q;  4M8L A;  3C15 A;  3BZQ A;  3SCJ E;  1N56 A;  4NZ7 A;  3DLE B;  4PCQ A;  2EG2 A;  2HBZ B;  1HPZ A;  2KDO A;  2NVX C;  3HP6 A;  4ZDN A;  4DR7 F;  4XK8 C;  4DPX A;  4F67 A;  2HYI B;  1KNZ A;  4IR9 A;  2D7S A;  3WBZ A;  5FDL B;  3ZXW A;  1T03 A;  2CQI A;  2D9P A;  1Q16 B;  2YNI B;  1UZD A;  2R93 K;  3TR5 A;  2U1A A;  2K3K A;  4NI2 A;  1Q5V A;  4LIW A;  1VJW A;  2XS2 A;  1Q1K A;  4PG7 A;  5IP7 C;  4KH1 B;  3NGR A;  2NSB A;  1RU1 A;  1A9N B;  2L41 A;  1XXA A;  4LT6 A;  2JWN A;  5E3Q A;  3BH6 B;  3NL0 A;  5F8M A;  4DR4 J;  5EDW A;  2LKZ A;  3RR8 A;  1Y0H A;  3SEO A;  3PHT A;  5GMK a;  3W61 A;  2CXE A;  4USV A;  4BCA A;  1IWG A;  1RUS A;  4OHZ A;  4ALZ A;  1IKY A;  4KB7 A;  3IAM 9;  2GZO A;  1U45 A;  2VUM C;  2YX7 A;  2LDI A;  3RTV A;  2FQQ B;  3EZ5 A;  4DV4 J;  2JVR A;  1Q8I A;  1Z1Z A;  3DRX A;  4CNZ A;  5I42 B;  1LQ9 A;  2FHJ D;  1SC4 B;  1BC6 A;  2D69 A;  2C3M A;  1WF2 A;  2P9C A;  3GE9 A;  1Q82 T;  4OZ2 A;  5JMN A;  3UCZ P;  1IQZ A;  2HZV A;  1JK9 B;  2ATC B;  3Q86 A;  2WVE A;  2GHV C;  4YME A;  2HHT A;  3R97 A;  4FXD A;  3CSK A;  2HHU A;  4C2M K;  3S2D K;  4X64 J;  2PA8 L;  4LF1 A;  3BSC A;  5HQM A;  4RO0 A;  2JA7 A;  4NLR A;  2YBV A;  3B78 A;  1IN0 A;  2K7K A;  4GTF A;  2H51 B;  3B6B A;  4R25 A;  3KMS A;  2J9D A;  1AUS L;  4ZVQ B;  4OZ0 A;  5E7O B;  1XEZ A;  2HUR A;  3BR9 A;  3GSI A;  2DCU B;  1HKA A;  5BR8 J;  3K5M A;  1S1T B;  5L38 A;  3M4O K;  2HBQ B;  3ICL A;  1R89 A;  1SL2 A;  1WKK A;  4A3G K;  3DDN A;  3DLG B;  5EUH A;  1UP1 A;  3W2V A;  3KDO A;  3NWG A;  3QQC D;  5KFZ A;  3GYN A;  3CJ4 A;  4C3I C;  2LA6 A;  2R7T A;  5CYQ B;  1TV6 B;  3EDR B;  4NYP A;  4BY1 K;  2AKW B;  3KK3 B;  4CTA B;  4LF7 J;  3FEZ A;  3R5G A;  2W2P P;  1F5A A;  4IRD A;  3Q24 A;  4NLP A;  4WBF A;  1CJK A;  3GIM A;  2KFY A;  3MI7 X;  2MY8 A;  4ZCM A;  3PYE A;  4PWD B;  4Z2X A;  2R42 A;  4DN9 A;  3GSD A;  4DR4 F;  4G0V A;  3UN3 A;  4WTY A;  3PW7 A;  4ED2 A;  4CLL A;  3RU0 A;  3LPY A;  1ZVU A;  1WNE A;  3W8P A;  3AQO A;  3TFH A;  2MDA A;  4OI1 A;  4ZK7 M;  3AB4 B;  4ANC A;  1HBU B;  3W65 A;  2XYP B;  3TAM A;  4WE1 A;  3Q8P B;  1VQ6 S;  1RAA B;  5DET A;  3FBE A;  3LA0 A;  1FFS B;  4DV4 F;  4OJH A;  2J0Q D;  2CNK B;  3O3L A;  4C8M A;  2YKQ A;  4E98 A;  2V9K A;  1B3T A;  1VHF A;  1R0A A;  1B64 A;  4N8O A;  1D3W A;  3MPV A;  2XY5 A;  2ZDO A;  5KFW A;  3H0G C;  2IBK A;  3FQL A;  1YSJ A;  1SXL A;  3M30 B;  4K4T A;  2JA5 K;  3NCP A;  4C2M C;  3S2D C;  4FM9 A;  1VIO A;  3V4I A;  3D1H A;  2NXJ A;  4X4N A;  2V50 A;  4X64 F;  4WZQ A;  2YU9 A;  1HNI B;  4ZVU B;  4LF4 J;  1B70 B;  3DOM B;  4NLQ A;  3NNH A;  2XYH B;  4MMO A;  1W7W A;  4FF1 A;  5T14 A;  2HPU A;  4YFN A;  2RIL A;  4DDQ A;  4USW A;  2VDI A;  3OFH A;  3K5O A;  3P8B B;  4BBR K;  3Q8Q B;  2E1C A;  1BDF A;  2ERR A;  5BR8 F;  4I6A A;  4A3G C;  4UOG A;  4DPY A;  2JZ5 A;  1TK0 A;  4A3F C;  3L7U A;  2ZBP A;  3CCU S;  4CLK A;  4IG0 A;  2YKM A;  2GML A;  3MOJ B;  1GTH A;  2G0J A;  2RH6 A;  2MGZ B;  1N52 B;  3NCQ A;  1RT3 B;  3ELH A;  2HW3 A;  2AYB A;  3G96 A;  1RT4 A;  3W66 A;  3SYZ A;  2FPH X;  3OTO J;  2EFQ A;  2B0G A;  1Q0N A;  4LF7 F;  3RGI A;  5B0A A;  1NU4 A;  2O5D A;  2ZWP A;  1KRP A;  3LP0 A;  1F0X A;  3MMA B;  1CS4 B;  3RAM A;  2MKY A;  3ENV A;  1LWF A;  2MQP A;  4PG5 A;  4A3B K;  3CF5 Q;  3FKI A;  3VAJ A;  4UT4 A;  4C0B A;  1FXL A;  4ZPA A;  2PGC A;  4PG8 A;  2G0C A;  3KHL A;  1U49 A;  3S14 C;  4B9S A;  3IS9 B;  1SJ1 A;  1H7W A;  4OX9 J;  2DGT A;  3QWP A;  2DGX A;  4NYO A;  3VR1 A;  5H9F J;  4OI3 A;  1VBY A;  5LJ5 Y;  3I9V 9;  4KE5 A;  3W5Y A;  3P3D A;  1XMO F;  2Y3P A;  4JB8 B;  4ZH4 A;  2K7J A;  4MJK A;  2CZV C;  3MEE A;  3M2V A;  3P4U B;  4AUK A;  5KG2 A;  1UW4 A;  2YQ1 A;  1RCX B;  3DYA B;  3S01 A;  2KO1 A;  1PIL A;  2RSQ A;  1ZM4 A;  4EK2 A;  1RWW B;  3DNC A;  4NOH A;  1O51 A;  3B54 A;  1HMV A;  1O2F B;  4MTP A;  3EM1 A;  3IWX A;  5F9N A;  4LF4 F;  3QGI A;  1RT7 B;  3L7P A;  3M8W A;  5B08 A;  3IN5 A;  4U6P A;  1FKO A;  2BA9 A;  4BBR C;  3S1N C;  2GQQ A;  1WQG A;  3K0J A;  3TX0 A;  2YNG A;  3S6E A;  1L3V A;  4NEY A;  4A8O A;  3DRP A;  3L3C A;  3GTJ A;  4Q7A A;  2H48 B;  4I7F B;  1TKT A;  3B8H A;  3KLG A;  2VDH A;  2J0W A;  4KMD A;  5J2P A;  3K8W A;  5H1S V;  4PUO A;  4PKD B;  3V6H A;  1MG7 A;  1U8S A;  1VC6 A;  1RKI A;  3M3Y C;  4RW4 A;  4UTG A;  5A8R A;  4F4K A;  4J3N A;  1USM A;  2PHC B;  4HTI A;  3N79 A;  1Y5N B;  2OLW A;  1DUR A;  3TUP A;  4B3O A;  2B43 A;  3OTO F;  1TUV A;  1GNK A;  2MQN A;  3T1Y J;  2YPZ A;  1UVN A;  1VK3 A;  3GU0 A;  2O5J A;  4A3B C;  3IWL A;  3DOK B;  4LBP A;  3KNG A;  4CO1 A;  4PAB A;  1S5Z A;  2B6A A;  4B9N A;  1NDL A;  2AYE A;  2N4D A;  3CDB A;  3M9M B;  2F1F A;  1HWL A;  2DD8 S;  1G7C B;  4I67 A;  1J6V A;  1DAX A;  3L7O A;  2R8G A;  4I2Q A;  2ZHB A;  4DSJ A;  5RUB A;  3MR3 A;  4YFU A;  4OX9 F;  3RB4 A;  2W9C B;  4U8Y A;  3KTQ A;  2MKK A;  1SJQ A;  3WQP A;  2VKR A;  4OV6 A;  3F73 A;  4NMX A;  3CJQ A;  4NLO A;  1FWP A;  4FDF A;  4LR2 A;  2XHC A;  3IGN A;  4NCG B;  2BE2 A;  2ASD A;  3Q0A A;  3E3X A;  3CCS S;  3I6P A;  1C0A A;  5IFM A;  1O6X A;  4V19 J;  3D6M B;  5D4P A;  4USM A;  3MMC A;  2KTQ A;  3TUJ C;  1QM9 A;  2M5Y A;  3MML B;  2HWT A;  7FD1 A;  2WTF A;  5J2Q B;  2JA6 A;  4DJB A;  1TWH A;  3LAK A;  4QIF A;  3S17 K;  4H4K A;  3D1O A;  4C3J K;  3CD6 S;  3S1M K;  1LW2 B;  3V6K A;  5B0G A;  2NXC A;  2R3V A;  1U25 A;  1QJH A;  2ZH5 A;  1TKX B;  2WSF C;  4DR1 J;  1SBR A;  3D68 A;  3FFI A;  4OYZ A;  3SQO P;  1SH3 A;  1IR0 A;  1GAO A;  2XWX A;  5L1J A;  4O3R A;  3R8Y A;  4M1X A;  2ZKU A;  2OPP B;  3UVJ A;  1BUX A;  4KQZ A;  6FDR A;  2OPQ B;  2RAQ A;  4P71 A;  1IE0 A;  1NZA A;  1N5T A;  3ZZ0 A;  1YHQ S;  2VG6 B;  2A6H A;  3QIP B;  4Q44 A;  2FGO A;  1YQH A;  3SSR A;  4JBC A;  3C16 A;  4DF4 A;  5KG7 A;  1H73 A;  2KJW A;  2E1M C;  3RB0 A;  3EGZ A;  1OO0 B;  4ECS A;  3ENW A;  2DYA A;  5L8R C;  3Q8U A;  2BZ2 A;  2IAJ A;  2HGM A;  4UZB A;  1Q78 A;  2O5I A;  3PRV A;  2FDN A;  4U7U K;  1TVR B;  1WG4 A;  2VJV A;  5CCM A;  4FS1 A;  1EP4 A;  3EZO A;  2OEM A;  4A8M P;  3M05 A;  2ZOM A;  3J81 Y;  1S57 A;  5LMU J;  1H38 A;  2XCP A;  2AHO B;  3CUN A;  1RT5 A;  3LF0 A;  2W24 A;  3D7S B;  1X4B A;  3H5X A;  3FNN A;  4TXS A;  4CLT A;  3T01 A;  2KM8 C;  1YIT S;  4C8N A;  4A3M K;  2KZZ A;  3D1Q A;  1G4C A;  1OMS A;  4HH0 A;  4ZVF A;  2ZWO A;  2ZOF A;  3NOG A;  3JTN A;  1WEX A;  1KS2 A;  4QJV A;  2UUA J;  3SCI E;  2V63 A;  5M5Y K;  3LAJ A;  1SKW A;  2NZ4 A;  2K1R B;  2I2Y A;  4YHH J;  3I4N C;  2X7I A;  3J81 U;  5EWG A;  4WF9 Q;  5C44 K;  1F5B A;  4IO1 A;  2OPR A;  2I6W A;  1DD5 A;  2DNQ A;  1JJ4 A;  3GIJ A;  3SIP B;  3UD5 A;  2U2F A;  2Z8Q A;  1XXB A;  4H4M A;  4WFX A;  1UEU A;  2ZUE A;  5F8N A;  2X51 A;  3JQJ A;  2GO9 A;  3PJX A;  1CPZ A;  5D15 A;  3G6E S;  5KT3 A;  3HDS A;  1SKU B;  2A1B A;  5M5X K;  3HSJ A;  2QA4 G;  3FSY A;  4DR1 F;  4EBD A;  3HOU K;  1JXL A;  2IC3 A;  3QAT A;  4IDK A;  2XLI A;  1VC5 A;  2HVI A;  1IKV A;  1KFS A;  1KN6 A;  4DL3 A;  3PYD A;  1HBM A;  3ZNJ 1;  2FVQ A;  4TYA A;  1FWK A;  4OX8 A;  2AEF A;  1RT1 A;  3N6N A;  4JV1 A;  3THP A;  3MPU B;  4TN2 A;  2CPF A;  3POT B;  1SC6 A;  3HMJ G;  3VAI A;  4DFK A;  2QJ3 A;  2GVD A;  4G0W A;  2B7C B;  2IM0 A;  4XDD A;  4X66 J;  5H9E J;  1AYE A;  4GKJ J;  2EK6 A;  2E29 A;  3GTQ K;  3MHY A;  3PR4 A;  3I0R B;  1KR4 A;  1WI8 A;  2KWA A;  4DFM A;  3VGT A;  3D4J A;  1K1S A;  4M5L A;  2CFX A;  5DRK A;  4PXC A;  5IT9 Y;  1UMJ A;  5IP9 K;  2J8S A;  1VS3 A;  2BW7 A;  1J5O A;  4NLS A;  4QR1 A;  4A3K C;  2A6E A;  1FVS A;  1KFD A;  2MXY A;  4OX6 A;  2YNI A;  3H4D A;  5LMU F;  2V67 A;  2BAN B;  3A8I A;  3HHL A;  4YR3 A;  4A8K A;  1O26 A;  1MWQ A;  1C1C B;  1X60 A;  1YNJ A;  3CUL A;  2PMZ D;  3ET6 A;  5L9X A;  4CNY A;  4R5P A;  3M1V A;  5EWE A;  2AZ3 A;  5ETO A;  2J6T A;  2GHW A;  3PIO Q;  5M2U A;  1OIA A;  5IT9 U;  4Q45 A;  3FKI K;  3ZZP A;  1NKC A;  1IVZ A;  2ZC3 A;  3CQZ A;  3JQM A;  4P75 A;  2UUA F;  3JYT A;  1ROF A;  5C44 C;  1T7P A;  4KC5 A;  5ETN A;  4YHH F;  3V81 B;  3DLK A;  3E8O A;  1X4F A;  4KHP J;  3PX0 A;  3U02 A;  4I4B A;  5K8M A;  1CC8 A;  2OEJ A;  4F36 A;  1C1B B;  2XUL A;  3ZTP A;  3BKU A;  3UW1 A;  4AXJ A;  2NVT C;  3V4G A;  3MM7 B;  2XTJ P;  2MJN A;  3NP5 A;  4WFN Q;  3WDO A;  4DV1 J;  1RTZ A;  2NLW A;  1WSR A;  1RAG B;  1VQP S;  4C3K A;  4ZIV A;  4ED3 A;  4KTQ A;  2AEM A;  4DBQ A;  4ZMM A;  2RQ4 A;  3SFU A;  1GH8 A;  4RBU A;  2HNY A;  3ENA A;  4LF6 J;  3DMJ B;  2H54 B;  1OYE A;  1F9F A;  1I3Q A;  4ZJO A;  3FK4 A;  2FYX A;  5EN1 A;  2E5L J;  4NXN J;  4YR0 A;  4DFJ A;  5SUH A;  2CNN B;  4X66 F;  1BWE A;  4AL6 A;  3P49 B;  4GKJ F;  2E9T A;  3BSO A;  1RAE B;  4ZVT B;  3FC9 A;  5IOL A;  2FLN A;  3CCW A;  3G87 A;  5IP9 C;  1S1T A;  1RWN B;  2WK4 A;  4G7H A;  2Z2Y B;  1VQO S;  4K4W A;  2RE1 A;  4OJ1 A;  5AE2 A;  3J7Y U;  4P73 A;  4ZPV R;  2YKN A;  3PO4 A;  3PEJ A;  2Y0S L;  2CAJ A;  4WII A;  2B7B B;  1H2V Z;  4RW7 B;  3C14 B;  2MKC A;  4GRS A;  4QIG A;  4YDD B;  5IV4 A;  1BQM B;  1EX8 A;  2PN6 A;  5G0R A;  2NYI A;  4RW8 A;  4R0J A;  4QU6 A;  4K4V A;  2KH9 A;  4Y65 A;  1JXE A;  1FA0 A;  1WTB A;  1M5S A;  2DHH A;  4FYV B;  4O0I A;  4NLD A;  2IVF B;  4Y2A A;  3FKI C;  1R6Y A;  2JFD A;  1G1X A;  1T9Y A;  3H5Y A;  4PWD A;  4J9M A;  3UDE A;  3WZ0 A;  4PZV A;  4F0H A;  1URR A;  3FZB A;  2XMW A;  1YG0 A;  2D3U A;  4MH8 A;  3B4D A;  2BE7 D;  3JAM Y;  4C3H C;  3LO3 A;  1YCL A;  4KHP F;  4KV8 A;  2R7Z A;  3R3T A;  1C0T A;  2FD2 A;  1U1P A;  3S16 C;  1W26 A;  3DN9 A;  4DV1 F;  2E9Z A;  5DM7 Q;  4B9M A;  4LRD A;  2NSC A;  3D66 A;  3VVT A;  4G6V B;  3DRS A;  1S7H A;  2KL8 A;  3FZ2 A;  1FXD A;  2ZH2 A;  4IRC A;  1FXR A;  2D9O A;  3A8K A;  3GP9 A;  2DGW A;  2DHS A;  5KFU A;  4MKY A;  4QIV A;  1VQ5 S;  1S9F A;  4X4P A;  2ZNY A;  1YKW A;  3T1H J;  1QVF R;  1R0C B;  1YI2 S;  3P45 B;  3K7R A;  4B3M J;  4ELT A;  4LF6 F;  3JAM U;  4MK7 A;  4A3E C;  2XB2 D;  1JLA A;  2N82 B;  1RU2 A;  5JVO A;  3D3C J;  3J81 j;  4HLB A;  1I5O B;  5TMC A;  3DOM A;  3UPF A;  1Y10 A;  4NXN F;  1QAI A;  3OTB A;  2ZUA A;  5KG1 A;  4A8W A;  3T02 A;  3CCV S;  2DCL A;  3GTJ C;  4CH0 S;  4WZM A;  1EI6 A;  2XSJ B;  3OLA A;  2EWH A;  3OR2 A;  2AW0 A;  2AD9 A;  4NOI A;  3PYG A;  2QT7 A;  1EFW A;  2VC1 A;  4A47 A;  2FY1 A;  4MIW A;  1F9H A;  3H20 A;  1DQA A;  2Y8Y A;  1CBK A;  3FGV A;  4BC9 A;  4QQB A;  2R7Q A;  5D78 A;  4I1T A;  1EAR A;  2A69 A;  1RP5 A;  1NZ8 A;  2NPI A;  2UV8 G;  1H6K X;  3S1Q K;  1TQL A;  1YRX A;  2HZC A;  3GZ7 A;  1RWX B;  1IBL F;  1PBA A;  3NS5 A;  4I69 A;  4LVN P;  2ASJ A;  2V8H A;  4IH7 A;  2EFV A;  4WU3 A;  4UOH A;  1HYS B;  4ED0 A;  2ZFH A;  4QIE A;  3H3V D;  4KPY A;  3A8J A;  1TWA K;  2HND A;  4OMF G;  2FLO A;  3IG1 B;  1FWL A;  2MTL A;  4WFZ A;  1SUQ B;  2APO A;  2BKO A;  4NYZ A;  2HIY A;  2DIT A;  4QPX A;  2PI5 A;  2OKQ A;  2NUH A;  3Q83 A;  4LRF A;  4WTO B;  4BWM A;  5D8H B;  1O29 A;  1O24 A;  1NH7 A;  4EI2 A;  1EAY C;  3G82 A;  1B99 A;  1HBO A;  1YNN A;  3NAH A;  4EZ6 A;  2XBP A;  4LQY A;  3R7B B;  3RRK A;  5KFS A;  2W7V A;  3T1H F;  3CCR S;  2ALZ A;  4B9U A;  2QO3 A;  4B3M F;  4LSN B;  1UA0 A;  1VDH A;  3TEH B;  2OSR A;  3O2I A;  4H4K C;  1TP7 A;  2M70 A;  2Z4P A;  4DX5 A;  4M5H A;  1RTD B;  2XNQ A;  3TQ1 A;  3N6L A;  4TY8 B;  1YJN S;  2MQL A;  3KUG A;  1WQH A;  5SZT A;  3MDF A;  3DXS X;  2ZH4 A;  1PG5 B;  5IM0 B;  1EB0 A;  4ETX A;  4WJ3 M;  2V8V A;  3CE8 A;  4ETZ A;  1JLF A;  2R92 K;  1TKZ B;  2ASL A;  2L08 A;  4C8Z A;  1YRT A;  3CIM A;  4CO3 A;  1U1O A;  1LWE A;  2C2E A;  2YVS A;  2IA0 A;  1NK0 A;  1S1U B;  3S15 K;  1J27 A;  4RUA A;  3MMB A;  3BYR A;  3A12 A;  5F0W A;  2XMU A;  4RNO A;  2XNR A;  3MM6 B;  3ILI A;  3PY8 A;  1OQ3 A;  4O3Q A;  3MUV P;  2CVE A;  4F7V A;  2FY8 A;  1UVM A;  3S1Q C;  2F9J A;  3EZU A;  2FZC B;  4JV0 A;  5IYC K;  3H7H B;  1TWG A;  3CWJ A;  2UU9 J;  2B9E A;  1RYR A;  1U1M A;  1FK9 B;  1S0O A;  4MQ9 A;  3AOD A;  2HS3 A;  1Z4U A;  3MEG A;  4KC6 A;  3DOL B;  3LAL A;  4BDP A;  5A6P A;  4B3T J;  3TO8 A;  1NXI A;  2CRL A;  1DTT B;  3CVK A;  2QA2 A;  2QSF A;  3LGN A;  4R0E A;  3AD8 C;  4PYD A;  1QUV A;  2CJB A;  2GO8 A;  4XIU A;  2GC8 A;  4G0U A;  1YX2 A;  3CO0 P;  1QSL A;  1I6V A;  3T5J A;  1TUW A;  3IR6 B;  2WW8 A;  4DUT A;  3I0S B;  1EH1 A;  1ZM2 A;  3MD1 A;  1EK8 A;  4DV0 J;  3QZ7 A;  5DZ6 A;  4ES2 A;  1KQS R;  2ZH1 A;  5DDP C;  2RUG A;  3QLH B;  1K1Q A;  2YWE A;  1EKR A;  1JLG B;  4HHH A;  2HHS A;  2WHO A;  1IM6 A;  3E2E A;  5F0U A;  2FVS A;  1F7U A;  2D3O R;  1NK9 A;  5L46 A;  2DGO A;  3TA2 A;  3M8Z A;  2IA6 A;  1LNQ A;  4P7V A;  4P2X A;  1HBN A;  3HOV K;  2RDD A;  4CWB A;  1T9T A;  1ZAV A;  2EKY A;  1OY9 A;  4ECY A;  5KFA A;  1GMV A;  4ZPB A;  1RAC B;  1C4A A;  5D6G A;  2OAU A;  1NJX A;  2ZKT A;  2LQJ A;  4F26 A;  1VQ9 S;  3H8Y A;  2A18 A;  2FTR A;  2C2Z B;  4RPF A;  4ZVO B;  2VOP A;  3TZX A;  2VON A;  2HAF A;  1S12 A;  2OPP A;  1S49 A;  4DLE A;  4N8N A;  4RNN A;  4OYI A;  1I3Q K;  3VTI A;  1QSS A;  1HIY A;  3PO3 K;  2LQ9 A;  3DI6 B;  2VG6 A;  2JEG A;  3QIP A;  4CO0 A;  2LEB A;  5DG9 A;  2JSX A;  3CCL S;  1TFW A;  3RAQ A;  4YR2 A;  2RUS A;  2E9R X;  3KDN A;  2A2D A;  1VR6 A;  2W7A A;  2UU9 F;  2V4J A;  2J9E A;  4F3O A;  4C48 A;  2JA8 C;  2BM1 A;  5IOQ A;  1TMJ A;  2AYG A;  1I51 B;  2ZJQ Q;  4OZL A;  3UCU P;  2WAQ L;  1PIE A;  3DM2 A;  2XC9 A;  4B3T F;  3MED A;  5IYB C;  1K0T A;  4R8U B;  1QUP A;  4ZPD A;  1HQ2 A;  3KNA A;  2DTJ A;  2DGS A;  4ECZ A;  1RKJ A;  5E3P A;  2AGQ A;  1D09 B;  3T1A A;  1APS A;  1INN A;  4URS A;  5HBM A;  4QWD A;  4WIL A;  3HHL C;  4RMF A;  4RW6 A;  2BXJ A;  4CT8 A;  4IUF A;  1SC3 B;  3PFO A;  2HQ3 A;  3A3N B;  4WP9 A;  4DV0 F;  3LP2 B;  1ZPV A;  3I5B A;  5LL6 d;  1F3V A;  1YDL A;  4HAC B;  3CTR A;  3SMZ A;  4OHW A;  2ZVI A;  1P6T A;  4ZKA A;  2RHQ B;  4F4A A;  3R9L A;  2ZE2 B;  1SJ4 P;  5C2C A;  1HFE L;  5KFH A;  1PCA A;  4NAS A;  2ADB A;  3HCX A;  4X4U A;  1Y5L B;  4F0M A;  1IWA A;  1N5Q A;  2K1R A;  3UD3 P;  5HK4 A;  1X5T A;  4JV5 J;  5IOT A;  3MCS A;  4HDG A;  5CQG A;  4YEA A;  5C25 A;  3UQS A;  3HOV C;  5HQ8 A;  5CYM B;  1JLQ B;  1FI4 A;  2E1R A;  3J7A N;  3WIU A;  4TKT A;  1YK9 A;  2NVY A;  4X4S A;  3CIZ A;  3KK2 B;  5HRO A;  2DO4 A;  1I94 J;  2QMX A;  1UPM B;  2FJE B;  3TJ8 A;  2GVZ B;  2MPU A;  2NZC A;  2FC8 A;  1IUJ A;  1VQS A;  3KJV B;  1PO6 A;  2GIF A;  4DPU A;  4K4Y A;  3F41 A;  3Q2S C;  1I3Q C;  4YFK A;  1NK6 A;  4JI6 J;  4CO2 A;  5H9E K;  2ZIT A;  4X62 J;  5L1K A;  2IMO A;  1KBR A;  1CLF A;  1VBZ A;  1RQ0 A;  4KAR A;  1UL3 A;  1O5J A;  1R6V A;  4OLO A;  1N0V C;  4N47 A;  2RRB A;  3MM5 B;  2FHJ A;  3HVT B;  4DN0 A;  4DSL A;  2HQF A;  1QSY A;  3AOB A;  3CJK B;  1NEE A;  2F63 A;  1FDB A;  3BP8 C;  4XLP A;  4NLU A;  2CPJ A;  4NRT A;  2DR9 A;  4PEO A;  1N4L A;  5D4L A;  4NL5 A;  4ZP9 A;  1FRM A;  1AZS B;  1IJF B;  5D4D A;  4O2D A;  1FVQ A;  1RTI B;  4DI6 A;  2CNO B;  2WON A;  2R7X A;  3D0H E;  4ZLJ A;  3D0G E;  1JWW A;  5HLF B;  3VAH A;  3TVZ A;  1C1C A;  1RLC L;  2FHK A;  1WDT A;  3Q3Q A;  1N32 J;  3VAG A;  4ED1 A;  4KM9 A;  4ICL B;  2C3U A;  2RS8 A;  4FNH A;  1CJT B;  4P2M A;  3ENQ A;  3SFG A;  2V8D A;  3D2W A;  3MM9 B;  1NJW A;  3PAC A;  2KFZ A;  4C4W A;  1RHU B;  4LJM A;  3V81 A;  2R7Z C;  2GFF A;  4JV5 F;  3HUL A;  4DQI A;  4OYA A;  2ACY A;  4UUW A;  5IC4 B;  1CUL A;  2HGL A;  1V5V A;  2I38 A;  1N5V A;  4EEY A;  3HKW A;  1S1W B;  2KN4 A;  3MM7 A;  2B9X A;  4NA3 A;  2GGP A;  2HNZ B;  3J7Y I;  1BGX T;  4OL8 A;  5DG8 A;  4KYZ A;  3G8S A;  2ZVS A;  1G3O A;  1I94 F;  2CPY A;  3ISN C;  2KT2 A;  4HVZ A;  1RT6 B;  4PQU B;  3GEH A;  1H74 A;  5E2Q A;  1IKX B;  4C11 A;  2W2N P;  1UEK A;  2IM3 A;  2HHH J;  2LMI A;  3CAG A;  4YFX A;  3NGS A;  1WOR A;  1Y1W K;  2YKO A;  2YH0 A;  1ZM3 A;  2VFU A;  1O0P A;  3DGP B;  2E2I K;  2NXU A;  4KB2 A;  1Q8B A;  4DPO A;  4JI6 F;  1MU2 B;  4ECQ A;  1S72 S;  2AV5 A;  3ULH A;  4E8U A;  2XLJ A;  3IR5 B;  3OLB A;  1X7V A;  3PEH A;  1ARO P;  3MPD A;  4X62 F;  2VQF J;  1HWI A;  3LWM A;  3KHG A;  2EI5 A;  2QG9 B;  4BBS K;  3OEP A;  2NYH A;  5B0B A;  1RWP B;  3KHR A;  2YTC A;  2DRA A;  3C8Y A;  1JKH B;  3QBC A;  1X5O A;  2RML A;  4IYQ A;  2L9W A;  2CWK A;  4ZVH A;  2EPI A;  1B4B A;  3PW5 A;  5KFC A;  1HL6 A;  4CYU B;  4GTD A;  3K7A K;  3NAI A;  2V6T A;  1FX2 A;  4ZLL A;  3OHA A;  5K14 B;  1VQY A;  1RWU A;  4TY9 A;  2Z30 B;  1HW9 A;  2QLJ B;  3C14 A;  3FEX B;  1FRK A;  4FBU A;  1SJ3 P;  2HIQ A;  4IFY B;  3GYX B;  1TWG K;  4BY7 K;  2CQH A;  5DQI A;  1HW8 A;  4MFB A;  5ETP A;  2KXH A;  4A3L K;  3WX4 A;  5FLX Y;  3QJL A;  2HFU A;  2QZ8 A;  1N32 F;  3UR0 A;  2RKI A;  3CJ2 A;  2XMJ A;  2J5A A;  2X1F A;  3SQG A;  4JV2 A;  1TWF K;  2A6O A;  3NCR A;  1VMB A;  2MMY A;  3GG0 A;  2P5M A;  2YKP A;  4EU0 A;  3LWL A;  2GIQ A;  3O5T B;  4B3R J;  2R7W A;  4C9D A;  3KUE A;  2PO4 A;  1PBU A;  2QMW A;  4RW9 B;  3OJS A;  4F02 A;  3W5X A;  4LBH A;  3PZP A;  3M6W A;  3HFK A;  5A8W B;  3OR1 B;  4YS2 A;  2NVQ K;  4O0N A;  5E68 A;  1N48 A;  5FLX U;  2BJ1 A;  2A2C A;  3UCG A;  4F2R A;  1JMT A;  3GTK A;  4OI2 A;  1C0U B;  1Y1W C;  3M9N B;  4ZN1 A;  2HHH F;  3KLF B;  1O2B A;  1R8B A;  5A2Q Y;  4ID5 A;  1V6H A;  3KLI B;  3Q89 A;  1LXJ A;  5KFM A;  1E6V B;  1WSV A;  1N6Q B;  2GV1 A;  5A6W A;  2HRU A;  2GS8 A;  1R7I A;  1T95 A;  1KQK A;  4G7Z A;  5JFE A;  1F3F A;  4MKA A;  2HVD A;  4ZP7 A;  1FDD A;  4FKX A;  3OPF A;  4ZLP A;  2L9N A;  2VQF F;  4J9K A;  1BWV A;  4WCE Q;  2VG5 A;  4GC7 A;  3IR7 B;  5KG0 A;  5KOX A;  2HSE B;  2XSJ A;  4P2F A;  4ECX A;  2W9B B;  5A2Q U;  1NJI T;  2V2Z A;  2OD4 A;  4BWJ A;  2UUT A;  2IJR A;  3DLL Q;  1BY9 A;  2QSW A;  5C5J A;  1DLO A;  4IFV B;  4BKW A;  2CA9 A;  4LF2 A;  4NE9 C;  3TAN A;  2R2S A;  1TWG C;  3I9Z A;  2HS0 A;  3ETM A;  3ZNU A;  1K0V A;  3CXC R; 
#chains in the Genus database with same CATH homology
 1WSV A;  3AD7 C;  3GEE A;  3GEI A;  1WOO A;  1VLO A;  3TTG A;  3ADA C;  1X31 C;  1WOP A;  2GAG C;  1PJ6 A;  1XZP A;  3AD9 C;  1VRQ C;  5L46 A;  4PAA A;  1WSR A;  3GEH A;  1XZQ B;  4P9S A;  1WOS A;  2GAH C;  1V5V A;  3TFJ A;  3A8I A;  3GSI A;  1PJ7 A;  3TFI A;  1XZP B;  3A8J A;  4PAB A;  1WOR A;  3AD8 C;  3A8K A;  3TFH A;  1YX2 A;  3GIR A;  1PJ5 A;  1XZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...