2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
3GIRA 1VLOA 3TTGA 1WSRA 3GEHA 1YX2A 3GEEA 4PABA 3TFJA 1XZQB 1XZPB 3A8KA 3AD9C 1WORA 1PJ7A 1X31C 3GEIA 3TFHA 5L46A 3A8JA 1WOPA 3AD8C 1PJ6A 1WOSA 3AD7C 3A8IA 1VRQC 4P9SA 1WOOA 4PAAA 1V5VA 1PJ5A 1WSVA 1XZQA 3GSIA 1XZPA 3ADAC 2GAHC 2GAGC 3TFIA
chains in the Genus database with same CATH superfamily
1XMQF 3EGZA 1N5YB 4J9MA 2BJ3A 3DKDA 4QZVB 5LMUF 5GADU 4B3TF 2ZKUA 1I3QK 3QMQA 1S9EA 1PC4A 1R31A 5EX0A 1MWZA 2YNFA 1SJ4P 3OQ2A 5DG9A 1CPZA 5ETVA 1B0VA 1NLKL 2ZJQQ 2EK1A 3UD5A 4O3RA 1TWHC 1YKWA 4LBPA 4DLEA 3OPKA 2KZZA 2IHR1 1X4GA 2LEPA 3KK1B 3T19A 5KFCA 3P45B 4NEYA 2XYHB 5G4DA 4OYWA 4A8MP 3CDEA 2ZHAA 4C8KA 3MMCA 5IYBK 3I4HX 1WC0A 2YWKA 3N5FA 1QE1B 1SUQB 5IQ6A 1FEHA 4KKOA 1WOOA 3Q23A 1RU0A 4JV0A 4B9MA 1N0UA 2A2DA 1LFWA 2NXEA 4BY7K 3MXHP 3HJVA 4RWXA 2YQ1A 1HWIA 3CEDA 4KGXB 4WFZA 4OI0A 3J81U 1DCPA 3H0GC 1JXVA 1AFJA 3UNGC 3W2VB 2J0WA 2J9DA 3PRVA 1H6KX 2VBZA 4ITSA 3ZTOA 1WCMK 2I5JB 2EFVA 2ZH4A 3D67A 1HL6A 5LJ5Y 2GQQA 1JLEA 2J0QD 3FOFA 4OHVA 3H5UA 1UWBA 2IRUA 1HLWA 4ELUA 1XZQB 1BUXA 3BSAA 4RU2A 1ZZFA 4DV6J 3FRZA 4DF4A 1H38A 1HNIB 1H0HB 1AYEA 1X7VA 3N28A 2JA5A 4ZPDA 1T9VA 2DNQA 4OIQA 2CFAB 3HMJG 4A3EC 1HI9A 2D74B 3TZWA 1U0SA 3MM7A 2PHCB 1LK5A 3ENAA 2ZDPA 4K7QA 4B3MJ 4NEZA 5CHPA 2A2CA 2AJ4A 2RQCA 4ZCIA 5LSOA 2B8QA 5IP7C 4TQRA 3IS9A 3EQLA 4X66F 1T8EA 1HWKA 1O8BA 1ZTWA 3Q8YA 1KLMA 2H5JB 4CNZA 5DM6Q 2E1MC 2BJEA 1FTCA 4FXVA 2PI5A 3GCWP 1RADB 4LSZB 5KFIA 4WFYA 2B9XA 3HVTA 2YKAA 2QMWA 2Y0SL 2YU9A 4DX6A 4UT4A 1UVKA 4DR4J 5FLXU 6FD1A 5HQ8A 3RAMA 2D1CA 3P5TL 1Y1WK 3LAMA 2BR0A 4KAIA 2V6TA 4XLNA 3MM8A 3RZOK 2FC9A 2K3IA 3W3SA 5IC6B 5C3EC 2KWAA 4G6VB 1TWAA 4C7QA 3I96A 3UW1A 5RUBA 1IWGA 2W1BA 3I5BA 3KTQA 1D09B 1H2VZ 4OYZA 1ZM4A 1HYSB 3GTKC 2MSTA 5E3RA 2X1FA 1RTDB 3S2DK 1S0OA 4LQ3A 1FRJA 2GZOA 1YG0A 3DLGB 1D8ZA 3KJFB 4FS2A 3I31A 2J9EA 3GTOK 1HNWJ 1FXRA 1SV5B 3DYAB 1CJTA 1QJHA 2W7AA 5IWAF 4JV2A 4YB7A 3FQKA 3BGUA 1K0TA 3C46A 4YFUA 1JLQB 2C2DA 3J81Y 2WB1D 2H3EB 4N47A 3IR7B 2HGLA 1G3OA 1RWVB 2BZ2A 1L3SA 1U45A 3NP5A 1JKHB 5C4XK 3GTPK 1OYDA 1O2BA 4YY3F 2JZ5A 2ADBA 1HQEB 1N54B 3HOVC 4DLGA 2NPFA 1SH0A 4M95A 3S16C 1H98A 3HFVA 2IC3A 4Z7CA 1TKDA 3RRGA 2LQ5A 2HNDB 4N76A 5B0BA 1VOMA 3KJVB 3B6BA 2E1RA 3HVAA 4FDFA 2FVPA 2V4RA 2YNIA 2HQCA 2MPUA 2QX0A 1WC3A 5JMNA 2ZBCA 4DR6F 3GSDA 3M1VB 1TWAC 4YFXA 2M8DB 1UA0A 2GIQA 3M8PA 1YVFA 4QR2A 3AA8A 1NDKA 4LJZA 1EKRA 2ZH1A 2PGCA 1SCJB 3FKIK 5M3MK 1FDDA 5CJ9A 5K5MA 4X4UA 5B0DA 2VFSA 3K5NA 4A3DK 4KPYA 5KFEA 1CJUA 4FBUA 3G9CA 3NWGA 5J1NA 5C5JA 4RR5A 1FRXA 1K8AT 1L3UA 3GFXA 1GEHA 3CD5A 3H8YA 1EX8A 3VCDA 3M9NB 3BUEA 4C3JC 3RZDC 2QLXA 1U6FA 4C3KA 4C8YA 5C7PA 3ZZYA 3M8QA 4Y0FA 3MEEB 2Y3PA 2DPIA 3CT9A 5FLXY 2Z56B 5IT4A 1UV7A 2PD1A 1U25A 2OTJS 2Z8QA 1HMVB 4URSA 2MHNA 3ZTPA 5HLFA 3O3LA 1C4AA 3I4NK 3DI6A 2XSJB 4N8OA 1BMQB 2QSFA 3F56A 3LH2S 1T3NA 4Y2MA 3EX7B 3ETMA 4C2MK 5D0HA 3IBCB 1W25A 3MR5A 2XGPA 1RT1B 4QWDA 3SYZA 3TP2A 4ZMMA 3NGKA 2YKMB 4UY85 1TKTB 3ILIA 2ACMA 1KRPA 4J5OA 2K06A 2MTLA 4NLXA 4WP3A 1RWUA 1JK9B 3FZ2A 4K8RA 3ZNJ1 5GAHI 4QIVA 3AJ2A 3FEYB 4R0JA 2JVOA 1FF2A 2VA3A 2XCOA 2N7YA 4FXDA 3I5CA 3V2UC 4IO9Q 1J98A 3TFJA 3TZZA 4B3RF 1PBAA 2HZAA 2HWHA 2UVWA 2QLWA 2R2SA 2AGPA 1F60B 3PYDA 2KRRA 2COLA 4QPXA 3PJXA 3AH5A 1TL5A 2XMWA 1RT7A 4C3IK 4A3BK 4PQAA 3QGGA 4QIWD 5HMYA 2AMCB 3KMSA 4LFAF 4PG5A 1HHSA 3E2EA 5K8NA 2R7ZK 2FB0A 4ED0A 2RRAA 2K7JA 2HLTA 2UXBJ 2NPIA 3CCQS 2W2OP 1I50A 3QWUA 3FK4A 5M5YK 4IH7A 4J7CA 1TL3B 2FQOA 2DH7A 1Q7LB 3HCXA 3GTLK 2JEGA 4L72B 5JFEA 1S99A 5F8LA 3ET6A 3ILOA 3AHPA 1GE9A 4OZ5A 2KJVA 2IIHA 2CQPA 4ZVGA 2NQPA 3DGPA 1S6OA 1SIWB 2W01A 3THVA 1EKSA 5HVHA 3ZZZA 3MOJB 1RTHB 3MM6A 2LEAA 2E2IK 1P8GA 3NKYA 4HTJA 2HAFA 4OLOA 1H2UX 4UOCA 1KBRA 2D9PA 1MMDA 2F4VF 3OUYA 4GFQA 3H4DA 5AJ3F 3QGIA 5IYCK 4GKKF 1VFJA 3SSSA 3U1MA 1WUUA 3EYZA 2MKHA 4A3IK 4DL4A 1F7VA 2LECA 2JFDA 5E3PA 4KRWA 4PABA 1O28A 4G3IA 4KDDA 2XO7A 4KC6A 1URNA 3CO0P 1MN7A 1MMLA 4ZHRB 4CO1A 3ADAC 2V63A 2ASYA 1PJ6A 2O3DA 2VDHA 4RJVA 1HBMA 1VLYA 2AEFA 2HVHA 1TWFK 1F1BB 4YB5A 2BUNA 5CZVA 5D6GA 2ZUAA 3W64A 4FXWA 3M3YK 4A3JK 1I50C 3VVTA 1VYAA 1LWCA 3PX6A 3NBPA 3QLHA 3BDPA 3CJ5A 5F0UA 3IAS9 1AUDA 3ZZPA 1VQYA 1WKJA 4ZOSA 1F5BA 3GTQC 1U2RA 3J7Z5 4ED5A 1UJ4A 2YPYA 4RW9B 3I0SA 1AT1B 1NSAA 3JAMU 3GTJK 2BE7D 2AGQA 2V5HG 2GGPA 2HGMA 4PQUB 4QIEA 4FBTA 4KIAA 3QAEA 2L3MA 3PFEA 3D1QA 4LRFA 1DTTB 1LW0B 2DHHA 1TZ0A 1KDNA 3PO3K 2HBRB 3K7RA 2XC9A 3FRYA 4DBQA 2UZAA 4CH7A 1CJVA 1U1QA 3K5OA 2MHEA 4CZCA 3HOWK 2BBEA 2NVTC 3AA9A 8ATCB 5DGAA 1UVJA 1RHQB 2F7VA 4I2PB 1KVIA 4HT5A 1U1RA 1QDUB 2OPRA 2LDYA 2JA6C 4R25A 5A6WA 1VI7A 2W9CA 2IRXA 3JTOA 5FD1A 4IRCA 1TAUA 2AX0A 1UEUA 4FP9A 4DMZA 1L3TA 3BDEA 3CDAA 4Y2IA 3FCHA 3ITHA 2I6WA 1TL1A 2XI3A 1GMWA 4I7FA 1LNQA 2GW8A 2JNJA 2WCXA 2CQ0A 4RUCA 4XSXA 4NCGA 3EMTA 3CDWA 1HR0J 3QZ7A 3P4UB 1YSJA 3PYFA 4OI6A 1DTQA 5D78A 2WB4A 3DOKB 4FM9A 1F0XA 4PXEA 2UU9F 3KUHA 2WSFC 3IXQA 2MQ8A 2GQCA 2DNMA 1YJ7A 1TV6B 1F9EB 3QT6A 3MPYA 3RJMB 2MY7A 1JLFB 3CJQA 3FBCA 1VQLS 2UXDJ 4N41A 4ANCA 4RZRA 4QYZK 4KB4A 3W8PA 1PAEX 3L3CA 3D4JA 4OI4A 3PIPQ 2L9WA 5KAKA 2VBXA 1NH7A 4JI5F 4PXCA 3TAMA 4IG0A 1AZSA 4ZLLA 1VH2A 2OGUA 4Q8FA 2MZTA 3MEGB 3QGPA 1E6VB 1FTRA 2IBOA 3MCSA 4WFBQ 3ENQA 2E9RX 1GTHA 4ZP7A 4F04B 4ZITA 3PIOQ 3M8YA 3AOBA 3KLIB 2ZH9A 4ALZA 1KFSA 1RA6A 5JXSA 4GKJJ 2Q43A 3DDKA 4Q5VA 1X5SA 3GZ7A 1JJ2R 4URQU 3EXYA 3HKWA 4PG4A 5KT4A 3EVMA 3RRKA 2WVDA 1IKXA 3JAMY 1DLOB 3KLGB 3GWCA 4JBCA 2OJ3A 2QO3A 1K1QA 1QLNA 1Q5YA 1J6XA 1SXLA 3C16B 2VKZG 2AT1B 4OYAA 5HP1A 3BO2A 1M5SA 4LK1A 4A8QA 4MEYA 1NK9A 1N5SA 2A69A 3OR2B 2M5YA 4EEYA 3BJYA 2HLUA 3VVUA 5JVHQ 4MQ9A 2HFUA 3KLHB 1NHVA 2FZKB 3CCRS 3H3VL 2CG8A 1HNXF 1FA0A 3MOZA 4YDXA 2GVDA 1DD5A 3BR8A 1YJTA 1FNXH 2CUYA 2R7XA 2BX6A 3W1YC 4YOEA 4UF4A 4RX6A 1JLGA 4OHZA 2V34A 3K8WA 2RU3A 1DQ9A 4QBUA 5DQIA 1S1WB 1K73T 4KHPJ 4TY8B 2CQ1A 3HSJA 5GAEI 4P74A 2VC0A 3FVYA 2F1FA 1U4BA 1R9TC 4Q0BA 4L74A 1S9GB 1LV5A 2J9DE 3M32B 5A0YA 5DDPC 1EFWA 5F41A 2ZVIA 4UQGA 3PO4A 2OD6A 3QPIA 1S1XB 1EARA 2BJDA 4ZPWR 3LP0A 5HMZA 3PACA 2R8IA 4DR1J 4W90B 2O5DA 1I6JA 4X4SA 3K58A 1KVJA 2K1RB 4KGKA 4U95A 4BKWA 1VQSA 5FDLB 1CBKA 2BV3A 4F02A 4IDKA 4LLGA 1VBZA 1NMEB 4ZKAA 3DRSA 3V4IB 4J9LA 5D4PA 4DG1B 5EWEA 4RW4B 3QNWB 5DRKA 1OY9A 1GX5A 4C8MA 3GTYX 3L7OA 3EE3A 1RTZA 3UCUP 4ECYA 1MROA 1R0BG 2E29A 4NXNJ 2AJ2A 3QAUA 2V4JB 1HIYA 5KFQA 2HRYA 2ROEA 4LJMA 2B56A 4QWCA 3DXBA 3QIPA 3GB0A 3FGVA 1RT6A 1EP4A 3T00A 3GP9A 1NJYA 2K3KA 1CJKA 4B9VA 3QFHA 3MMJA 3MPWA 4DG1A 3K7AC 4I64A 1N6QA 3FEXB 4KMDA 1AB8A 4KMAA 3HHLD 1RU2A 1K1SA 1SFOC 1KP6A 1PIEA 3B4DA 2GV1A 3HXMA 5D3GA 3NS5A 3NS6A 4OHYA 5A8KA 3JYTA 2LA4A 4NE9C 4X4OA 2H65B 4AD6A 2BQRA 2IM2A 1WHYA 1LWEB 3DLKA 2E9ZA 2VICA 2OMOA 4DUZJ 4MIAA 4ED4A 4TU7A 3LWLA 5B7WA 2W4DA 2B5JB 3TW0A 4L76A 3G8QA 3C3LA 1QAYA 5HO4A 1Z2ZA 2OFHX 1X4AA 2D3UA 5J2PA 4RUHA 3K0JA 2LFVA 3KLEB 4E0DA 5KG3A 3L95X 3V6JA 1Y1VK 3W63A 2R7WA 4PUOA 2YWWA 4J9QA 3A8IA 4LQ9A 5HMXA 4DV0J 3GJTB 4DR2F 2MKYA 5C42B 1KD1T 3MMBB 4C0OC 1WEXA 4KV8B 2NVQC 3Q2SC 3OFFA 4KR0B 3M2VB 2LYVA 3AQOA 2VDIA 3QT8A 5EWGA 1VQ7S 3D0IE 4DSIA 5GMKa 3OXGA 4EBEA 2XYPB 4ZP9A 3NNAA 4EFAC 3UCZP 3AJ1A 4JV5J 2CQGA 4HACA 2J8SA 2VOOA 3AT1B 2MJNA 1REVB 4LF7F 1N32J 1NRKA 5ETMA 2KI2A 1W2BR 1FFGB 2J6TA 3TEHB 5D4NA 4F2SA 5C44K 1ZAWA 1TQLA 2EWHA 5L46A 4ZN1A 3MAQA 3M05A 4KSEB 1S5ZA 3T5KA 1VQNS 3PW2A 4A3CC 1VJEA 1RWWB 1JXEA 4R5PA 4KM9A 1LWFA 3CDUA 4RW7B 1UL3A 4BXXK 3HHKA 4WCEQ 2ATLA 2VF3A 2PN6A 4HVZA 3IRXB 4XPEA 5I3QA 7AT1B 3HD2A 2NCKL 1YJUA 3MAAB 2CJ9A 3M9MB 3AXKA 1R8BA 1ZM2A 5THWA 3K57A 1G7CB 3N0VA 4ED7A 1TMJA 3MEKA 2R93A 4AFFA 3W9IA 2C3MA 3BO4A 2MZSA 2R9LA 1VCTA 4P71A 2JDJA 4FKYA 1WD6A 1X4EA 2I8EA 4F0KA 4CTAB 1C1CB 1RWXB 5C25A 5AE1A 4FVCA 1WTBA 3WHIA 4AH6A 3S1RC 3PG9A 1QTMA 1BQMB 3TZYA 2YX1A 5FJ4A 3D7SB 3SSQA 2CNOB 4KN7A 1PCAA 1Y0HA 3NS7B 1GXLA 3GE9A 1I94J 3D6MB 2W8LA 1NAQA 3FNNA 4H4OA 2ZFHA 4P73A 2F40A 1VLOA 2VFVA 3K8VA 2XS2A 2DH9A 3GTMA 4I2QA 5KG2A 2FDNA 3VAKA 2RHQB 5EWFA 4KGMA 5CXTA 4DF8A 2BQUA 4WBFA 2RB7A 1T9YA 4F4ZA 1TWGA 2YNHA 1RUSA 1R0CB 2FZGB 3DLEB 1P9YA 3MR3A 5ETLA 4DPTA 3CAGA 2AF6A 3D66A 1DFDA 2GMJA 4CP5A 2D3O1 3BR9A 1AXQA 5CYJA 2Y1RI 2R93C 1KWMA 1HBOB 1H7XA 2D7SA 3HULA 5AE2A 1WOSA 1T03A 3BKTA 2BM0A 3CC2S 3GFYA 4CLFA 2RKIA 4HKQA 2W2NP 2QGFB 2HFNA 4ZJLA 2OELA 1WORA 1VQMS 4DS4A 2W9BA 1U1OA 4B17A 3NNHA 3RB6A 3RAXA 3ETOA 1TFYA 3O8WA 1RT4A 4A4JA 4DR3J 4LR8A 4QJVA 4X62F 4P7TA 4E8UA 4X66J 3NY0A 5B0CA 1Y3JA 1TKZB 2QMXA 3T41A 4W92B 2HWIA 3C14A 1NSQA 3ZZTA 4P2SA 2NXUA 3S15K 1NK5A 3GTMC 4H4MB 1GTEA 1X4FA 3QT7A 4XPCA 4F3OA 2M88A 3SZ2A 4OX9J 1J6VA 1S6QA 3IR5B 1U1LA 4NA2A 1OWXA 3G8SA 3MUMP 2I38A 3NGTA 1UJ5A 4M94A 3N01A 5CAAA 1K47A 3BH7B 2CJQA 5D0EA 3QT5A 2QFJA 4QW8A 2KG0A 4IKAA 3UE2A 2P9GA 4ED2A 3N9UC 5DDRC 1J27A 2KB2A 1CS4A 2WVEA 4ZIWA 4GTAA 2KHDA 4YHHF 5HN0A 2GMLA 1L3KA 3GIJA 2GQ2A 5HBMA 1HNWF 1RWMB 4C8OA 2FGCA 3PVXA 1YI2S 4ECVA 4HH1A 2YKOA 1I6VA 5KFTA 4RKUC 2ZH2A 4RNNA 4C45A 3HOZK 1WOPA 1D1UA 4DZ6A 3PCOB 3OPFA 5L38A 3NWRA 1IW7A 4U7UK 4YS2A 5K14A 2RH6A 2FJDB 3MUVP 1WELA 1JNZB 2KVQE 2W8KA 3G82B 3JTPA 3J7YU 2MQLA 2HZVA 4IG3A 3KLFA 4LR2A 1YGYA 1IQTA 2IA6A 1JOEA 1TAQA 3W5XA 4DV1J 4YY3J 2BOPA 1INNA 2Q1LA 4Y00A 2XHWA 2ZNZA 3NOCA 3R5AA 2Z57B 4NLDA 3IM8A 2B9WA 2CQCA 1NHUA 4M1KA 1FERA 3IA0A 2ZUEA 4CCHA 3BQ1A 1Q86T 4FVMA 3HXAA 2UUAJ 1EK8A 3IBWA 1B7YB 3KDNA 1WC4A 2W24A 4P72A 4DL6A 3H0PA 4PZVA 1RAGB 1V3ZA 3KJNB 2Y9HA 3CCLS 3BGFA 2KZMA 3WBZA 4A46A 3D3CJ 3G86A 2FY8A 4HTIA 4F67A 2KTQA 4K50A 1RTJB 2G9OA 5K8PA 2HNYB 3TAPA 5AXKA 3NOGA 2Y0SD 1R8PA 3C66A 2LDIA 5B08A 1MU2A 4F4WA 2XY5A 3I0RA 3S1TA 3B4MA 1CULA 4KH1B 4WFXA 2HQDA 1NH8A 3S2HC 4GMKA 2XMVA 2F8MA 5M2UA 5IT9U 4PWWA 4DCOB 3S1QC 1YQHA 2BXJA 1Q95G 3N4WA 4JUZA 2OPQA 1NJIT 4ZP6A 2R7VA 4Q45A 1S72S 3PKMA 2MYFA 3CCMS 5KG4A 2DR8A 1KR4A 4LQYA 2HS3A 1RB0A 3QO9B 4FF1A 4GTEA 1YRTA 3UD3P 3HKZL 1QY7A 3RU0A 3DRPA 4LSNA 2ZVSA 5DLGA 1U47A 1EETB 2HG4A 4FYDA 3IPJA 3M30A 3GTGA 2NVXC 2DISA 2FLPA 5TMFA 2RDJA 1S48A 2CQIA 2DNYA 4WJ4A 4KM8A 3CCJS 4WIIA 4O4GA 4JI8J 3UNYA 2DIUA 1CC8A 2LLZA 4LRAA 2JA7K 5IM0B 3JSTA 2X3DA 1IKYA 2R92C 1L0WA 1SPBP 4B9NA 2WAQL 3GMGA 1T05B 5I3UB 4O3SA 2LP4A 5HI7A 5KOWA 2FYXA 4RW8B 1Y7PA 2CWXA 4IOBA 3SMZA 2M8HA 4USMA 3PKYA 5EDWA 1RAEB 4B3RJ 2VFUA 1IS1A 3PJWA 1S12A 1XPPA 2DT9A 1LFPA 3J80Y 4XAKA 4B3OB 4LRDA 2UXBF 3FBBA 4CLZA 2B9EA 2V68A 1IL2A 1FKOB 3J81j 4X65J 4A3EK 4ZS6A 2VG7A 2AJ1A 1FJ7A 5IYDK 3G6YA 2JA8C 2BE5A 4ES3A 2E5JA 3TUZC 3PX4A 1JLBA 3ILLA 1XZPB 3CJRA 2E1CA 4NWBA 2V2KA 4JI3F 3L4JA 2OSRA 1KTVA 3AB4B 3HFZB 3JQMA 5CD4A 2G13A 3CTRA 3F44A 3PO2C 3M6WA 2CAJA 4ECSA 4DV5F 2MZJA 1TL4A 3CF5Q 5J2NA 1D9FA 2XCPA 3NGSA 1VGYA 3G4CA 4UY8T 2GSNA 5L9NA 4KAWX 1U2CA 2RF2B 1C1BB 1I3QC 1Y5IB 1HNVA 3WZ0A 1W2IA 5GAGI 2XGQA 3QBCA 3P96A 4NI2B 2UUBF 5IT9Y 3A12A 4A3FC 1NJWA 3TZXA 4DS5A 3WIVA 8RUCA 4OV1A 5A8RB 2HHWA 1N48A 5JJBA 1GFWB 2DXEA 1TKXB 1T3OA 5HK4A 4C3HK 2LU1A 5IYBC 1SBRA 4J9OA 1ULRA 4ENOA 5C3EK 1DBDA 1RT5B 1UPMB 4B3SJ 3THTA 4DX8H 1M1KT 2JA5K 5JVOA 4AXJA 2RILA 1S6UA 4USTA 2DRBA 4IFVB 3LGHA 4BY7C 1RI7A 3GTKK 2GA7A 1S0NA 2C2RA 3HI9A 4CT9A 4BHQA 2MLXA 3WIUA 4EZ6A 1S79A 4UOGA 2FZCB 3CCES 2A6EA 3S1NK 5F8HA 1HBUB 4MYTA 2JJ4D 4CLYA 1H3DA 4OFZA 2BE2A 3KK3B 5K9FA 4PG8A 2HNZA 1TWCC 2E2HA 2J0SD 1SKWA 1SC3B 1U1NA 3MMAA 3TQ1A 1YDLA 3S1MK 1WHXA 1RLDA 3DFEA 2RQMA 2J9CA 2DGUA 2FJEB 2ZC4A 5FLMC 3NXZA 3V81A 1O29A 3M4OC 4LBHA 3ZC4A 3ZZRA 2ZZTA 4FF2A 3H25A 1N56A 1PJ7A 4NPOA 2G2ZA 4PRFA 3HOVK 1VR6A 4DN0A 2YU9K 4W4MA 1S1TB 3S16K 2EBEA 2IJFA 3ZO7A 3Q2TC 5HROB 1XNQF 3ZZOA 4IRKA 1I5OB 3UCGA 2MLZA 3R1HA 4ZVRB 4ECUA 5H1SV 4J9PA 1J5OA 3AB2B 3DRXA 3UN2A 5LXYA 5L1LA 3AXMA 3LPEA 1TWAK 3F73A 3HHLB 3OTDA 2IA0A 1HR0F 1BQNB 4EYHB 2GJ2A 4IFYB 2YNGA 3HOXC 2ACYA 4L73A 3Q8UA 3C19A 1T9WA 4PWDA 5KFUA 3N5BA 4FPIA 5KFMA 4M63A 1WF0A 3FBEA 3NUHA 1HQ2A 1ROFA 2H1YA 3J7ZT 3A3OB 2VC1A 3R27A 4NASA 2YWFA 2NXJA 2FY1A 4PPZA 3K5LA 3RB0A 3RTVA 3BQ2A 4ID5A 3D54A 3GG0A 3HHLA 2ZHBA 1IQZA 3MEDA 2PC6A 1YNJA 4ZCMA 2VPWB 3TFIA 4C3JK 2E2HC 2UXDF 1RT2A 2IDEA 4A8WA 2QA4S 2XULA 3RZOC 2J76E 1ZAVA 1XK8A 2CPJA 2G1DA 4ICLB 2BE9B 4C48A 4BCAA 4WILA 1UWAA 3R7SB 1ZM3A 2CZ4A 2OPPB 3W62A 4C9DA 2B6AA 1IBMJ 2B7BB 3DMJA 4CT8A 2HK3A 5EX3A 4OYMA 3S2DC 1WIHA 3MURP 4LMZA 2UUWA 4OZ2A 4XO0A 3VAFA 1NPPA 4N7TA 1V5VA 4A8XA 1AFIA 2VG6A 1O2AA 3KG4A 4EO6A 4BS2A 4ANDA 2Z2MA 2HIYA 4O0NA 4GKJF 4G0UA 4Y34A 2CPIA 3FSIA 5EGEA 3D68A 1GT8A 3JSMB 3TUJC 2QIFA 3SDEB 3CJKB 4S0MA 5M3FK 3CJTA 2O5IA 1HQUB 2NUHA 5IS2A 4F7VA 3C15B 1VK8A 3QJLA 2BJ1A 2CJKA 1LEOA 1ZPWX 2MGZA 2ALZA 2E2JK 1FKPB 2HURA 1GNKA 1U09A 5F9LA 4K0KJ 3FZBA 3NMAA 2V8HA 3HHLC 2KFYA 1C0UA 1FRKA 1S6PB 4PAAA 2WVBA 2DGSA 4L6V3 4DSKA 5FJ8K 3UPFA 4C98A 2V8DA 3LO3A 1IKVB 3LP1B 3BEGB 4LF2A 1FX4A 1DHMA 4JI2J 3FBFA 3OFGA 3HHDA 1OQ3A 4XDDA 2NVYA 3SQGB 3I5AA 1USOA 3Q8PB 4KHPF 2CJXB 4MFBA 1FJEB 1RT3A 3FKIC 4C11A 1VQKS 2NSCA 2PE8A 4A3DC 2PEHA 2HFZA 4L3NA 3KNGA 3MM5B 3JS9A 1NSKL 3GJSB 1NUEA 2E44A 2R7QA 4KO0A 2XMJA 2EEYA 2GO8A 1WWHA 1YJRA 3G87A 3EM1A 4CH0S 1Q8KA 3SV3A 5AE3A 5EHHA 2B4VA 4CO2A 2AD9A 4U6PA 2OH2A 3M2UB 1TFWA 2ZH5A 3HHNB 2CIMA 1YTYA 2KFNA 3VAIA 3G4AA 4K2XA 1C0TB 5ITHA 4IYQA 2X1GA 1W26A 1HI8A 1XXBA 3H40A 1N36J 1HBNA 2PT0A 4X4VA 4RW6B 3OSPA 2Z30B 4NLGA 4CO0A 4WP8A 3IR6B 4O44A 4L75A 3UWTA 4U7UD 2NVYC 4DV3J 2CPYA 1I50K 2XS7A 5A8WB 1RISA 2AW0A 5KFNA 2FHJA 4B02A 1SL0A 4NZ7A 2JX2A 1EQ0A 2FJBB 1LQ9A 4TKTA 2O5JA 2AYMA 5FIIA 1RE1B 3FFIA 3R9LA 2DH8A 5HL8A 4UOHA 1XR6A 2V6AA 5I3PA 3D9BA 4RL1A 1S0MA 4F26A 4GVLA 1QAJA 5C24A 4OJHA 4Y52K 2V6UA 5HATA 4U67Q 4ZPBA 4YEAA 2ASDA 1M1GA 2ROPA 4DUZF 2D69A 4I67A 2IYIA 4M8LA 2CPXA 1LXJA 2KKHA 2C3YA 4C0BA 5KTQA 1RQ0A 2QLJB 3JB9k 2C22A 2ALYB 1HKAA 1R7IA 2R7ZC 2IVMA 4NLPA 4OYXA 4G1QB 1ZAXA 2BM1A 1W7WA 4K4TA 1T9TA 4KATA 3WX8A 2NVTK 2A3JA 2EBBA 2V0NA 2WW8A 4LIRA 4DU8A 2F4FA 1YWXA 2GSOA 4DUYJ 1Q0NA 3GTLC 2AJQA 3UVJA 1PGZA 2BJ9A 2Y3YA 2NREA 2QEXS 3HZGA 5CD4H 3PEHA 1NPRA 4Q8EA 3RB3A 5HJYA 3BGRA 4DV0F 2IM0A 3JXOA 1NCLA 3C6TA 1E6YA 4ED3A 2VJVA 2VB6A 5AT1B 3RBDA 3EPGA 3THPA 1KQGB 3OVBA 1G1XA 4K4WA 2YBVA 4J9UE 2XMUA 2ZZNA 1TWHA 2FQTA 4F0MA 1YRUA 5KT6A 4R8UA 4DR2J 1QUPA 3DDNA 3HOYC 1KQFB 2FVRA 4CWBA 5I42A 2VBWA 4HEA9 2XZWA 2JL9A 5IYCC 2FHOB 4ZH4A 3TA1A 4JV5F 5J2MB 2EKNA 3R5JB 4A3IC 4PXBA 1N32F 1S1UA 1YBAA 5KFXA 4F3QA 1FDBA 3MPVA 4ZVHA 1R43A 2FJVA 4UW2A 4ZDNA 2CG4A 1HPZA 3MECB 1FWPA 3H2VE 1LW2B 1TWFC 2HRUA 1S1VA 1XXAA 2ZBRA 4ECXA 1IKWA 1GMVA 3U02A 4OI1A 4NLRA 3H0GA 3ZZ0A 4TU8A 1BD6A 2WHOA 3GLJA 1XBWA 3OLBA 4BLGA 4I0WA 1Q8BA 1PJ5A 1CG2A 2XBPA 1U8WA 2ROGA 5IP9C 2EKYA 3HJFA 3ERED 2WSCC 1RTIA 4EBCA 3GEIA 5K8MA 1WJ9A 2HMIA 1RAJA 1GAOA 2IAJB 3GTJC 3OJUA 1HI0P 1JXLA 5IOSA 4WTOB 2GVZB 3NCQA 5KFZA 4USVA 2XB2D 5CABA 2YVSA 2E5IA 4CLPA 4AUKA 2RQKA 1SIZA 4A3LK 1C0AA 1N5YA 3CCVS 3PO3C 1FRHA 2B0GA 1WQGA 3TO8A 3ELHA 3EZOA 4NX9A 2DNNA 5GADI 1OSDA 1I94F 2F9DA 3R97A 1NPKA 1YITS 1HARA 1KTQA 5G0RB 4OHWA 3HOWC 3GU0A 2IAJA 2UVUA 3D3BJ 3BP3A 1KVKA 3L7UA 3QRRA 1K44A 3NG8A 1DQAA 1Y00A 2XWXA 4NXMF 3DGVA 3Q8RB 4AQYJ 5CHCB 2FJAB 1VGXA 1UTAA 2V2ZA 1FVSA 4DQSA 1TK0A 3KK1A 2M4MA 4UUWA 2DTJA 1JLAB 2B51A 3SBMA 1SJFA 2KU7A 2N4DA 1QE1A 1SUQA 3D0GE 4YQWA 2EFNA 4DDQA 2J7KA 1R3NA 1Z2LA 2CADA 2ZITA 1RCOB 3MCOA 2ZZMA 2JLFA 4GTFA 1OPZA 2DGXA 4B9TA 4ZPAA 2MSSA 3FKBA 4YFKA 1IBAA 1GXUA 1MMNA 1FESA 4FYVB 2VPYB 3MM9B 3QX3A 2QSWA 1JLAA 1IJEB 1WQHA 2WVCA 2ZD1B 2DRAA 3ULHA 1JQWA 4CLKA 1F6TA 2PIIA 4DFKA 1CC7A 2M3DA 1UMJA 4LR9A 3KOAA 3W2VA 4FKXA 4EU0A 5CYQB 3GTKA 2OLWA 2N7CA 3GIKA 2I5JA 4QWEA 4J9NA 1AW0A 3UDEA 4EMDA 2HHUA 1XZQA 3Q8VA 1ZYRA 1B4AA 1HNIA 4DR3F 2HHVA 1OQ6A 2OO4A 4GTBA 2D3ZA 3I56S 2CFAA 1WC1A 1O6XA 2B4OA 2Z2YB 2HBZB 2C28A 1RKJA 3KHHA 4ZVUB 4CO4A 4X62J 1XEZA 4NRUA 3I32A 4FF4A 2OHDA 3RGIA 3W9JA 3QRQA 2DPJA 2VZ9A 5ETPA 5D0GA 2XWYA 4OX9F 2QFIA 3MCMA 3M8ZA 1K83A 4OYOA 4K4VA 4DN9A 3GQCA 1FWKA 3BYRA 3VQSA 2AP6A 1IBKJ 4ZVQB 1JWWA 2YKNB 1BXNA 3H4BA 3K7AK 4X2BA 3FDSA 5F8IA 2RE1A 4QIGA 5DETA 4KC5A 4F3MA 3AJDA 3GEHA 2HS0A 1X8DA 4Q43A 4TNOA 3TRGA 2RJZA 4OZNA 3NAHA 2QT7A 4K4YA 2RMLA 1HWUA 4CLWA 3IWLA 4WPAA 1FI4A 4J90A 2BMBA 4OIRA 1V9OA 3T01A 4YHHJ 2P8IA 3S14C 4OIXA 3BPDA 1TTHB 3CMQA 4WE1B 1CLFA 4NLUA 3I9V9 1J2VA 3DOLB 4PPDA 3HZEA 1EIYB 4QYZJ 2V50A 2WONB 4K59A 1MSWD 3PRDA 2Z2ZA 1HYSA 1RTDA 1WDDA 3MR7A 4HH0A 4H4KC 4MTPA 1WI8A 3DLGA 4A8KA 3BGOP 1F5CA 3H2UB 4DV1F 1SV5A 4QR0A 3DYAA 1NK6A 1B99A 2NVQK 2VUMA 2RDDA 1HNZJ 2FVCA 2LQ8A 2V67A 2XLKA 1K83C 1HD0A 1JLQA 1EAYC 2QZ8A 3SZYA 2R7RA 1UPPA 4O3NA 1X9SA 2HHQA 1R6VA 2V6SA 2UUAF 4A3KK 2ZOMA 2E7WA 2HFSA 1Y10A 2EXUA 3S7RA 4MMOA 2G2OA 3E01B 1JKHA 3VALA 3E51A 6AT1B 2WOMB 2YX7A 2HGNA 3A8EA 1JJHA 1HQEA 1RA7A 5KFBA 5D4LA 5B0AA 2KVIA 1VBYA 3VAGA 4TY9A 4JI0J 3WX4A 3CD7A 1FJGF 2RAQA 1KFDA 2HNDA 3KJVA 1BDFA 2MZQA 2R7UA 2C2KB 2V8VA 2LCWA 4LSLB 5CYMB 4ZCKA 1UVNA 4DV7J 4LF6J 4DFPA 2F3JA 3QSYB 3UR3C 4FN5A 2RD5C 2KT2A 3EZ5A 4JI6J 3M1VA 2Q6BA 2CRLA 2HK2A 3O1LA 1RWKB 2HW3A 4GTDA 1DCOA 1TVRB 4LFBJ 3LGNA 1X4HA 4PYDA 1QSSA 2QTWA 2OEJA 4C3MA 2VIHA 3V6DB 3GONA 3TX8A 3QSIA 2XY6A 5MAOA 2EG1A 2POKA 4W98A 1BQXA 3PNIA 2VUMC 1UEVA 4C97A 3DN9A 4KTQA 2KJWA 2OMLA 2R7TA 3Q0AA 3S1RK 5J2QB 3OL7A 3R5GA 3HM9A 1SVDA 4NA3A 1BLUA 3MEEA 1SQEA 4C8LA 3OBIA 1NZAA 1PKUA 4JI8F 1Q82T 2P6SA 4KFBB 1HMVA 3QWPA 2A1BA 5KG6A 1T9XA 4WF9Q 1EH1A 3M2RB 1IM4A 2XSJA 2BJ7A 4WP9A 1EHWA 4KY3A 3T5HA 2NR0A 1Y1VC 4M5JA 3PW4A 2XS5A 1N34J 3FSYA 1LOUA 1RT1A 1RWOB 1S10A 1X60A 3G96A 3FSXA 2YKMA 4KHMA 1TKTA 2E1AA 1UJ6A 1F9NA 3LP2B 2K7KA 1SC1B 4M1XA 1XMBA 3KYLA 3US5A 2DCLA 3I4PA 1N8RT 4X65F 1VRUB 4WYLA 2ZE2B 3H90A 2R93K 1GK8A 4Z2XA 3PR5B 4U9RA 3UDLA 3OVAA 1A7GE 3BQ0A 2FQQB 3GILA 3TJ8A 2AGOA 2CPZA 4UUXA 2DY1A 2R8KA 4IR9A 5B0FA 3VV2B 2VBYA 5IOLA 3GTQA 3GDZA 1IN0A 3NGDA 2V8PA 3X1LB 2B9YA 2A6OA 3NEKA 1OY8A 2IJRA 2X7IA 4JI3J 1R0AB 2E66A 4BXXC 2MKSA 3IWXA 3VAHA 1TL3A 4BLAA 2GAGC 4DV5J 4Y65A 2VUGA 1U48A 2ASLA 1X4CA 2MLYA 3I4MC 3POTB 5M5XK 4NCAA 3HKZD 2GS8A 3GTMK 1OYEA 4G0VA 1FK9B 2E7VA 3U1NA 4BLBA 2UUBJ 2KXFA 5C4JK 4Y7NC 2UVRA 1RTHA 4N56A 3KKFA 3KG0A 5L1KA 3A3NB 4C3LA 1TWGK 1ITPA 3CDBA 2JA6A 4M5DB 5H9EK 4WXWA 1IVZA 1VDHA 2MDAA 4B3SF 3QIDA 2EVZA 2Y8WA 5IZHA 2C3UA 3DLHA 1NU4A 3HD1A 2WAQD 3NRBA 1EQRA 1TUWA 4FYXB 2E5GA 1ZVUA 1RHUB 3UFCX 4OZ0A 1KHVA 2HHHJ 3F0NA 1HHQA 4Q7AA 3M9OB 2F9JA 3B82A 4ZHRA 3DOMB 2NS1B 4V1Ak 2HVEA 5F9NA 4ILLA 1TL7B 4BBSK 2X1AA 1UP1A 2N3OA 3RR7A 2DRDA 1YNNA 2PSZA 1PSDA 1NO8A 3W2WB 1BE4A 3B54A 2BANB 3TWZA 5KFWA 3PYEA 4J9KA 1X9WA 1Y9OA 3RBZA 1FEEA 3OV7A 2UUCJ 3IC1A 2P9EA 2I9SA 3CJSA 2WW4A 3VAMA 2ABYA 3N0BA 1QAIA 2PPBA 1DARA 3GYNA 1OS5A 4O23A 4JV1A 2ZH3A 4ZCLA 1TU0B 4RW9A 1JLCB 3JQJA 3R3TA 2N4CA 2NXCA 3MD1A 4U96A 2HPUA 2FC8A 4PQUA 4KT0C 1B4SA 2UXCJ 1I1GA 4BWJA 1RYRA 2M70A 3TYTA 1FRMA 2CQ3A 3CCUS 3J7A1 3LAPA 3RUBL 3FC9A 1DTTA 1LW0A 3OXLA 2DNLA 4ZLJA 2HVIA 1VK3A 4K4XA 3R6LB 2FLNA 2VODA 4P5BA 3HSDA 4RWWA 1XNQJ 3IBFB 4QQBA 1PAUB 2F65A 5HQMA 2QA1A 2JC0A 1H7WA 1KOHA 3DM2B 4KB7A 2HEKA 4QR1A 1QTNB 2X51A 2QJ3A 4ECWA 2HHSA 1VRTB 4I2PA 4RNHA 2RUGA 2GIRA 3CVKA 1RWPB 1N4LA 1A9NB 1JJCB 1H74A 4RNMA 4PEOA 3S15C 3IGVA 1NK8A 2MQNA 3H20A 1H73A 4ES2A 3P5BP 2DKOB 2NZCA 4TLRA 3PJ9A 2E1PA 3CC7S 4JP8A 3UDVA 2ILYA 4K4SA 3W7BA 3S1QK 4DR5J 1B70B 1BWVA 5IQQA 4PWUA 2QA4G 2V8GA 1EI6A 3OD2A 3GIMA 1RABB 1KKHA 4L3KA 1WSRA 2NSBA 2W2MP 3C2PA 3MHYA 3DOKA 1IBMF 2HZCA 3O44A 2VHGA 4OI2A 1M5VC 3AH6A 2OI2A 3QFWA 2MKJA 4XDCA 4JK1A 4KGVB 1K9MT 1WG4A 1TV6A 4N5SA 3IP0A 5KFYA 4DL3A 3DRYA 1JLFA 3I55S 2W4PA 3IGNA 3GFZA 1R9TA 4DPOA 2VOPA 2CPHA 1D3WA 5DDOC 3HK2A 2DNOA 2GMHA 3BM7A 4IQMA 2GSUA 5HMWA 3R1LA 1O26A 1B4BA 1U1PA 2HBQB 3HT0A 1R8AA 4YN3B 4EGLA 2DR6A 3CJ2A 4WKYA 4RUAA 3QJJA 3SIPB 3KK2B 1SH3A 3MEGA 4DX7A 4URGA 1E6VA 4NLQA 4MYUA 2HHTA 2IM1A 4K0KF 3OTBA 2KRBA 2K8GA 2A0FB 2EC0A 2HSEB 2M52A 3C6UB 3PRBA 1V6HA 1IQ0A 2VG5B 2E5LJ 3KLIA 1U0HB 2R8JA 1S49A 3OR1B 3S6EA 3BN4A 4TXSA 3D2WA 2U2FA 1IR1A 4JI2F 5KFLA 4OYPA 2XHCA 2BKNA 5DG8A 1DLOA 3KLGA 4NMXA 5J1EB 4A8FA 1NJZA 4GT9A 5KG0A 1QVFR 4YMEA 3IRWP 3CQZA 3C16A 1FJCA 1JNRB 2AHOB 1KQKA 2JA8K 3ZFVA 4CO5A 3OR2A 3DHWC 1Q7YT 2MMYA 2B43A 3KLHA 5LSRA 2AWZA 1S9EB 4LVNP 3GTGK 2J6SA 2B4UA 1RAAB 1XN9A 2YNFB 3V5RA 1YBUA 4ED1A 1LXNA 4P6QA 3PO2K 1SFOA 2L9NA 4OYBA 1D9AA 4YFNA 2R4FA 3GSIA 3VGUA 3UQSA 2YQ3A 1MNEA 3A1YG 5HQLA 1NKBA 1S1WA 4KN4A 2MKKA 5C2CA 4WK1A 3MR2A 3MR6A 2BYCA 4TY8A 2RSQA 3MMCB 1PYTA 4USUA 1FX2A 4KKOB 2NXNA 3GR0A 4F4AA 1IBLJ 1S9GA 1T02A 3LGMA 3M32A 4BC7A 1N36F 4A3FK 4Y6IA 5LT5A 3SCJE 4EYIB 4P2MA 3L4BC 2R2UA 4QU6A 2EPIA 2IYGA 3I6PA 2QL9B 1S1XA 1A0OB 3BBBA 3FJ2A 4EUVA 3ISNC 3HOUK 4LF9J 1RWNB 2P6TA 3OHBA 1FRIA 2C2MB 2K1RA 3CIMA 5FDLA 2ZH7A 4NLVA 3IMQJ 2DD8S 4DV3F 2RIJA 3D6HB 2A6MA 3CQZC 1RACB 4OZ1A 2XNQA 3BB5A 1VBKA 5AXNA 2GNKA 4RBUA 4AT1B 2JA7C 2MQQA 4NLSA 3AOAA 1X5PA 3EZUA 1UKUA 4BDPA 1JLEB 1UWBB 2ZHOA 3F41A 3V4IA 4LOWA 4HR2A 2HYIB 4RW4A 1ELOA 4UZBA 4ZVPB 1O27A 1OJ4A 2F8HA 3W61A 1B0PA 2Y1LB 3CMAS 1GXTA 3OFHA 2CWKA 4WFNQ 4V19J 1TWCK 3MI7X 1YIJS 4Y28C 2V4JA 3HHEA 1O2FB 1ZOTA 2PMZD 3MM7B 4P5AA 4OI3A 1N52B 2Z58B 3K59A 4OJ3A 2DR5A 4X84A 3PW5A 2QG9B 3OXFA 3S8SA 5FLMK 1I51B 3IS9B 3M4OK 1WF1A 5BR8J 4YB1P 3BO3A 1FNOA 4DUYF 5HAOA 1F9HA 2NYIA 2DEIA 3PR4A 5IYDC 5A76A 1XNRJ 2JEFA 4DPXA 1KLMB 4CQ1A 2MY8A 1DURA 4X64J 3PHTA 3CCWA 4M5IA 1Q79A 2VD3A 2PA8L 2Y1JA 1FHTA 1LWEA 5SUHA 1CQNA 3TNVA 4OIPA 3HVTB 4F4YA 2B5JA 2EC2A 1M5KC 4OZLA 2ADCA 4TYAA 4TU9A 4WWSA 4XSZA 1ZBSA 4FNIA 3HOXK 2DR9A 2NZ4A 2CQ4A 4RO0A 2GX8A 2DHXA 3ICLA 3BPSP 3MM8B 3AD9C 4AE5A 2DHSA 2F63A 3DHXA 3KLEA 2H5IB 2H5EA 4JI4J 4IOAQ 5F8NA 1RBAA 3VF0B 3MWBA 4A8YA 3ZTQA 3HFKA 1DJ0A 2LQJA 5C42A 3RR8A 3MMBA 3H5SA 4KV8A 1NHKL 3Q86A 2I2YA 2XQCA 3CNQP 3SV4A 2E2HK 3M2VA 4C3HC 4P2XA 3NMRA 2XMTA 1XR7A 1Z1ZA 1OSCA 5TJ3A 4BY1C 2QMUB 1MW7A 1CJTB 2JA5C 1VQ9S 2CQ2A 4K4ZA 1S4FA 3A13A 4EO8A 2VA2A 3TVKA 1O0PA 2CVIA 3TUIC 1P1TA 1REVA 4ECZA 5GMDA 5EGYA 3BV8A 5LMNJ 1NZ8A 3S1NC 2W4CA 1MLAA 4CLLA 4A3GK 4ETXA 1H2TZ 1TUGB 1RSCA 4B9UA 1L5UA 3M6XA 1S7HA 3TTGA 2KHCA 1O5JA 1ZYQA 2JH3A 4X6AC 4F2RA 3S0XA 4J3NA 2IC3B 5DG7A 3OHAA 4RW7A 3B8HA 3S1MC 2HQGA 5M5WK 4CYUB 3OTEA 4A93K 3IRXA 2YNIB 4O3PA 5KFDA 2MZ1A 3CD6S 4GRSA 3BKUA 1NXIA 4NL5A 1NK4A 2LEBA 3MAAA 2O67A 4AL6A 3OTOJ 2MQMA 1K0VA 3MZIA 1X4DA 3M8PB 4AQYF 2CPDA 4UOFA 2LXIA 2YU9C 1RAIB 3OL8A 3OLAA 1Q8IA 5F8GA 2IM3A 2JSXA 2HQFA 2HQ3A 1U7LA 2RS2A 3OL9A 2DNKA 3N3YA 4CTAA 4CYUA 1C1CA 2QN6B 4NXMJ 4KJIA 2BW2A 1CJUB 3RG6A 5M2PA 2M0GB 1BQMA 3G6VA 3P3DA 1REGX 4MK9A 2D3OR 1JJ4A 1VQ5S 4DQRA 5L8RC 4DCJB 2R7OA 4BBRC 1XWLA 4DSJA 4G1PA 3S01A 4HDHA 5D4OA 2GCFA 1VQPS 1C4CA 1X0FA 2CJAA 4F4XA 3K5PA 4Z7YA 3HLUA 3V6KA 3M8QB 2YWGA 3D0HE 4WJ3M 3FEZA 4ILDA 2DIVA 3CMES 2M2BA 2ZOFA 4RMFA 1F2HA 1JX4A 4OX6A 1QD1A 4WU2A 1BGXT 4TYBA 4EI2A 1I6HC 5E3CA 4A3MK 4U7CA 5HLFB 3DI6B 1B3TA 3OT9A 4QIFA 4HYKA 4ZIVA 1D8YA 5F8MA 3DLEA 5C2GA 2C2NA 3ZXWA 1JB0C 1OPIA 1RP5A 1S76D 3AY0A 2KDOA 1UETA 2WVFA 3CC4S 3R5DA 5BXIA 3AD7C 5KT7A 3GPAA 4IRDA 1SL2A 4ZVEA 1HBOA 4Q4ZA 4ID8A 3TVZA 2O01C 2Z2LA 5GAHU 1KOOA 3W66A 1SC6A 2J8AA 1VHIA 5ETNA 3CCTA 2HAIA 3SXLA 1WACA 3AOCA 1JQGA 3MPDA 2NVYK 2BACA 1FWLA 3I9ZA 3MFHA 3IO1A 2IFXA 3IM9A 3SSRA 5CZXA 3CWJA 3DLBA 3UD4P 1RT7B 5E3AA 4ZVSB 2HRTA 2AKWB 1WC6A 1IBKF 3PHEA 4MK7A 3GYXB 4OV6A 2W2PP 1BWEA 4DZDA 2R8GA 4YDDB 1TKZA 4X4QA 4DCPB 3A8KA 2DNHA 2E2JC 3TFHA 4CO3A 1ZZNA 2XCRB 4RUBA 4H4MA 3L7PA 4H54A 1R89A 4MK8A 4P2FA 1PC5A 3SCKE 3ET6B 4I68A 4CRJA 4AYBD 3R7NB 1S9FA 5D8HB 3WQPA 4B9LA 5K20B 2VH7A 3DGPB 1Y11A 2AV5A 1UEKA 3BF4A 3VHQA 1FDAA 4C8NA 1AUSL 4YR2A 3MM6B 4IUFA 1HFEL 2P5MA 1KC8T 4DR7J 3RZAA 1WDTA 2QLBB 4ELTA 4DPYA 4JYAJ 4Y2KA 4DV4J 3KHLA 2CNNB 3OUYB 2DBBA 2FGOA 1J6WA 2QL5B 5KFJA 4AL5A 2L48A 4G65A 1TP7A 1HNZF 1XR5A 1FFSB 1DQ8A 1ZH5A 2VQEJ 4J37A 2EW9A 3V6HA 2IMWP 2Z0GA 4TVAB 3MDFA 4Q2MA 2ZWOA 2CKWA 3HOYK 3UN3A 1HBMB 1RCXB 1UZHA 4I6AA 4J9RA 2XLIA 1RBLA 2NVXA 1AA1B 4LVOP 2RNEA 5ETRA 1KQ4A 9RUBA 2IVYA 1SKRA 3FCVA 1KLNA 3EWGA 3G82A 1YZ6A 3J7YI 2PFFB 1LWCB 2ZOGA 3EICA 3NBPB 5B0GA 4JI0F 3QLHB 5KT2A 2DJWA 3CCZA 2HQIA 4I6YA 3HP6A 2GC8A 3L4KA 4LF4F 2B63A 2R92A 4FZBA 4USHA 4DV7F 3K17A 4LF6F 4OL8A 2VONA 4DPUA 1QAXA 3I0SB 1FJGJ 2KG1A 4DWIA 4JI6F 2R42A 4U8VA 1O25A 2OP5A 2GGPB 4LF1A 4I4BA 2J5AA 2OKQA 5KOXA 3TA2A 4NMLA 4LFBF 3RYLA 2XI2A 4CLSA 2ASJA 5KG1A 1NDCA 2DXFA 1RTJA 2PMWA 2HNYA 5IP9K 1L3VA 1ZBTA 4WU3A 2NUUG 3KWMA 1CJVB 3LQVA 3OREA 2X3GA 4Y52C 1YJVA 1SKUB 2LMIA 2BVZA 2DGVA 3L9ZA 3LWMA 2OPRB 2EFPA 3VZIA 1TWHK 1KQSR 3R6GB 4USWA 4NOHA 2YH0A 4TQSA 2W9CB 3EGVA 1S97A 3HDSA 2OEKA 4MT1A 4O3OA 2Y0BB 3EJMA 3AD8C 4DV2J 2V2VA 2CW0A 3ITHB 4D3GA 1TL1B 2L9DA 3H7HB 4I7FB 2OPSB 3CIZA 1TMMA 1WEZA 1VQ4S 1XJWB 2QE5A 4QPTA 3LF0A 3QO9A 4KB2A 4NCGB 2W25A 3CO9A 3NAIA 4UTGA 1Q8LA 4LF8J 2B63C 1DTQB 1EETA 1XMOJ 2R8HA 1RLCL 2YPZA 1I3QA 3Q24A 4DFJA 4M5NA 1N34F 2ZC3A 2Q6CA 3SI8A 3EVWA 4QYRA 2ZWPA 4DL7A 2OPSA 3PZPA 2C2OB 2FUG9 3H0GK 1UAWA 3MPUB 3WC0A 4KHRA 3FCWA 2CJBA 2N3LA 1YRXA 1WG5A 2FTRA 4NLTA 1LWXA 4K2JA 5IM0A 1Q53A 4JOUA 4PYAA 5E0OA 2YH1A 1F5AA 1KEKA 1TK8A 1T05A 4LFCJ 5I3UA 3EGWB 1UW4A 1XQIA 3TAMB 4RW8A 5DJBA 4IG0B 3S17C 1AZSB 3CSKA 2DCUB 1S57A 3UDCA 4Y2AA 3AFGA 2VQFF 2CZ9A 5IXUA 2EFOA 3T1HJ 2F8EX 1FT8A 1NSPA 3PFOA 3GFHA 4A47A 2O66A 4DQQA 4JI1F 3NL0A 1DY3A 1FCAA 2IPOB 3IN5A 4CM0A 1HI1A 4ILRA 5DDQC 5LOQA 3AAWB 4B3OA 3R2CJ 1APSA 5EN1A 4NLYA 1NBEB 1URRA 3SCLE 2YY3A 3E8OA 2EI5A 3EVOA 2QYGA 1FKOA 5IP7K 2G0CA 5IFMA 1TWCA 3VWSA 2AYEA 5KFOA 5L1IA 1RHMB 1WCMA 2PDAA 3HX9A 3O5TB 2R2TA 3WODA 3OJSA 4CH1A 2U1AA 1IKXB 2WTFA 1WG1A 3NLCA 2IBKA 4OLPA 3RRHA 4E98A 1KS2A 3D6TB 5KG7A 1XZPA 2KH9A 2XO6A 5HP1B 1QVGR 3GIRA 3DXJA 2HHPA 4DUTA 4OQJA 4RLEA 4WIQA 4G7OA 1DRZA 2B7CB 2JFKA 4HL9A 2MJUA 2H4WB 4A3LC 3H5XA 2BRLA 2K2PA 1EB0A 4FPRA 5ETTA 3R2DJ 1CQMA 2RF2A 2GVDB 1H72C 1C1BA 2AJ0A 2DY9A 4LRBA 3QRPA 2ZJPQ 3DNCA 5DO2A 2R3VA 2JOQA 1JLGB 2ZBQA 5BYSA 4NI2A 4MH8A 3GJRB 5J1PA 1Q81T 1UA1A 2HHHF 3HO1A 2M9KA 3JSBA 2LVWA 4C4WA 3W65A 4P52A 5F3ZA 5GAEU 2YKQA 3CJ8A 4YR3A 4P9SA 5A8RA 2D9OA 1HA1A 2W7OA 4ZPVR 1TKXA 4DDFA 1S7IA 4Q0BB 1VBXA 3HF5A 3S14K 1SI9A 3IFEA 1YCLA 5A0YB 3R5BA 2HFVA 2AX1A 3QJPA 4UQTA 2RU9A 2QYCA 1J5EJ 1RT5A 3LP0B 1I3OB 2UUCF 4IFVA 2D41A 1WCMC 2KL8A 1Y1WA 1PYSB 2RRNA 1GMUA 1Q78A 4IDKB 1N0VC 2JLEA 2RQ4A 4OZJA 1HBUA 4IR1A 2DR7A 4KYZA 2UXCF 1WKKA 3KK3A 2OAUA 3DRSB 1VJWA 1K83K 3IWNC 5DQGA 5DZ7A 4OJ1A 2YKPA 2N82B 3EUNA 1KHWA 2RT3A 3JTNA 2IVFB 2XCAA 2OUGA 1UCNA 1P6TA 2CPEA 3GTOA 5IOTA 4R0EA 3Q8QB 2H54B 1MROB 3R7BB 5GMEA 4I69A 3PY8A 1USMA 4FYYB 3KNAA 2WBRA 3UI3A 2OIHA 1BHNA 3L09A 1ZQ1C 3QIPB 4OJGA 1RT6B 4DL5A 1EP4B 1S1TA 3T6BA 1CJKB 3KMQA 3T5JA 2F5GA 3G6ES 5CH7B 5HROA 2BKPA 2HKEA 1N6QB 3KHRA 1VHFA 3GTPA 1SJQA 2V69A 4Y2CA 2PO4A 3DLLQ 3LPYA 4USJC 4ETZA 3MAHA 2ILZA 3DU5A 3DDIA 4IO1A 1PYOB 5M2RA 3V4GA 2V2QA 5D3GB 2JHEA 1NB2A 4DR5F 3N6LA 2GO9A 3D6FB 2A6HA 5A8KB 3JYTB 1BQNA 5TMCA 4YUDA 1N5TA 4IFYA 2P9CA 3T1YJ 1Y1WC 3DLKB 5A2QU 3BSCA 3PXGa 3RZDK 3NCRA 2V4QA 2C3OA 1JIHA 5KFGA 3LOUA 4K4UA 2XNRA 1QM9A 4LF5F 2DGTA 5B0EA 2YTCA 4ES1A 2MQOA 2QL7B 4YP3A 2VUMK 5KFFA 3JQKA 4M5LA 3VGVA 3HSGA 3FKIA 5J2PB 1SJ3P 4ZK7M 4X4RA 3LW5C 4N77A 4O2DA 3TA0A 3PDNA 1SJ1A 1R8CA 2E7XA 4M5MA 1P9QC 4ZVFA 3GTOC 4PUOB 3O2IA 4ZJOA 2VV5A 4ICLA 2ZM6F 3LTOA 1ZTTA 3FUYA 3PW7A 3BSOA 2BQ3A 2OPPA 4WFAQ 2KN4A 3K5MA 1N33J 2X1BA 1UVMA 5KFPA 3TVYA 3VGTA 3DRRB 2XMKA 6FDRA 4WK3A 1CEZA 5C4XC 2E5LF 3GTPC 2VPZB 3BBFA 4HACB 2BRKA 1FD8A 3GG1A 4LK0A 3JSMA 5KT3A 5KFVA 3PW0A 4WYWA 3SDEA 3CJKA 4OMFG 3IAM9 2EFGA 2CQBA 1HQUA 2P8TA 4DEZA 3KHGA 4A3KC 2FD2A 3DRRA 3ISZA 2CDRB 3C15A 4KQZA 4C2MA 2CA9A 3N79A 4A48A 2ZUFA 4DPWA 2UV8G 2PMZL 4R5PB 1FKPA 1LWFB 2Q3PA 4DU7A 4JI7F 1F9FA 1TELA 4X4TA 3G2XA 5BJRA 3BN7A 1S6PA 2OFGX 4Y3CA 5DS7A 1NKEA 2FHKA 5IT0A 4GVBB 2XYGB 3AODA 2APOA 2SXLA 1IKVA 3LP1A 2E9TA 2IMOA 5D77A 1PBUA 4FS1A 1VS3A 1N88A 3DCAA 3M7VA 1T0TV 3SQGA 2DHGA 2VASA 5IORA 5C25B 1ACMB 1UFKA 2AYBA 4NYOA 4IH5A 3OW2R 1Q1KA 1WEYA 2A10A 3GCXP 1ZA2B 1AB4A 1XMQJ 4GVBA 1VIOA 1IBLF 1NM2A 2LQ9A 3I4MK 1F7UA 2R7ZA 3MM5A 2ZUGA 5LMUJ 3BH6B 4B3TJ 4QWAA 4CM2A 1HQMA 5A2QY 2XM3A 5E5NA 1M1HA 1WTFA 3CGIA 3KJQB 3Q89A 4LF9F 3MCNA 4YR0A 2R7SA 1MWYA 4Y7NK 3GTLA 3QATA 3I4NC 3PM9A 4H4OB 2ZFZA 1SKSA 2EK6A 4DOZA 5HL7Q 2O1PA 1D0EA 3EDRB 4CLUA 4XTTA 2DNRA 2P2CB 3M2UA 1ZA1B 4I2QB 2J0XA 4C2MC 4Q5SA 3RBXA 2GHVC 4A8OA 1VQOS 1C0TA 2M7SA 2E2IA 1V3SA 1TK5A 4NZ0A 3T02A 2YNHB 2DNZA 2BOAA 4MIBA 1U2FA 2C3PA 3GTQK 4RW6A 4ED6A 4JB8B 2AJFE 5KFHA 2FHJD 4F0HA 2RUSA 2XG8A 1PG5B 1FFWB 3DC2A 1R8HA 1T03B 4AXIA 2UV8A 5LSLA 3SCIE 4F25A 5A8WA 3LPXA 4K5RA 1LK7A 2UVVA 2EG2A 2YWHA 4C3IC 4A3BC 4DV6F 2RHSB 1PILA 3H98A 3MGJA 1RAHB 2RKIB 4G0WA 4LT6A 1NJXA 5BR8F 1TWFA 3GIIA 1Y4ZB 3ONQA 2W9BB 5D15A 5HVGA 2XEXA 1UZDA 4KMUA 3E3XA 4ED8A 2WB1L 1Y3KA 4J9VA 4BWMA 2HHXA 1XNRF 1RT4B 3TI0A 4QJVB 2Z4PA 4MIWA 4X64F 2DK2A 3TAQA 4DSFA 1ICEB 2PEBA 4B3MF 2QRRA 3KXDA 3CXCR 2JA6K 1WF2A 3PYGA 5E7OB 3C14B 1V3RA 2MXYA 4IOCQ 4G1QA 3GTJA 4MKBA 1S6QB 3NNCA 1OMSA 1U1MA 2ZDOA 1Y5NB 1RKIA 1WC5A 2E2IC 1ISEA 3CJ3A 2BEFA 1T95A 2H4YB 4KASA 4JI4F 1RHRB 3VAJA 2GIFA 2YQ0A 2HIQA 2VFRA 1OY6A 8AT1B 1VC0A 1Z4UA 1FE4A 2VKRA 1EQMA 4DR4F 4YG2A 3U1LA 3O6QA 2HFOA 2W9AA 1CS4B 1U49A 3T9NA 4MAKA 2GHPA 5C4JC 1X5TA 2VL1A 4DSLA 2V9WA 2FHMA 5HBMB 1FNMA 1TWGC 1N5VA 2HS4A 3EXCX 1VJQA 3RW6A 2QA2A 2DNGA 5J2MA 3AQPA 1KN6A 1FO1A 1C2PA 1RZMA 1S77D 3FMWA 3M3YC 2VJUA 5IV4A 5SZTA 4A3JC 3KUEA 3SQOP 4D3HA 9ATCB 4Q44A 1OO0B 3UO0A 1HW9A 3ZZUA 5LMNF 4C6AA 5K14B 4E2FB 5JVGQ 4HHHA 4OZ3A 1GX6A 3PO5A 4XK8C 4PXDA 3MECA 3EPIA 1QSLA 3T9ZA 3T5LA 1NK7A 4KGZB 4BBSC 4IG3B 2PI4A 3KLFB 1LW2A 3PX0A 1YLXA 1QUVA 4YB6A 3RB4A 1B0TA 3BP8C 2R2RA 1Y5LB 3P49B 3C8YA 2G4BA 3J7AN 7FD1A 5IWAJ 1RGVA 1ZM9A 1N5QA 2LXFA 5JUMA 4I56A 1G51A 4EBDA 4PG7A 1ZS6A 2FPHX 5LJ3Y 5KT5A 3X3UA 1VIXA 3OTOF 3WC2A 2KFZA 2MZRA 1IUJA 1RHJB 2DITA 3TJAA 3J80U 4HHJA 1UVLA 4ZVTB 2PA8D 4F50A 1B64A 3KFWX 2DYAA 3B78A 4GC7A 4DSEA 2GVZA 5E2QA 5EUHA 5KFAA 3Q22A 1MU2B 5DZ6A 2VPXB 2W7VA 1T94A 4ILMA 2RRBA 3I0RB 1B7FA 1CULB 3TARA 1IBCB 2DVIA 5H9EJ 7FDRA 5G0RA 2OTLS 4QW9A 2Y1IA 3MD3A 4QIWL 2QC3A 1XC9A 4AYBL 4DR6J 3M8WA 2A18A 2D6FC 3U7JA 1VRQC 3G8TA 2WSEC 2OPQB 5F0WA 3TR5A 4DX5A 5AXLA 1X4BA 4GO5X 3VQTA 2NYHA 1MN9A 1R9TK 3P6YC 1MG7A 3N0CA 1IR0A 1WI6A 3CCSS 5IV3A 2FJWA 4BC9A 2UUTA 4C8ZA 1Q5VA 2V9KA 1WHVA 3DRPB 4LSNB 2AZ3A 1NK0A 5HSPA 1R6YA 4WZQA 1BJTA 2MEWA 3M30B 5E41A 3W8GA 2RDIA 5I4MA 1NDLA 2CPFA 1BY9A 5HJXA 4Q2LA 3MM9A 4ECTA 4K5SA 1BGWA 1VMBA 4NLWA 3U27A 5HVFA 4O4GB 2ZD1A 4J91A 4ZLPA 1P1LA 5BYQA 3D1OA 1IKYB 3RAQA 2IRYA 5GVQA 4ZN3A 5CYQA 1FVQA 4ER8A 1S59A 1CVJA 4RNOA 2BABA 4H4KA 3DU6A 1G2EA 4KBIA 4PKDB 4QU7A 3LAKA 3FMBA 3K89A 3DLJA 3CQZK 4I6WA 1SH2A 2ZH6A 2I0XA 4M5GA 1JVIA 5E33A 2AEJA 2H48B 3EGNA 3GV8B 3H2LA 2DB1A 2BDPA 4Z37A 1GH8A 3TANA 1M5PC 1VISA 2KT5A 1SC4B 3TUPA 1WQFA 3BKFA 5F3TA 2VG7B 1SFOK 2Y8YA 3VA7A 3R5CA 2DEJA 3GR1A 3HVWA 4AL7A 3H42A 1HD1A 3VGSA 1YJ9S 1OIAA 2ATCB 2PA3A 5CCMA 1JLBB 3ENWA 3MF5A 2EFQA 2ZH8A 5E68A 4J9SA 4EK2A 1HHTP 4O0IA 2IY5B 2A68A 2CFXA 1U6ZA 1YX2A 2BA9A 2YKNA 5AXMA 3SEOA 4LFAJ 4EZ9A 1U24A 5KG5A 4QOTA 4DR7F 4NLOA 4ECQA 4QWBA 5J2NB 3PTWA 2OD4A 3M4XA 4JYAF 4HLBA 3A3PB 4DV4F 4NCBA 3MTKA 5LXRA 4U8YA 1SJRA 2QV6A 1X31C 5CA5A 1XIQA 2MB0B 2KO1A 1HNVB 3GTGC 5GAGU 2G1HA 4G7HA 2GHWA 2CNLB 3RW7A 4P10A 4NOIA 2WRMA 2VQEF 3I82A 5LM7E 4GZYA 3PEJA 3W5YA 5DQHA 2P5VA 4WE1A 3D28A 4OIOA 3M8SA 3RBEA 3DOLA 5CQGA 1S4EA 2WONA 2HBYB 5MLCV 2AIRB 1F3VA 5EGHA 2GAHC 4B08A 2B3TB 5ETSA 4X4NA 4CLTA 2JEIA 2NLWA 3KLVA 1BS2A 5KFRA 3CPWR 2F4VJ 1WNEA 1NDPA 3OTCA 5AJ3J 1TR0A 2ZEJA 2JEJA 4GKKJ 2YX4A 1ZXOA 5IOQA 2XZTB 1IR2A 3OEPA 1NB7A 4OHXA 2B8PA 4DI6A 1TUVA 3HOUC 3G4SS 2V94A 4V19X 3HVRA 1M5HA 5ETOA 2J6UA 4WTYA 4EWTA 1FXDA 4BBYA 4IH6A 5D4DA 2J7WA 4BY1K 4PR6A 2BW7A 4MKAA 4LF4J 1Y1VA 2XMMA 2BE2B 4ANEA 1HWLA 2HNZB 3E01A 1D9DA 4C0HA 2WOMA 3TX0A 3OVSA 4A3CK 1M0SA 1IJFB 3MMAB 1X9MA 2LXUA 5CCLA 3LUYA 5D0RA 4MEXA 2XCQA 3V81B 1FKAF 3FHZA 2YWEA 4LSLA 3H5YA 1RXOB 5CYMA 5T41A 2GJFA 4KE5A 1YJNS 4CDIA 2Q66A 4X6AK 5DGBA 2H9ZA 4KH0B 2BKOA 1ZPVA 2ZJRQ 3PV8A 1RAOA 4N8NA 4DV2F 3D1HA 2QLFB 1TVRA 5H9FJ 4OX8A 1T7PA 1RBOB 3ZTRA 2ZBIA 4ZA1A 2L08A 1KNZA 1J5OB 4ATNA 3T6JA 3CE8A 3V6DA 4HDGA 4A8SA 3QZ8A 3VZHA 2H51B 4LBIA 4WJBA 2YNGB 4LF8F 1Q16B 2ERRA 4RU9A 3N6NA 4PWDB 1XMOF 1RAFB 3NCPA 1G6BA 1QSYA 2RH3A 5E3QA 4ZLNA 4KMHA 2KM8B 3IG1B 1UFLA 1AROP 3P8BB 5J2QA 3CJ0A 4GC6A 3LANA 2DGWA 2RVJA 4MJKA 2DGOA 4LREA 1XTZA 4USIA 4CNYA 4ID5B 4BBRK 1SQGA 4USKA 4G7ZA 3HSZA 4OYIA 3MEDB 2KYZA 2LKZA 1RT2B 4KFBA 2G0JA 2CDQA 2LA6A 4DXLA 4NA1A 4LFCF 1O51A 3CD0A 1RK8A 3DXSX 3IG1A 2KYXA 3M2RA 3QYYA 5HANA 1DCHA 3TOQA 2W2QP 3KG1A 2C1EB 2B6AB 1I6HK 5L39A 1U8SA 3LA0A 3T1HF 3DMJB 1XXCA 3CUNA 1DAXA 2UU9J 4ZVOB 3D5MA 4ERDA 3NGUA 2VG6B 4UZCA 5C44C 2VQFJ 3LP2A 1IXKA 4F4KA 2CZVC 1EJ7L 1FXLA 3GV5B 4JI1J 2HVZA 2DO0A 3BGLA 4OINA 3N6MA 1PO6A 1DZ5A 1VRUA 2ZE2A 1YBTA 2JLGA 1CSJA 4I1TA 3SZZA 4O3QA 3M6VA 1UFWA 4JI5J 2XMAA 3ZNUA 1VQ8S 4RPFA 1WSVA 4XIUA 1NEEA 4HT7A 2DO4A 2MGZB 2FJXA 3TJ9A 2MKIA 4A3GC 3H59A 2ZBPA 1P27B 4FF3A 5ADZA 4GTLA 3BZQA 1FE0A 2WK4A 2AU0A 1C0UB 1R0AA 3G6XA 2G0IA 4LUBA 5ETKA 2MKCA 1SQFA 4WXOA 2CNKB 5L9XA 4A93C 2B4PA 5B09A 1U6BA 3Q3QA 4ZPCA 3QQCD 4DL2A 1F3FA 3OL6A 2KM8C 4NYZA 1BC6A 2XY7A 4ELVA 3FQLA 5BYRA 3POTA 2JC1A 3LALA 3JSRA 5A6PA 4CIOA 4MFBB 1FK9A 4DQIA 1RT3B 2VU5A 1YHQS 4C11B 5L1JA 1RHKB 4G1IA 1YJWS 3GYGA 4NRTA 1S0VA 1VC5A 4ZJQA 1WKLA 4M5DA 4KO0B 1J5EF 4F8RA 1G4CA 1HNXJ 3MTJA 4ZP8A 2CXEA 4HI2A 2DNPA 4OX7A 4O4RA 3MFIA 1ZETA 4P7VA 1VQ6S 1SMYA 2G2YA 5K8OA 1XERA 4FYWB 4KARA 3DOMA 4RBTA 1YZ7A 2JRSA 3JSYA 1MWQA 3M8RA 1F2GA 1TL7A 3GEEA 4PG6A 4DHVA 4A3MC 4DR1F 4FNHA 4PCQA 4MKYA 3FOEA 2HVDA 1HBNB 3BS9A 3W2WA 4X4PA 2BANA 1JMTA 2YXLA 2W7PA 3W9HA 5KFKA 3BBCA 2MQPA 1T11A 3MUTP 2XTJP 3SFGA 4O44B 1KSPA 4XCHA 2GJIA 3G71S 1RDRA 3A4TA 1JLCA 1IWAA 5ETQA 4RNFA 2FVQA 1VC6A 2RS8A 4LR7A 3ILJA 1U26A 3NGRA 2VFTA 3FFIB 3UN5A 3V4MA 3ZTSA 2WBMA 4TLQA 2RGRA 3HT3A 4NYPA 4NXNF 3BSNA 5C24B 1GMWD 2AZ1A 1GQEA 3QGHA 3A8JA 1YK9A 3I87A 1UW9A 1IM6A 3DM2A 1UVIA 1FRLA 4RBVA 1HW8A 3T1YF 3GJQB 3S2HK 5DLFA 3CJ4A 2GFFA 2OEMA 2AQ4A 4KPCA 3Q8SB 1M90T 1VRTA 2EBGA 1WHWA 2IJNA 2ZKTA 1NNDA 4TN2A 1RYSA 2DXDA 2HWTA 2FLLA 3CB4A 3SFUA 3H3VD 2XZDB 1M5OC 4GO7X 5DM7Q 3T3FA 2CYYA 1HWJA 4HI1A 2JWNA 4LRCA 5T7LB 3M6UA 2BJ8A 4LF5J 5U47A 3UVJB 1IE0A 1O24A 5F8JA 2I1RA 3OFEA 3VR1A 2FIUA 3K2YA 5T14A 3BGRB 1FDNA 4B9SA 1NKCA 3C6TB 1E6YB 4CI0B 2NVXK 2KXHA 2DGQA 2CVEA 3HOZC 1RJJA 1X0PA 1N33F 2LQBA 3EDQB 1KONA 3BYPA 3TQEA 5T7LA 2C2ZB 1FD2A 5LL6d 4R8UB 3GV7B 4DJBA 4DL0C 2ZM6J 1U1KA 2C2EA 5I42B 1Q4RA 1A6LA 3UR0A 2B63K 4FZVA 2R92K 3W5ZA 2FLOA 3W60A 3KDOA 1X5OA 2Q79A 3BREA 1S1UB 2XLJA 2FVSA 4NZ6A 2AYGA 1SL1A 4WKRA 2CJYB 1LKZA 3ENVA 2ZNYA 4IQXA 2CQDA 1HPZB 2WZ1A 3Q83A 2DHAA 3TEGA 3KK2A 1RU1A 4F36A 1S1VB 1EZZB 2OSQA 1IKWB 4M5HA 4HHUA 3WDOA 4ECRA 2E5HA 1T9UA 2XSFA 3ISND 4ZPTR 4P75A 3S17K 2KT3A 3C6UA 4M5KA 2VG5A 4XLPA 1U02A 3CW2C 3OSNA 2L41A 4GTCA 3LAJA 2IDLA 3R8YA 2JA7A 1U0HA 3OR1A 2J7UA 1V5IB 4LF7J 2LU2A 2UP1A 2C42A 3VTIA 4DFMA 3HPOA 4DQPA 4JI7J 3MMLB 1RTIB 2HMIB 1SB6A 5J1EA 5IC4B 2CQHA 2JVRA 1F93A 2KXNB 2PMHA 3CULA 2AEMA 4LIWA 4WZMA 4MKVA 1R27B 3KUGA 5KFSA 4QCLA 3T1AA 2PFDA 5H9FK
chains in the Genus database with same CATH topology
3GIRA 1VLOA 3TTGA 1WSRA 3GEHA 1YX2A 3GEEA 4PABA 3TFJA 1XZQB 1XZPB 3A8KA 3AD9C 1WORA 1PJ7A 1X31C 3GEIA 3TFHA 5L46A 3A8JA 1WOPA 3AD8C 1PJ6A 1WOSA 3AD7C 3A8IA 1VRQC 4P9SA 1WOOA 4PAAA 1V5VA 1PJ5A 1WSVA 1XZQA 3GSIA 1XZPA 3ADAC 2GAHC 2GAGC 3TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIR A;  1VLO A;  3TTG A;  1WSR A;  3GEH A;  1YX2 A;  3GEE A;  4PAB A;  3TFJ A;  1XZQ B;  1XZP B;  3A8K A;  3AD9 C;  1WOR A;  1PJ7 A;  1X31 C;  3GEI A;  3TFH A;  5L46 A;  3A8J A;  1WOP A;  3AD8 C;  1PJ6 A;  1WOS A;  3AD7 C;  3A8I A;  1VRQ C;  4P9S A;  1WOO A;  4PAA A;  1V5V A;  1PJ5 A;  1WSV A;  1XZQ A;  3GSI A;  1XZP A;  3ADA C;  2GAH C;  2GAG C;  3TFI A; 
#chains in the Genus database with same CATH topology
 1XMQ F;  3EGZ A;  1N5Y B;  4J9M A;  2BJ3 A;  3DKD A;  4QZV B;  5LMU F;  5GAD U;  4B3T F;  2ZKU A;  1I3Q K;  3QMQ A;  1S9E A;  1PC4 A;  1R31 A;  5EX0 A;  1MWZ A;  2YNF A;  1SJ4 P;  3OQ2 A;  5DG9 A;  1CPZ A;  5ETV A;  1B0V A;  1NLK L;  2ZJQ Q;  2EK1 A;  3UD5 A;  4O3R A;  1TWH C;  1YKW A;  4LBP A;  4DLE A;  3OPK A;  2KZZ A;  2IHR 1;  1X4G A;  2LEP A;  3KK1 B;  3T19 A;  5KFC A;  3P45 B;  4NEY A;  2XYH B;  5G4D A;  4OYW A;  4A8M P;  3CDE A;  2ZHA A;  4C8K A;  3MMC A;  5IYB K;  3I4H X;  1WC0 A;  2YWK A;  3N5F A;  1QE1 B;  1SUQ B;  5IQ6 A;  1FEH A;  4KKO A;  1WOO A;  3Q23 A;  1RU0 A;  4JV0 A;  4B9M A;  1N0U A;  2A2D A;  1LFW A;  2NXE A;  4BY7 K;  3MXH P;  3HJV A;  4RWX A;  2YQ1 A;  1HWI A;  3CED A;  4KGX B;  4WFZ A;  4OI0 A;  3J81 U;  1DCP A;  3H0G C;  1JXV A;  1AFJ A;  3UNG C;  3W2V B;  2J0W A;  2J9D A;  3PRV A;  1H6K X;  2VBZ A;  4ITS A;  3ZTO A;  1WCM K;  2I5J B;  2EFV A;  2ZH4 A;  3D67 A;  1HL6 A;  5LJ5 Y;  2GQQ A;  1JLE A;  2J0Q D;  3FOF A;  4OHV A;  3H5U A;  1UWB A;  2IRU A;  1HLW A;  4ELU A;  1XZQ B;  1BUX A;  3BSA A;  4RU2 A;  1ZZF A;  4DV6 J;  3FRZ A;  4DF4 A;  1H38 A;  1HNI B;  1H0H B;  1AYE A;  1X7V A;  3N28 A;  2JA5 A;  4ZPD A;  1T9V A;  2DNQ A;  4OIQ A;  2CFA B;  3HMJ G;  4A3E C;  1HI9 A;  2D74 B;  3TZW A;  1U0S A;  3MM7 A;  2PHC B;  1LK5 A;  3ENA A;  2ZDP A;  4K7Q A;  4B3M J;  4NEZ A;  5CHP A;  2A2C A;  2AJ4 A;  2RQC A;  4ZCI A;  5LSO A;  2B8Q A;  5IP7 C;  4TQR A;  3IS9 A;  3EQL A;  4X66 F;  1T8E A;  1HWK A;  1O8B A;  1ZTW A;  3Q8Y A;  1KLM A;  2H5J B;  4CNZ A;  5DM6 Q;  2E1M C;  2BJE A;  1FTC A;  4FXV A;  2PI5 A;  3GCW P;  1RAD B;  4LSZ B;  5KFI A;  4WFY A;  2B9X A;  3HVT A;  2YKA A;  2QMW A;  2Y0S L;  2YU9 A;  4DX6 A;  4UT4 A;  1UVK A;  4DR4 J;  5FLX U;  6FD1 A;  5HQ8 A;  3RAM A;  2D1C A;  3P5T L;  1Y1W K;  3LAM A;  2BR0 A;  4KAI A;  2V6T A;  4XLN A;  3MM8 A;  3RZO K;  2FC9 A;  2K3I A;  3W3S A;  5IC6 B;  5C3E C;  2KWA A;  4G6V B;  1TWA A;  4C7Q A;  3I96 A;  3UW1 A;  5RUB A;  1IWG A;  2W1B A;  3I5B A;  3KTQ A;  1D09 B;  1H2V Z;  4OYZ A;  1ZM4 A;  1HYS B;  3GTK C;  2MST A;  5E3R A;  2X1F A;  1RTD B;  3S2D K;  1S0O A;  4LQ3 A;  1FRJ A;  2GZO A;  1YG0 A;  3DLG B;  1D8Z A;  3KJF B;  4FS2 A;  3I31 A;  2J9E A;  3GTO K;  1HNW J;  1FXR A;  1SV5 B;  3DYA B;  1CJT A;  1QJH A;  2W7A A;  5IWA F;  4JV2 A;  4YB7 A;  3FQK A;  3BGU A;  1K0T A;  3C46 A;  4YFU A;  1JLQ B;  2C2D A;  3J81 Y;  2WB1 D;  2H3E B;  4N47 A;  3IR7 B;  2HGL A;  1G3O A;  1RWV B;  2BZ2 A;  1L3S A;  1U45 A;  3NP5 A;  1JKH B;  5C4X K;  3GTP K;  1OYD A;  1O2B A;  4YY3 F;  2JZ5 A;  2ADB A;  1HQE B;  1N54 B;  3HOV C;  4DLG A;  2NPF A;  1SH0 A;  4M95 A;  3S16 C;  1H98 A;  3HFV A;  2IC3 A;  4Z7C A;  1TKD A;  3RRG A;  2LQ5 A;  2HND B;  4N76 A;  5B0B A;  1VOM A;  3KJV B;  3B6B A;  2E1R A;  3HVA A;  4FDF A;  2FVP A;  2V4R A;  2YNI A;  2HQC A;  2MPU A;  2QX0 A;  1WC3 A;  5JMN A;  2ZBC A;  4DR6 F;  3GSD A;  3M1V B;  1TWA C;  4YFX A;  2M8D B;  1UA0 A;  2GIQ A;  3M8P A;  1YVF A;  4QR2 A;  3AA8 A;  1NDK A;  4LJZ A;  1EKR A;  2ZH1 A;  2PGC A;  1SCJ B;  3FKI K;  5M3M K;  1FDD A;  5CJ9 A;  5K5M A;  4X4U A;  5B0D A;  2VFS A;  3K5N A;  4A3D K;  4KPY A;  5KFE A;  1CJU A;  4FBU A;  3G9C A;  3NWG A;  5J1N A;  5C5J A;  4RR5 A;  1FRX A;  1K8A T;  1L3U A;  3GFX A;  1GEH A;  3CD5 A;  3H8Y A;  1EX8 A;  3VCD A;  3M9N B;  3BUE A;  4C3J C;  3RZD C;  2QLX A;  1U6F A;  4C3K A;  4C8Y A;  5C7P A;  3ZZY A;  3M8Q A;  4Y0F A;  3MEE B;  2Y3P A;  2DPI A;  3CT9 A;  5FLX Y;  2Z56 B;  5IT4 A;  1UV7 A;  2PD1 A;  1U25 A;  2OTJ S;  2Z8Q A;  1HMV B;  4URS A;  2MHN A;  3ZTP A;  5HLF A;  3O3L A;  1C4A A;  3I4N K;  3DI6 A;  2XSJ B;  4N8O A;  1BMQ B;  2QSF A;  3F56 A;  3LH2 S;  1T3N A;  4Y2M A;  3EX7 B;  3ETM A;  4C2M K;  5D0H A;  3IBC B;  1W25 A;  3MR5 A;  2XGP A;  1RT1 B;  4QWD A;  3SYZ A;  3TP2 A;  4ZMM A;  3NGK A;  2YKM B;  4UY8 5;  1TKT B;  3ILI A;  2ACM A;  1KRP A;  4J5O A;  2K06 A;  2MTL A;  4NLX A;  4WP3 A;  1RWU A;  1JK9 B;  3FZ2 A;  4K8R A;  3ZNJ 1;  5GAH I;  4QIV A;  3AJ2 A;  3FEY B;  4R0J A;  2JVO A;  1FF2 A;  2VA3 A;  2XCO A;  2N7Y A;  4FXD A;  3I5C A;  3V2U C;  4IO9 Q;  1J98 A;  3TFJ A;  3TZZ A;  4B3R F;  1PBA A;  2HZA A;  2HWH A;  2UVW A;  2QLW A;  2R2S A;  2AGP A;  1F60 B;  3PYD A;  2KRR A;  2COL A;  4QPX A;  3PJX A;  3AH5 A;  1TL5 A;  2XMW A;  1RT7 A;  4C3I K;  4A3B K;  4PQA A;  3QGG A;  4QIW D;  5HMY A;  2AMC B;  3KMS A;  4LFA F;  4PG5 A;  1HHS A;  3E2E A;  5K8N A;  2R7Z K;  2FB0 A;  4ED0 A;  2RRA A;  2K7J A;  2HLT A;  2UXB J;  2NPI A;  3CCQ S;  2W2O P;  1I50 A;  3QWU A;  3FK4 A;  5M5Y K;  4IH7 A;  4J7C A;  1TL3 B;  2FQO A;  2DH7 A;  1Q7L B;  3HCX A;  3GTL K;  2JEG A;  4L72 B;  5JFE A;  1S99 A;  5F8L A;  3ET6 A;  3ILO A;  3AHP A;  1GE9 A;  4OZ5 A;  2KJV A;  2IIH A;  2CQP A;  4ZVG A;  2NQP A;  3DGP A;  1S6O A;  1SIW B;  2W01 A;  3THV A;  1EKS A;  5HVH A;  3ZZZ A;  3MOJ B;  1RTH B;  3MM6 A;  2LEA A;  2E2I K;  1P8G A;  3NKY A;  4HTJ A;  2HAF A;  4OLO A;  1H2U X;  4UOC A;  1KBR A;  2D9P A;  1MMD A;  2F4V F;  3OUY A;  4GFQ A;  3H4D A;  5AJ3 F;  3QGI A;  5IYC K;  4GKK F;  1VFJ A;  3SSS A;  3U1M A;  1WUU A;  3EYZ A;  2MKH A;  4A3I K;  4DL4 A;  1F7V A;  2LEC A;  2JFD A;  5E3P A;  4KRW A;  4PAB A;  1O28 A;  4G3I A;  4KDD A;  2XO7 A;  4KC6 A;  1URN A;  3CO0 P;  1MN7 A;  1MML A;  4ZHR B;  4CO1 A;  3ADA C;  2V63 A;  2ASY A;  1PJ6 A;  2O3D A;  2VDH A;  4RJV A;  1HBM A;  1VLY A;  2AEF A;  2HVH A;  1TWF K;  1F1B B;  4YB5 A;  2BUN A;  5CZV A;  5D6G A;  2ZUA A;  3W64 A;  4FXW A;  3M3Y K;  4A3J K;  1I50 C;  3VVT A;  1VYA A;  1LWC A;  3PX6 A;  3NBP A;  3QLH A;  3BDP A;  3CJ5 A;  5F0U A;  3IAS 9;  1AUD A;  3ZZP A;  1VQY A;  1WKJ A;  4ZOS A;  1F5B A;  3GTQ C;  1U2R A;  3J7Z 5;  4ED5 A;  1UJ4 A;  2YPY A;  4RW9 B;  3I0S A;  1AT1 B;  1NSA A;  3JAM U;  3GTJ K;  2BE7 D;  2AGQ A;  2V5H G;  2GGP A;  2HGM A;  4PQU B;  4QIE A;  4FBT A;  4KIA A;  3QAE A;  2L3M A;  3PFE A;  3D1Q A;  4LRF A;  1DTT B;  1LW0 B;  2DHH A;  1TZ0 A;  1KDN A;  3PO3 K;  2HBR B;  3K7R A;  2XC9 A;  3FRY A;  4DBQ A;  2UZA A;  4CH7 A;  1CJV A;  1U1Q A;  3K5O A;  2MHE A;  4CZC A;  3HOW K;  2BBE A;  2NVT C;  3AA9 A;  8ATC B;  5DGA A;  1UVJ A;  1RHQ B;  2F7V A;  4I2P B;  1KVI A;  4HT5 A;  1U1R A;  1QDU B;  2OPR A;  2LDY A;  2JA6 C;  4R25 A;  5A6W A;  1VI7 A;  2W9C A;  2IRX A;  3JTO A;  5FD1 A;  4IRC A;  1TAU A;  2AX0 A;  1UEU A;  4FP9 A;  4DMZ A;  1L3T A;  3BDE A;  3CDA A;  4Y2I A;  3FCH A;  3ITH A;  2I6W A;  1TL1 A;  2XI3 A;  1GMW A;  4I7F A;  1LNQ A;  2GW8 A;  2JNJ A;  2WCX A;  2CQ0 A;  4RUC A;  4XSX A;  4NCG A;  3EMT A;  3CDW A;  1HR0 J;  3QZ7 A;  3P4U B;  1YSJ A;  3PYF A;  4OI6 A;  1DTQ A;  5D78 A;  2WB4 A;  3DOK B;  4FM9 A;  1F0X A;  4PXE A;  2UU9 F;  3KUH A;  2WSF C;  3IXQ A;  2MQ8 A;  2GQC A;  2DNM A;  1YJ7 A;  1TV6 B;  1F9E B;  3QT6 A;  3MPY A;  3RJM B;  2MY7 A;  1JLF B;  3CJQ A;  3FBC A;  1VQL S;  2UXD J;  4N41 A;  4ANC A;  4RZR A;  4QYZ K;  4KB4 A;  3W8P A;  1PAE X;  3L3C A;  3D4J A;  4OI4 A;  3PIP Q;  2L9W A;  5KAK A;  2VBX A;  1NH7 A;  4JI5 F;  4PXC A;  3TAM A;  4IG0 A;  1AZS A;  4ZLL A;  1VH2 A;  2OGU A;  4Q8F A;  2MZT A;  3MEG B;  3QGP A;  1E6V B;  1FTR A;  2IBO A;  3MCS A;  4WFB Q;  3ENQ A;  2E9R X;  1GTH A;  4ZP7 A;  4F04 B;  4ZIT A;  3PIO Q;  3M8Y A;  3AOB A;  3KLI B;  2ZH9 A;  4ALZ A;  1KFS A;  1RA6 A;  5JXS A;  4GKJ J;  2Q43 A;  3DDK A;  4Q5V A;  1X5S A;  3GZ7 A;  1JJ2 R;  4URQ U;  3EXY A;  3HKW A;  4PG4 A;  5KT4 A;  3EVM A;  3RRK A;  2WVD A;  1IKX A;  3JAM Y;  1DLO B;  3KLG B;  3GWC A;  4JBC A;  2OJ3 A;  2QO3 A;  1K1Q A;  1QLN A;  1Q5Y A;  1J6X A;  1SXL A;  3C16 B;  2VKZ G;  2AT1 B;  4OYA A;  5HP1 A;  3BO2 A;  1M5S A;  4LK1 A;  4A8Q A;  4MEY A;  1NK9 A;  1N5S A;  2A69 A;  3OR2 B;  2M5Y A;  4EEY A;  3BJY A;  2HLU A;  3VVU A;  5JVH Q;  4MQ9 A;  2HFU A;  3KLH B;  1NHV A;  2FZK B;  3CCR S;  3H3V L;  2CG8 A;  1HNX F;  1FA0 A;  3MOZ A;  4YDX A;  2GVD A;  1DD5 A;  3BR8 A;  1YJT A;  1FNX H;  2CUY A;  2R7X A;  2BX6 A;  3W1Y C;  4YOE A;  4UF4 A;  4RX6 A;  1JLG A;  4OHZ A;  2V34 A;  3K8W A;  2RU3 A;  1DQ9 A;  4QBU A;  5DQI A;  1S1W B;  1K73 T;  4KHP J;  4TY8 B;  2CQ1 A;  3HSJ A;  5GAE I;  4P74 A;  2VC0 A;  3FVY A;  2F1F A;  1U4B A;  1R9T C;  4Q0B A;  4L74 A;  1S9G B;  1LV5 A;  2J9D E;  3M32 B;  5A0Y A;  5DDP C;  1EFW A;  5F41 A;  2ZVI A;  4UQG A;  3PO4 A;  2OD6 A;  3QPI A;  1S1X B;  1EAR A;  2BJD A;  4ZPW R;  3LP0 A;  5HMZ A;  3PAC A;  2R8I A;  4DR1 J;  4W90 B;  2O5D A;  1I6J A;  4X4S A;  3K58 A;  1KVJ A;  2K1R B;  4KGK A;  4U95 A;  4BKW A;  1VQS A;  5FDL B;  1CBK A;  2BV3 A;  4F02 A;  4IDK A;  4LLG A;  1VBZ A;  1NME B;  4ZKA A;  3DRS A;  3V4I B;  4J9L A;  5D4P A;  4DG1 B;  5EWE A;  4RW4 B;  3QNW B;  5DRK A;  1OY9 A;  1GX5 A;  4C8M A;  3GTY X;  3L7O A;  3EE3 A;  1RTZ A;  3UCU P;  4ECY A;  1MRO A;  1R0B G;  2E29 A;  4NXN J;  2AJ2 A;  3QAU A;  2V4J B;  1HIY A;  5KFQ A;  2HRY A;  2ROE A;  4LJM A;  2B56 A;  4QWC A;  3DXB A;  3QIP A;  3GB0 A;  3FGV A;  1RT6 A;  1EP4 A;  3T00 A;  3GP9 A;  1NJY A;  2K3K A;  1CJK A;  4B9V A;  3QFH A;  3MMJ A;  3MPW A;  4DG1 A;  3K7A C;  4I64 A;  1N6Q A;  3FEX B;  4KMD A;  1AB8 A;  4KMA A;  3HHL D;  1RU2 A;  1K1S A;  1SFO C;  1KP6 A;  1PIE A;  3B4D A;  2GV1 A;  3HXM A;  5D3G A;  3NS5 A;  3NS6 A;  4OHY A;  5A8K A;  3JYT A;  2LA4 A;  4NE9 C;  4X4O A;  2H65 B;  4AD6 A;  2BQR A;  2IM2 A;  1WHY A;  1LWE B;  3DLK A;  2E9Z A;  2VIC A;  2OMO A;  4DUZ J;  4MIA A;  4ED4 A;  4TU7 A;  3LWL A;  5B7W A;  2W4D A;  2B5J B;  3TW0 A;  4L76 A;  3G8Q A;  3C3L A;  1QAY A;  5HO4 A;  1Z2Z A;  2OFH X;  1X4A A;  2D3U A;  5J2P A;  4RUH A;  3K0J A;  2LFV A;  3KLE B;  4E0D A;  5KG3 A;  3L95 X;  3V6J A;  1Y1V K;  3W63 A;  2R7W A;  4PUO A;  2YWW A;  4J9Q A;  3A8I A;  4LQ9 A;  5HMX A;  4DV0 J;  3GJT B;  4DR2 F;  2MKY A;  5C42 B;  1KD1 T;  3MMB B;  4C0O C;  1WEX A;  4KV8 B;  2NVQ C;  3Q2S C;  3OFF A;  4KR0 B;  3M2V B;  2LYV A;  3AQO A;  2VDI A;  3QT8 A;  5EWG A;  1VQ7 S;  3D0I E;  4DSI A;  5GMK a;  3OXG A;  4EBE A;  2XYP B;  4ZP9 A;  3NNA A;  4EFA C;  3UCZ P;  3AJ1 A;  4JV5 J;  2CQG A;  4HAC A;  2J8S A;  2VOO A;  3AT1 B;  2MJN A;  1REV B;  4LF7 F;  1N32 J;  1NRK A;  5ETM A;  2KI2 A;  1W2B R;  1FFG B;  2J6T A;  3TEH B;  5D4N A;  4F2S A;  5C44 K;  1ZAW A;  1TQL A;  2EWH A;  5L46 A;  4ZN1 A;  3MAQ A;  3M05 A;  4KSE B;  1S5Z A;  3T5K A;  1VQN S;  3PW2 A;  4A3C C;  1VJE A;  1RWW B;  1JXE A;  4R5P A;  4KM9 A;  1LWF A;  3CDU A;  4RW7 B;  1UL3 A;  4BXX K;  3HHK A;  4WCE Q;  2ATL A;  2VF3 A;  2PN6 A;  4HVZ A;  3IRX B;  4XPE A;  5I3Q A;  7AT1 B;  3HD2 A;  2NCK L;  1YJU A;  3MAA B;  2CJ9 A;  3M9M B;  3AXK A;  1R8B A;  1ZM2 A;  5THW A;  3K57 A;  1G7C B;  3N0V A;  4ED7 A;  1TMJ A;  3MEK A;  2R93 A;  4AFF A;  3W9I A;  2C3M A;  3BO4 A;  2MZS A;  2R9L A;  1VCT A;  4P71 A;  2JDJ A;  4FKY A;  1WD6 A;  1X4E A;  2I8E A;  4F0K A;  4CTA B;  1C1C B;  1RWX B;  5C25 A;  5AE1 A;  4FVC A;  1WTB A;  3WHI A;  4AH6 A;  3S1R C;  3PG9 A;  1QTM A;  1BQM B;  3TZY A;  2YX1 A;  5FJ4 A;  3D7S B;  3SSQ A;  2CNO B;  4KN7 A;  1PCA A;  1Y0H A;  3NS7 B;  1GXL A;  3GE9 A;  1I94 J;  3D6M B;  2W8L A;  1NAQ A;  3FNN A;  4H4O A;  2ZFH A;  4P73 A;  2F40 A;  1VLO A;  2VFV A;  3K8V A;  2XS2 A;  2DH9 A;  3GTM A;  4I2Q A;  5KG2 A;  2FDN A;  3VAK A;  2RHQ B;  5EWF A;  4KGM A;  5CXT A;  4DF8 A;  2BQU A;  4WBF A;  2RB7 A;  1T9Y A;  4F4Z A;  1TWG A;  2YNH A;  1RUS A;  1R0C B;  2FZG B;  3DLE B;  1P9Y A;  3MR3 A;  5ETL A;  4DPT A;  3CAG A;  2AF6 A;  3D66 A;  1DFD A;  2GMJ A;  4CP5 A;  2D3O 1;  3BR9 A;  1AXQ A;  5CYJ A;  2Y1R I;  2R93 C;  1KWM A;  1HBO B;  1H7X A;  2D7S A;  3HUL A;  5AE2 A;  1WOS A;  1T03 A;  3BKT A;  2BM0 A;  3CC2 S;  3GFY A;  4CLF A;  2RKI A;  4HKQ A;  2W2N P;  2QGF B;  2HFN A;  4ZJL A;  2OEL A;  1WOR A;  1VQM S;  4DS4 A;  2W9B A;  1U1O A;  4B17 A;  3NNH A;  3RB6 A;  3RAX A;  3ETO A;  1TFY A;  3O8W A;  1RT4 A;  4A4J A;  4DR3 J;  4LR8 A;  4QJV A;  4X62 F;  4P7T A;  4E8U A;  4X66 J;  3NY0 A;  5B0C A;  1Y3J A;  1TKZ B;  2QMX A;  3T41 A;  4W92 B;  2HWI A;  3C14 A;  1NSQ A;  3ZZT A;  4P2S A;  2NXU A;  3S15 K;  1NK5 A;  3GTM C;  4H4M B;  1GTE A;  1X4F A;  3QT7 A;  4XPC A;  4F3O A;  2M88 A;  3SZ2 A;  4OX9 J;  1J6V A;  1S6Q A;  3IR5 B;  1U1L A;  4NA2 A;  1OWX A;  3G8S A;  3MUM P;  2I38 A;  3NGT A;  1UJ5 A;  4M94 A;  3N01 A;  5CAA A;  1K47 A;  3BH7 B;  2CJQ A;  5D0E A;  3QT5 A;  2QFJ A;  4QW8 A;  2KG0 A;  4IKA A;  3UE2 A;  2P9G A;  4ED2 A;  3N9U C;  5DDR C;  1J27 A;  2KB2 A;  1CS4 A;  2WVE A;  4ZIW A;  4GTA A;  2KHD A;  4YHH F;  5HN0 A;  2GML A;  1L3K A;  3GIJ A;  2GQ2 A;  5HBM A;  1HNW F;  1RWM B;  4C8O A;  2FGC A;  3PVX A;  1YI2 S;  4ECV A;  4HH1 A;  2YKO A;  1I6V A;  5KFT A;  4RKU C;  2ZH2 A;  4RNN A;  4C45 A;  3HOZ K;  1WOP A;  1D1U A;  4DZ6 A;  3PCO B;  3OPF A;  5L38 A;  3NWR A;  1IW7 A;  4U7U K;  4YS2 A;  5K14 A;  2RH6 A;  2FJD B;  3MUV P;  1WEL A;  1JNZ B;  2KVQ E;  2W8K A;  3G82 B;  3JTP A;  3J7Y U;  2MQL A;  2HZV A;  4IG3 A;  3KLF A;  4LR2 A;  1YGY A;  1IQT A;  2IA6 A;  1JOE A;  1TAQ A;  3W5X A;  4DV1 J;  4YY3 J;  2BOP A;  1INN A;  2Q1L A;  4Y00 A;  2XHW A;  2ZNZ A;  3NOC A;  3R5A A;  2Z57 B;  4NLD A;  3IM8 A;  2B9W A;  2CQC A;  1NHU A;  4M1K A;  1FER A;  3IA0 A;  2ZUE A;  4CCH A;  3BQ1 A;  1Q86 T;  4FVM A;  3HXA A;  2UUA J;  1EK8 A;  3IBW A;  1B7Y B;  3KDN A;  1WC4 A;  2W24 A;  4P72 A;  4DL6 A;  3H0P A;  4PZV A;  1RAG B;  1V3Z A;  3KJN B;  2Y9H A;  3CCL S;  3BGF A;  2KZM A;  3WBZ A;  4A46 A;  3D3C J;  3G86 A;  2FY8 A;  4HTI A;  4F67 A;  2KTQ A;  4K50 A;  1RTJ B;  2G9O A;  5K8P A;  2HNY B;  3TAP A;  5AXK A;  3NOG A;  2Y0S D;  1R8P A;  3C66 A;  2LDI A;  5B08 A;  1MU2 A;  4F4W A;  2XY5 A;  3I0R A;  3S1T A;  3B4M A;  1CUL A;  4KH1 B;  4WFX A;  2HQD A;  1NH8 A;  3S2H C;  4GMK A;  2XMV A;  2F8M A;  5M2U A;  5IT9 U;  4PWW A;  4DCO B;  3S1Q C;  1YQH A;  2BXJ A;  1Q95 G;  3N4W A;  4JUZ A;  2OPQ A;  1NJI T;  4ZP6 A;  2R7V A;  4Q45 A;  1S72 S;  3PKM A;  2MYF A;  3CCM S;  5KG4 A;  2DR8 A;  1KR4 A;  4LQY A;  2HS3 A;  1RB0 A;  3QO9 B;  4FF1 A;  4GTE A;  1YRT A;  3UD3 P;  3HKZ L;  1QY7 A;  3RU0 A;  3DRP A;  4LSN A;  2ZVS A;  5DLG A;  1U47 A;  1EET B;  2HG4 A;  4FYD A;  3IPJ A;  3M30 A;  3GTG A;  2NVX C;  2DIS A;  2FLP A;  5TMF A;  2RDJ A;  1S48 A;  2CQI A;  2DNY A;  4WJ4 A;  4KM8 A;  3CCJ S;  4WII A;  4O4G A;  4JI8 J;  3UNY A;  2DIU A;  1CC8 A;  2LLZ A;  4LRA A;  2JA7 K;  5IM0 B;  3JST A;  2X3D A;  1IKY A;  2R92 C;  1L0W A;  1SPB P;  4B9N A;  2WAQ L;  3GMG A;  1T05 B;  5I3U B;  4O3S A;  2LP4 A;  5HI7 A;  5KOW A;  2FYX A;  4RW8 B;  1Y7P A;  2CWX A;  4IOB A;  3SMZ A;  2M8H A;  4USM A;  3PKY A;  5EDW A;  1RAE B;  4B3R J;  2VFU A;  1IS1 A;  3PJW A;  1S12 A;  1XPP A;  2DT9 A;  1LFP A;  3J80 Y;  4XAK A;  4B3O B;  4LRD A;  2UXB F;  3FBB A;  4CLZ A;  2B9E A;  2V68 A;  1IL2 A;  1FKO B;  3J81 j;  4X65 J;  4A3E K;  4ZS6 A;  2VG7 A;  2AJ1 A;  1FJ7 A;  5IYD K;  3G6Y A;  2JA8 C;  2BE5 A;  4ES3 A;  2E5J A;  3TUZ C;  3PX4 A;  1JLB A;  3ILL A;  1XZP B;  3CJR A;  2E1C A;  4NWB A;  2V2K A;  4JI3 F;  3L4J A;  2OSR A;  1KTV A;  3AB4 B;  3HFZ B;  3JQM A;  5CD4 A;  2G13 A;  3CTR A;  3F44 A;  3PO2 C;  3M6W A;  2CAJ A;  4ECS A;  4DV5 F;  2MZJ A;  1TL4 A;  3CF5 Q;  5J2N A;  1D9F A;  2XCP A;  3NGS A;  1VGY A;  3G4C A;  4UY8 T;  2GSN A;  5L9N A;  4KAW X;  1U2C A;  2RF2 B;  1C1B B;  1I3Q C;  1Y5I B;  1HNV A;  3WZ0 A;  1W2I A;  5GAG I;  2XGQ A;  3QBC A;  3P96 A;  4NI2 B;  2UUB F;  5IT9 Y;  3A12 A;  4A3F C;  1NJW A;  3TZX A;  4DS5 A;  3WIV A;  8RUC A;  4OV1 A;  5A8R B;  2HHW A;  1N48 A;  5JJB A;  1GFW B;  2DXE A;  1TKX B;  1T3O A;  5HK4 A;  4C3H K;  2LU1 A;  5IYB C;  1SBR A;  4J9O A;  1ULR A;  4ENO A;  5C3E K;  1DBD A;  1RT5 B;  1UPM B;  4B3S J;  3THT A;  4DX8 H;  1M1K T;  2JA5 K;  5JVO A;  4AXJ A;  2RIL A;  1S6U A;  4UST A;  2DRB A;  4IFV B;  3LGH A;  4BY7 C;  1RI7 A;  3GTK K;  2GA7 A;  1S0N A;  2C2R A;  3HI9 A;  4CT9 A;  4BHQ A;  2MLX A;  3WIU A;  4EZ6 A;  1S79 A;  4UOG A;  2FZC B;  3CCE S;  2A6E A;  3S1N K;  5F8H A;  1HBU B;  4MYT A;  2JJ4 D;  4CLY A;  1H3D A;  4OFZ A;  2BE2 A;  3KK3 B;  5K9F A;  4PG8 A;  2HNZ A;  1TWC C;  2E2H A;  2J0S D;  1SKW A;  1SC3 B;  1U1N A;  3MMA A;  3TQ1 A;  1YDL A;  3S1M K;  1WHX A;  1RLD A;  3DFE A;  2RQM A;  2J9C A;  2DGU A;  2FJE B;  2ZC4 A;  5FLM C;  3NXZ A;  3V81 A;  1O29 A;  3M4O C;  4LBH A;  3ZC4 A;  3ZZR A;  2ZZT A;  4FF2 A;  3H25 A;  1N56 A;  1PJ7 A;  4NPO A;  2G2Z A;  4PRF A;  3HOV K;  1VR6 A;  4DN0 A;  2YU9 K;  4W4M A;  1S1T B;  3S16 K;  2EBE A;  2IJF A;  3ZO7 A;  3Q2T C;  5HRO B;  1XNQ F;  3ZZO A;  4IRK A;  1I5O B;  3UCG A;  2MLZ A;  3R1H A;  4ZVR B;  4ECU A;  5H1S V;  4J9P A;  1J5O A;  3AB2 B;  3DRX A;  3UN2 A;  5LXY A;  5L1L A;  3AXM A;  3LPE A;  1TWA K;  3F73 A;  3HHL B;  3OTD A;  2IA0 A;  1HR0 F;  1BQN B;  4EYH B;  2GJ2 A;  4IFY B;  2YNG A;  3HOX C;  2ACY A;  4L73 A;  3Q8U A;  3C19 A;  1T9W A;  4PWD A;  5KFU A;  3N5B A;  4FPI A;  5KFM A;  4M63 A;  1WF0 A;  3FBE A;  3NUH A;  1HQ2 A;  1ROF A;  2H1Y A;  3J7Z T;  3A3O B;  2VC1 A;  3R27 A;  4NAS A;  2YWF A;  2NXJ A;  2FY1 A;  4PPZ A;  3K5L A;  3RB0 A;  3RTV A;  3BQ2 A;  4ID5 A;  3D54 A;  3GG0 A;  3HHL A;  2ZHB A;  1IQZ A;  3MED A;  2PC6 A;  1YNJ A;  4ZCM A;  2VPW B;  3TFI A;  4C3J K;  2E2H C;  2UXD F;  1RT2 A;  2IDE A;  4A8W A;  2QA4 S;  2XUL A;  3RZO C;  2J76 E;  1ZAV A;  1XK8 A;  2CPJ A;  2G1D A;  4ICL B;  2BE9 B;  4C48 A;  4BCA A;  4WIL A;  1UWA A;  3R7S B;  1ZM3 A;  2CZ4 A;  2OPP B;  3W62 A;  4C9D A;  2B6A A;  1IBM J;  2B7B B;  3DMJ A;  4CT8 A;  2HK3 A;  5EX3 A;  4OYM A;  3S2D C;  1WIH A;  3MUR P;  4LMZ A;  2UUW A;  4OZ2 A;  4XO0 A;  3VAF A;  1NPP A;  4N7T A;  1V5V A;  4A8X A;  1AFI A;  2VG6 A;  1O2A A;  3KG4 A;  4EO6 A;  4BS2 A;  4AND A;  2Z2M A;  2HIY A;  4O0N A;  4GKJ F;  4G0U A;  4Y34 A;  2CPI A;  3FSI A;  5EGE A;  3D68 A;  1GT8 A;  3JSM B;  3TUJ C;  2QIF A;  3SDE B;  3CJK B;  4S0M A;  5M3F K;  3CJT A;  2O5I A;  1HQU B;  2NUH A;  5IS2 A;  4F7V A;  3C15 B;  1VK8 A;  3QJL A;  2BJ1 A;  2CJK A;  1LEO A;  1ZPW X;  2MGZ A;  2ALZ A;  2E2J K;  1FKP B;  2HUR A;  1GNK A;  1U09 A;  5F9L A;  4K0K J;  3FZB A;  3NMA A;  2V8H A;  3HHL C;  2KFY A;  1C0U A;  1FRK A;  1S6P B;  4PAA A;  2WVB A;  2DGS A;  4L6V 3;  4DSK A;  5FJ8 K;  3UPF A;  4C98 A;  2V8D A;  3LO3 A;  1IKV B;  3LP1 B;  3BEG B;  4LF2 A;  1FX4 A;  1DHM A;  4JI2 J;  3FBF A;  3OFG A;  3HHD A;  1OQ3 A;  4XDD A;  2NVY A;  3SQG B;  3I5A A;  1USO A;  3Q8P B;  4KHP F;  2CJX B;  4MFB A;  1FJE B;  1RT3 A;  3FKI C;  4C11 A;  1VQK S;  2NSC A;  2PE8 A;  4A3D C;  2PEH A;  2HFZ A;  4L3N A;  3KNG A;  3MM5 B;  3JS9 A;  1NSK L;  3GJS B;  1NUE A;  2E44 A;  2R7Q A;  4KO0 A;  2XMJ A;  2EEY A;  2GO8 A;  1WWH A;  1YJR A;  3G87 A;  3EM1 A;  4CH0 S;  1Q8K A;  3SV3 A;  5AE3 A;  5EHH A;  2B4V A;  4CO2 A;  2AD9 A;  4U6P A;  2OH2 A;  3M2U B;  1TFW A;  2ZH5 A;  3HHN B;  2CIM A;  1YTY A;  2KFN A;  3VAI A;  3G4A A;  4K2X A;  1C0T B;  5ITH A;  4IYQ A;  2X1G A;  1W26 A;  1HI8 A;  1XXB A;  3H40 A;  1N36 J;  1HBN A;  2PT0 A;  4X4V A;  4RW6 B;  3OSP A;  2Z30 B;  4NLG A;  4CO0 A;  4WP8 A;  3IR6 B;  4O44 A;  4L75 A;  3UWT A;  4U7U D;  2NVY C;  4DV3 J;  2CPY A;  1I50 K;  2XS7 A;  5A8W B;  1RIS A;  2AW0 A;  5KFN A;  2FHJ A;  4B02 A;  1SL0 A;  4NZ7 A;  2JX2 A;  1EQ0 A;  2FJB B;  1LQ9 A;  4TKT A;  2O5J A;  2AYM A;  5FII A;  1RE1 B;  3FFI A;  3R9L A;  2DH8 A;  5HL8 A;  4UOH A;  1XR6 A;  2V6A A;  5I3P A;  3D9B A;  4RL1 A;  1S0M A;  4F26 A;  4GVL A;  1QAJ A;  5C24 A;  4OJH A;  4Y52 K;  2V6U A;  5HAT A;  4U67 Q;  4ZPB A;  4YEA A;  2ASD A;  1M1G A;  2ROP A;  4DUZ F;  2D69 A;  4I67 A;  2IYI A;  4M8L A;  2CPX A;  1LXJ A;  2KKH A;  2C3Y A;  4C0B A;  5KTQ A;  1RQ0 A;  2QLJ B;  3JB9 k;  2C22 A;  2ALY B;  1HKA A;  1R7I A;  2R7Z C;  2IVM A;  4NLP A;  4OYX A;  4G1Q B;  1ZAX A;  2BM1 A;  1W7W A;  4K4T A;  1T9T A;  4KAT A;  3WX8 A;  2NVT K;  2A3J A;  2EBB A;  2V0N A;  2WW8 A;  4LIR A;  4DU8 A;  2F4F A;  1YWX A;  2GSO A;  4DUY J;  1Q0N A;  3GTL C;  2AJQ A;  3UVJ A;  1PGZ A;  2BJ9 A;  2Y3Y A;  2NRE A;  2QEX S;  3HZG A;  5CD4 H;  3PEH A;  1NPR A;  4Q8E A;  3RB3 A;  5HJY A;  3BGR A;  4DV0 F;  2IM0 A;  3JXO A;  1NCL A;  3C6T A;  1E6Y A;  4ED3 A;  2VJV A;  2VB6 A;  5AT1 B;  3RBD A;  3EPG A;  3THP A;  1KQG B;  3OVB A;  1G1X A;  4K4W A;  2YBV A;  4J9U E;  2XMU A;  2ZZN A;  1TWH A;  2FQT A;  4F0M A;  1YRU A;  5KT6 A;  4R8U A;  4DR2 J;  1QUP A;  3DDN A;  3HOY C;  1KQF B;  2FVR A;  4CWB A;  5I42 A;  2VBW A;  4HEA 9;  2XZW A;  2JL9 A;  5IYC C;  2FHO B;  4ZH4 A;  3TA1 A;  4JV5 F;  5J2M B;  2EKN A;  3R5J B;  4A3I C;  4PXB A;  1N32 F;  1S1U A;  1YBA A;  5KFX A;  4F3Q A;  1FDB A;  3MPV A;  4ZVH A;  1R43 A;  2FJV A;  4UW2 A;  4ZDN A;  2CG4 A;  1HPZ A;  3MEC B;  1FWP A;  3H2V E;  1LW2 B;  1TWF C;  2HRU A;  1S1V A;  1XXA A;  2ZBR A;  4ECX A;  1IKW A;  1GMV A;  3U02 A;  4OI1 A;  4NLR A;  3H0G A;  3ZZ0 A;  4TU8 A;  1BD6 A;  2WHO A;  3GLJ A;  1XBW A;  3OLB A;  4BLG A;  4I0W A;  1Q8B A;  1PJ5 A;  1CG2 A;  2XBP A;  1U8W A;  2ROG A;  5IP9 C;  2EKY A;  3HJF A;  3ERE D;  2WSC C;  1RTI A;  4EBC A;  3GEI A;  5K8M A;  1WJ9 A;  2HMI A;  1RAJ A;  1GAO A;  2IAJ B;  3GTJ C;  3OJU A;  1HI0 P;  1JXL A;  5IOS A;  4WTO B;  2GVZ B;  3NCQ A;  5KFZ A;  4USV A;  2XB2 D;  5CAB A;  2YVS A;  2E5I A;  4CLP A;  4AUK A;  2RQK A;  1SIZ A;  4A3L K;  1C0A A;  1N5Y A;  3CCV S;  3PO3 C;  1FRH A;  2B0G A;  1WQG A;  3TO8 A;  3ELH A;  3EZO A;  4NX9 A;  2DNN A;  5GAD I;  1OSD A;  1I94 F;  2F9D A;  3R97 A;  1NPK A;  1YIT S;  1HAR A;  1KTQ A;  5G0R B;  4OHW A;  3HOW C;  3GU0 A;  2IAJ A;  2UVU A;  3D3B J;  3BP3 A;  1KVK A;  3L7U A;  3QRR A;  1K44 A;  3NG8 A;  1DQA A;  1Y00 A;  2XWX A;  4NXM F;  3DGV A;  3Q8R B;  4AQY J;  5CHC B;  2FJA B;  1VGX A;  1UTA A;  2V2Z A;  1FVS A;  4DQS A;  1TK0 A;  3KK1 A;  2M4M A;  4UUW A;  2DTJ A;  1JLA B;  2B51 A;  3SBM A;  1SJF A;  2KU7 A;  2N4D A;  1QE1 A;  1SUQ A;  3D0G E;  4YQW A;  2EFN A;  4DDQ A;  2J7K A;  1R3N A;  1Z2L A;  2CAD A;  2ZIT A;  1RCO B;  3MCO A;  2ZZM A;  2JLF A;  4GTF A;  1OPZ A;  2DGX A;  4B9T A;  4ZPA A;  2MSS A;  3FKB A;  4YFK A;  1IBA A;  1GXU A;  1MMN A;  1FES A;  4FYV B;  2VPY B;  3MM9 B;  3QX3 A;  2QSW A;  1JLA A;  1IJE B;  1WQH A;  2WVC A;  2ZD1 B;  2DRA A;  3ULH A;  1JQW A;  4CLK A;  1F6T A;  2PII A;  4DFK A;  1CC7 A;  2M3D A;  1UMJ A;  4LR9 A;  3KOA A;  3W2V A;  4FKX A;  4EU0 A;  5CYQ B;  3GTK A;  2OLW A;  2N7C A;  3GIK A;  2I5J A;  4QWE A;  4J9N A;  1AW0 A;  3UDE A;  4EMD A;  2HHU A;  1XZQ A;  3Q8V A;  1ZYR A;  1B4A A;  1HNI A;  4DR3 F;  2HHV A;  1OQ6 A;  2OO4 A;  4GTB A;  2D3Z A;  3I56 S;  2CFA A;  1WC1 A;  1O6X A;  2B4O A;  2Z2Y B;  2HBZ B;  2C28 A;  1RKJ A;  3KHH A;  4ZVU B;  4CO4 A;  4X62 J;  1XEZ A;  4NRU A;  3I32 A;  4FF4 A;  2OHD A;  3RGI A;  3W9J A;  3QRQ A;  2DPJ A;  2VZ9 A;  5ETP A;  5D0G A;  2XWY A;  4OX9 F;  2QFI A;  3MCM A;  3M8Z A;  1K83 A;  4OYO A;  4K4V A;  4DN9 A;  3GQC A;  1FWK A;  3BYR A;  3VQS A;  2AP6 A;  1IBK J;  4ZVQ B;  1JWW A;  2YKN B;  1BXN A;  3H4B A;  3K7A K;  4X2B A;  3FDS A;  5F8I A;  2RE1 A;  4QIG A;  5DET A;  4KC5 A;  4F3M A;  3AJD A;  3GEH A;  2HS0 A;  1X8D A;  4Q43 A;  4TNO A;  3TRG A;  2RJZ A;  4OZN A;  3NAH A;  2QT7 A;  4K4Y A;  2RML A;  1HWU A;  4CLW A;  3IWL A;  4WPA A;  1FI4 A;  4J90 A;  2BMB A;  4OIR A;  1V9O A;  3T01 A;  4YHH J;  2P8I A;  3S14 C;  4OIX A;  3BPD A;  1TTH B;  3CMQ A;  4WE1 B;  1CLF A;  4NLU A;  3I9V 9;  1J2V A;  3DOL B;  4PPD A;  3HZE A;  1EIY B;  4QYZ J;  2V50 A;  2WON B;  4K59 A;  1MSW D;  3PRD A;  2Z2Z A;  1HYS A;  1RTD A;  1WDD A;  3MR7 A;  4HH0 A;  4H4K C;  4MTP A;  1WI8 A;  3DLG A;  4A8K A;  3BGO P;  1F5C A;  3H2U B;  4DV1 F;  1SV5 A;  4QR0 A;  3DYA A;  1NK6 A;  1B99 A;  2NVQ K;  2VUM A;  2RDD A;  1HNZ J;  2FVC A;  2LQ8 A;  2V67 A;  2XLK A;  1K83 C;  1HD0 A;  1JLQ A;  1EAY C;  2QZ8 A;  3SZY A;  2R7R A;  1UPP A;  4O3N A;  1X9S A;  2HHQ A;  1R6V A;  2V6S A;  2UUA F;  4A3K K;  2ZOM A;  2E7W A;  2HFS A;  1Y10 A;  2EXU A;  3S7R A;  4MMO A;  2G2O A;  3E01 B;  1JKH A;  3VAL A;  3E51 A;  6AT1 B;  2WOM B;  2YX7 A;  2HGN A;  3A8E A;  1JJH A;  1HQE A;  1RA7 A;  5KFB A;  5D4L A;  5B0A A;  2KVI A;  1VBY A;  3VAG A;  4TY9 A;  4JI0 J;  3WX4 A;  3CD7 A;  1FJG F;  2RAQ A;  1KFD A;  2HND A;  3KJV A;  1BDF A;  2MZQ A;  2R7U A;  2C2K B;  2V8V A;  2LCW A;  4LSL B;  5CYM B;  4ZCK A;  1UVN A;  4DV7 J;  4LF6 J;  4DFP A;  2F3J A;  3QSY B;  3UR3 C;  4FN5 A;  2RD5 C;  2KT2 A;  3EZ5 A;  4JI6 J;  3M1V A;  2Q6B A;  2CRL A;  2HK2 A;  3O1L A;  1RWK B;  2HW3 A;  4GTD A;  1DCO A;  1TVR B;  4LFB J;  3LGN A;  1X4H A;  4PYD A;  1QSS A;  2QTW A;  2OEJ A;  4C3M A;  2VIH A;  3V6D B;  3GON A;  3TX8 A;  3QSI A;  2XY6 A;  5MAO A;  2EG1 A;  2POK A;  4W98 A;  1BQX A;  3PNI A;  2VUM C;  1UEV A;  4C97 A;  3DN9 A;  4KTQ A;  2KJW A;  2OML A;  2R7T A;  3Q0A A;  3S1R K;  5J2Q B;  3OL7 A;  3R5G A;  3HM9 A;  1SVD A;  4NA3 A;  1BLU A;  3MEE A;  1SQE A;  4C8L A;  3OBI A;  1NZA A;  1PKU A;  4JI8 F;  1Q82 T;  2P6S A;  4KFB B;  1HMV A;  3QWP A;  2A1B A;  5KG6 A;  1T9X A;  4WF9 Q;  1EH1 A;  3M2R B;  1IM4 A;  2XSJ A;  2BJ7 A;  4WP9 A;  1EHW A;  4KY3 A;  3T5H A;  2NR0 A;  1Y1V C;  4M5J A;  3PW4 A;  2XS5 A;  1N34 J;  3FSY A;  1LOU A;  1RT1 A;  1RWO B;  1S10 A;  1X60 A;  3G96 A;  3FSX A;  2YKM A;  4KHM A;  1TKT A;  2E1A A;  1UJ6 A;  1F9N A;  3LP2 B;  2K7K A;  1SC1 B;  4M1X A;  1XMB A;  3KYL A;  3US5 A;  2DCL A;  3I4P A;  1N8R T;  4X65 F;  1VRU B;  4WYL A;  2ZE2 B;  3H90 A;  2R93 K;  1GK8 A;  4Z2X A;  3PR5 B;  4U9R A;  3UDL A;  3OVA A;  1A7G E;  3BQ0 A;  2FQQ B;  3GIL A;  3TJ8 A;  2AGO A;  2CPZ A;  4UUX A;  2DY1 A;  2R8K A;  4IR9 A;  5B0F A;  3VV2 B;  2VBY A;  5IOL A;  3GTQ A;  3GDZ A;  1IN0 A;  3NGD A;  2V8P A;  3X1L B;  2B9Y A;  2A6O A;  3NEK A;  1OY8 A;  2IJR A;  2X7I A;  4JI3 J;  1R0A B;  2E66 A;  4BXX C;  2MKS A;  3IWX A;  3VAH A;  1TL3 A;  4BLA A;  2GAG C;  4DV5 J;  4Y65 A;  2VUG A;  1U48 A;  2ASL A;  1X4C A;  2MLY A;  3I4M C;  3POT B;  5M5X K;  4NCA A;  3HKZ D;  2GS8 A;  3GTM K;  1OYE A;  4G0V A;  1FK9 B;  2E7V A;  3U1N A;  4BLB A;  2UUB J;  2KXF A;  5C4J K;  4Y7N C;  2UVR A;  1RTH A;  4N56 A;  3KKF A;  3KG0 A;  5L1K A;  3A3N B;  4C3L A;  1TWG K;  1ITP A;  3CDB A;  2JA6 A;  4M5D B;  5H9E K;  4WXW A;  1IVZ A;  1VDH A;  2MDA A;  4B3S F;  3QID A;  2EVZ A;  2Y8W A;  5IZH A;  2C3U A;  3DLH A;  1NU4 A;  3HD1 A;  2WAQ D;  3NRB A;  1EQR A;  1TUW A;  4FYX B;  2E5G A;  1ZVU A;  1RHU B;  3UFC X;  4OZ0 A;  1KHV A;  2HHH J;  3F0N A;  1HHQ A;  4Q7A A;  3M9O B;  2F9J A;  3B82 A;  4ZHR A;  3DOM B;  2NS1 B;  4V1A k;  2HVE A;  5F9N A;  4ILL A;  1TL7 B;  4BBS K;  2X1A A;  1UP1 A;  2N3O A;  3RR7 A;  2DRD A;  1YNN A;  2PSZ A;  1PSD A;  1NO8 A;  3W2W B;  1BE4 A;  3B54 A;  2BAN B;  3TWZ A;  5KFW A;  3PYE A;  4J9K A;  1X9W A;  1Y9O A;  3RBZ A;  1FEE A;  3OV7 A;  2UUC J;  3IC1 A;  2P9E A;  2I9S A;  3CJS A;  2WW4 A;  3VAM A;  2ABY A;  3N0B A;  1QAI A;  2PPB A;  1DAR A;  3GYN A;  1OS5 A;  4O23 A;  4JV1 A;  2ZH3 A;  4ZCL A;  1TU0 B;  4RW9 A;  1JLC B;  3JQJ A;  3R3T A;  2N4C A;  2NXC A;  3MD1 A;  4U96 A;  2HPU A;  2FC8 A;  4PQU A;  4KT0 C;  1B4S A;  2UXC J;  1I1G A;  4BWJ A;  1RYR A;  2M70 A;  3TYT A;  1FRM A;  2CQ3 A;  3CCU S;  3J7A 1;  3LAP A;  3RUB L;  3FC9 A;  1DTT A;  1LW0 A;  3OXL A;  2DNL A;  4ZLJ A;  2HVI A;  1VK3 A;  4K4X A;  3R6L B;  2FLN A;  2VOD A;  4P5B A;  3HSD A;  4RWW A;  1XNQ J;  3IBF B;  4QQB A;  1PAU B;  2F65 A;  5HQM A;  2QA1 A;  2JC0 A;  1H7W A;  1KOH A;  3DM2 B;  4KB7 A;  2HEK A;  4QR1 A;  1QTN B;  2X51 A;  2QJ3 A;  4ECW A;  2HHS A;  1VRT B;  4I2P A;  4RNH A;  2RUG A;  2GIR A;  3CVK A;  1RWP B;  1N4L A;  1A9N B;  1JJC B;  1H74 A;  4RNM A;  4PEO A;  3S15 C;  3IGV A;  1NK8 A;  2MQN A;  3H20 A;  1H73 A;  4ES2 A;  3P5B P;  2DKO B;  2NZC A;  4TLR A;  3PJ9 A;  2E1P A;  3CC7 S;  4JP8 A;  3UDV A;  2ILY A;  4K4S A;  3W7B A;  3S1Q K;  4DR5 J;  1B70 B;  1BWV A;  5IQQ A;  4PWU A;  2QA4 G;  2V8G A;  1EI6 A;  3OD2 A;  3GIM A;  1RAB B;  1KKH A;  4L3K A;  1WSR A;  2NSB A;  2W2M P;  3C2P A;  3MHY A;  3DOK A;  1IBM F;  2HZC A;  3O44 A;  2VHG A;  4OI2 A;  1M5V C;  3AH6 A;  2OI2 A;  3QFW A;  2MKJ A;  4XDC A;  4JK1 A;  4KGV B;  1K9M T;  1WG4 A;  1TV6 A;  4N5S A;  3IP0 A;  5KFY A;  4DL3 A;  3DRY A;  1JLF A;  3I55 S;  2W4P A;  3IGN A;  3GFZ A;  1R9T A;  4DPO A;  2VOP A;  2CPH A;  1D3W A;  5DDO C;  3HK2 A;  2DNO A;  2GMH A;  3BM7 A;  4IQM A;  2GSU A;  5HMW A;  3R1L A;  1O26 A;  1B4B A;  1U1P A;  2HBQ B;  3HT0 A;  1R8A A;  4YN3 B;  4EGL A;  2DR6 A;  3CJ2 A;  4WKY A;  4RUA A;  3QJJ A;  3SIP B;  3KK2 B;  1SH3 A;  3MEG A;  4DX7 A;  4URG A;  1E6V A;  4NLQ A;  4MYU A;  2HHT A;  2IM1 A;  4K0K F;  3OTB A;  2KRB A;  2K8G A;  2A0F B;  2EC0 A;  2HSE B;  2M52 A;  3C6U B;  3PRB A;  1V6H A;  1IQ0 A;  2VG5 B;  2E5L J;  3KLI A;  1U0H B;  2R8J A;  1S49 A;  3OR1 B;  3S6E A;  3BN4 A;  4TXS A;  3D2W A;  2U2F A;  1IR1 A;  4JI2 F;  5KFL A;  4OYP A;  2XHC A;  2BKN A;  5DG8 A;  1DLO A;  3KLG A;  4NMX A;  5J1E B;  4A8F A;  1NJZ A;  4GT9 A;  5KG0 A;  1QVF R;  4YME A;  3IRW P;  3CQZ A;  3C16 A;  1FJC A;  1JNR B;  2AHO B;  1KQK A;  2JA8 K;  3ZFV A;  4CO5 A;  3OR2 A;  3DHW C;  1Q7Y T;  2MMY A;  2B43 A;  3KLH A;  5LSR A;  2AWZ A;  1S9E B;  4LVN P;  3GTG K;  2J6S A;  2B4U A;  1RAA B;  1XN9 A;  2YNF B;  3V5R A;  1YBU A;  4ED1 A;  1LXN A;  4P6Q A;  3PO2 K;  1SFO A;  2L9N A;  4OYB A;  1D9A A;  4YFN A;  2R4F A;  3GSI A;  3VGU A;  3UQS A;  2YQ3 A;  1MNE A;  3A1Y G;  5HQL A;  1NKB A;  1S1W A;  4KN4 A;  2MKK A;  5C2C A;  4WK1 A;  3MR2 A;  3MR6 A;  2BYC A;  4TY8 A;  2RSQ A;  3MMC B;  1PYT A;  4USU A;  1FX2 A;  4KKO B;  2NXN A;  3GR0 A;  4F4A A;  1IBL J;  1S9G A;  1T02 A;  3LGM A;  3M32 A;  4BC7 A;  1N36 F;  4A3F K;  4Y6I A;  5LT5 A;  3SCJ E;  4EYI B;  4P2M A;  3L4B C;  2R2U A;  4QU6 A;  2EPI A;  2IYG A;  3I6P A;  2QL9 B;  1S1X A;  1A0O B;  3BBB A;  3FJ2 A;  4EUV A;  3ISN C;  3HOU K;  4LF9 J;  1RWN B;  2P6T A;  3OHB A;  1FRI A;  2C2M B;  2K1R A;  3CIM A;  5FDL A;  2ZH7 A;  4NLV A;  3IMQ J;  2DD8 S;  4DV3 F;  2RIJ A;  3D6H B;  2A6M A;  3CQZ C;  1RAC B;  4OZ1 A;  2XNQ A;  3BB5 A;  1VBK A;  5AXN A;  2GNK A;  4RBU A;  4AT1 B;  2JA7 C;  2MQQ A;  4NLS A;  3AOA A;  1X5P A;  3EZU A;  1UKU A;  4BDP A;  1JLE B;  1UWB B;  2ZHO A;  3F41 A;  3V4I A;  4LOW A;  4HR2 A;  2HYI B;  4RW4 A;  1ELO A;  4UZB A;  4ZVP B;  1O27 A;  1OJ4 A;  2F8H A;  3W61 A;  1B0P A;  2Y1L B;  3CMA S;  1GXT A;  3OFH A;  2CWK A;  4WFN Q;  4V19 J;  1TWC K;  3MI7 X;  1YIJ S;  4Y28 C;  2V4J A;  3HHE A;  1O2F B;  1ZOT A;  2PMZ D;  3MM7 B;  4P5A A;  4OI3 A;  1N52 B;  2Z58 B;  3K59 A;  4OJ3 A;  2DR5 A;  4X84 A;  3PW5 A;  2QG9 B;  3OXF A;  3S8S A;  5FLM K;  1I51 B;  3IS9 B;  3M4O K;  1WF1 A;  5BR8 J;  4YB1 P;  3BO3 A;  1FNO A;  4DUY F;  5HAO A;  1F9H A;  2NYI A;  2DEI A;  3PR4 A;  5IYD C;  5A76 A;  1XNR J;  2JEF A;  4DPX A;  1KLM B;  4CQ1 A;  2MY8 A;  1DUR A;  4X64 J;  3PHT A;  3CCW A;  4M5I A;  1Q79 A;  2VD3 A;  2PA8 L;  2Y1J A;  1FHT A;  1LWE A;  5SUH A;  1CQN A;  3TNV A;  4OIP A;  3HVT B;  4F4Y A;  2B5J A;  2EC2 A;  1M5K C;  4OZL A;  2ADC A;  4TYA A;  4TU9 A;  4WWS A;  4XSZ A;  1ZBS A;  4FNI A;  3HOX K;  2DR9 A;  2NZ4 A;  2CQ4 A;  4RO0 A;  2GX8 A;  2DHX A;  3ICL A;  3BPS P;  3MM8 B;  3AD9 C;  4AE5 A;  2DHS A;  2F63 A;  3DHX A;  3KLE A;  2H5I B;  2H5E A;  4JI4 J;  4IOA Q;  5F8N A;  1RBA A;  3VF0 B;  3MWB A;  4A8Y A;  3ZTQ A;  3HFK A;  1DJ0 A;  2LQJ A;  5C42 A;  3RR8 A;  3MMB A;  3H5S A;  4KV8 A;  1NHK L;  3Q86 A;  2I2Y A;  2XQC A;  3CNQ P;  3SV4 A;  2E2H K;  3M2V A;  4C3H C;  4P2X A;  3NMR A;  2XMT A;  1XR7 A;  1Z1Z A;  1OSC A;  5TJ3 A;  4BY1 C;  2QMU B;  1MW7 A;  1CJT B;  2JA5 C;  1VQ9 S;  2CQ2 A;  4K4Z A;  1S4F A;  3A13 A;  4EO8 A;  2VA2 A;  3TVK A;  1O0P A;  2CVI A;  3TUI C;  1P1T A;  1REV A;  4ECZ A;  5GMD A;  5EGY A;  3BV8 A;  5LMN J;  1NZ8 A;  3S1N C;  2W4C A;  1MLA A;  4CLL A;  4A3G K;  4ETX A;  1H2T Z;  1TUG B;  1RSC A;  4B9U A;  1L5U A;  3M6X A;  1S7H A;  3TTG A;  2KHC A;  1O5J A;  1ZYQ A;  2JH3 A;  4X6A C;  4F2R A;  3S0X A;  4J3N A;  2IC3 B;  5DG7 A;  3OHA A;  4RW7 A;  3B8H A;  3S1M C;  2HQG A;  5M5W K;  4CYU B;  3OTE A;  4A93 K;  3IRX A;  2YNI B;  4O3P A;  5KFD A;  2MZ1 A;  3CD6 S;  4GRS A;  3BKU A;  1NXI A;  4NL5 A;  1NK4 A;  2LEB A;  3MAA A;  2O67 A;  4AL6 A;  3OTO J;  2MQM A;  1K0V A;  3MZI A;  1X4D A;  3M8P B;  4AQY F;  2CPD A;  4UOF A;  2LXI A;  2YU9 C;  1RAI B;  3OL8 A;  3OLA A;  1Q8I A;  5F8G A;  2IM3 A;  2JSX A;  2HQF A;  2HQ3 A;  1U7L A;  2RS2 A;  3OL9 A;  2DNK A;  3N3Y A;  4CTA A;  4CYU A;  1C1C A;  2QN6 B;  4NXM J;  4KJI A;  2BW2 A;  1CJU B;  3RG6 A;  5M2P A;  2M0G B;  1BQM A;  3G6V A;  3P3D A;  1REG X;  4MK9 A;  2D3O R;  1JJ4 A;  1VQ5 S;  4DQR A;  5L8R C;  4DCJ B;  2R7O A;  4BBR C;  1XWL A;  4DSJ A;  4G1P A;  3S01 A;  4HDH A;  5D4O A;  2GCF A;  1VQP S;  1C4C A;  1X0F A;  2CJA A;  4F4X A;  3K5P A;  4Z7Y A;  3HLU A;  3V6K A;  3M8Q B;  2YWG A;  3D0H E;  4WJ3 M;  3FEZ A;  4ILD A;  2DIV A;  3CME S;  2M2B A;  2ZOF A;  4RMF A;  1F2H A;  1JX4 A;  4OX6 A;  1QD1 A;  4WU2 A;  1BGX T;  4TYB A;  4EI2 A;  1I6H C;  5E3C A;  4A3M K;  4U7C A;  5HLF B;  3DI6 B;  1B3T A;  3OT9 A;  4QIF A;  4HYK A;  4ZIV A;  1D8Y A;  5F8M A;  3DLE A;  5C2G A;  2C2N A;  3ZXW A;  1JB0 C;  1OPI A;  1RP5 A;  1S76 D;  3AY0 A;  2KDO A;  1UET A;  2WVF A;  3CC4 S;  3R5D A;  5BXI A;  3AD7 C;  5KT7 A;  3GPA A;  4IRD A;  1SL2 A;  4ZVE A;  1HBO A;  4Q4Z A;  4ID8 A;  3TVZ A;  2O01 C;  2Z2L A;  5GAH U;  1KOO A;  3W66 A;  1SC6 A;  2J8A A;  1VHI A;  5ETN A;  3CCT A;  2HAI A;  3SXL A;  1WAC A;  3AOC A;  1JQG A;  3MPD A;  2NVY K;  2BAC A;  1FWL A;  3I9Z A;  3MFH A;  3IO1 A;  2IFX A;  3IM9 A;  3SSR A;  5CZX A;  3CWJ A;  3DLB A;  3UD4 P;  1RT7 B;  5E3A A;  4ZVS B;  2HRT A;  2AKW B;  1WC6 A;  1IBK F;  3PHE A;  4MK7 A;  3GYX B;  4OV6 A;  2W2P P;  1BWE A;  4DZD A;  2R8G A;  4YDD B;  1TKZ A;  4X4Q A;  4DCP B;  3A8K A;  2DNH A;  2E2J C;  3TFH A;  4CO3 A;  1ZZN A;  2XCR B;  4RUB A;  4H4M A;  3L7P A;  4H54 A;  1R89 A;  4MK8 A;  4P2F A;  1PC5 A;  3SCK E;  3ET6 B;  4I68 A;  4CRJ A;  4AYB D;  3R7N B;  1S9F A;  5D8H B;  3WQP A;  4B9L A;  5K20 B;  2VH7 A;  3DGP B;  1Y11 A;  2AV5 A;  1UEK A;  3BF4 A;  3VHQ A;  1FDA A;  4C8N A;  1AUS L;  4YR2 A;  3MM6 B;  4IUF A;  1HFE L;  2P5M A;  1KC8 T;  4DR7 J;  3RZA A;  1WDT A;  2QLB B;  4ELT A;  4DPY A;  4JYA J;  4Y2K A;  4DV4 J;  3KHL A;  2CNN B;  3OUY B;  2DBB A;  2FGO A;  1J6W A;  2QL5 B;  5KFJ A;  4AL5 A;  2L48 A;  4G65 A;  1TP7 A;  1HNZ F;  1XR5 A;  1FFS B;  1DQ8 A;  1ZH5 A;  2VQE J;  4J37 A;  2EW9 A;  3V6H A;  2IMW P;  2Z0G A;  4TVA B;  3MDF A;  4Q2M A;  2ZWO A;  2CKW A;  3HOY K;  3UN3 A;  1HBM B;  1RCX B;  1UZH A;  4I6A A;  4J9R A;  2XLI A;  1RBL A;  2NVX A;  1AA1 B;  4LVO P;  2RNE A;  5ETR A;  1KQ4 A;  9RUB A;  2IVY A;  1SKR A;  3FCV A;  1KLN A;  3EWG A;  3G82 A;  1YZ6 A;  3J7Y I;  2PFF B;  1LWC B;  2ZOG A;  3EIC A;  3NBP B;  5B0G A;  4JI0 F;  3QLH B;  5KT2 A;  2DJW A;  3CCZ A;  2HQI A;  4I6Y A;  3HP6 A;  2GC8 A;  3L4K A;  4LF4 F;  2B63 A;  2R92 A;  4FZB A;  4USH A;  4DV7 F;  3K17 A;  4LF6 F;  4OL8 A;  2VON A;  4DPU A;  1QAX A;  3I0S B;  1FJG J;  2KG1 A;  4DWI A;  4JI6 F;  2R42 A;  4U8V A;  1O25 A;  2OP5 A;  2GGP B;  4LF1 A;  4I4B A;  2J5A A;  2OKQ A;  5KOX A;  3TA2 A;  4NML A;  4LFB F;  3RYL A;  2XI2 A;  4CLS A;  2ASJ A;  5KG1 A;  1NDC A;  2DXF A;  1RTJ A;  2PMW A;  2HNY A;  5IP9 K;  1L3V A;  1ZBT A;  4WU3 A;  2NUU G;  3KWM A;  1CJV B;  3LQV A;  3ORE A;  2X3G A;  4Y52 C;  1YJV A;  1SKU B;  2LMI A;  2BVZ A;  2DGV A;  3L9Z A;  3LWM A;  2OPR B;  2EFP A;  3VZI A;  1TWH K;  1KQS R;  3R6G B;  4USW A;  4NOH A;  2YH0 A;  4TQS A;  2W9C B;  3EGV A;  1S97 A;  3HDS A;  2OEK A;  4MT1 A;  4O3O A;  2Y0B B;  3EJM A;  3AD8 C;  4DV2 J;  2V2V A;  2CW0 A;  3ITH B;  4D3G A;  1TL1 B;  2L9D A;  3H7H B;  4I7F B;  2OPS B;  3CIZ A;  1TMM A;  1WEZ A;  1VQ4 S;  1XJW B;  2QE5 A;  4QPT A;  3LF0 A;  3QO9 A;  4KB2 A;  4NCG B;  2W25 A;  3CO9 A;  3NAI A;  4UTG A;  1Q8L A;  4LF8 J;  2B63 C;  1DTQ B;  1EET A;  1XMO J;  2R8H A;  1RLC L;  2YPZ A;  1I3Q A;  3Q24 A;  4DFJ A;  4M5N A;  1N34 F;  2ZC3 A;  2Q6C A;  3SI8 A;  3EVW A;  4QYR A;  2ZWP A;  4DL7 A;  2OPS A;  3PZP A;  2C2O B;  2FUG 9;  3H0G K;  1UAW A;  3MPU B;  3WC0 A;  4KHR A;  3FCW A;  2CJB A;  2N3L A;  1YRX A;  1WG5 A;  2FTR A;  4NLT A;  1LWX A;  4K2J A;  5IM0 A;  1Q53 A;  4JOU A;  4PYA A;  5E0O A;  2YH1 A;  1F5A A;  1KEK A;  1TK8 A;  1T05 A;  4LFC J;  5I3U A;  3EGW B;  1UW4 A;  1XQI A;  3TAM B;  4RW8 A;  5DJB A;  4IG0 B;  3S17 C;  1AZS B;  3CSK A;  2DCU B;  1S57 A;  3UDC A;  4Y2A A;  3AFG A;  2VQF F;  2CZ9 A;  5IXU A;  2EFO A;  3T1H J;  2F8E X;  1FT8 A;  1NSP A;  3PFO A;  3GFH A;  4A47 A;  2O66 A;  4DQQ A;  4JI1 F;  3NL0 A;  1DY3 A;  1FCA A;  2IPO B;  3IN5 A;  4CM0 A;  1HI1 A;  4ILR A;  5DDQ C;  5LOQ A;  3AAW B;  4B3O A;  3R2C J;  1APS A;  5EN1 A;  4NLY A;  1NBE B;  1URR A;  3SCL E;  2YY3 A;  3E8O A;  2EI5 A;  3EVO A;  2QYG A;  1FKO A;  5IP7 K;  2G0C A;  5IFM A;  1TWC A;  3VWS A;  2AYE A;  5KFO A;  5L1I A;  1RHM B;  1WCM A;  2PDA A;  3HX9 A;  3O5T B;  2R2T A;  3WOD A;  3OJS A;  4CH1 A;  2U1A A;  1IKX B;  2WTF A;  1WG1 A;  3NLC A;  2IBK A;  4OLP A;  3RRH A;  4E98 A;  1KS2 A;  3D6T B;  5KG7 A;  1XZP A;  2KH9 A;  2XO6 A;  5HP1 B;  1QVG R;  3GIR A;  3DXJ A;  2HHP A;  4DUT A;  4OQJ A;  4RLE A;  4WIQ A;  4G7O A;  1DRZ A;  2B7C B;  2JFK A;  4HL9 A;  2MJU A;  2H4W B;  4A3L C;  3H5X A;  2BRL A;  2K2P A;  1EB0 A;  4FPR A;  5ETT A;  3R2D J;  1CQM A;  2RF2 A;  2GVD B;  1H72 C;  1C1B A;  2AJ0 A;  2DY9 A;  4LRB A;  3QRP A;  2ZJP Q;  3DNC A;  5DO2 A;  2R3V A;  2JOQ A;  1JLG B;  2ZBQ A;  5BYS A;  4NI2 A;  4MH8 A;  3GJR B;  5J1P A;  1Q81 T;  1UA1 A;  2HHH F;  3HO1 A;  2M9K A;  3JSB A;  2LVW A;  4C4W A;  3W65 A;  4P52 A;  5F3Z A;  5GAE U;  2YKQ A;  3CJ8 A;  4YR3 A;  4P9S A;  5A8R A;  2D9O A;  1HA1 A;  2W7O A;  4ZPV R;  1TKX A;  4DDF A;  1S7I A;  4Q0B B;  1VBX A;  3HF5 A;  3S14 K;  1SI9 A;  3IFE A;  1YCL A;  5A0Y B;  3R5B A;  2HFV A;  2AX1 A;  3QJP A;  4UQT A;  2RU9 A;  2QYC A;  1J5E J;  1RT5 A;  3LP0 B;  1I3O B;  2UUC F;  4IFV A;  2D41 A;  1WCM C;  2KL8 A;  1Y1W A;  1PYS B;  2RRN A;  1GMU A;  1Q78 A;  4IDK B;  1N0V C;  2JLE A;  2RQ4 A;  4OZJ A;  1HBU A;  4IR1 A;  2DR7 A;  4KYZ A;  2UXC F;  1WKK A;  3KK3 A;  2OAU A;  3DRS B;  1VJW A;  1K83 K;  3IWN C;  5DQG A;  5DZ7 A;  4OJ1 A;  2YKP A;  2N82 B;  3EUN A;  1KHW A;  2RT3 A;  3JTN A;  2IVF B;  2XCA A;  2OUG A;  1UCN A;  1P6T A;  2CPE A;  3GTO A;  5IOT A;  4R0E A;  3Q8Q B;  2H54 B;  1MRO B;  3R7B B;  5GME A;  4I69 A;  3PY8 A;  1USM A;  4FYY B;  3KNA A;  2WBR A;  3UI3 A;  2OIH A;  1BHN A;  3L09 A;  1ZQ1 C;  3QIP B;  4OJG A;  1RT6 B;  4DL5 A;  1EP4 B;  1S1T A;  3T6B A;  1CJK B;  3KMQ A;  3T5J A;  2F5G A;  3G6E S;  5CH7 B;  5HRO A;  2BKP A;  2HKE A;  1N6Q B;  3KHR A;  1VHF A;  3GTP A;  1SJQ A;  2V69 A;  4Y2C A;  2PO4 A;  3DLL Q;  3LPY A;  4USJ C;  4ETZ A;  3MAH A;  2ILZ A;  3DU5 A;  3DDI A;  4IO1 A;  1PYO B;  5M2R A;  3V4G A;  2V2Q A;  5D3G B;  2JHE A;  1NB2 A;  4DR5 F;  3N6L A;  2GO9 A;  3D6F B;  2A6H A;  5A8K B;  3JYT B;  1BQN A;  5TMC A;  4YUD A;  1N5T A;  4IFY A;  2P9C A;  3T1Y J;  1Y1W C;  3DLK B;  5A2Q U;  3BSC A;  3PXG a;  3RZD K;  3NCR A;  2V4Q A;  2C3O A;  1JIH A;  5KFG A;  3LOU A;  4K4U A;  2XNR A;  1QM9 A;  4LF5 F;  2DGT A;  5B0E A;  2YTC A;  4ES1 A;  2MQO A;  2QL7 B;  4YP3 A;  2VUM K;  5KFF A;  3JQK A;  4M5L A;  3VGV A;  3HSG A;  3FKI A;  5J2P B;  1SJ3 P;  4ZK7 M;  4X4R A;  3LW5 C;  4N77 A;  4O2D A;  3TA0 A;  3PDN A;  1SJ1 A;  1R8C A;  2E7X A;  4M5M A;  1P9Q C;  4ZVF A;  3GTO C;  4PUO B;  3O2I A;  4ZJO A;  2VV5 A;  4ICL A;  2ZM6 F;  3LTO A;  1ZTT A;  3FUY A;  3PW7 A;  3BSO A;  2BQ3 A;  2OPP A;  4WFA Q;  2KN4 A;  3K5M A;  1N33 J;  2X1B A;  1UVM A;  5KFP A;  3TVY A;  3VGT A;  3DRR B;  2XMK A;  6FDR A;  4WK3 A;  1CEZ A;  5C4X C;  2E5L F;  3GTP C;  2VPZ B;  3BBF A;  4HAC B;  2BRK A;  1FD8 A;  3GG1 A;  4LK0 A;  3JSM A;  5KT3 A;  5KFV A;  3PW0 A;  4WYW A;  3SDE A;  3CJK A;  4OMF G;  3IAM 9;  2EFG A;  2CQB A;  1HQU A;  2P8T A;  4DEZ A;  3KHG A;  4A3K C;  2FD2 A;  3DRR A;  3ISZ A;  2CDR B;  3C15 A;  4KQZ A;  4C2M A;  2CA9 A;  3N79 A;  4A48 A;  2ZUF A;  4DPW A;  2UV8 G;  2PMZ L;  4R5P B;  1FKP A;  1LWF B;  2Q3P A;  4DU7 A;  4JI7 F;  1F9F A;  1TEL A;  4X4T A;  3G2X A;  5BJR A;  3BN7 A;  1S6P A;  2OFG X;  4Y3C A;  5DS7 A;  1NKE A;  2FHK A;  5IT0 A;  4GVB B;  2XYG B;  3AOD A;  2APO A;  2SXL A;  1IKV A;  3LP1 A;  2E9T A;  2IMO A;  5D77 A;  1PBU A;  4FS1 A;  1VS3 A;  1N88 A;  3DCA A;  3M7V A;  1T0T V;  3SQG A;  2DHG A;  2VAS A;  5IOR A;  5C25 B;  1ACM B;  1UFK A;  2AYB A;  4NYO A;  4IH5 A;  3OW2 R;  1Q1K A;  1WEY A;  2A10 A;  3GCX P;  1ZA2 B;  1AB4 A;  1XMQ J;  4GVB A;  1VIO A;  1IBL F;  1NM2 A;  2LQ9 A;  3I4M K;  1F7U A;  2R7Z A;  3MM5 A;  2ZUG A;  5LMU J;  3BH6 B;  4B3T J;  4QWA A;  4CM2 A;  1HQM A;  5A2Q Y;  2XM3 A;  5E5N A;  1M1H A;  1WTF A;  3CGI A;  3KJQ B;  3Q89 A;  4LF9 F;  3MCN A;  4YR0 A;  2R7S A;  1MWY A;  4Y7N K;  3GTL A;  3QAT A;  3I4N C;  3PM9 A;  4H4O B;  2ZFZ A;  1SKS A;  2EK6 A;  4DOZ A;  5HL7 Q;  2O1P A;  1D0E A;  3EDR B;  4CLU A;  4XTT A;  2DNR A;  2P2C B;  3M2U A;  1ZA1 B;  4I2Q B;  2J0X A;  4C2M C;  4Q5S A;  3RBX A;  2GHV C;  4A8O A;  1VQO S;  1C0T A;  2M7S A;  2E2I A;  1V3S A;  1TK5 A;  4NZ0 A;  3T02 A;  2YNH B;  2DNZ A;  2BOA A;  4MIB A;  1U2F A;  2C3P A;  3GTQ K;  4RW6 A;  4ED6 A;  4JB8 B;  2AJF E;  5KFH A;  2FHJ D;  4F0H A;  2RUS A;  2XG8 A;  1PG5 B;  1FFW B;  3DC2 A;  1R8H A;  1T03 B;  4AXI A;  2UV8 A;  5LSL A;  3SCI E;  4F25 A;  5A8W A;  3LPX A;  4K5R A;  1LK7 A;  2UVV A;  2EG2 A;  2YWH A;  4C3I C;  4A3B C;  4DV6 F;  2RHS B;  1PIL A;  3H98 A;  3MGJ A;  1RAH B;  2RKI B;  4G0W A;  4LT6 A;  1NJX A;  5BR8 F;  1TWF A;  3GII A;  1Y4Z B;  3ONQ A;  2W9B B;  5D15 A;  5HVG A;  2XEX A;  1UZD A;  4KMU A;  3E3X A;  4ED8 A;  2WB1 L;  1Y3K A;  4J9V A;  4BWM A;  2HHX A;  1XNR F;  1RT4 B;  3TI0 A;  4QJV B;  2Z4P A;  4MIW A;  4X64 F;  2DK2 A;  3TAQ A;  4DSF A;  1ICE B;  2PEB A;  4B3M F;  2QRR A;  3KXD A;  3CXC R;  2JA6 K;  1WF2 A;  3PYG A;  5E7O B;  3C14 B;  1V3R A;  2MXY A;  4IOC Q;  4G1Q A;  3GTJ A;  4MKB A;  1S6Q B;  3NNC A;  1OMS A;  1U1M A;  2ZDO A;  1Y5N B;  1RKI A;  1WC5 A;  2E2I C;  1ISE A;  3CJ3 A;  2BEF A;  1T95 A;  2H4Y B;  4KAS A;  4JI4 F;  1RHR B;  3VAJ A;  2GIF A;  2YQ0 A;  2HIQ A;  2VFR A;  1OY6 A;  8AT1 B;  1VC0 A;  1Z4U A;  1FE4 A;  2VKR A;  1EQM A;  4DR4 F;  4YG2 A;  3U1L A;  3O6Q A;  2HFO A;  2W9A A;  1CS4 B;  1U49 A;  3T9N A;  4MAK A;  2GHP A;  5C4J C;  1X5T A;  2VL1 A;  4DSL A;  2V9W A;  2FHM A;  5HBM B;  1FNM A;  1TWG C;  1N5V A;  2HS4 A;  3EXC X;  1VJQ A;  3RW6 A;  2QA2 A;  2DNG A;  5J2M A;  3AQP A;  1KN6 A;  1FO1 A;  1C2P A;  1RZM A;  1S77 D;  3FMW A;  3M3Y C;  2VJU A;  5IV4 A;  5SZT A;  4A3J C;  3KUE A;  3SQO P;  4D3H A;  9ATC B;  4Q44 A;  1OO0 B;  3UO0 A;  1HW9 A;  3ZZU A;  5LMN F;  4C6A A;  5K14 B;  4E2F B;  5JVG Q;  4HHH A;  4OZ3 A;  1GX6 A;  3PO5 A;  4XK8 C;  4PXD A;  3MEC A;  3EPI A;  1QSL A;  3T9Z A;  3T5L A;  1NK7 A;  4KGZ B;  4BBS C;  4IG3 B;  2PI4 A;  3KLF B;  1LW2 A;  3PX0 A;  1YLX A;  1QUV A;  4YB6 A;  3RB4 A;  1B0T A;  3BP8 C;  2R2R A;  1Y5L B;  3P49 B;  3C8Y A;  2G4B A;  3J7A N;  7FD1 A;  5IWA J;  1RGV A;  1ZM9 A;  1N5Q A;  2LXF A;  5JUM A;  4I56 A;  1G51 A;  4EBD A;  4PG7 A;  1ZS6 A;  2FPH X;  5LJ3 Y;  5KT5 A;  3X3U A;  1VIX A;  3OTO F;  3WC2 A;  2KFZ A;  2MZR A;  1IUJ A;  1RHJ B;  2DIT A;  3TJA A;  3J80 U;  4HHJ A;  1UVL A;  4ZVT B;  2PA8 D;  4F50 A;  1B64 A;  3KFW X;  2DYA A;  3B78 A;  4GC7 A;  4DSE A;  2GVZ A;  5E2Q A;  5EUH A;  5KFA A;  3Q22 A;  1MU2 B;  5DZ6 A;  2VPX B;  2W7V A;  1T94 A;  4ILM A;  2RRB A;  3I0R B;  1B7F A;  1CUL B;  3TAR A;  1IBC B;  2DVI A;  5H9E J;  7FDR A;  5G0R A;  2OTL S;  4QW9 A;  2Y1I A;  3MD3 A;  4QIW L;  2QC3 A;  1XC9 A;  4AYB L;  4DR6 J;  3M8W A;  2A18 A;  2D6F C;  3U7J A;  1VRQ C;  3G8T A;  2WSE C;  2OPQ B;  5F0W A;  3TR5 A;  4DX5 A;  5AXL A;  1X4B A;  4GO5 X;  3VQT A;  2NYH A;  1MN9 A;  1R9T K;  3P6Y C;  1MG7 A;  3N0C A;  1IR0 A;  1WI6 A;  3CCS S;  5IV3 A;  2FJW A;  4BC9 A;  2UUT A;  4C8Z A;  1Q5V A;  2V9K A;  1WHV A;  3DRP B;  4LSN B;  2AZ3 A;  1NK0 A;  5HSP A;  1R6Y A;  4WZQ A;  1BJT A;  2MEW A;  3M30 B;  5E41 A;  3W8G A;  2RDI A;  5I4M A;  1NDL A;  2CPF A;  1BY9 A;  5HJX A;  4Q2L A;  3MM9 A;  4ECT A;  4K5S A;  1BGW A;  1VMB A;  4NLW A;  3U27 A;  5HVF A;  4O4G B;  2ZD1 A;  4J91 A;  4ZLP A;  1P1L A;  5BYQ A;  3D1O A;  1IKY B;  3RAQ A;  2IRY A;  5GVQ A;  4ZN3 A;  5CYQ A;  1FVQ A;  4ER8 A;  1S59 A;  1CVJ A;  4RNO A;  2BAB A;  4H4K A;  3DU6 A;  1G2E A;  4KBI A;  4PKD B;  4QU7 A;  3LAK A;  3FMB A;  3K89 A;  3DLJ A;  3CQZ K;  4I6W A;  1SH2 A;  2ZH6 A;  2I0X A;  4M5G A;  1JVI A;  5E33 A;  2AEJ A;  2H48 B;  3EGN A;  3GV8 B;  3H2L A;  2DB1 A;  2BDP A;  4Z37 A;  1GH8 A;  3TAN A;  1M5P C;  1VIS A;  2KT5 A;  1SC4 B;  3TUP A;  1WQF A;  3BKF A;  5F3T A;  2VG7 B;  1SFO K;  2Y8Y A;  3VA7 A;  3R5C A;  2DEJ A;  3GR1 A;  3HVW A;  4AL7 A;  3H42 A;  1HD1 A;  3VGS A;  1YJ9 S;  1OIA A;  2ATC B;  2PA3 A;  5CCM A;  1JLB B;  3ENW A;  3MF5 A;  2EFQ A;  2ZH8 A;  5E68 A;  4J9S A;  4EK2 A;  1HHT P;  4O0I A;  2IY5 B;  2A68 A;  2CFX A;  1U6Z A;  1YX2 A;  2BA9 A;  2YKN A;  5AXM A;  3SEO A;  4LFA J;  4EZ9 A;  1U24 A;  5KG5 A;  4QOT A;  4DR7 F;  4NLO A;  4ECQ A;  4QWB A;  5J2N B;  3PTW A;  2OD4 A;  3M4X A;  4JYA F;  4HLB A;  3A3P B;  4DV4 F;  4NCB A;  3MTK A;  5LXR A;  4U8Y A;  1SJR A;  2QV6 A;  1X31 C;  5CA5 A;  1XIQ A;  2MB0 B;  2KO1 A;  1HNV B;  3GTG C;  5GAG U;  2G1H A;  4G7H A;  2GHW A;  2CNL B;  3RW7 A;  4P10 A;  4NOI A;  2WRM A;  2VQE F;  3I82 A;  5LM7 E;  4GZY A;  3PEJ A;  3W5Y A;  5DQH A;  2P5V A;  4WE1 A;  3D28 A;  4OIO A;  3M8S A;  3RBE A;  3DOL A;  5CQG A;  1S4E A;  2WON A;  2HBY B;  5MLC V;  2AIR B;  1F3V A;  5EGH A;  2GAH C;  4B08 A;  2B3T B;  5ETS A;  4X4N A;  4CLT A;  2JEI A;  2NLW A;  3KLV A;  1BS2 A;  5KFR A;  3CPW R;  2F4V J;  1WNE A;  1NDP A;  3OTC A;  5AJ3 J;  1TR0 A;  2ZEJ A;  2JEJ A;  4GKK J;  2YX4 A;  1ZXO A;  5IOQ A;  2XZT B;  1IR2 A;  3OEP A;  1NB7 A;  4OHX A;  2B8P A;  4DI6 A;  1TUV A;  3HOU C;  3G4S S;  2V94 A;  4V19 X;  3HVR A;  1M5H A;  5ETO A;  2J6U A;  4WTY A;  4EWT A;  1FXD A;  4BBY A;  4IH6 A;  5D4D A;  2J7W A;  4BY1 K;  4PR6 A;  2BW7 A;  4MKA A;  4LF4 J;  1Y1V A;  2XMM A;  2BE2 B;  4ANE A;  1HWL A;  2HNZ B;  3E01 A;  1D9D A;  4C0H A;  2WOM A;  3TX0 A;  3OVS A;  4A3C K;  1M0S A;  1IJF B;  3MMA B;  1X9M A;  2LXU A;  5CCL A;  3LUY A;  5D0R A;  4MEX A;  2XCQ A;  3V81 B;  1FKA F;  3FHZ A;  2YWE A;  4LSL A;  3H5Y A;  1RXO B;  5CYM A;  5T41 A;  2GJF A;  4KE5 A;  1YJN S;  4CDI A;  2Q66 A;  4X6A K;  5DGB A;  2H9Z A;  4KH0 B;  2BKO A;  1ZPV A;  2ZJR Q;  3PV8 A;  1RAO A;  4N8N A;  4DV2 F;  3D1H A;  2QLF B;  1TVR A;  5H9F J;  4OX8 A;  1T7P A;  1RBO B;  3ZTR A;  2ZBI A;  4ZA1 A;  2L08 A;  1KNZ A;  1J5O B;  4ATN A;  3T6J A;  3CE8 A;  3V6D A;  4HDG A;  4A8S A;  3QZ8 A;  3VZH A;  2H51 B;  4LBI A;  4WJB A;  2YNG B;  4LF8 F;  1Q16 B;  2ERR A;  4RU9 A;  3N6N A;  4PWD B;  1XMO F;  1RAF B;  3NCP A;  1G6B A;  1QSY A;  2RH3 A;  5E3Q A;  4ZLN A;  4KMH A;  2KM8 B;  3IG1 B;  1UFL A;  1ARO P;  3P8B B;  5J2Q A;  3CJ0 A;  4GC6 A;  3LAN A;  2DGW A;  2RVJ A;  4MJK A;  2DGO A;  4LRE A;  1XTZ A;  4USI A;  4CNY A;  4ID5 B;  4BBR K;  1SQG A;  4USK A;  4G7Z A;  3HSZ A;  4OYI A;  3MED B;  2KYZ A;  2LKZ A;  1RT2 B;  4KFB A;  2G0J A;  2CDQ A;  2LA6 A;  4DXL A;  4NA1 A;  4LFC F;  1O51 A;  3CD0 A;  1RK8 A;  3DXS X;  3IG1 A;  2KYX A;  3M2R A;  3QYY A;  5HAN A;  1DCH A;  3TOQ A;  2W2Q P;  3KG1 A;  2C1E B;  2B6A B;  1I6H K;  5L39 A;  1U8S A;  3LA0 A;  3T1H F;  3DMJ B;  1XXC A;  3CUN A;  1DAX A;  2UU9 J;  4ZVO B;  3D5M A;  4ERD A;  3NGU A;  2VG6 B;  4UZC A;  5C44 C;  2VQF J;  3LP2 A;  1IXK A;  4F4K A;  2CZV C;  1EJ7 L;  1FXL A;  3GV5 B;  4JI1 J;  2HVZ A;  2DO0 A;  3BGL A;  4OIN A;  3N6M A;  1PO6 A;  1DZ5 A;  1VRU A;  2ZE2 A;  1YBT A;  2JLG A;  1CSJ A;  4I1T A;  3SZZ A;  4O3Q A;  3M6V A;  1UFW A;  4JI5 J;  2XMA A;  3ZNU A;  1VQ8 S;  4RPF A;  1WSV A;  4XIU A;  1NEE A;  4HT7 A;  2DO4 A;  2MGZ B;  2FJX A;  3TJ9 A;  2MKI A;  4A3G C;  3H59 A;  2ZBP A;  1P27 B;  4FF3 A;  5ADZ A;  4GTL A;  3BZQ A;  1FE0 A;  2WK4 A;  2AU0 A;  1C0U B;  1R0A A;  3G6X A;  2G0I A;  4LUB A;  5ETK A;  2MKC A;  1SQF A;  4WXO A;  2CNK B;  5L9X A;  4A93 C;  2B4P A;  5B09 A;  1U6B A;  3Q3Q A;  4ZPC A;  3QQC D;  4DL2 A;  1F3F A;  3OL6 A;  2KM8 C;  4NYZ A;  1BC6 A;  2XY7 A;  4ELV A;  3FQL A;  5BYR A;  3POT A;  2JC1 A;  3LAL A;  3JSR A;  5A6P A;  4CIO A;  4MFB B;  1FK9 A;  4DQI A;  1RT3 B;  2VU5 A;  1YHQ S;  4C11 B;  5L1J A;  1RHK B;  4G1I A;  1YJW S;  3GYG A;  4NRT A;  1S0V A;  1VC5 A;  4ZJQ A;  1WKL A;  4M5D A;  4KO0 B;  1J5E F;  4F8R A;  1G4C A;  1HNX J;  3MTJ A;  4ZP8 A;  2CXE A;  4HI2 A;  2DNP A;  4OX7 A;  4O4R A;  3MFI A;  1ZET A;  4P7V A;  1VQ6 S;  1SMY A;  2G2Y A;  5K8O A;  1XER A;  4FYW B;  4KAR A;  3DOM A;  4RBT A;  1YZ7 A;  2JRS A;  3JSY A;  1MWQ A;  3M8R A;  1F2G A;  1TL7 A;  3GEE A;  4PG6 A;  4DHV A;  4A3M C;  4DR1 F;  4FNH A;  4PCQ A;  4MKY A;  3FOE A;  2HVD A;  1HBN B;  3BS9 A;  3W2W A;  4X4P A;  2BAN A;  1JMT A;  2YXL A;  2W7P A;  3W9H A;  5KFK A;  3BBC A;  2MQP A;  1T11 A;  3MUT P;  2XTJ P;  3SFG A;  4O44 B;  1KSP A;  4XCH A;  2GJI A;  3G71 S;  1RDR A;  3A4T A;  1JLC A;  1IWA A;  5ETQ A;  4RNF A;  2FVQ A;  1VC6 A;  2RS8 A;  4LR7 A;  3ILJ A;  1U26 A;  3NGR A;  2VFT A;  3FFI B;  3UN5 A;  3V4M A;  3ZTS A;  2WBM A;  4TLQ A;  2RGR A;  3HT3 A;  4NYP A;  4NXN F;  3BSN A;  5C24 B;  1GMW D;  2AZ1 A;  1GQE A;  3QGH A;  3A8J A;  1YK9 A;  3I87 A;  1UW9 A;  1IM6 A;  3DM2 A;  1UVI A;  1FRL A;  4RBV A;  1HW8 A;  3T1Y F;  3GJQ B;  3S2H K;  5DLF A;  3CJ4 A;  2GFF A;  2OEM A;  2AQ4 A;  4KPC A;  3Q8S B;  1M90 T;  1VRT A;  2EBG A;  1WHW A;  2IJN A;  2ZKT A;  1NND A;  4TN2 A;  1RYS A;  2DXD A;  2HWT A;  2FLL A;  3CB4 A;  3SFU A;  3H3V D;  2XZD B;  1M5O C;  4GO7 X;  5DM7 Q;  3T3F A;  2CYY A;  1HWJ A;  4HI1 A;  2JWN A;  4LRC A;  5T7L B;  3M6U A;  2BJ8 A;  4LF5 J;  5U47 A;  3UVJ B;  1IE0 A;  1O24 A;  5F8J A;  2I1R A;  3OFE A;  3VR1 A;  2FIU A;  3K2Y A;  5T14 A;  3BGR B;  1FDN A;  4B9S A;  1NKC A;  3C6T B;  1E6Y B;  4CI0 B;  2NVX K;  2KXH A;  2DGQ A;  2CVE A;  3HOZ C;  1RJJ A;  1X0P A;  1N33 F;  2LQB A;  3EDQ B;  1KON A;  3BYP A;  3TQE A;  5T7L A;  2C2Z B;  1FD2 A;  5LL6 d;  4R8U B;  3GV7 B;  4DJB A;  4DL0 C;  2ZM6 J;  1U1K A;  2C2E A;  5I42 B;  1Q4R A;  1A6L A;  3UR0 A;  2B63 K;  4FZV A;  2R92 K;  3W5Z A;  2FLO A;  3W60 A;  3KDO A;  1X5O A;  2Q79 A;  3BRE A;  1S1U B;  2XLJ A;  2FVS A;  4NZ6 A;  2AYG A;  1SL1 A;  4WKR A;  2CJY B;  1LKZ A;  3ENV A;  2ZNY A;  4IQX A;  2CQD A;  1HPZ B;  2WZ1 A;  3Q83 A;  2DHA A;  3TEG A;  3KK2 A;  1RU1 A;  4F36 A;  1S1V B;  1EZZ B;  2OSQ A;  1IKW B;  4M5H A;  4HHU A;  3WDO A;  4ECR A;  2E5H A;  1T9U A;  2XSF A;  3ISN D;  4ZPT R;  4P75 A;  3S17 K;  2KT3 A;  3C6U A;  4M5K A;  2VG5 A;  4XLP A;  1U02 A;  3CW2 C;  3OSN A;  2L41 A;  4GTC A;  3LAJ A;  2IDL A;  3R8Y A;  2JA7 A;  1U0H A;  3OR1 A;  2J7U A;  1V5I B;  4LF7 J;  2LU2 A;  2UP1 A;  2C42 A;  3VTI A;  4DFM A;  3HPO A;  4DQP A;  4JI7 J;  3MML B;  1RTI B;  2HMI B;  1SB6 A;  5J1E A;  5IC4 B;  2CQH A;  2JVR A;  1F93 A;  2KXN B;  2PMH A;  3CUL A;  2AEM A;  4LIW A;  4WZM A;  4MKV A;  1R27 B;  3KUG A;  5KFS A;  4QCL A;  3T1A A;  2PFD A;  5H9F K; 
#chains in the Genus database with same CATH homology
 3GIR A;  1VLO A;  3TTG A;  1WSR A;  3GEH A;  1YX2 A;  3GEE A;  4PAB A;  3TFJ A;  1XZQ B;  1XZP B;  3A8K A;  3AD9 C;  1WOR A;  1PJ7 A;  1X31 C;  3GEI A;  3TFH A;  5L46 A;  3A8J A;  1WOP A;  3AD8 C;  1PJ6 A;  1WOS A;  3AD7 C;  3A8I A;  1VRQ C;  4P9S A;  1WOO A;  4PAA A;  1V5V A;  1PJ5 A;  1WSV A;  1XZQ A;  3GSI A;  1XZP A;  3ADA C;  2GAH C;  2GAG C;  3TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...