2GAGC

Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gagC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gagC01
1X31C 3TTGA 1PJ5A 3TFIA 1PJ6A 3TFHA 3A8IA 3AD8C 1XZPA 2GAHC 1XZQB 1WSVA 3GSIA 1YX2A 3A8JA 1WSRA 1WOOA 1V5VA 4PABA 1WOPA 5L46A 2GAGC 3GEHA 1XZQA 4PAAA 3ADAC 3AD7C 3TFJA 3A8KA 4P9SA 1VRQC 1WOSA 3GEEA 3GIRA 1XZPB 1VLOA 1PJ7A 3AD9C 3GEIA 1WORA
chains in the Genus database with same CATH superfamily
2MKKA 1JLGA 2KH9A 5C3EC 5KFRA 2V4RA 5CQGA 5F41A 1IBMF 4AYBL 3GIRA 2EFPA 4EZ6A 2R7ZA 1YBTA 2DT9A 3JTOA 3S6EA 4I7FA 5L38A 3J7YI 3H42A 4AL6A 2HQGA 1VMBA 2B3TB 1BUXA 1UJ5A 2CQ1A 3BYPA 1XMOJ 3NGUA 3TUIC 4HACB 4MJKA 3Q8UA 2C22A 2BJ7A 1C1BB 2AT1B 2PA8D 4ED5A 4ELTA 3CD5A 3OVAA 5IYBC 3FEZA 1XTZA 2WZ1A 5D4OA 3RB0A 2KT2A 5T41A 2LU1A 1VS3A 1XXAA 4A8OA 1T9XA 5JFEA 1ZAVA 4RNHA 4GKKJ 3VAMA 5EUHA 2UUAF 3G2XA 1R0BG 1NKCA 3NBPA 3P6YC 1YTYA 3M6WA 2AJ2A 5L1IA 2EBBA 4BBSK 2YWGA 3ULHA 5EX3A 3EQLA 1T03B 1YJVA 3M2RB 5KFHA 3GIKA 4OX6A 2LQ8A 2QN6B 4ECUA 4M5DA 3KDNA 2QSFA 4Y2MA 5A2QU 2F7VA 4F4ZA 1UCNA 1JVIA 3C15B 3H2UB 2W2NP 4DV0F 2R93A 2OD4A 1NK6A 2E1MC 3BN4A 1PILA 3KLHB 4J9KA 2WB1L 5M3FK 4DL0C 5C24B 2WAQD 4EFAC 3CE8A 3P8BB 1TP7A 2DR5A 3ERED 4QIFA 1IKYB 2UV8G 5DO2A 1D3WA 1EK8A 2OD6A 4C0HA 4AYBD 2ACMA 4CLPA 1WHXA 1R0AA 2NLWA 4J9OA 2O5JA 4O4RA 3GTLC 3JB9k 2I8EA 3THTA 4ZN3A 2ZDPA 7FDRA 4CP5A 4DR5J 4A47A 3GYXB 1JJCB 3LAPA 3MTJA 1JXLA 4DR6F 3OREA 2KXNB 5J2QA 3M8ZA 1RHKB 5DDPC 4G1QB 2E29A 4Z7YA 1U26A 1ROFA 1B0TA 2CXEA 3PYGA 2MZQA 5IV3A 3C66A 1T9VA 3HOVK 4AH6A 3TFJA 4TYBA 2UXCJ 1WI6A 4DV5F 1WORA 1WG1A 2BE9B 2A6HA 4JI4J 4R25A 1HFEL 2EI5A 1S9FA 2VQEF 5D3GB 2VC1A 2HMIA 4C2MK 1OO0B 3SYZA 3UCUP 2OPPA 1S59A 2LP4A 1VHFA 5KFWA 4KMUA 5DZ6A 2RU3A 1YJTA 5DQGA 3D67A 1UKUA 4D3GA 2HAIA 4F3OA 4M95A 2L9DA 3GTQA 1GFWB 5E3RA 4YR2A 1VIOA 4CYUB 5E68A 5A76A 3DHWC 1CC7A 3HK2A 2V0NA 3S1QK 1LOUA 2NPIA 2ZHOA 3DOMA 3IO1A 4S0MA 3GJQB 3MEEB 2AP6A 2J9DA 5IP7C 1JLBA 3CCLS 3I0RB 1FRIA 2IAJB 4M5LA 4Y00A 1RWXB 2H3EB 3CCVS 1HNIB 4ECTA 2P9CA 4Q7AA 5KG7A 4O3PA 1IQTA 2DY1A 1IKXA 4B3TF 3J7YU 2QA1A 4G1PA 2OH2A 3R6GB 5SZTA 2VKZG 1KN6A 3M9MB 3CIMA 3W2VA 4XPEA 4X2BA 1S1XA 1H74A 4WFZA 2YH1A 1TUWA 4WBFA 1WHYA 3RYLA 2F8EX 3MR5A 2RDJA 1S49A 1Q0NA 4CLFA 2QGFB 4BWJA 4TKTA 1S0MA 1Q7LB 2V67A 1IS1A 2EK6A 1DZ5A 2FUG9 4ETXA 1B7YB 2KJVA 2RS2A 4MFBA 2ZNZA 4BY7C 5CYQA 3MAAA 2M88A 3CCWA 1I3OB 2ADBA 4BHQA 5D4LA 3Q2TC 2DNMA 3I6PA 2LEAA 3PX0A 2OJ3A 5KT3A 3X1LB 3K17A 4QR0A 1SC1B 5BXIA 4BBSC 4M5NA 1VQOS 4A3DK 3OR2B 5C5JA 4BY1C 4GVBB 4I6YA 1ZTWA 1SUQA 2HQIA 2EFNA 4P52A 4BDPA 2NXJA 1XMQF 2W4CA 5E7OB 3R6LB 2BQRA 4CI0B 3PTWA 4NXNF 2J6TA 2QLJB 1HNZJ 3VGSA 3CPWR 1GTEA 3KK1A 2FVPA 1SC6A 3Q8SB 3MAQA 1IJFB 2MKIA 3D3CJ 1VQ5S 1S1WB 4R0EA 2MKHA 4DS4A 1G2EA 1U45A 1TKTA 4DF4A 5I42A 3ILLA 4ZLNA 5GAEI 2IJNA 4QJVA 4B9UA 4PG6A 5DGBA 3RB3A 3L9ZA 4PRFA 1SCJB 3MPVA 5CXTA 3QGGA 5KFLA 1BS2A 4WK3A 1UW4A 3ILOA 3K57A 1WOPA 3C6TA 4NCAA 4ER8A 1LWCB 2NZCA 4M94A 1U02A 5I3UA 3TWZA 2M2BA 2HVHA 1RWKB 2XNQA 1WDTA 5HANA 4A3LK 4CZCA 4B02A 2DXDA 1KRPA 2B0GA 4HH1A 5DGAA 2NZ4A 2V4JA 2HLUA 4WU3A 3HD2A 4AD6A 3CQZK 2HS4A 4LF5F 3P3DA 2ZH7A 1ZAXA 2XS2A 3PFOA 4J5OA 4DG1B 1SVDA 4MK8A 2Y0SD 4CNZA 2Y8WA 5EX0A 3KUEA 2UXBJ 2W4PA 5HI7A 4GKKF 4PR6A 2XB2D 3WZ0A 3PW7A 4X65F 6FD1A 1EJ7L 3PKMA 3GZ7A 1PAUB 1WC0A 3VAHA 4NE9C 5KFKA 1N6QA 1W2BR 4RUHA 4NZ7A 1RT2B 3D3BJ 2A6OA 3HZGA 1F2HA 3FZBA 4J9MA 3HOYC 2DR9A 2RQCA 1HA1A 3NOCA 5DETA 1N56A 3GV5B 2CNKB 4TY8B 2QMXA 2FQTA 2HBYB 3MFIA 5J1EB 1HWJA 3TA1A 1IBMJ 4PABA 1RKIA 3BP3A 1HBMA 3UDVA 1N88A 2LXIA 5SUHA 2WW8A 5J2NB 5CYMA 1EFWA 3TVYA 1NKEA 4DR4F 4Y6IA 3GIJA 3ILIA 5IYCC 2A69A 4PWWA 1FVQA 1SQEA 1NK9A 2QZ8A 1ZBSA 1HBUB 1HQ2A 3M8WA 4A3DC 4OZNA 1S76D 1S6QB 2OEMA 3MZIA 4GTDA 1SIWB 2R7XA 2E5LJ 1JWWA 2VUMA 2V8PA 1FK9A 1QAIA 5H9FJ 4WE1B 4AXJA 4IFYA 3G6YA 1XC9A 1KQGB 2DHXA 3HVTB 4V19J 3A12A 2RDIA 1KP6A 3ZZUA 1Q8KA 1UW9A 4L76A 4LFBF 1NJZA 1JLCB 3BDEA 1JKHB 2CJ9A 2GHVC 3LP2B 4L3KA 4F4KA 1LNQA 4WJBA 1O2FB 4LFCJ 1NHVA 3KK3B 4YB5A 4C3JC 2Z2ZA 1TAUA 3A8IA 1UMJA 3BQ1A 1ZAWA 1RWMB 4WXOA 3HM9A 4Y52K 3VALA 2DK2A 4PQAA 5F0WA 2VONA 2EC0A 1FDAA 2DRAA 2IM2A 2R8JA 2ZD1B 1F1BB 2E1RA 2QC3A 1KS2A 3ZZPA 4WKYA 2AKWB 2D74B 1ZA1B 1NSPA 4OHXA 1H98A 4DCJB 1PO6A 3RZDK 4LK1A 1PCAA 5LOQA 3DKDA 3MEDB 1SFOC 5KAKA 1WF1A 3TFHA 1YJRA 2L08A 1RTIA 3SSQA 1C0UB 1OY8A 1TAQA 5AXMA 3PRVA 3LQVA 4ILMA 2VG6A 3BBBA 3FK4A 1RTDA 3NGRA 3HHNB 1S1XB 1OSDA 4NLUA 4H4MB 3DRXA 2JSXA 3K8WA 2JA6K 5F0UA 1RWPB 1KVKA 4CO3A 3OL7A 1OQ6A 4GTBA 2E9ZA 3VA7A 1N33F 4RBTA 4E2FB 4ZVRB 1RTHA 2RIJA 3KYLA 2RS8A 5GMEA 3D6MB 3KKFA 4N8NA 4H4MA 2V2KA 1U25A 2V68A 1A7GE 3QO9B 2B56A 1KQSR 2V9KA 4DX5A 5DM7Q 3UDEA 3MR6A 3JSYA 4JI0F 4BCAA 4IOAQ 3FBCA 3A3NB 1P1TA 1HBOA 3TO8A 5K8NA 3QZ8A 4DV3F 1JLFA 5F3TA 3HFZB 2JA6A 1IJEB 3DLGB 1RWWB 1URRA 1L3VA 5H9EK 1P6TA 3SQGA 4ZKAA 4Y2CA 1KVIA 4DFMA 2GAHC 4MT1A 4A3EC 2IC3A 2W8LA 1EKRA 2ZFHA 1BQMB 4K0KJ 5TMFA 2W1BA 5C24A 2MJNA 1MW7A 2DNKA 2ZVIA 4X84A 4PZVA 1I50A 1UA1A 3O8WA 2DHAA 2G2ZA 4F2RA 3ISZA 1RWNB 1FKOB 1YI2S 4C8MA 3MCOA 4OIPA 3PVXA 2D3OR 4WP3A 2ZH5A 3NCQA 1XERA 4J9VA 2HWIA 3AXKA 1N54B 1S48A 1YJ7A 2BA9A 3HULA 1O8BA 1HPZA 4PXDA 3NOGA 4DV1J 2N4CA 2GIRA 3VGUA 4ZVHA 3LWLA 4FP9A 1YITS 2XY5A 3PJXA 5EGEA 4CTAB 4UOGA 4TQRA 3KLVA 1FDBA 3WX8A 2UU9J 3H0GA 2VG5A 4LF9F 4KGKA 2XCRB 1MWYA 2QTWA 2HWHA 3DNCA 4TN2A 5AE2A 3FCWA 1RT7B 4DV0J 1FKPA 1M5VC 2R7VA 4DX8H 4KY3A 4O44B 1Y11A 2EXUA 2DO0A 2IC3B 3K5PA 2CFAB 3I9V9 2K3KA 2BJEA 1TK8A 4G65A 2AQ4A 2ZUFA 2HG4A 2AHOB 4CLWA 1HW8A 1L3TA 3QSIA 3HI9A 1CJVA 3JQKA 4RL1A 4F4WA 2JHEA 2Y3PA 4NLDA 4PPDA 3ZZTA 3OTOJ 3U1NA 4FS2A 4ZCLA 4QYRA 1I6JA 4C8YA 1RISA 1HLWA 3QO9A 3IAS9 1U8WA 3ZTSA 4FBTA 2PIIA 4Q4ZA 2P9GA 2NSCA 1PJ7A 2BXJA 2G13A 3IBWA 3MCNA 4ZPVR 2JEJA 3K5MA 4NOHA 4RO0A 2VZ9A 5AXNA 3SI8A 2RJZA 3BZQA 2KVQE 3MEKA 1H2TZ 2MHEA 5G0RA 4DUZJ 2HHPA 2Q6CA 1C0UA 1LV5A 2HSEB 1KOOA 1RT6A 2QYGA 3FKIA 1YQHA 2ROGA 3UVJA 3OTCA 3CDWA 3J80U 3AB2B 4JOUA 1EKSA 2W9CA 3DU5A 5D0GA 4AL7A 2F9DA 5LT5A 2MKCA 4IH7A 3V4GA 3DDNA 4ZK7M 5DRKA 5C7PA 3BPDA 4J3NA 4ZHRB 5FIIA 1TWFK 1JNRB 4DHVA 2MMYA 1C1CA 1I6HK 1T05A 1HKAA 1IKYA 1B0PA 2XYHB 2ASJA 2HNYA 2DNZA 3TW0A 2MQMA 1NJIT 4F3QA 4F2SA 1Y3JA 2R2RA 2FTRA 2FC8A 1FWLA 4OYOA 2HMIB 1PGZA 1K1SA 3CJTA 3RAQA 2EK1A 4M1KA 4QPXA 2EC2A 4M63A 2AW0A 1YJNS 1HHQA 3T9ZA 3C16B 1SQFA 2UXDF 3MMAA 3H5XA 3RGIA 3H3VL 2W7VA 2CFXA 3ZTRA 4GT9A 1LQ9A 1HNWJ 4ECSA 3IMQJ 3AD7C 3H7HB 2YX7A 2Q43A 3MXHP 1X4FA 3OLBA 2IVFB 3W8PA 5J1NA 2IFXA 1USMA 2WOMA 4A3EK 2ZVSA 4UOCA 3AOCA 3C16A 2QV6A 4NLTA 8AT1B 1RAHB 2MLXA 1FRLA 5EWGA 3BQ0A 1YHQS 4YUDA 1X4EA 3H3VD 2HHHF 5ETLA 4B9TA 2GVZA 2YPYA 3OR2A 4ZITA 2DR6A 4BXXK 2J7WA 4DCPB 2J9CA 1Y00A 1KC8T 4DPWA 1NK7A 1WELA 2D3UA 3D7SB 2BW7A 5ETNA 2MY8A 1S7IA 4YFUA 3QT8A 3H0GC 3WC2A 1NK4A 4H4OB 2IVYA 2P2CB 4LF4F 4CLZA 4GTLA 4FYWB 2XMWA 3W62A 1GT8A 3M4XA 2X1GA 2GJFA 7AT1B 1XR6A 5HQ8A 4PG7A 5CYJA 3K5NA 5D8HB 3R7NB 5T7LA 4KE5A 3ZZ0A 3NMAA 2IYGA 1J5EJ 1RTJA 1WEXA 5IXUA 4C97A 5KG6A 1IW7A 2KO1A 3H25A 5ETOA 1GH8A 2Q66A 1WNEA 3H5YA 3W5YA 4CYUA 3DRYA 2HGLA 4I67A 3OXGA 1WOSA 4X6AC 3CW2C 3RR7A 2HLTA 2VD3A 2RDDA 3CJ3A 1WCMA 1PBUA 3AJ1A 1BXNA 1B3TA 1LFWA 4IDKB 2R2SA 5ETVA 2MHNA 1NB2A 4ZHRA 1REVA 3TFIA 2QRRA 3ETMA 1TMMA 3MAHA 4DDFA 2BJ1A 1QTNB 1X4HA 4DUZF 1RP5A 3W65A 2RAQA 1H0HB 3AOAA 2LU2A 4ZDNA 3WIVA 1CJUA 3MMCA 1UAWA 3R1LA 3B4MA 1M5SA 4QCLA 3MM9A 2B4PA 4KQZA 3GU0A 3MURP 3ZXWA 4P6QA 5CYMB 1RT1B 5I3UB 2M4MA 4F0MA 4K4XA 3ZTPA 4DV4F 2M52A 2XLKA 4Z7CA 2WSCC 1XNQJ 2RT3A 3WX4A 3LPXA 3KNGA 1RDRA 3TTGA 2JA8K 5IORA 2CG4A 1O29A 4L3NA 2X1AA 1K83C 1Z2LA 2HVDA 3NS6A 1J27A 1NHKL 2R7OA 3LAJA 4B9MA 4BLGA 3FHZA 2IBKA 4IG0B 2BKOA 3NS7B 1URNA 2QMWA 1S1VA 2MGZA 4OHYA 3R5GA 4U8YA 1U0HB 2WVEA 1JOEA 4MIAA 2VPXB 4A3MC 3BN7A 4DR1J 1HHTP 4MK7A 4KAIA 2DBBA 4FPRA 2MSTA 8ATCB 4B3OB 2JA5C 4N76A 5E3QA 1R9TA 1FHTA 1N36F 2E2IK 1X9MA 2FGCA 4OI6A 1IR0A 4JBCA 5BYSA 1FFWB 2CDQA 3QRRA 1Y1VK 2J8SA 4C45A 1B99A 2ZH9A 3W9IA 3I5BA 5IP9C 2R8KA 3NL0A 2J8AA 4F04B 5AE3A 1R31A 4FF1A 4J90A 5HL8A 1IBLJ 5AE1A 4NLRA 1JX4A 4HKQA 1ZZFA 4NA3A 4I1TA 5J2PA 4WP9A 2VPWB 1F5AA 4OI0A 4HYKA 4YDDB 3EVMA 3UN2A 3TAMA 5GAHI 3FNNA 4DU8A 1Y5LB 4JK1A 4PXCA 1PYTA 4LLGA 1YNNA 3CO0P 2FZCB 3KLFB 4X66J 3EPGA 3IXQA 4NASA 4URGA 5BYRA 4DLEA 3S2HK 2GJIA 3ZTQA 2MDAA 3KOAA 3I56S 5ETMA 2C3PA 5M3MK 3CQZA 4KATA 4Q2LA 3LWMA 3E8OA 1TV6A 4YB1P 4N41A 4P73A 3CSKA 5KFMA 4LR9A 1GX5A 1Z4UA 3RZOK 2G9OA 2HFZA 4NWBA 2BE7D 1O0PA 3JSMB 1FVSA 3CQZC 2YX4A 4RW6A 1KVJA 1HWUA 2GVZB 3FRYA 1WKLA 3IRWP 3GILA 2CA9A 4RKUC 2YWEA 3CC4S 2LA4A 3EVWA 4QIGA 4A3LC 5IFMA 2PD1A 3BKUA 3T41A 3DRPB 1DLOA 3MR3A 3PW2A 4FYYB 2H4WB 1TWCK 3H98A 4K2XA 2AX0A 2BJ9A 4DV4J 2EKYA 4HHUA 1R89A 1C0TB 2JZ5A 2UXDJ 4ANEA 3WQPA 2CQ3A 4JI3F 3TAPA 1YZ6A 3TX8A 5HSPA 1U1QA 5AJ3F 1APSA 5GAEU 2ZZNA 1DY3A 2GZOA 1NJWA 4OHVA 2XYPB 4O4GA 1EQRA 3HVAA 5IT4A 3EZ5A 3RB4A 5D4PA 3GEHA 2GV1A 4OJ1A 3PW4A 5GADU 2ZBRA 4JI0J 2A2CA 2KM8B 1VQLS 4C98A 4CT9A 3QGIA 3NCRA 4JI2F 3S1RK 2X1FA 3ELHA 1HWLA 1I3QA 1FRXA 2M0GB 4GMKA 5DZ7A 1RT4B 3K5OA 4RW8B 1KEKA 4ECRA 3A3PB 1PC4A 4AT1B 4IH5A 2QL5B 2KJWA 3MEGB 2UV8A 2N7CA 2XLJA 1XZQA 3O1LA 3QJJA 2DNYA 3UN5A 5KT6A 3AH5A 1UP1A 1T11A 2BDPA 2JNJA 2HVZA 2R8HA 4Q8FA 2GMLA 3T00A 4C8ZA 2BMBA 4WFXA 1WC4A 4DV7F 3C6UA 4JI3J 3D2WA 3I55S 1WCMC 3DLJA 3PCOB 3QJLA 4P2XA 1HWKA 1BMQB 5U47A 5DG9A 3L4KA 2FHMA 5A0YA 1HI1A 1YNJA 2FVCA 1VGYA 4ZVTB 1IKWA 4AXIA 2D3O1 2DXFA 4BLAA 4FYDA 4X64F 4A3FC 5HMWA 3KG1A 2RRNA 4GC6A 3Q2SC 5B0CA 3MGJA 3I4NC 1YDLA 1CJVB 2ZH1A 2J0SD 2NPFA 2B5JA 3RB6A 4M5DB 2EVZA 3R5DA 1U0SA 4G1IA 2PMZL 1DQ8A 3CDBA 3BDPA 3U7JA 5IC4B 3PV8A 3O2IA 1EI6A 3GTKC 1WOOA 3EZUA 4U9RA 2RU9A 3S17C 3TZYA 4Q5SA 1N4LA 3U1MA 5CHPA 3E01B 4Y7NK 1CJKA 3UR0A 1JLEA 2FLLA 3OJUA 2LDYA 1TUGB 3D0HE 3JXOA 3N6NA 4DZ6A 1RAJA 1S6QA 5HVFA 4NEZA 1HBNB 3OXFA 1N34J 2V6SA 1SL0A 4ES2A 1OMSA 1RSCA 3PO3K 2AYBA 1HIYA 4DQRA 3CJKA 5KFNA 1NZ8A 3SV3A 1IBLF 3NGKA 1F60B 2XMUA 3DXJA 1CLFA 1U0HA 2DKOB 1SJ1A 3HOVC 2RQMA 3S17K 2AJ4A 2QMUB 4NLPA 2BJ3A 2KN4A 4ANCA 4YR0A 4GKJF 3DXBA 4M5IA 3O5TB 2XNRA 1SKSA 2NXNA 3GFZA 4WXWA 4FF2A 4DR1F 4YG2A 2E7XA 5DJBA 1M5PC 1NB7A 2NVXA 1H38A 2RUGA 4A46A 2LMIA 2KXFA 4ELUA 3J81U 2KYXA 3DM2A 5IT0A 3OTDA 3CC2S 3CCES 2E9TA 3VVTA 3Q3QA 1D9FA 1R6YA 4FZBA 3BH6B 4V1Ak 1YIJS 1D9AA 2EWHA 2W7AA 2HYIB 4CO4A 3CCRS 3C14B 3RJMB 2ZDOA 1S79A 5B08A 2JH3A 1F6TA 2JRSA 4KO0B 4UY85 3M6VA 2VOPA 3W63A 2EG1A 3CCZA 4KV8B 1OSCA 4J91A 2E2HC 4TLQA 3C6TB 2VU5A 3S14K 4XAKA 4ZVSB 4WKRA 3S2DC 4A8MP 1T3OA 2ADCA 5F8LA 1RABB 1WSVA 1HI9A 2G2OA 4G6VB 4K4VA 2FQOA 4FNIA 2VFRA 3BB5A 4WCEQ 2KZZA 1O2BA 3HOYK 3GTMC 2FJAB 4N7TA 3DRSA 2PO4A 2UUTA 2K3IA 2IRUA 2HVIA 4NPOA 4G3IA 1TKXA 2XMAA 4ICLB 3OQ2A 1SH3A 2DH8A 3NBPB 3CCSS 3SZYA 2KDOA 3HSDA 3DC2A 1R8BA 5JVHQ 4XLNA 1KONA 1QE1B 5FLXU 4QR1A 3BBFA 3QFHA 2JEFA 2OMOA 1UFKA 2DNOA 1H2VZ 5KT4A 3O3LA 1VQYA 1T02A 1T7PA 5LSLA 4R5PB 1HNZF 4RUCA 2B63C 1BGWA 4HTIA 2Z2YB 1A9NB 2F65A 2V9WA 3J80Y 2AD9A 3OL9A 1UEUA 3TUPA 2GW8A 1YKWA 4DUTA 3US5A 1XR5A 5F8NA 2RILA 5C3EK 3E01A 1JLFB 2YQ1A 2BUNA 2CJQA 2Z8QA 5ETSA 3I87A 4A3GC 1ZM9A 2ZC4A 3ZZZA 1H6KX 1B4AA 3CD0A 1JJ2R 3RZOC 4NLWA 1OPZA 4LBHA 2QL7B 3NCPA 2PA8L 3Q8VA 5KG1A 3QLHA 1EAYC 3AJDA 1YJUA 4J7CA 1U1RA 2QX0A 1QSSA 2IA6A 2DGSA 2F9JA 5KG0A 2OPSA 4DPXA 3HKZL 4RLEA 3GSIA 3JQJA 4IG3B 1JQGA 2EFQA 2OPRB 1GAOA 4CNYA 4J37A 3DRSB 2CPHA 4JV5J 4ZP6A 3TJAA 3TAMB 4LF6J 1GMUA 3GIMA 3SXLA 2W9CB 4BY1K 2MGZB 2O1PA 5C2GA 3D0IE 2UVVA 1H3DA 3CJ4A 4C8OA 1ISEA 3S14C 3MEGA 3SCIE 2PDAA 3BM7A 3PO2K 1TKXB 1IBKJ 3MMBB 4JI4F 4F50A 1XWLA 3MD1A 2KB2A 5K9FA 1LW2B 3HP6A 3OFEA 1U6FA 3EICA 4X65J 5EGHA 3GTPC 3MPDA 5ETKA 4F8RA 3CMAS 3EPIA 5FDLB 2JFDA 3C19A 3K58A 2K8GA 3Q24A 5CHCB 4JYAJ 5HP1A 2C28A 3GYGA 4UQTA 5C42B 3HHLD 4DMZA 2EPIA 2JVOA 3EJMA 4KN4A 4W98A 1S1UB 2IRXA 2HHQA 1RACB 3KJVA 1DCHA 1TV6B 1TFYA 2AEJA 1DJ0A 2DY9A 1P27B 3NGDA 4NLQA 4YP3A 3ZTOA 2ZUAA 5IWAJ 2HZCA 2V34A 1U1PA 1SMYA 3QWPA 1OIAA 3PJWA 1U09A 2R3VA 1FCAA 4EBCA 2DEJA 3VF0B 3UD5A 3Q0AA 2CPJA 3H0PA 3A3OB 1KTQA 1YRUA 1PBAA 3C6UB 3OL8A 2FVQA 2VUMK 1K83A 2MLYA 3K59A 4LFBJ 4A3CK 1AA1B 5IYDK 2VBYA 3OTOF 2R42A 4I56A 5KOWA 3PY8A 4ZPCA 3TZWA 5KFFA 2IY5B 1MNEA 3G8QA 2MQNA 2O5IA 2PPBA 3HOUK 2AJ0A 4QYZK 1I50C 1OPIA 2QLWA 2M70A 2IVMA 5E5NA 3ISNC 1T94A 3K0JA 3W5XA 4ILDA 2HZAA 5A6WA 1Y5NB 3FMWA 5DG8A 2GMHA 1K44A 1AYEA 4RW4A 4G7ZA 1DTQA 2QYCA 3I32A 2F4FA 3J7AN 2WVCA 3OHBA 4ALZA 2UU9F 5IOQA 1C4AA 3QQCD 2QIFA 3BGRB 4OL8A 1L0WA 1KKHA 2RRBA 3G6XA 2W2PP 3M1VB 2B43A 2DO4A 2XY7A 4ITSA 2Z57B 4F7VA 3N0BA 3MECA 4YDXA 3IP0A 3EXYA 1FD8A 3UN3A 4OYXA 2WCXA 3EGNA 4U7UD 3MR7A 2YKMB 3MCSA 4IUFA 2W9BB 1FNMA 2E5HA 4I64A 4PUOB 1FD2A 2O01C 3RTVA 3V81A 2AIRB 2E2JC 2H5JB 1FRJA 4EUVA 1G6BA 4NRTA 2DGWA 4A8FA 3EWGA 4PKDB 5K20B 4K0KF 1WQHA 4TXSA 3RUBL 3ENVA 1REGX 4MMOA 3KJFB 3I4HX 3S7RA 1VQNS 5KFZA 2ZHAA 2RF2B 1H7WA 3W8GA 2G2YA 2V63A 4FKXA 1XN9A 4HEA9 5JMNA 1OQ3A 3R7BB 3TVKA 1AW0A 4A3IK 1RTDB 2VG6B 4J9RA 4ZP7A 3BR9A 2CPFA 2ZH6A 1ZZNA 1XMOF 3V4IA 3GJRB 1TKZB 3WBZA 4LVNP 4Z37A 1KDNA 1EZZB 1RGVA 1TKZA 2RE1A 2MZTA 2BABA 3VWSA 1Q1KA 3K7AK 4ZLJA 1P9QC 4WPAA 4ED0A 2C2EA 4WYWA 3ZZOA 1U7LA 1OY6A 3TNVA 4DPYA 3DLKB 4ZOSA 1YCLA 2Q3PA 2ATCB 2O5DA 3D66A 3SZZA 4LF8F 4U6PA 3GQCA 2F5GA 3FBBA 5LMUF 2DIUA 2BANB 2KXHA 2RVJA 4IRDA 1RBLA 2HEKA 2VUMC 3CMQA 4OZJA 3L7OA 2NXUA 4KO0A 2BV3A 1TWAA 1RU2A 4LSLA 4ZVPB 2FVSA 3CTRA 1O5JA 2FZKB 4KH0B 5LMNJ 4YY3J 3GEIA 5HLFB 2B6AB 4ECQA 2WHOA 3KNAA 2LQBA 2HGNA 4LF2A 3BO4A 1IL2A 1RB0A 4C3MA 1RHQB 5A8KB 4A93C 2J6UA 1BGXT 4EYIB 5EDWA 5HROB 3HSGA 4URQU 1S9GA 3HOWK 5DDOC 2VJUA 3N28A 3D54A 4KJIA 3QRPA 1GEHA 4EO6A 1X0FA 2CQ4A 3HHDA 4LFCF 4USWA 5A8RB 2CQ2A 2AGQA 3PIPQ 1VRUA 4F02A 2MKYA 2R7UA 2YWWA 4ZLPA 2B8PA 1Y7PA 1MMDA 4MAKA 4B3MJ 1TWGC 3QJPA 4WK1A 1IKWB 4CO1A 2C2NA 5CD4H 3KJQB 4DSLA 1HBMB 2JEIA 2IDEA 1BQXA 4H4KA 3HFKA 2UUBJ 3HOWC 4GRSA 2OELA 4DUYF 4EEYA 5HAOA 4Q0BA 4P74A 1WF0A 3BO2A 1YBUA 2IIHA 4A93K 2H48B 4MIWA 1LFPA 4NX9A 1NPKA 4J9UE 3FJ2A 3UWTA 5IQQA 4DN0A 1GTHA 2XO6A 4DR4J 2E44A 1RAFB 1LWEA 1TL7B 1IM4A 4L6V3 2VA3A 4MIBA 1J5OB 5E2QA 3QIPA 1HNVA 3THPA 5L9NA 5LL6d 3G8TA 2DNNA 1FJGJ 5CJ9A 4U8VA 3VAFA 2DNRA 4I6AA 1V3ZA 4YFNA 2ZM6F 1F7UA 1G3OA 2HK3A 4LF5J 2ZBCA 3FKIC 3G82B 3OHAA 5KFBA 1O6XA 1IQZA 2F3JA 2GA7A 3A8KA 3GIIA 2ZEJA 2DNHA 1Y3KA 3T19A 4C9DA 4P7VA 2C2MB 3QPIA 4I6WA 1S7HA 3AD8C 1VR6A 4O44A 3NNCA 2NQPA 4N5SA 3HVRA 4DFJA 1IE0A 5IC6B 2J0QD 1CJTA 3T02A 2PI4A 2MKSA 3P5TL 4P9SA 5T14A 3NNAA 2BX6A 5A0YB 2HFSA 1HNXJ 4CTAA 1VQ8S 1LW0B 1O51A 1ZQ1C 4A3IC 2FJVA 5IT9Y 1ZBTA 5KG2A 2LQJA 1R27B 1B4SA 2NUUG 1S6OA 4ZPTR 5MAOA 1XIQA 2QLFB 2LQ5A 3J81j 3AOBA 4JB8B 2VFVA 4DEZA 4DR6J 3BH7B 1QDUB 1BLUA 1TMJA 2DH7A 1X4GA 3M32B 1YVFA 2HURA 1XMQJ 1TWHK 3UPFA 4ZIVA 2VPZB 1UPMB 3TA0A 4J9LA 2PE8A 5AXKA 1GMWA 1UFLA 3KLGA 2DRDA 5G0RB 5CCLA 2XLIA 3S16C 2V8VA 3GTMK 3CDAA 3NAHA 2VQFJ 1INNA 2YNGA 1G1XA 4A3BK 2FD2A 3VZHA 3GEEA 4NA2A 4C48A 1LWFB 2GFFA 2MEWA 3AD9C 2D1CA 4HLBA 1QSLA 1TL1B 3PW5A 1R8AA 1RQ0A 4YN3B 4RWXA 3TOQA 4ID5B 4LJMA 1QAXA 1RCOB 1QVFR 5E3PA 4TQSA 5M5WK 3HPOA 1ZM4A 2QO3A 3N6MA 4DV6J 1FDDA 5F9NA 1T05B 4EBDA 3T5LA 4NLGA 1L3SA 3SDEB 1P1LA 4FF4A 3T5JA 1FE4A 3P45B 4LIRA 3BGFA 5KFSA 2K7JA 3J81Y 2YKQA 4OX9F 1C0TA 2CQIA 5DLFA 4NMLA 4EWTA 4B9NA 2NVXK 1IR1A 3M4OK 2R4FA 5GVQA 5CAAA 1XZQB 1YSJA 3LGMA 3ENQA 1H73A 4KKOB 3BR8A 5HATA 4F0HA 3IWLA 1CULA 2CAJA 5LMUJ 1AB4A 3R8YA 1O28A 4I2PB 3Q8RB 2ZUGA 3QRQA 5IM0A 4P2MA 2XQCA 3IBFB 3HJVA 4P71A 1WSRA 3QAUA 4C3JK 3GTOA 5KOXA 5F8MA 2HRTA 1V3SA 3ET6B 3D6TB 4IG3A 3DLEB 3GTQK 3VAIA 3DU6A 4K7QA 4LRFA 1CULB 5H1SV 2C42A 1DTTA 2Z56B 2XS5A 1NNDA 3BYRA 2A0FB 4OJGA 2G0IA 1GMWD 2LFVA 3W61A 1FJCA 2OFHX 2R8GA 2LKZA 2GO8A 5DS7A 2XHWA 1AZSA 5KG3A 2ZH3A 3DOKB 2OSRA 2R7WA 3NLCA 2KFZA 4TY8A 2MZRA 5D6GA 3OFFA 3MEDA 2DD8S 4WIIA 3GPAA 2XGQA 3V6JA 1L3KA 3FC9A 1U6BA 3GTKA 2XC9A 4B17A 1VDHA 2CPXA 2JWNA 4DPOA 1UWBA 3KJNB 2GIFA 2G1DA 4ZIWA 4P2FA 1D09B 4PAAA 4OYWA 3NRBA 4H4KC 5E0OA 3DDKA 2POKA 1VBYA 1HQEA 3GONA 3IC1A 5C4JK 2JC1A 2LXUA 2J7KA 4XDDA 3W2VB 1VIXA 2XI3A 2UZAA 2VFTA 1C4CA 4IFVB 3GV7B 4RUBA 4DCOB 2VFSA 3I5CA 3DLKA 4C3IC 3HFVA 2KM8C 1ZM3A 3BF4A 2XBPA 3LP0B 3LANA 1FXRA 2ERRA 3JSRA 5M2UA 4OYBA 4NI2A 4DV5J 1KNZA 3VHQA 2OGUA 3N4WA 3BSAA 1Q8BA 2ROPA 4OZ2A 5BR8J 4PYDA 4OI3A 5LSRA 2OTJS 4KC6A 4LRCA 3H90A 2BQUA 1U1OA 4JUZA 3NXZA 1YG0A 5E33A 2DCUB 2CZ9A 4QU6A 3BQ2A 5IWAF 1PAEX 3OLAA 1NM2A 2WONA 3FUYA 4LFAF 3HHLB 3V5RA 4DWIA 3CXCR 4UOHA 1HYSA 4C0OC 2X3GA 4HDHA 4LK0A 3SFGA 1D8ZA 3KHRA 3FSYA 3M8RA 5CA5A 1VRQC 8RUCA 3D1OA 4QW9A 2YY3A 1SUQB 2X1BA 2NXCA 4LMZA 4RW7A 2BRLA 2LVWA 1JXVA 5L9XA 2CW0A 4DL5A 4KN7A 2XG8A 4O3RA 4Y2IA 1KQ4A 3M8SA 4OYMA 3TAQA 3CJQA 3R7SB 1O27A 1FK9B 3H5SA 1XBWA 5T7LB 4GTEA 4KKOA 3RZAA 3UCZP 2NR0A 2FGOA 1O24A 3HVWA 4MK9A 1K1QA 1XNRF 4V19X 3T3FA 1NJYA 3G6ES 2AZ3A 2UUCF 2FC9A 4X4QA 2O67A 1RLCL 3LGNA 2I38A 5J2NA 1YGYA 3N6LA 3HOXC 4LRAA 2C2OB 3GYNA 4C8NA 3CC7S 2KFNA 1DTTB 4DV2J 3EUNA 4ECXA 3CD6S 3IWXA 4CO0A 3LF0A 5KFGA 4OZLA 5E3CA 3BUEA 1FEHA 1TWFA 4JI6J 4BBRC 3OEPA 1PSDA 1Q5VA 2P8IA 4JI5F 2B4UA 2BM1A 1TL4A 3I0RA 5DQIA 1F93A 3SV4A 2XMVA 1WTFA 1RT5A 1VLOA 4KGXB 2QA4G 3AFGA 1J2VA 3HXAA 1WKKA 4FXVA 1Y0HA 4F36A 1RUSA 5HMXA 3G4SS 4WF9Q 1M90T 1S9EB 1JXEA 2Y9HA 4NYPA 2H54B 2KZMA 5HMYA 5CD4A 3PW0A 3G86A 1VLYA 2GQ2A 1N0UA 3VAKA 3G87A 2KT3A 3M4OC 4OIOA 3S15K 4C11B 3IR7B 1S1TA 3QT7A 2Y3YA 3KMSA 4ZLLA 3MEEA 2MQPA 2L48A 3R9LA 5IP9K 3HKWA 4ECYA 1PJ5A 4XO0A 1NK0A 4EBEA 1Y1VC 4DPTA 5B0AA 5CH7B 4YY3F 1Q4RA 1CBKA 2HNDA 3PYEA 3G6VA 4W4MA 2HHVA 2GSOA 3J7A1 2AJFE 2GX8A 2V6AA 2O3DA 2M3DA 3ICLA 4JI8F 4ZVUB 2F4VJ 3IRXB 2A1BA 4HT7A 3ETOA 2P8TA 2D9OA 4F4AA 2EFOA 2ZITA 4ZP9A 4DV7J 3H4DA 1S57A 4I2QB 1I94J 1LW2A 2CYYA 5HROA 2VV5A 3NWGA 4QIEA 1A6LA 2HHHJ 1JLQA 3RAMA 2YX1A 3GCWP 2MSSA 5L1JA 4DR3J 4WU2A 2HIQA 4A48A 5IYDC 2JDJA 2E2HK 4DR7F 2KL8A 4KHPF 1SIZA 3MM6A 2Y0BB 4X4OA 4EK2A 1VQ4S 1Y5IB 4LSNB 1S97A 3T01A 4KTQA 2JA5K 1S10A 2DNLA 4P10A 4X4PA 2PHCB 4ZPAA 1E6VA 2X3DA 1RXOB 3R2DJ 2WTFA 1WD6A 4LVOP 5E41A 3PNIA 2XS7A 2GVDA 1U6ZA 1UZHA 5M2PA 2RQ4A 4X4SA 1UWBB 3N01A 4CM0A 2VDHA 1SC3B 1GX6A 2MXYA 3EM1A 3R5BA 2L41A 4GKJJ 4KFBB 1TWHC 2H4YB 5L1LA 1NDCA 5RUBA 1NH8A 1I1GA 3LALA 5GAGU 3GTQC 1JMTA 3VQSA 3WDOA 4KIAA 1DHMA 3LA0A 2RH3A 4DV2F 1EP4B 2FHOB 4GO5X 2QA2A 4ATNA 3MMAB 2R2TA 4OZ0A 2NVYA 1RU0A 1BC6A 2ZHBA 4TU8A 3S8SA 5DDRC 4ERDA 2OI2A 1AROP 3PM9A 3T1YJ 1R0AB 1JLBB 2E7VA 3BPSP 3PX6A 1VQ7S 4JV2A 2ZBIA 4CIOA 3HHLA 2L3MA 5HN0A 1KFDA 1VBZA 3S1NC 4A3BC 4YB6A 1OWXA 3HOUC 2UP1A 1OY9A 2M9KA 2ZUEA 2K06A 2C3YA 3WIUA 1CSJA 1EQMA 4YQWA 1DURA 2DHSA 1FKAF 2CZVC 1QJHA 4RNMA 4BC9A 2RHSB 3L7PA 2E5GA 3I96A 1S0NA 4CH7A 1XZPB 2GMJA 4RUAA 5GAGI 3ZZYA 1UJ4A 4YS2A 3KHHA 1K47A 1LEOA 1UETA 1NRKA 4C11A 4LUBA 4PEOA 4CLTA 4CH1A 5KT2A 2WVDA 4Q44A 1Y1WA 3H0GK 4GO7X 4RW9B 4RU2A 4K4SA 4IRCA 3OVSA 3PRBA 4OYPA 4KM9A 3TJ8A 4JI7J 2I5JB 4KDDA 1R7IA 4ED1A 4RW7B 1N36J 2DR8A 4C6AA 9ATCB 2ZZMA 4JI7F 1S1UA 1ZTTA 1SJ4P 2CPZA 3V6KA 4OI1A 1P8GA 3ZZRA 3I0SA 1AXQA 3D1QA 2V5HG 1F9EB 4Y2AA 4WE1A 1CS4B 2ZE2A 3SZ2A 1VQ9S 2BANA 2ZBQA 4EGLA 3EGZA 1USOA 4KAWX 3VV2B 2XO7A 1U2RA 4J9NA 1KSPA 1LW0A 4L74A 2AGOA 3HD1A 3MHYA 2V4JB 3CMES 3UI3A 1NDKA 1T0TV 1KLMB 4PXBA 3S2HC 4NYZA 5F3ZA 4QJVB 1RTZA 5KTQA 2VDIA 2OPSB 3TX0A 2XWXA 3TARA 5D0RA 1HD1A 5ADZA 2W2OP 1IBKF 2V4QA 3PR5B 2NXEA 2W7PA 2R92A 4CO5A 1VH2A 1LK7A 1RHJB 1QY7A 3FKIK 4AE5A 4FPIA 2E1AA 2WBMA 2C2ZB 3Q8PB 1PJ6A 4LF6F 3AA8A 3KK3A 3T1AA 2JEGA 2UVWA 2NUHA 2MQQA 1S0VA 4ZPBA 4YOEA 1VGXA 1GQEA 3G82A 4ZVFA 2H5EA 1DQAA 4NRUA 5BYQA 5KG4A 3GTJA 4OYIA 3AXMA 1WF2A 3PDNA 4K50A 4A3MK 4A3KC 1JIHA 2DGOA 5IOSA 1KR4A 2B4VA 1FT8A 1I3QK 3SBMA 4DDQA 1O25A 2M5YA 5LXRA 1X5TA 4UTGA 2EFGA 3C3LA 1VOMA 3MUMP 4NA1A 3GTMA 3W5ZA 3KLIA 4WZMA 2V8GA 4QR2A 3GDZA 4USKA 5AJ3J 2MY7A 2KKHA 2NYHA 3OXLA 3W1YC 1K8AT 1X5PA 2XSJB 1C1CB 2Z4PA 4C7QA 2CUYA 2AJ1A 3LPYA 2R7SA 4LF4J 1MSWD 4CLYA 2RKIA 1TELA 4GZYA 2YNHA 4K4YA 3MPWA 4XK8C 1AUSL 1RZMA 3LH2S 3KLFA 1MG7A 2DR7A 3S1MC 3KLGB 2AJQA 4B9VA 2U2FA 3TVZA 2OUGA 1JKHA 4USHA 3K7AC 1V3RA 3PACA 3MOZA 3MPYA 3QIPB 4A8XA 2ZKUA 3KXDA 4XCHA 3HLUA 2V2QA 1AFIA 1QVGR 4WIQA 2KHDA 3CWJA 5A8KA 4KM8A 4Y2KA 2ZE2B 3CJ5A 1PKUA 1I94F 2FJDB 3EYZA 2FHKA 1TWHA 2PMHA 3DLHA 3MM7A 2JLFA 3MUTP 1S77D 2GO9A 2YQ0A 5FD1A 3GTOC 1T9TA 4ED2A 2OHDA 4WJ3M 1NH7A 1TUVA 1HNWF 3Q83A 1D8YA 2FB0A 2W24A 2KTQA 2QFJA 3BGLA 4AL5A 1IQ0A 1S1VB 1IXKA 3GMGA 3BGRA 4JI5J 2YWFA 1X8DA 3W2WB 1XJWB 4NLSA 2E2JK 1SL1A 4ZP8A 4ZVQB 5B0GA 5C25B 2HRYA 4I69A 5J2QB 2ZOFA 1FEEA 1M1HA 3GB0A 4BXXC 3OSPA 5C25A 4A3KK 2VIHA 2YNIA 4MH8A 2ZH8A 4M5KA 4K5RA 2A10A 5KFJA 2VL1A 1FNXH 1ZXOA 4ZVGA 4URSA 1QM9A 1TL7A 4B08A 2DGTA 3V4MA 3M8PA 3M9OB 2ZJRQ 1S6PB 4QU7A 3GTPK 4K4UA 3AAWB 1ZYQA 3NAIA 5HVGA 1UPPA 5C4XK 3P96A 4XPCA 2AMCB 1GK8A 1EETB 3H8YA 1TVRB 3CCTA 4B9SA 3SIPB 1XNQF 2BKPA 2GGPA 3I4PA 3D4JA 5CZVA 3OTBA 3TJ9A 4DQPA 2PMZD 3EDRB 2BE2B 1MN9A 1OJ4A 4C8LA 2D41A 2GCFA 1WIHA 1S12A 3BKFA 4CCHA 2DYAA 1UEVA 3RAXA 3CJ8A 1JNZB 2J5AA 3M1VA 3GTPA 1T8EA 2I1RA 4EYHB 5IS2A 3UDLA 2WBRA 3ADAC 4Y0FA 2QFIA 3ZO7A 3I9ZA 2Z58B 3K5LA 1KQFB 5ETTA 2MZSA 5IQ6A 4MKYA 2B5JB 4UOFA 4RPFA 4G7HA 1SC4B 5K8MA 1RTHB 4M5HA 3G4AA 3B8HA 1CQMA 3A1YG 4WFNQ 1W25A 5BR8F 4KHPJ 3N5BA 4ZA1A 4B3MF 1MROB 1R0CB 3Q89A 4QWAA 1T9YA 1PYOB 2XCOA 2HS0A 1HI0P 3FOEA 4NZ0A 4ID8A 1NXIA 4K5SA 4CLSA 3GFXA 2KRRA 3UNYA 4ZJOA 3OR1A 3SSRA 4DXLA 1MU2A 5IYCK 1FRMA 1NLKL 2WAQL 2P5MA 4QW8A 4DSIA 4NOIA 2K1RB 1C1BA 2XMJA 1F5BA 5L39A 2YPZA 1R43A 2HVEA 3L7UA 1TL5A 2BR0A 2BOAA 3FSXA 2PT0A 2FLNA 4MFBB 2PEHA 5LM7E 3W9HA 5D4NA 1X60A 1M5HA 2HWTA 1XMBA 1NO8A 1IKVA 3M8QB 2KWAA 2ZD1A 4ED7A 4RNNA 2QSWA 4X4NA 1ZPWX 1I51B 2D7SA 4C3IK 1VISA 3U02A 1Y9OA 1RK8A 1X5OA 3DN9A 1Q53A 2JOQA 3O6QA 4C3KA 1FJEB 2B63A 1VK3A 4MQ9A 1QUPA 1W7WA 2KHCA 1R8HA 4USJC 4FXWA 2MQOA 1F9HA 1TWCA 4OMFG 2KU7A 3A8JA 1LWFA 1NMEB 2B7CB 4DQSA 1JJHA 1F3VA 1WTBA 1HNIA 1ACMB 4HHJA 4LSLB 1VCTA 3DFEA 3JYTA 3CF5Q 1DCOA 3NY0A 4BLBA 1SKWA 3LUYA 2QJ3A 3PYDA 1N48A 4A8SA 4MTPA 5H9FK 1YJ9S 3GWCA 4NCBA 3M30B 3FOFA 1LXJA 2BW2A 3QT5A 1RADB 4WFBQ 3NUHA 2AEMA 4F26A 1M0SA 2Z2MA 1ZH5A 4FBUA 4PWDB 4M5MA 2E66A 1LXNA 1AZSB 1V9OA 4J9PA 3VVUA 3I4MC 2OEJA 1U1NA 2R7QA 1QTMA 3QFWA 5GAHU 1FFGB 5BJRA 4C3LA 5THWA 4KGMA 2HHSA 3HDSA 2QEXS 3C15A 2BYCA 2VG7A 3DGPA 5JVOA 1WHWA 2VFUA 4C3HC 3GE9A 4XTTA 4OX9J 3MM8B 3TA2A 4LJZA 3GP9A 4OINA 1NJXA 2VF3A 3M8YA 1NDPA 2WSFC 5EWEA 5K14A 2W8KA 3NKYA 3UE2A 3PR4A 1SI9A 4QIWD 4TY9A 4OJHA 3EXCX 2RH6A 3FFIA 3FQKA 4FVCA 2M7SA 3Q23A 1X5SA 2YH0A 1C2PA 1ZPVA 3PO3C 4MYUA 1UL3A 2C3OA 2CJYB 3MDFA 3LAMA 3PO5A 2ASDA 2V50A 3BGUA 1SV5B 5ETRA 2VQFF 3M3YC 4O3QA 1W26A 2PI5A 2AYEA 5D15A 3GFHA 2LEPA 1U24A 3MD3A 5C4JC 2H5IB 4WTYA 2D6FC 4RNFA 2E2HA 2CQHA 2E5LF 3PFEA 4DR5F 1ULRA 3CNQP 3KLEA 1ZM2A 3SSSA 4YFXA 2AX1A 2GAGC 4USVA 1CC8A 2JVRA 3DRRA 2B9XA 5L8RC 3F44A 1KFSA 2EKNA 4FZVA 5HQLA 4PG4A 1ZVUA 2DGXA 5EWFA 2HPUA 1K83K 2OLWA 5KFXA 4LF9J 2EG2A 2VUGA 3BJYA 4A3FK 1NK5A 1U48A 4WZQA 4PWDA 1FNOA 2OP5A 4OV6A 5D77A 1KD1T 2XTJP 1TKTB 4NYOA 3E51A 4ZS6A 1L5UA 2EW9A 4NCGA 3OW2R 2FY8A 3T1YF 2OSQA 5J2PB 7FD1A 1AFJA 1TQLA 4N77A 3EGVA 1KLMA 1FO1A 3PIOQ 2OTLS 3J7Z5 1ELOA 2LLZA 4C2MA 4UZBA 2AYMA 4NLVA 2ALYB 3UR3C 2QA4S 1MU2B 4DFPA 3N0CA 4YHHF 2O66A 2HNZB 3SQOP 1LWXA 2N3LA 3GCXP 1JJ4A 2KT5A 3WC0A 1NDLA 1CG2A 3B4DA 3FEYB 2C2DA 2YU9K 1CJTB 3DM2B 5F8JA 2DNPA 4DLGA 3BV8A 3H5UA 3GTGK 1JK9B 5A2QY 2Z2LA 4MYTA 5G4DA 1TR0A 1JLAA 3S1RC 3HOXK 4CLKA 4C4WA 5AT1B 5C42A 2HFUA 1Q78A 2BOPA 1JLGB 1VQ6S 2GHWA 3R27A 3M2RA 4NCGB 1FWKA 4TVAB 2BVZA 3PHEA 2GQQA 4P5BA 2FJWA 5IYBK 2RQKA 2VBWA 2DITA 1VC5A 1U8SA 1AT1B 2L9NA 2OMLA 1N33J 2WW4A 2VBXA 2DVIA 2Y1RI 2JLGA 4EO8A 4LF7J 3RRHA 2UUWA 1RAIB 3AQOA 4A8KA 4CM2A 4DR3F 1WUUA 4O23A 3CCUS 3J7ZT 3I4NK 3MCMA 3OR1B 3MMBA 2A6EA 2MYFA 5F8IA 3HZEA 3D1HA 4KGZB 1REVB 2CIMA 3DDIA 1TWCC 4KYZA 4ETZA 1VBXA 1CS4A 4ZH4A 2WK4A 2B4OA 2DCLA 2XZWA 3C14A 4HI1A 1RAOA 4NXNJ 1RT4A 2F4VF 3NEKA 4U96A 3BBCA 3BS9A 1UVIA 1FDNA 4DU7A 2RD5C 4ZVOB 4CLUA 4GTAA 1TWGK 5IM0B 2WB4A 4DQIA 1Y1VA 4USMA 5HL7Q 3BSNA 3MF5A 5LMNF 2ALZA 4MEYA 2W7OA 1M5OC 2R93C 4NMXA 2ZOMA 2YNIB 3E2EA 5CYQB 2HBZB 3S01A 1Q16B 3PO4A 3UNGC 5HQMA 4OFZA 3VGVA 1WHVA 1K9MT 1FERA 4FS1A 3KWMA 2FJEB 1NU4A 3ZNJ1 4OYZA 2PSZA 3D0GE 5CZXA 5KT7A 5I4MA 2HAFA 4ES1A 3KDOA 3RRGA 1I3QC 1QSYA 2CNOB 1HD0A 2GJ2A 4K8RA 2CZ4A 2NYIA 5KFDA 1MN7A 2BZ2A 3BGOP 4RX6A 3DHXA 1HL6A 3GG1A 4KPCA 2XI2A 1ZA2B 3FDSA 4DI6A 3X3UA 4R5PA 2D69A 2KYZA 4B3TJ 4B3SJ 4TU7A 2CVEA 4DQQA 3K7RA 3OL6A 1U2FA 1FTCA 4RNOA 2IM0A 4LQYA 3IS9A 1FRHA 1NCLA 2J9EA 3TQEA 1UZDA 3CT9A 3HCXA 2UXBF 2VASA 2R7ZK 2BBEA 2BJDA 1RT1A 2DIVA 1N5YB 2GHPA 2MQ8A 2CNLB 2JJ4D 4I2QA 3TYTA 3H4BA 1LK5A 2NVQC 1YX2A 4WYLA 2FDNA 3S2DK 2VH7A 4LF7F 4KFBA 1F3FA 4YHHJ 2ABYA 4IRKA 3IRXA 5TMCA 4EU0A 4RBUA 3QLHB 2IM1A 5A8WA 1NEEA 3GG0A 4DS5A 1HQUB 1R9TC 5ETPA 2AEFA 3G9CA 2ILYA 3LP1B 4KR0B 1N52B 1A0OB 3TR5A 4RBVA 2OKQA 2DPIA 3AT1B 2RSQA 4LREA 2Q1LA 3PEJA 2R92K 1WEYA 2ZC3A 3H2VE 1MLAA 1S99A 2ATLA 2FVRA 1NPPA 1FJGF 2F8MA 2YKNA 3AQPA 2R7RA 1OYDA 2HHWA 4O0IA 4LSNA 3U1LA 2IM3A 3PKYA 1HARA 2FIUA 4DX7A 2IMWP 4UUXA 3QNWB 3P4UB 2XY6A 3JQMA 2WOMB 4RWWA 3T6JA 1EQ0A 1NPRA 1W2IA 1X9WA 3MWBA 2KRBA 2NREA 1HW9A 1RT6B 4QWBA 3PZPA 3L4JA 3TI0A 4F0KA 1NBEB 3DXSX 4WP8A 3B78A 2FZGB 4RW6B 4C8KA 1WG4A 1TZ0A 1RTJB 1FX2A 2I6WA 3QX3A 2LCWA 4ED4A 3POTA 4KRWA 1HI8A 4YFKA 4AQYF 2G0JA 1WQGA 1NHUA 1R8PA 3FSIA 1J6XA 1DRZA 2WB1D 4Q2MA 2KVIA 2XCQA 3CJKB 3LGHA 4OQJA 3NWRA 4KB2A 3AJ2A 4U67Q 3GSDA 1IM6A 1RKJA 1EARA 1H7XA 1FFSB 5F8HA 2Z30B 4Y52C 4RR5A 2HBQB 1TFWA 5C4XC 3MMCB 3DLLQ 4OX8A 3ZNUA 4L72B 1ZETA 3CGIA 5A8RA 5KFIA 1PG5B 5E3AA 4ILLA 3PEHA 2CPDA 1BE4A 1N6QB 1NUEA 1RA7A 2N82B 3GJTB 4N56A 1U2CA 4CO2A 2I2YA 4XLPA 2CQCA 4DL4A 4DSKA 2A18A 2CJXB 5FJ4A 2IJRA 4R8UB 2B9WA 5DM6Q 3Q8QB 4WTOB 2PFDA 1WI8A 2IRYA 4IG0A 4ZVEA 5KG5A 1FKOA 4FN5A 2B8QA 2LXFA 1RTIB 2C1EB 1TK0A 2V2ZA 3K2YA 3TUZC 3KFWX 3D6FB 1BWEA 3QWUA 3KG0A 4O0NA 4HVZA 4N8OA 3CJSA 1VJQA 2HNDB 2CWKA 4WFYA 2HNYB 3KG4A 4NLYA 1WG5A 3F0NA 5JVGQ 3HF5A 4GFQA 3SQGB 3HHKA 1HMVB 1QAYA 2FYXA 3CB4A 4JI2J 2BQ3A 1SH0A 3OTEA 1G4CA 3UVJB 1FKPB 3QSYB 3B82A 1CJUB 5F9LA 2GQCA 4DSEA 2LECA 5MLCV 4FYVB 5CCMA 3L3CA 1Q82T 1GMVA 2UXCF 4USUA 3C8YA 4KHMA 1HBNA 4B3SF 1Q8LA 3S1MK 5KFQA 2H65B 4NXMF 5B0BA 4FF3A 2R2UA 2PFFB 1WEZA 2BJ8A 3MM7B 3OPKA 2ZNYA 2P9EA 3UFCX 2LYVA 1X4DA 2XCAA 3JAMU 4PQUB 1R9TK 1TU0B 4IQXA 1HHSA 5ITHA 1U47A 1DD5A 4CWBA 2ILZA 3LTOA 3HJFA 3CCMS 2XSJA 4DV6F 2OO4A 3M32A 1GXTA 3HO1A 2NVQK 1HBUA 2DRBA 1D1UA 3M6UA 2CVIA 1UV7A 3V6DA 3IFEA 3I4MK 2LEBA 1TWAK 4MKVA 3TUJC 2DPJA 1YRTA 2ROEA 5GADI 1S9EA 3KMQA 3OVBA 2IHR1 5LSOA 1DBDA 4XDCA 4X4RA 2B63K 5J1EA 4FYXB 6AT1B 2XM3A 2QE5A 5K5MA 2CQBA 3R5AA 1EETA 2FHJA 1BJTA 1TK5A 2EBGA 1KLNA 3SMZA 5L46A 2CDRB 4ED3A 2HZVA 4IOCQ 3RW6A 2FJBB 2I5JA 1RT2A 2YNGB 3D9BA 1VI7A 3POTB 3KK2A 2Y1LB 1Q86T 3N9UC 2CPEA 4LBIA 1CJKB 2DNGA 1NSAA 1T03A 1WDDA 3TANA 1WACA 1HNXF 3DI6B 1U1MA 2I9SA 4HR2A 2Y0SL 4USIA 4LBPA 5B7WA 4KC5A 1GXLA 4ZCMA 1BWVA 2J9DE 1Q95G 2XSFA 3VTIA 1HYSB 1M5KC 4Y3CA 3MMJA 2JX2A 1DQ9A 3S1TA 2GC8A 1ZOTA 3FVYA 1SJ3P 4H4OA 1XXBA 4PPZA 1VRTB 1VC0A 2AU0A 3QGHA 4JV0A 3W66A 4XSZA 2DISA 2JA7K 2ZBPA 3AH6A 4A8WA 2BE2A 1SL2A 4PQUA 2R8IA 4MEXA 3N3YA 4OLOA 1YWXA 3L95X 2HQDA 3UD4P 3A4TA 2EEYA 2DGUA 3N5FA 3HOZK 2CPIA 3VAGA 3MM8A 4OIXA 3EGWB 4LR2A 4I4BA 3KK2B 1NSKL 1WC3A 1QLNA 2Q79A 2N4DA 4B3OA 3CD7A 3DRPA 1T9WA 2WVBA 2N7YA 3UDCA 5HMZA 3TEGA 3SFUA 1SJQA 3AHPA 2COLA 3B54A 1VQMS 4LR7A 3ZFVA 1MMLA 4LF1A 4DUYJ 2ZJPQ 2IPOB 4IFYB 1ZS6A 5KFCA 2JA7A 5I42B 4LRDA 4DN9A 2JA6C 3HXMA 3O44A 4IKAA 2BM0A 4DSJA 4Q43A 2V2VA 5HLFA 2HHXA 4IR1A 1R3NA 4DR2J 2FY1A 3CIZA 3VQTA 4P75A 3OFHA 1LKZA 1FRKA 2ZH2A 5DG7A 3DLGA 2DEIA 4KH1B 6FDRA 1XPPA 3LP0A 2QL9B 1UWAA 3KUHA 4XSXA 2VC0A 3GTGC 4TYAA 3ILJA 2VHGA 1Q7YT 4HL9A 1XZPA 4OI2A 4Q8EA 4IO1A 5DQHA 4TLRA 4X6AK 1TL1A 1VRTA 4FDFA 2IBOA 3PX4A 1X31C 2E1PA 5TJ3A 1N34F 4M5JA 4OLPA 2IYIA 4CQ1A 2XMKA 4RZRA 4P7TA 1HR0F 4OIRA 3FFIB 1IR2A 3DCAA 4A3CC 2QLXA 1RYSA 2V6UA 4LF8J 3CVKA 1EB0A 2V94A 3OJSA 3PYFA 1VK8A 1IKXB 1V5IB 4F67A 4X62J 2D3ZA 4B3RF 4TNOA 2A2DA 5D0EA 2A3JA 5IZHA 2YU9C 4B9LA 1RA6A 5GMDA 3V2UC 1ICEB 2L9WA 4R8UA 1SKRA 4DF8A 5EN1A 2PEBA 1JLQB 5I3PA 1VJWA 2H51B 1HMVA 4KSEB 3CULA 1SXLA 1WC1A 2U1AA 1I6VA 4JV1A 1DAXA 1T95A 2B9YA 3GTGA 5ETQA 2RMLA 4I2PA 4BKWA 4X64J 4DBQA 2RNEA 2W9AA 1HQMA 4Q5VA 5KFOA 1IWGA 1XK8A 4LQ3A 1RHMB 3VCDA 1BHNA 1S1TB 4DZDA 5FLXY 1PIEA 1RAEB 2DGQA 4ANDA 4PUOA 2JA5A 1V5VA 2V6TA 2G0CA 3H2LA 1U1LA 3DLBA 1J6WA 1L3UA 3I31A 4OHWA 3CO9A 2M8HA 5L1KA 2I0XA 5KFUA 4RMFA 1UFWA 4N47A 4DOZA 4Z2XA 1BY9A 4IOBA 3EDQB 1BDFA 3V4IB 2VICA 4ECZA 2H1YA 3L4BC 3HVTA 3W9JA 1S9GB 4C2MC 1QUVA 3GLJA 2XMTA 1Z2ZA 4UY8T 4ELVA 1RAGB 4H54A 2CKWA 1VBKA 1M1KT 4KB7A 1PYSB 4EI2A 4BC7A 2VBZA 1I50K 3Q22A 4R0JA 2F1FA 5C2CA 1VFJA 4RW9A 1TL3B 3HKZD 3T5HA 3GTKK 1RBAA 4XIUA 3F41A 2W4DA 3UCGA 2MPUA 4OYAA 2XEXA 4KPYA 2VQEJ 4OV1A 2V8DA 4DL3A 1NAQA 2D9PA 4ENOA 3E3XA 3IWNC 1I6HC 4OZ3A 4CT8A 4ZPDA 4KMHA 1X4CA 1S6PA 1H2UX 2W9BA 4ZPWR 3QIDA 5KT5A 1HWIA 1VQKS 3NS5A 2ZWOA 1KWMA 1MWZA 3CJ0A 4ICLA 3TP2A 2NS1B 3TZZA 4LRBA 2E2IA 2R92C 3M9NB 4LSZB 4DL2A 2AV5A 3THVA 4NI2B 3KK1B 2CNNB 1PC5A 5D3GA 4JP8A 2VOOA 3JS9A 3DI6A 1N0VC 2YWKA 5IOLA 2PC6A 2OIHA 3KHLA 5HO4A 5LJ3Y 1FWPA 1HPZB 4YEAA 3QZ7A 1O26A 4FM9A 3T6BA 3FGVA 4ES3A 9RUBA 5K8PA 1VHIA 1X9SA 4IFVA 1N5YA 2OAUA 1V6HA 3RG6A 1Q5YA 4G7OA 3LP2A 3CCQS 3R3TA 3VR1A 4QWEA 3K8VA 2RGRA 4G0UA 1J98A 1I5OB 1RT5B 1S5ZA 2WSEC 3IBCB 2CFAA 3GR0A 4E8UA 3FMBA 1AB8A 3KUGA 5B0FA 2J0XA 4IO9Q 2VODA 2CQPA 4BS2A 2DNQA 3QYYA 1B0VA 4DG1A 2YKPA 2V69A 1LWCA 3BKTA 1Q79A 4IR9A 4C0BA 4JI1J 3R5JB 2YKOA 5I3QA 3HHEA 4JYAF 3W60A 4KHRA 1K0TA 3TRGA 4DJBA 1RT7A 2LQ9A 2UUAJ 4MKBA 3OUYB 2HHUA 2ZJQQ 3HSZA 3K89A 1VRUB 3DLEA 5A8WB 1E6YB 2DHHA 4OZ5A 4RJVA 2FPHX 1LWEB 2GS8A 2YXLA 1WWHA 1K73T 2HFNA 1IBCB 2FQQB 2BACA 2CJAA 4NEYA 4W92B 4IH6A 1N5QA 4BWMA 1T3NA 4DPUA 1B7FA 3FEXB 2XULA 1DARA 2AGPA 3Q86A 4AUKA 2FJXA 5B09A 4QIVA 1JLCA 2DGVA 4P72A 2Y8YA 1F0XA 4JV5F 1UJ6A 2J0WA 2CRLA 2QT7A 3M30A 4K4TA 1SJFA 2NVTK 3R5CA 3GV8B 2XZDB 5EHHA 2BKNA 3RU0A 2R7TA 3QT6A 4I0WA 2OEKA 3MM9B 1N32F 2A6MA 3VAJA 2A68A 3MR2A 3TZXA 4U7UK 4K59A 5HJXA 4NLXA 2IA0A 3DYAB 2KG0A 3JSBA 1N5VA 1HQEB 3D68A 4FXDA 2C2KB 1QD1A 1N5SA 2AYGA 4Q0BB 5EGYA 4KT0C 4QZVB 3DOKA 1HBOB 3EVOA 5HK4A 2PGCA 3CUNA 2OFGX 3V6DB 4DL7A 1RLDA 5HVHA 3A13A 2OPPB 2F63A 4U95A 4UF4A 2PMWA 1TTHB 3R2CJ 3PXGa 3S1NK 4G0WA 3AA9A 2RB7A 4ID5A 1U49A 2DXEA 1EIYB 5D0HA 3CCJS 3GTJK 3UD3P 2B9EA 2YQ3A 2HKEA 3VGTA 1FA0A 4NZ6A 2UVUA 2GSUA 3JTNA 1Z1ZA 5AXLA 5M5XK 2EFVA 3CAGA 2LA6A 4O2DA 2E2IC 3MUVP 2MB0B 1XXCA 3FQLA 3EMTA 2HFOA 1VJEA 1IKVB 4NL5A 3PG9A 4OJ3A 1D0EA 2J7UA 2K2PA 1P9YA 3LW5C 4OI4A 2P5VA 4AFFA 2FLOA 3UQSA 2LDIA 1K0VA 4B3RJ 2J76E 1CPZA 4X62F 1KQKA 3QATA 3JSTA 4DX6A 1RT3B 2E9RX 4BY7K 1EX8A 4JI8J 4X66F 2NCKL 1HR0J 2AF6A 3HHLC 4OX7A 4A8QA 3GR1A 1SQGA 2R93K 5CABA 4PYAA 3C46A 1WCMK 3RBXA 3RR8A 1FXLA 2DTJA 3T1HF 3MTKA 2K7KA 2CJBA 1U1KA 3U27A 3ET6A 1RE1B 4G0VA 1H72C 3SEOA 3CEDA 4DL6A 3IM8A 2IJFA 4ED8A 2ASYA 1X7VA 1J5OA 2Q6BA 5KFTA 1KBRA 1RCXB 4UT4A 2HHTA 2HNZA 1KOHA 1CVJA 4RW4B 1SJRA 4A3JC 1VQSA 3ZC4A 1N32J 1OS5A 5B0EA 3VZIA 2NVXC 3PJ9A 5HBMB 2QLBB 3AODA 3HT0A 4DR2F 3F56A 2CWXA 2BEFA 5IP7K 2C3MA 2ZZTA 3HSJA 1Y4ZB 1R8CA 4X4TA 4HI2A 3FRZA 1O2AA 4Y7NC 4QIWL 3UW1A 1GE9A 2PA3A 3D5MA 2OPQA 1JQWA 3MFHA 3S1QC 2G1HA 3DOMB 1S6UA 5JUMA 4QPTA 3KTQA 3D6HB 5KFYA 3ENWA 3M3YK 4HACA 1WC5A 3H20A 3BO3A 5K8OA 2G4BA 2E7WA 3Q8YA 2Y1JA 4ZJLA 3CJ2A 3S15C 3PRDA 3P49B 3IPJA 3M2UA 4CLLA 2YKMA 3BEGB 3GTLA 5KFEA 2APOA 2JC0A 1EH1A 3S16K 1JB0C 3MECB 4WWSA 4PXEA 2AWZA 1WJ9A 1IUJA 5HJYA 2GSNA 2MZJA 3RBZA 3R1HA 3PHTA 1YK9A 3EZOA 1XEZA 1IBAA 4YR3A 3HOZC 4OZ1A 1BQNA 5F8GA 5LJ5Y 3H40A 2GIQA 3NNHA 3DOLA 4F3MA 1KTVA 3GJSB 3QAEA 2WVFA 1RWVB 4X4UA 3KLEB 3CJRA 3L09A 3OPFA 4M8LA 4C3HK 1GNKA 2HGMA 2NVTC 2QG9B 2YNFA 3DGVA 3GTLK 2GGPB 1FF2A 2FLPA 4DR7J 3M05A 2XHCA 3OT9A 1CQNA 1TWGA 2YKNB 1XR7A 2C3UA 1FI4A 5B0DA 1F9NA 1J5EF 3DOLB 1JLEB 3CDEA 4DV1F 2ZKTA 1UEKA 4L73A 4KGVB 2HK2A 1F5CA 3MM5A 4Y65A 1YBAA 5K14B 1F7VA 3T1HJ 4YB7A 3LP1A 3FKBA 2MTLA 4ZJQA 3ONQA 1RWUA 3D28A 5IT9U 2XCPA 2VG5B 3IG1B 5M2RA 1S1WA 1RU1A 2E5IA 1ITPA 3W64A 2XWYA 1FESA 4D3HA 1TWFC 1FXDA 2N3OA 3KLHA 4I7FB 4K4ZA 1YJWS 2DHGA 2CQDA 2NSBA 1WC6A 3TQ1A 3IN5A 4FVMA 3B6BA 1S4FA 1YLXA 1TKDA 3OD2A 3NP5A 2BRKA 5H9EJ 1G7CB 4GTFA 3DMJA 4HH0A 4G1QA 1EP4A 1FE0A 2HBRB 4IYQA 1Y1WC 3ITHA 3C2PA 4Y28C 1OYEA 2B6AA 1YRXA 1N8RT 2YKAA 3MAAB 3KLIB 2KFYA 4E0DA 5IOTA 1UVJA 1RHUB 1SV5A 4O3OA 1R6VA 4USTA 2X51A 1X4AA 3H59A 4NXMJ 4HHHA 1NKBA 2ZOGA 2MKJA 2DB1A 3ITHB 2GVDB 4JI6F 4PG8A 5IV4A 1Q8IA 4NLOA 2H9ZA 2JL9A 1TWAC 1VYAA 1UVKA 1HQUA 2YNHB 2YVSA 3I82A 3T9NA 1JLAB 3IR5B 5LXYA 5J1PA 3GFYA 3R97A 2CQ0A 4JI1F 3EE3A 2CG8A 4HDGA 4ZCIA 3MOJB 3G96A 3BREA 4LR8A 1N5TA 2UUCJ 2NVYC 3GTYX 2CADA 3SCKE 4QOTA 1YZ7A 4ED6A 3V6HA 4OIQA 3OV7A 3ENAA 3BSCA 1XQIA 3IG1A 2B7BB 1UVNA 2AZ1A 2IAJA 1CEZA 2FHJD 3SCLE 3FBFA 5C44C 2RF2A 4UW2A 3N0VA 4FNHA 2K1RA 3IGVA 1SH2A 4F4XA 1C0AA 1SBRA 4UQGA 4WILA 3N79A 3RBDA 1SKUB 2ACYA 2XYGB 1VQPS 3CDUA 2EBEA 4KARA 1RYRA 2J6SA 3EX7B 2MZ1A 1EHWA 2OPRA 2HW3A 1QAJA 3G8SA 4PCQA 1Q81T 1IWAA 3LOUA 4RW8A 2ZFZA 3IAM9 2IMOA 2YTCA 2DH9A 2HQFA 4K4WA 1FTRA 1SB6A 4KV8A 1M1GA 4ECVA 2PN6A 1F2GA 5FLMK 4O3SA 3IA0A 4J9QA 4CRJA 5DLGA 2W2QP 1S72S 3NMRA 2YBVA 4DSFA 3A8EA 4WJ4A 2VB6A 2MJUA 4ILRA 3M7VA 1HNVB 1X4BA 4F25A 3IR6B 3BP8C 2IDLA 3JTPA 3LO3A 3HMJG 1ZYRA 4ZMMA 3W2WA 1SFOA 5J2MB 2GNKA 4OHZA 2W25A 4CDIA 3FZ2A 2X7IA 2JA8C 1B4BA 1DCPA 4AQYJ 3NGSA 1BD6A 3MM5B 4J9SA 1B64A 3DRRB 2XZTB 3JSMA 1U4BA 4A4JA 4EZ9A 4E98A 4KMAA 4WFAQ 3JYTB 4M5GA 1G51A 3M2VB 2HQ3A 1NZAA 4IQMA 1MROA 2HFVA 1UVLA 4ZCKA 2OPQB 2ZM6J 3DMJB 2MQLA 3GTOK 3JAMY 4ZN1A 3BSOA 1MWQA 1WQFA 3F73A 4TU9A 2RKIB 3NG8A 3M8PB 1RWOB 4W90B 1E6YA 2F40A 1NK8A 3PO2C 2WRMA 1SFOK 3FCHA 3W7BA 4LIWA 5HBMA 3RZDC 1S4EA 3UO0A 4HTJA 4A3JK 1AUDA 4ECWA 2YU9A 1DFDA 1F9FA 4L75A 3QMQA 3AB4B 4DV3J 2F8HA 3KHGA 5M5YK 3AY0A 2V8HA 4O4GB 2DJWA 4QYZJ 3NGTA 3T5KA 2W2MP 1XNRJ 4GTCA 2HQCA 1IVZA 2VA2A 4P5AA 4KB4A 2RUSA 1RI7A 3P5BP 4PWUA 3QBCA 2CQGA 2UUBF 3ISND 3IS9B 1FJ7A 1B70B 4KMDA 4QQBA 3G71S 3MPUB 1NSQA 2E1CA 4MKAA 3WHIA 4UUWA 2NVYK 1RT3A 1DTQB 5DDQC 3LPEA 3WODA 5HP1B 5JXSA 1KHVA 4F4YA 2UVRA 1RJJA 2YWHA 1T9UA 4A8YA 1RHRB 5KFVA 4UZCA 2WONB 2KG1A 1E6VB 3IGNA 5D78A 2KI2A 1UTAA 4LT6A 5KFPA 3SCJE 2Y1IA 3RW7A 4YMEA 1J6VA 2SXLA 4LFAJ 4GVLA 4X4VA 4QWDA 3HT3A 1BQNB 2VG7B 3DGPB 4DFKA 3RRKA 3OSNA 2C2RA 2CPYA 1Y10A 3I5AA 2HRUA 2W01A 2P6SA 5FLMC 2E5JA 3OUYA 3KJVB 2Z0GA 2VJVA 4QBUA 2JA7C 4BBYA 2XGPA 4Q45A 4BBRK 4CH0S 5D4DA 2VPYB 4KASA 1BQMA 4PG5A 1GXUA 1SPBP 2ZH4A 1UA0A 4KBIA 3IM9A 1D9DA 4K2JA 2XMMA 3M6XA 5GMKa 3M2UB 4U7CA 3MMLB 3GTJC 1Y1WK 3HX9A 3FBEA 1KHWA 3LAKA 3SDEA 4EMDA 2MLZA 1RAAB 2R7ZC 2ZWPA 1IN0A 2B51A 3I0SB 2BE5A 2CJKA 2P6TA 4O3NA 3FCVA 4GVBA 3W3SA 3QGPA 2HIYA 1RBOB 2YNFB 1TL3A 1X0PA 2JLEA 5C44K 4I68A 1S0OA 1WKJA 3M2VA 4P2SA 1TVRA 1MMNA 3M8QA 4IDKA 2RRAA 5FDLA 3S0XA 4LQ9A 3OFGA 2M8DB 5A6PA 3V81B 4GC7A 3MM6B 3RBEA 2RHQB 4QWCA 3TEHB 2ASLA 3DYAA 2HS3A 1QE1A 3OBIA 2VKRA 2R9LA 4LOWA 2JFKA 5KFAA 4RU9A 1UVMA 4HT5A 5J2MA 1DLOB 3G4CA 4Y34A 5FJ8K 1FX4A 3MI7X 5JJBA 1VC6A 4FKYA 4M1XA 4A3GK
chains in the Genus database with same CATH topology
1X31C 3TTGA 1PJ5A 3TFIA 1PJ6A 3TFHA 3A8IA 3AD8C 1XZPA 2GAHC 1XZQB 1WSVA 3GSIA 1YX2A 3A8JA 1WSRA 1WOOA 1V5VA 4PABA 1WOPA 5L46A 2GAGC 3GEHA 1XZQA 4PAAA 3ADAC 3AD7C 3TFJA 3A8KA 4P9SA 1VRQC 1WOSA 3GEEA 3GIRA 1XZPB 1VLOA 1PJ7A 3AD9C 3GEIA 1WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X31 C;  3TTG A;  1PJ5 A;  3TFI A;  1PJ6 A;  3TFH A;  3A8I A;  3AD8 C;  1XZP A;  2GAH C;  1XZQ B;  1WSV A;  3GSI A;  1YX2 A;  3A8J A;  1WSR A;  1WOO A;  1V5V A;  4PAB A;  1WOP A;  5L46 A;  2GAG C;  3GEH A;  1XZQ A;  4PAA A;  3ADA C;  3AD7 C;  3TFJ A;  3A8K A;  4P9S A;  1VRQ C;  1WOS A;  3GEE A;  3GIR A;  1XZP B;  1VLO A;  1PJ7 A;  3AD9 C;  3GEI A;  1WOR A; 
#chains in the Genus database with same CATH topology
 2MKK A;  1JLG A;  2KH9 A;  5C3E C;  5KFR A;  2V4R A;  5CQG A;  5F41 A;  1IBM F;  4AYB L;  3GIR A;  2EFP A;  4EZ6 A;  2R7Z A;  1YBT A;  2DT9 A;  3JTO A;  3S6E A;  4I7F A;  5L38 A;  3J7Y I;  3H42 A;  4AL6 A;  2HQG A;  1VMB A;  2B3T B;  1BUX A;  1UJ5 A;  2CQ1 A;  3BYP A;  1XMO J;  3NGU A;  3TUI C;  4HAC B;  4MJK A;  3Q8U A;  2C22 A;  2BJ7 A;  1C1B B;  2AT1 B;  2PA8 D;  4ED5 A;  4ELT A;  3CD5 A;  3OVA A;  5IYB C;  3FEZ A;  1XTZ A;  2WZ1 A;  5D4O A;  3RB0 A;  2KT2 A;  5T41 A;  2LU1 A;  1VS3 A;  1XXA A;  4A8O A;  1T9X A;  5JFE A;  1ZAV A;  4RNH A;  4GKK J;  3VAM A;  5EUH A;  2UUA F;  3G2X A;  1R0B G;  1NKC A;  3NBP A;  3P6Y C;  1YTY A;  3M6W A;  2AJ2 A;  5L1I A;  2EBB A;  4BBS K;  2YWG A;  3ULH A;  5EX3 A;  3EQL A;  1T03 B;  1YJV A;  3M2R B;  5KFH A;  3GIK A;  4OX6 A;  2LQ8 A;  2QN6 B;  4ECU A;  4M5D A;  3KDN A;  2QSF A;  4Y2M A;  5A2Q U;  2F7V A;  4F4Z A;  1UCN A;  1JVI A;  3C15 B;  3H2U B;  2W2N P;  4DV0 F;  2R93 A;  2OD4 A;  1NK6 A;  2E1M C;  3BN4 A;  1PIL A;  3KLH B;  4J9K A;  2WB1 L;  5M3F K;  4DL0 C;  5C24 B;  2WAQ D;  4EFA C;  3CE8 A;  3P8B B;  1TP7 A;  2DR5 A;  3ERE D;  4QIF A;  1IKY B;  2UV8 G;  5DO2 A;  1D3W A;  1EK8 A;  2OD6 A;  4C0H A;  4AYB D;  2ACM A;  4CLP A;  1WHX A;  1R0A A;  2NLW A;  4J9O A;  2O5J A;  4O4R A;  3GTL C;  3JB9 k;  2I8E A;  3THT A;  4ZN3 A;  2ZDP A;  7FDR A;  4CP5 A;  4DR5 J;  4A47 A;  3GYX B;  1JJC B;  3LAP A;  3MTJ A;  1JXL A;  4DR6 F;  3ORE A;  2KXN B;  5J2Q A;  3M8Z A;  1RHK B;  5DDP C;  4G1Q B;  2E29 A;  4Z7Y A;  1U26 A;  1ROF A;  1B0T A;  2CXE A;  3PYG A;  2MZQ A;  5IV3 A;  3C66 A;  1T9V A;  3HOV K;  4AH6 A;  3TFJ A;  4TYB A;  2UXC J;  1WI6 A;  4DV5 F;  1WOR A;  1WG1 A;  2BE9 B;  2A6H A;  4JI4 J;  4R25 A;  1HFE L;  2EI5 A;  1S9F A;  2VQE F;  5D3G B;  2VC1 A;  2HMI A;  4C2M K;  1OO0 B;  3SYZ A;  3UCU P;  2OPP A;  1S59 A;  2LP4 A;  1VHF A;  5KFW A;  4KMU A;  5DZ6 A;  2RU3 A;  1YJT A;  5DQG A;  3D67 A;  1UKU A;  4D3G A;  2HAI A;  4F3O A;  4M95 A;  2L9D A;  3GTQ A;  1GFW B;  5E3R A;  4YR2 A;  1VIO A;  4CYU B;  5E68 A;  5A76 A;  3DHW C;  1CC7 A;  3HK2 A;  2V0N A;  3S1Q K;  1LOU A;  2NPI A;  2ZHO A;  3DOM A;  3IO1 A;  4S0M A;  3GJQ B;  3MEE B;  2AP6 A;  2J9D A;  5IP7 C;  1JLB A;  3CCL S;  3I0R B;  1FRI A;  2IAJ B;  4M5L A;  4Y00 A;  1RWX B;  2H3E B;  3CCV S;  1HNI B;  4ECT A;  2P9C A;  4Q7A A;  5KG7 A;  4O3P A;  1IQT A;  2DY1 A;  1IKX A;  4B3T F;  3J7Y U;  2QA1 A;  4G1P A;  2OH2 A;  3R6G B;  5SZT A;  2VKZ G;  1KN6 A;  3M9M B;  3CIM A;  3W2V A;  4XPE A;  4X2B A;  1S1X A;  1H74 A;  4WFZ A;  2YH1 A;  1TUW A;  4WBF A;  1WHY A;  3RYL A;  2F8E X;  3MR5 A;  2RDJ A;  1S49 A;  1Q0N A;  4CLF A;  2QGF B;  4BWJ A;  4TKT A;  1S0M A;  1Q7L B;  2V67 A;  1IS1 A;  2EK6 A;  1DZ5 A;  2FUG 9;  4ETX A;  1B7Y B;  2KJV A;  2RS2 A;  4MFB A;  2ZNZ A;  4BY7 C;  5CYQ A;  3MAA A;  2M88 A;  3CCW A;  1I3O B;  2ADB A;  4BHQ A;  5D4L A;  3Q2T C;  2DNM A;  3I6P A;  2LEA A;  3PX0 A;  2OJ3 A;  5KT3 A;  3X1L B;  3K17 A;  4QR0 A;  1SC1 B;  5BXI A;  4BBS C;  4M5N A;  1VQO S;  4A3D K;  3OR2 B;  5C5J A;  4BY1 C;  4GVB B;  4I6Y A;  1ZTW A;  1SUQ A;  2HQI A;  2EFN A;  4P52 A;  4BDP A;  2NXJ A;  1XMQ F;  2W4C A;  5E7O B;  3R6L B;  2BQR A;  4CI0 B;  3PTW A;  4NXN F;  2J6T A;  2QLJ B;  1HNZ J;  3VGS A;  3CPW R;  1GTE A;  3KK1 A;  2FVP A;  1SC6 A;  3Q8S B;  3MAQ A;  1IJF B;  2MKI A;  3D3C J;  1VQ5 S;  1S1W B;  4R0E A;  2MKH A;  4DS4 A;  1G2E A;  1U45 A;  1TKT A;  4DF4 A;  5I42 A;  3ILL A;  4ZLN A;  5GAE I;  2IJN A;  4QJV A;  4B9U A;  4PG6 A;  5DGB A;  3RB3 A;  3L9Z A;  4PRF A;  1SCJ B;  3MPV A;  5CXT A;  3QGG A;  5KFL A;  1BS2 A;  4WK3 A;  1UW4 A;  3ILO A;  3K57 A;  1WOP A;  3C6T A;  4NCA A;  4ER8 A;  1LWC B;  2NZC A;  4M94 A;  1U02 A;  5I3U A;  3TWZ A;  2M2B A;  2HVH A;  1RWK B;  2XNQ A;  1WDT A;  5HAN A;  4A3L K;  4CZC A;  4B02 A;  2DXD A;  1KRP A;  2B0G A;  4HH1 A;  5DGA A;  2NZ4 A;  2V4J A;  2HLU A;  4WU3 A;  3HD2 A;  4AD6 A;  3CQZ K;  2HS4 A;  4LF5 F;  3P3D A;  2ZH7 A;  1ZAX A;  2XS2 A;  3PFO A;  4J5O A;  4DG1 B;  1SVD A;  4MK8 A;  2Y0S D;  4CNZ A;  2Y8W A;  5EX0 A;  3KUE A;  2UXB J;  2W4P A;  5HI7 A;  4GKK F;  4PR6 A;  2XB2 D;  3WZ0 A;  3PW7 A;  4X65 F;  6FD1 A;  1EJ7 L;  3PKM A;  3GZ7 A;  1PAU B;  1WC0 A;  3VAH A;  4NE9 C;  5KFK A;  1N6Q A;  1W2B R;  4RUH A;  4NZ7 A;  1RT2 B;  3D3B J;  2A6O A;  3HZG A;  1F2H A;  3FZB A;  4J9M A;  3HOY C;  2DR9 A;  2RQC A;  1HA1 A;  3NOC A;  5DET A;  1N56 A;  3GV5 B;  2CNK B;  4TY8 B;  2QMX A;  2FQT A;  2HBY B;  3MFI A;  5J1E B;  1HWJ A;  3TA1 A;  1IBM J;  4PAB A;  1RKI A;  3BP3 A;  1HBM A;  3UDV A;  1N88 A;  2LXI A;  5SUH A;  2WW8 A;  5J2N B;  5CYM A;  1EFW A;  3TVY A;  1NKE A;  4DR4 F;  4Y6I A;  3GIJ A;  3ILI A;  5IYC C;  2A69 A;  4PWW A;  1FVQ A;  1SQE A;  1NK9 A;  2QZ8 A;  1ZBS A;  1HBU B;  1HQ2 A;  3M8W A;  4A3D C;  4OZN A;  1S76 D;  1S6Q B;  2OEM A;  3MZI A;  4GTD A;  1SIW B;  2R7X A;  2E5L J;  1JWW A;  2VUM A;  2V8P A;  1FK9 A;  1QAI A;  5H9F J;  4WE1 B;  4AXJ A;  4IFY A;  3G6Y A;  1XC9 A;  1KQG B;  2DHX A;  3HVT B;  4V19 J;  3A12 A;  2RDI A;  1KP6 A;  3ZZU A;  1Q8K A;  1UW9 A;  4L76 A;  4LFB F;  1NJZ A;  1JLC B;  3BDE A;  1JKH B;  2CJ9 A;  2GHV C;  3LP2 B;  4L3K A;  4F4K A;  1LNQ A;  4WJB A;  1O2F B;  4LFC J;  1NHV A;  3KK3 B;  4YB5 A;  4C3J C;  2Z2Z A;  1TAU A;  3A8I A;  1UMJ A;  3BQ1 A;  1ZAW A;  1RWM B;  4WXO A;  3HM9 A;  4Y52 K;  3VAL A;  2DK2 A;  4PQA A;  5F0W A;  2VON A;  2EC0 A;  1FDA A;  2DRA A;  2IM2 A;  2R8J A;  2ZD1 B;  1F1B B;  2E1R A;  2QC3 A;  1KS2 A;  3ZZP A;  4WKY A;  2AKW B;  2D74 B;  1ZA1 B;  1NSP A;  4OHX A;  1H98 A;  4DCJ B;  1PO6 A;  3RZD K;  4LK1 A;  1PCA A;  5LOQ A;  3DKD A;  3MED B;  1SFO C;  5KAK A;  1WF1 A;  3TFH A;  1YJR A;  2L08 A;  1RTI A;  3SSQ A;  1C0U B;  1OY8 A;  1TAQ A;  5AXM A;  3PRV A;  3LQV A;  4ILM A;  2VG6 A;  3BBB A;  3FK4 A;  1RTD A;  3NGR A;  3HHN B;  1S1X B;  1OSD A;  4NLU A;  4H4M B;  3DRX A;  2JSX A;  3K8W A;  2JA6 K;  5F0U A;  1RWP B;  1KVK A;  4CO3 A;  3OL7 A;  1OQ6 A;  4GTB A;  2E9Z A;  3VA7 A;  1N33 F;  4RBT A;  4E2F B;  4ZVR B;  1RTH A;  2RIJ A;  3KYL A;  2RS8 A;  5GME A;  3D6M B;  3KKF A;  4N8N A;  4H4M A;  2V2K A;  1U25 A;  2V68 A;  1A7G E;  3QO9 B;  2B56 A;  1KQS R;  2V9K A;  4DX5 A;  5DM7 Q;  3UDE A;  3MR6 A;  3JSY A;  4JI0 F;  4BCA A;  4IOA Q;  3FBC A;  3A3N B;  1P1T A;  1HBO A;  3TO8 A;  5K8N A;  3QZ8 A;  4DV3 F;  1JLF A;  5F3T A;  3HFZ B;  2JA6 A;  1IJE B;  3DLG B;  1RWW B;  1URR A;  1L3V A;  5H9E K;  1P6T A;  3SQG A;  4ZKA A;  4Y2C A;  1KVI A;  4DFM A;  2GAH C;  4MT1 A;  4A3E C;  2IC3 A;  2W8L A;  1EKR A;  2ZFH A;  1BQM B;  4K0K J;  5TMF A;  2W1B A;  5C24 A;  2MJN A;  1MW7 A;  2DNK A;  2ZVI A;  4X84 A;  4PZV A;  1I50 A;  1UA1 A;  3O8W A;  2DHA A;  2G2Z A;  4F2R A;  3ISZ A;  1RWN B;  1FKO B;  1YI2 S;  4C8M A;  3MCO A;  4OIP A;  3PVX A;  2D3O R;  4WP3 A;  2ZH5 A;  3NCQ A;  1XER A;  4J9V A;  2HWI A;  3AXK A;  1N54 B;  1S48 A;  1YJ7 A;  2BA9 A;  3HUL A;  1O8B A;  1HPZ A;  4PXD A;  3NOG A;  4DV1 J;  2N4C A;  2GIR A;  3VGU A;  4ZVH A;  3LWL A;  4FP9 A;  1YIT S;  2XY5 A;  3PJX A;  5EGE A;  4CTA B;  4UOG A;  4TQR A;  3KLV A;  1FDB A;  3WX8 A;  2UU9 J;  3H0G A;  2VG5 A;  4LF9 F;  4KGK A;  2XCR B;  1MWY A;  2QTW A;  2HWH A;  3DNC A;  4TN2 A;  5AE2 A;  3FCW A;  1RT7 B;  4DV0 J;  1FKP A;  1M5V C;  2R7V A;  4DX8 H;  4KY3 A;  4O44 B;  1Y11 A;  2EXU A;  2DO0 A;  2IC3 B;  3K5P A;  2CFA B;  3I9V 9;  2K3K A;  2BJE A;  1TK8 A;  4G65 A;  2AQ4 A;  2ZUF A;  2HG4 A;  2AHO B;  4CLW A;  1HW8 A;  1L3T A;  3QSI A;  3HI9 A;  1CJV A;  3JQK A;  4RL1 A;  4F4W A;  2JHE A;  2Y3P A;  4NLD A;  4PPD A;  3ZZT A;  3OTO J;  3U1N A;  4FS2 A;  4ZCL A;  4QYR A;  1I6J A;  4C8Y A;  1RIS A;  1HLW A;  3QO9 A;  3IAS 9;  1U8W A;  3ZTS A;  4FBT A;  2PII A;  4Q4Z A;  2P9G A;  2NSC A;  1PJ7 A;  2BXJ A;  2G13 A;  3IBW A;  3MCN A;  4ZPV R;  2JEJ A;  3K5M A;  4NOH A;  4RO0 A;  2VZ9 A;  5AXN A;  3SI8 A;  2RJZ A;  3BZQ A;  2KVQ E;  3MEK A;  1H2T Z;  2MHE A;  5G0R A;  4DUZ J;  2HHP A;  2Q6C A;  1C0U A;  1LV5 A;  2HSE B;  1KOO A;  1RT6 A;  2QYG A;  3FKI A;  1YQH A;  2ROG A;  3UVJ A;  3OTC A;  3CDW A;  3J80 U;  3AB2 B;  4JOU A;  1EKS A;  2W9C A;  3DU5 A;  5D0G A;  4AL7 A;  2F9D A;  5LT5 A;  2MKC A;  4IH7 A;  3V4G A;  3DDN A;  4ZK7 M;  5DRK A;  5C7P A;  3BPD A;  4J3N A;  4ZHR B;  5FII A;  1TWF K;  1JNR B;  4DHV A;  2MMY A;  1C1C A;  1I6H K;  1T05 A;  1HKA A;  1IKY A;  1B0P A;  2XYH B;  2ASJ A;  2HNY A;  2DNZ A;  3TW0 A;  2MQM A;  1NJI T;  4F3Q A;  4F2S A;  1Y3J A;  2R2R A;  2FTR A;  2FC8 A;  1FWL A;  4OYO A;  2HMI B;  1PGZ A;  1K1S A;  3CJT A;  3RAQ A;  2EK1 A;  4M1K A;  4QPX A;  2EC2 A;  4M63 A;  2AW0 A;  1YJN S;  1HHQ A;  3T9Z A;  3C16 B;  1SQF A;  2UXD F;  3MMA A;  3H5X A;  3RGI A;  3H3V L;  2W7V A;  2CFX A;  3ZTR A;  4GT9 A;  1LQ9 A;  1HNW J;  4ECS A;  3IMQ J;  3AD7 C;  3H7H B;  2YX7 A;  2Q43 A;  3MXH P;  1X4F A;  3OLB A;  2IVF B;  3W8P A;  5J1N A;  2IFX A;  1USM A;  2WOM A;  4A3E K;  2ZVS A;  4UOC A;  3AOC A;  3C16 A;  2QV6 A;  4NLT A;  8AT1 B;  1RAH B;  2MLX A;  1FRL A;  5EWG A;  3BQ0 A;  1YHQ S;  4YUD A;  1X4E A;  3H3V D;  2HHH F;  5ETL A;  4B9T A;  2GVZ A;  2YPY A;  3OR2 A;  4ZIT A;  2DR6 A;  4BXX K;  2J7W A;  4DCP B;  2J9C A;  1Y00 A;  1KC8 T;  4DPW A;  1NK7 A;  1WEL A;  2D3U A;  3D7S B;  2BW7 A;  5ETN A;  2MY8 A;  1S7I A;  4YFU A;  3QT8 A;  3H0G C;  3WC2 A;  1NK4 A;  4H4O B;  2IVY A;  2P2C B;  4LF4 F;  4CLZ A;  4GTL A;  4FYW B;  2XMW A;  3W62 A;  1GT8 A;  3M4X A;  2X1G A;  2GJF A;  7AT1 B;  1XR6 A;  5HQ8 A;  4PG7 A;  5CYJ A;  3K5N A;  5D8H B;  3R7N B;  5T7L A;  4KE5 A;  3ZZ0 A;  3NMA A;  2IYG A;  1J5E J;  1RTJ A;  1WEX A;  5IXU A;  4C97 A;  5KG6 A;  1IW7 A;  2KO1 A;  3H25 A;  5ETO A;  1GH8 A;  2Q66 A;  1WNE A;  3H5Y A;  3W5Y A;  4CYU A;  3DRY A;  2HGL A;  4I67 A;  3OXG A;  1WOS A;  4X6A C;  3CW2 C;  3RR7 A;  2HLT A;  2VD3 A;  2RDD A;  3CJ3 A;  1WCM A;  1PBU A;  3AJ1 A;  1BXN A;  1B3T A;  1LFW A;  4IDK B;  2R2S A;  5ETV A;  2MHN A;  1NB2 A;  4ZHR A;  1REV A;  3TFI A;  2QRR A;  3ETM A;  1TMM A;  3MAH A;  4DDF A;  2BJ1 A;  1QTN B;  1X4H A;  4DUZ F;  1RP5 A;  3W65 A;  2RAQ A;  1H0H B;  3AOA A;  2LU2 A;  4ZDN A;  3WIV A;  1CJU A;  3MMC A;  1UAW A;  3R1L A;  3B4M A;  1M5S A;  4QCL A;  3MM9 A;  2B4P A;  4KQZ A;  3GU0 A;  3MUR P;  3ZXW A;  4P6Q A;  5CYM B;  1RT1 B;  5I3U B;  2M4M A;  4F0M A;  4K4X A;  3ZTP A;  4DV4 F;  2M52 A;  2XLK A;  4Z7C A;  2WSC C;  1XNQ J;  2RT3 A;  3WX4 A;  3LPX A;  3KNG A;  1RDR A;  3TTG A;  2JA8 K;  5IOR A;  2CG4 A;  1O29 A;  4L3N A;  2X1A A;  1K83 C;  1Z2L A;  2HVD A;  3NS6 A;  1J27 A;  1NHK L;  2R7O A;  3LAJ A;  4B9M A;  4BLG A;  3FHZ A;  2IBK A;  4IG0 B;  2BKO A;  3NS7 B;  1URN A;  2QMW A;  1S1V A;  2MGZ A;  4OHY A;  3R5G A;  4U8Y A;  1U0H B;  2WVE A;  1JOE A;  4MIA A;  2VPX B;  4A3M C;  3BN7 A;  4DR1 J;  1HHT P;  4MK7 A;  4KAI A;  2DBB A;  4FPR A;  2MST A;  8ATC B;  4B3O B;  2JA5 C;  4N76 A;  5E3Q A;  1R9T A;  1FHT A;  1N36 F;  2E2I K;  1X9M A;  2FGC A;  4OI6 A;  1IR0 A;  4JBC A;  5BYS A;  1FFW B;  2CDQ A;  3QRR A;  1Y1V K;  2J8S A;  4C45 A;  1B99 A;  2ZH9 A;  3W9I A;  3I5B A;  5IP9 C;  2R8K A;  3NL0 A;  2J8A A;  4F04 B;  5AE3 A;  1R31 A;  4FF1 A;  4J90 A;  5HL8 A;  1IBL J;  5AE1 A;  4NLR A;  1JX4 A;  4HKQ A;  1ZZF A;  4NA3 A;  4I1T A;  5J2P A;  4WP9 A;  2VPW B;  1F5A A;  4OI0 A;  4HYK A;  4YDD B;  3EVM A;  3UN2 A;  3TAM A;  5GAH I;  3FNN A;  4DU8 A;  1Y5L B;  4JK1 A;  4PXC A;  1PYT A;  4LLG A;  1YNN A;  3CO0 P;  2FZC B;  3KLF B;  4X66 J;  3EPG A;  3IXQ A;  4NAS A;  4URG A;  5BYR A;  4DLE A;  3S2H K;  2GJI A;  3ZTQ A;  2MDA A;  3KOA A;  3I56 S;  5ETM A;  2C3P A;  5M3M K;  3CQZ A;  4KAT A;  4Q2L A;  3LWM A;  3E8O A;  1TV6 A;  4YB1 P;  4N41 A;  4P73 A;  3CSK A;  5KFM A;  4LR9 A;  1GX5 A;  1Z4U A;  3RZO K;  2G9O A;  2HFZ A;  4NWB A;  2BE7 D;  1O0P A;  3JSM B;  1FVS A;  3CQZ C;  2YX4 A;  4RW6 A;  1KVJ A;  1HWU A;  2GVZ B;  3FRY A;  1WKL A;  3IRW P;  3GIL A;  2CA9 A;  4RKU C;  2YWE A;  3CC4 S;  2LA4 A;  3EVW A;  4QIG A;  4A3L C;  5IFM A;  2PD1 A;  3BKU A;  3T41 A;  3DRP B;  1DLO A;  3MR3 A;  3PW2 A;  4FYY B;  2H4W B;  1TWC K;  3H98 A;  4K2X A;  2AX0 A;  2BJ9 A;  4DV4 J;  2EKY A;  4HHU A;  1R89 A;  1C0T B;  2JZ5 A;  2UXD J;  4ANE A;  3WQP A;  2CQ3 A;  4JI3 F;  3TAP A;  1YZ6 A;  3TX8 A;  5HSP A;  1U1Q A;  5AJ3 F;  1APS A;  5GAE U;  2ZZN A;  1DY3 A;  2GZO A;  1NJW A;  4OHV A;  2XYP B;  4O4G A;  1EQR A;  3HVA A;  5IT4 A;  3EZ5 A;  3RB4 A;  5D4P A;  3GEH A;  2GV1 A;  4OJ1 A;  3PW4 A;  5GAD U;  2ZBR A;  4JI0 J;  2A2C A;  2KM8 B;  1VQL S;  4C98 A;  4CT9 A;  3QGI A;  3NCR A;  4JI2 F;  3S1R K;  2X1F A;  3ELH A;  1HWL A;  1I3Q A;  1FRX A;  2M0G B;  4GMK A;  5DZ7 A;  1RT4 B;  3K5O A;  4RW8 B;  1KEK A;  4ECR A;  3A3P B;  1PC4 A;  4AT1 B;  4IH5 A;  2QL5 B;  2KJW A;  3MEG B;  2UV8 A;  2N7C A;  2XLJ A;  1XZQ A;  3O1L A;  3QJJ A;  2DNY A;  3UN5 A;  5KT6 A;  3AH5 A;  1UP1 A;  1T11 A;  2BDP A;  2JNJ A;  2HVZ A;  2R8H A;  4Q8F A;  2GML A;  3T00 A;  4C8Z A;  2BMB A;  4WFX A;  1WC4 A;  4DV7 F;  3C6U A;  4JI3 J;  3D2W A;  3I55 S;  1WCM C;  3DLJ A;  3PCO B;  3QJL A;  4P2X A;  1HWK A;  1BMQ B;  5U47 A;  5DG9 A;  3L4K A;  2FHM A;  5A0Y A;  1HI1 A;  1YNJ A;  2FVC A;  1VGY A;  4ZVT B;  1IKW A;  4AXI A;  2D3O 1;  2DXF A;  4BLA A;  4FYD A;  4X64 F;  4A3F C;  5HMW A;  3KG1 A;  2RRN A;  4GC6 A;  3Q2S C;  5B0C A;  3MGJ A;  3I4N C;  1YDL A;  1CJV B;  2ZH1 A;  2J0S D;  2NPF A;  2B5J A;  3RB6 A;  4M5D B;  2EVZ A;  3R5D A;  1U0S A;  4G1I A;  2PMZ L;  1DQ8 A;  3CDB A;  3BDP A;  3U7J A;  5IC4 B;  3PV8 A;  3O2I A;  1EI6 A;  3GTK C;  1WOO A;  3EZU A;  4U9R A;  2RU9 A;  3S17 C;  3TZY A;  4Q5S A;  1N4L A;  3U1M A;  5CHP A;  3E01 B;  4Y7N K;  1CJK A;  3UR0 A;  1JLE A;  2FLL A;  3OJU A;  2LDY A;  1TUG B;  3D0H E;  3JXO A;  3N6N A;  4DZ6 A;  1RAJ A;  1S6Q A;  5HVF A;  4NEZ A;  1HBN B;  3OXF A;  1N34 J;  2V6S A;  1SL0 A;  4ES2 A;  1OMS A;  1RSC A;  3PO3 K;  2AYB A;  1HIY A;  4DQR A;  3CJK A;  5KFN A;  1NZ8 A;  3SV3 A;  1IBL F;  3NGK A;  1F60 B;  2XMU A;  3DXJ A;  1CLF A;  1U0H A;  2DKO B;  1SJ1 A;  3HOV C;  2RQM A;  3S17 K;  2AJ4 A;  2QMU B;  4NLP A;  2BJ3 A;  2KN4 A;  4ANC A;  4YR0 A;  4GKJ F;  3DXB A;  4M5I A;  3O5T B;  2XNR A;  1SKS A;  2NXN A;  3GFZ A;  4WXW A;  4FF2 A;  4DR1 F;  4YG2 A;  2E7X A;  5DJB A;  1M5P C;  1NB7 A;  2NVX A;  1H38 A;  2RUG A;  4A46 A;  2LMI A;  2KXF A;  4ELU A;  3J81 U;  2KYX A;  3DM2 A;  5IT0 A;  3OTD A;  3CC2 S;  3CCE S;  2E9T A;  3VVT A;  3Q3Q A;  1D9F A;  1R6Y A;  4FZB A;  3BH6 B;  4V1A k;  1YIJ S;  1D9A A;  2EWH A;  2W7A A;  2HYI B;  4CO4 A;  3CCR S;  3C14 B;  3RJM B;  2ZDO A;  1S79 A;  5B08 A;  2JH3 A;  1F6T A;  2JRS A;  4KO0 B;  4UY8 5;  3M6V A;  2VOP A;  3W63 A;  2EG1 A;  3CCZ A;  4KV8 B;  1OSC A;  4J91 A;  2E2H C;  4TLQ A;  3C6T B;  2VU5 A;  3S14 K;  4XAK A;  4ZVS B;  4WKR A;  3S2D C;  4A8M P;  1T3O A;  2ADC A;  5F8L A;  1RAB B;  1WSV A;  1HI9 A;  2G2O A;  4G6V B;  4K4V A;  2FQO A;  4FNI A;  2VFR A;  3BB5 A;  4WCE Q;  2KZZ A;  1O2B A;  3HOY K;  3GTM C;  2FJA B;  4N7T A;  3DRS A;  2PO4 A;  2UUT A;  2K3I A;  2IRU A;  2HVI A;  4NPO A;  4G3I A;  1TKX A;  2XMA A;  4ICL B;  3OQ2 A;  1SH3 A;  2DH8 A;  3NBP B;  3CCS S;  3SZY A;  2KDO A;  3HSD A;  3DC2 A;  1R8B A;  5JVH Q;  4XLN A;  1KON A;  1QE1 B;  5FLX U;  4QR1 A;  3BBF A;  3QFH A;  2JEF A;  2OMO A;  1UFK A;  2DNO A;  1H2V Z;  5KT4 A;  3O3L A;  1VQY A;  1T02 A;  1T7P A;  5LSL A;  4R5P B;  1HNZ F;  4RUC A;  2B63 C;  1BGW A;  4HTI A;  2Z2Y B;  1A9N B;  2F65 A;  2V9W A;  3J80 Y;  2AD9 A;  3OL9 A;  1UEU A;  3TUP A;  2GW8 A;  1YKW A;  4DUT A;  3US5 A;  1XR5 A;  5F8N A;  2RIL A;  5C3E K;  3E01 A;  1JLF B;  2YQ1 A;  2BUN A;  2CJQ A;  2Z8Q A;  5ETS A;  3I87 A;  4A3G C;  1ZM9 A;  2ZC4 A;  3ZZZ A;  1H6K X;  1B4A A;  3CD0 A;  1JJ2 R;  3RZO C;  4NLW A;  1OPZ A;  4LBH A;  2QL7 B;  3NCP A;  2PA8 L;  3Q8V A;  5KG1 A;  3QLH A;  1EAY C;  3AJD A;  1YJU A;  4J7C A;  1U1R A;  2QX0 A;  1QSS A;  2IA6 A;  2DGS A;  2F9J A;  5KG0 A;  2OPS A;  4DPX A;  3HKZ L;  4RLE A;  3GSI A;  3JQJ A;  4IG3 B;  1JQG A;  2EFQ A;  2OPR B;  1GAO A;  4CNY A;  4J37 A;  3DRS B;  2CPH A;  4JV5 J;  4ZP6 A;  3TJA A;  3TAM B;  4LF6 J;  1GMU A;  3GIM A;  3SXL A;  2W9C B;  4BY1 K;  2MGZ B;  2O1P A;  5C2G A;  3D0I E;  2UVV A;  1H3D A;  3CJ4 A;  4C8O A;  1ISE A;  3S14 C;  3MEG A;  3SCI E;  2PDA A;  3BM7 A;  3PO2 K;  1TKX B;  1IBK J;  3MMB B;  4JI4 F;  4F50 A;  1XWL A;  3MD1 A;  2KB2 A;  5K9F A;  1LW2 B;  3HP6 A;  3OFE A;  1U6F A;  3EIC A;  4X65 J;  5EGH A;  3GTP C;  3MPD A;  5ETK A;  4F8R A;  3CMA S;  3EPI A;  5FDL B;  2JFD A;  3C19 A;  3K58 A;  2K8G A;  3Q24 A;  5CHC B;  4JYA J;  5HP1 A;  2C28 A;  3GYG A;  4UQT A;  5C42 B;  3HHL D;  4DMZ A;  2EPI A;  2JVO A;  3EJM A;  4KN4 A;  4W98 A;  1S1U B;  2IRX A;  2HHQ A;  1RAC B;  3KJV A;  1DCH A;  1TV6 B;  1TFY A;  2AEJ A;  1DJ0 A;  2DY9 A;  1P27 B;  3NGD A;  4NLQ A;  4YP3 A;  3ZTO A;  2ZUA A;  5IWA J;  2HZC A;  2V34 A;  1U1P A;  1SMY A;  3QWP A;  1OIA A;  3PJW A;  1U09 A;  2R3V A;  1FCA A;  4EBC A;  2DEJ A;  3VF0 B;  3UD5 A;  3Q0A A;  2CPJ A;  3H0P A;  3A3O B;  1KTQ A;  1YRU A;  1PBA A;  3C6U B;  3OL8 A;  2FVQ A;  2VUM K;  1K83 A;  2MLY A;  3K59 A;  4LFB J;  4A3C K;  1AA1 B;  5IYD K;  2VBY A;  3OTO F;  2R42 A;  4I56 A;  5KOW A;  3PY8 A;  4ZPC A;  3TZW A;  5KFF A;  2IY5 B;  1MNE A;  3G8Q A;  2MQN A;  2O5I A;  2PPB A;  3HOU K;  2AJ0 A;  4QYZ K;  1I50 C;  1OPI A;  2QLW A;  2M70 A;  2IVM A;  5E5N A;  3ISN C;  1T94 A;  3K0J A;  3W5X A;  4ILD A;  2HZA A;  5A6W A;  1Y5N B;  3FMW A;  5DG8 A;  2GMH A;  1K44 A;  1AYE A;  4RW4 A;  4G7Z A;  1DTQ A;  2QYC A;  3I32 A;  2F4F A;  3J7A N;  2WVC A;  3OHB A;  4ALZ A;  2UU9 F;  5IOQ A;  1C4A A;  3QQC D;  2QIF A;  3BGR B;  4OL8 A;  1L0W A;  1KKH A;  2RRB A;  3G6X A;  2W2P P;  3M1V B;  2B43 A;  2DO4 A;  2XY7 A;  4ITS A;  2Z57 B;  4F7V A;  3N0B A;  3MEC A;  4YDX A;  3IP0 A;  3EXY A;  1FD8 A;  3UN3 A;  4OYX A;  2WCX A;  3EGN A;  4U7U D;  3MR7 A;  2YKM B;  3MCS A;  4IUF A;  2W9B B;  1FNM A;  2E5H A;  4I64 A;  4PUO B;  1FD2 A;  2O01 C;  3RTV A;  3V81 A;  2AIR B;  2E2J C;  2H5J B;  1FRJ A;  4EUV A;  1G6B A;  4NRT A;  2DGW A;  4A8F A;  3EWG A;  4PKD B;  5K20 B;  4K0K F;  1WQH A;  4TXS A;  3RUB L;  3ENV A;  1REG X;  4MMO A;  3KJF B;  3I4H X;  3S7R A;  1VQN S;  5KFZ A;  2ZHA A;  2RF2 B;  1H7W A;  3W8G A;  2G2Y A;  2V63 A;  4FKX A;  1XN9 A;  4HEA 9;  5JMN A;  1OQ3 A;  3R7B B;  3TVK A;  1AW0 A;  4A3I K;  1RTD B;  2VG6 B;  4J9R A;  4ZP7 A;  3BR9 A;  2CPF A;  2ZH6 A;  1ZZN A;  1XMO F;  3V4I A;  3GJR B;  1TKZ B;  3WBZ A;  4LVN P;  4Z37 A;  1KDN A;  1EZZ B;  1RGV A;  1TKZ A;  2RE1 A;  2MZT A;  2BAB A;  3VWS A;  1Q1K A;  3K7A K;  4ZLJ A;  1P9Q C;  4WPA A;  4ED0 A;  2C2E A;  4WYW A;  3ZZO A;  1U7L A;  1OY6 A;  3TNV A;  4DPY A;  3DLK B;  4ZOS A;  1YCL A;  2Q3P A;  2ATC B;  2O5D A;  3D66 A;  3SZZ A;  4LF8 F;  4U6P A;  3GQC A;  2F5G A;  3FBB A;  5LMU F;  2DIU A;  2BAN B;  2KXH A;  2RVJ A;  4IRD A;  1RBL A;  2HEK A;  2VUM C;  3CMQ A;  4OZJ A;  3L7O A;  2NXU A;  4KO0 A;  2BV3 A;  1TWA A;  1RU2 A;  4LSL A;  4ZVP B;  2FVS A;  3CTR A;  1O5J A;  2FZK B;  4KH0 B;  5LMN J;  4YY3 J;  3GEI A;  5HLF B;  2B6A B;  4ECQ A;  2WHO A;  3KNA A;  2LQB A;  2HGN A;  4LF2 A;  3BO4 A;  1IL2 A;  1RB0 A;  4C3M A;  1RHQ B;  5A8K B;  4A93 C;  2J6U A;  1BGX T;  4EYI B;  5EDW A;  5HRO B;  3HSG A;  4URQ U;  1S9G A;  3HOW K;  5DDO C;  2VJU A;  3N28 A;  3D54 A;  4KJI A;  3QRP A;  1GEH A;  4EO6 A;  1X0F A;  2CQ4 A;  3HHD A;  4LFC F;  4USW A;  5A8R B;  2CQ2 A;  2AGQ A;  3PIP Q;  1VRU A;  4F02 A;  2MKY A;  2R7U A;  2YWW A;  4ZLP A;  2B8P A;  1Y7P A;  1MMD A;  4MAK A;  4B3M J;  1TWG C;  3QJP A;  4WK1 A;  1IKW B;  4CO1 A;  2C2N A;  5CD4 H;  3KJQ B;  4DSL A;  1HBM B;  2JEI A;  2IDE A;  1BQX A;  4H4K A;  3HFK A;  2UUB J;  3HOW C;  4GRS A;  2OEL A;  4DUY F;  4EEY A;  5HAO A;  4Q0B A;  4P74 A;  1WF0 A;  3BO2 A;  1YBU A;  2IIH A;  4A93 K;  2H48 B;  4MIW A;  1LFP A;  4NX9 A;  1NPK A;  4J9U E;  3FJ2 A;  3UWT A;  5IQQ A;  4DN0 A;  1GTH A;  2XO6 A;  4DR4 J;  2E44 A;  1RAF B;  1LWE A;  1TL7 B;  1IM4 A;  4L6V 3;  2VA3 A;  4MIB A;  1J5O B;  5E2Q A;  3QIP A;  1HNV A;  3THP A;  5L9N A;  5LL6 d;  3G8T A;  2DNN A;  1FJG J;  5CJ9 A;  4U8V A;  3VAF A;  2DNR A;  4I6A A;  1V3Z A;  4YFN A;  2ZM6 F;  1F7U A;  1G3O A;  2HK3 A;  4LF5 J;  2ZBC A;  3FKI C;  3G82 B;  3OHA A;  5KFB A;  1O6X A;  1IQZ A;  2F3J A;  2GA7 A;  3A8K A;  3GII A;  2ZEJ A;  2DNH A;  1Y3K A;  3T19 A;  4C9D A;  4P7V A;  2C2M B;  3QPI A;  4I6W A;  1S7H A;  3AD8 C;  1VR6 A;  4O44 A;  3NNC A;  2NQP A;  4N5S A;  3HVR A;  4DFJ A;  1IE0 A;  5IC6 B;  2J0Q D;  1CJT A;  3T02 A;  2PI4 A;  2MKS A;  3P5T L;  4P9S A;  5T14 A;  3NNA A;  2BX6 A;  5A0Y B;  2HFS A;  1HNX J;  4CTA A;  1VQ8 S;  1LW0 B;  1O51 A;  1ZQ1 C;  4A3I C;  2FJV A;  5IT9 Y;  1ZBT A;  5KG2 A;  2LQJ A;  1R27 B;  1B4S A;  2NUU G;  1S6O A;  4ZPT R;  5MAO A;  1XIQ A;  2QLF B;  2LQ5 A;  3J81 j;  3AOB A;  4JB8 B;  2VFV A;  4DEZ A;  4DR6 J;  3BH7 B;  1QDU B;  1BLU A;  1TMJ A;  2DH7 A;  1X4G A;  3M32 B;  1YVF A;  2HUR A;  1XMQ J;  1TWH K;  3UPF A;  4ZIV A;  2VPZ B;  1UPM B;  3TA0 A;  4J9L A;  2PE8 A;  5AXK A;  1GMW A;  1UFL A;  3KLG A;  2DRD A;  5G0R B;  5CCL A;  2XLI A;  3S16 C;  2V8V A;  3GTM K;  3CDA A;  3NAH A;  2VQF J;  1INN A;  2YNG A;  1G1X A;  4A3B K;  2FD2 A;  3VZH A;  3GEE A;  4NA2 A;  4C48 A;  1LWF B;  2GFF A;  2MEW A;  3AD9 C;  2D1C A;  4HLB A;  1QSL A;  1TL1 B;  3PW5 A;  1R8A A;  1RQ0 A;  4YN3 B;  4RWX A;  3TOQ A;  4ID5 B;  4LJM A;  1QAX A;  1RCO B;  1QVF R;  5E3P A;  4TQS A;  5M5W K;  3HPO A;  1ZM4 A;  2QO3 A;  3N6M A;  4DV6 J;  1FDD A;  5F9N A;  1T05 B;  4EBD A;  3T5L A;  4NLG A;  1L3S A;  3SDE B;  1P1L A;  4FF4 A;  3T5J A;  1FE4 A;  3P45 B;  4LIR A;  3BGF A;  5KFS A;  2K7J A;  3J81 Y;  2YKQ A;  4OX9 F;  1C0T A;  2CQI A;  5DLF A;  4NML A;  4EWT A;  4B9N A;  2NVX K;  1IR1 A;  3M4O K;  2R4F A;  5GVQ A;  5CAA A;  1XZQ B;  1YSJ A;  3LGM A;  3ENQ A;  1H73 A;  4KKO B;  3BR8 A;  5HAT A;  4F0H A;  3IWL A;  1CUL A;  2CAJ A;  5LMU J;  1AB4 A;  3R8Y A;  1O28 A;  4I2P B;  3Q8R B;  2ZUG A;  3QRQ A;  5IM0 A;  4P2M A;  2XQC A;  3IBF B;  3HJV A;  4P71 A;  1WSR A;  3QAU A;  4C3J K;  3GTO A;  5KOX A;  5F8M A;  2HRT A;  1V3S A;  3ET6 B;  3D6T B;  4IG3 A;  3DLE B;  3GTQ K;  3VAI A;  3DU6 A;  4K7Q A;  4LRF A;  1CUL B;  5H1S V;  2C42 A;  1DTT A;  2Z56 B;  2XS5 A;  1NND A;  3BYR A;  2A0F B;  4OJG A;  2G0I A;  1GMW D;  2LFV A;  3W61 A;  1FJC A;  2OFH X;  2R8G A;  2LKZ A;  2GO8 A;  5DS7 A;  2XHW A;  1AZS A;  5KG3 A;  2ZH3 A;  3DOK B;  2OSR A;  2R7W A;  3NLC A;  2KFZ A;  4TY8 A;  2MZR A;  5D6G A;  3OFF A;  3MED A;  2DD8 S;  4WII A;  3GPA A;  2XGQ A;  3V6J A;  1L3K A;  3FC9 A;  1U6B A;  3GTK A;  2XC9 A;  4B17 A;  1VDH A;  2CPX A;  2JWN A;  4DPO A;  1UWB A;  3KJN B;  2GIF A;  2G1D A;  4ZIW A;  4P2F A;  1D09 B;  4PAA A;  4OYW A;  3NRB A;  4H4K C;  5E0O A;  3DDK A;  2POK A;  1VBY A;  1HQE A;  3GON A;  3IC1 A;  5C4J K;  2JC1 A;  2LXU A;  2J7K A;  4XDD A;  3W2V B;  1VIX A;  2XI3 A;  2UZA A;  2VFT A;  1C4C A;  4IFV B;  3GV7 B;  4RUB A;  4DCO B;  2VFS A;  3I5C A;  3DLK A;  4C3I C;  3HFV A;  2KM8 C;  1ZM3 A;  3BF4 A;  2XBP A;  3LP0 B;  3LAN A;  1FXR A;  2ERR A;  3JSR A;  5M2U A;  4OYB A;  4NI2 A;  4DV5 J;  1KNZ A;  3VHQ A;  2OGU A;  3N4W A;  3BSA A;  1Q8B A;  2ROP A;  4OZ2 A;  5BR8 J;  4PYD A;  4OI3 A;  5LSR A;  2OTJ S;  4KC6 A;  4LRC A;  3H90 A;  2BQU A;  1U1O A;  4JUZ A;  3NXZ A;  1YG0 A;  5E33 A;  2DCU B;  2CZ9 A;  4QU6 A;  3BQ2 A;  5IWA F;  1PAE X;  3OLA A;  1NM2 A;  2WON A;  3FUY A;  4LFA F;  3HHL B;  3V5R A;  4DWI A;  3CXC R;  4UOH A;  1HYS A;  4C0O C;  2X3G A;  4HDH A;  4LK0 A;  3SFG A;  1D8Z A;  3KHR A;  3FSY A;  3M8R A;  5CA5 A;  1VRQ C;  8RUC A;  3D1O A;  4QW9 A;  2YY3 A;  1SUQ B;  2X1B A;  2NXC A;  4LMZ A;  4RW7 A;  2BRL A;  2LVW A;  1JXV A;  5L9X A;  2CW0 A;  4DL5 A;  4KN7 A;  2XG8 A;  4O3R A;  4Y2I A;  1KQ4 A;  3M8S A;  4OYM A;  3TAQ A;  3CJQ A;  3R7S B;  1O27 A;  1FK9 B;  3H5S A;  1XBW A;  5T7L B;  4GTE A;  4KKO A;  3RZA A;  3UCZ P;  2NR0 A;  2FGO A;  1O24 A;  3HVW A;  4MK9 A;  1K1Q A;  1XNR F;  4V19 X;  3T3F A;  1NJY A;  3G6E S;  2AZ3 A;  2UUC F;  2FC9 A;  4X4Q A;  2O67 A;  1RLC L;  3LGN A;  2I38 A;  5J2N A;  1YGY A;  3N6L A;  3HOX C;  4LRA A;  2C2O B;  3GYN A;  4C8N A;  3CC7 S;  2KFN A;  1DTT B;  4DV2 J;  3EUN A;  4ECX A;  3CD6 S;  3IWX A;  4CO0 A;  3LF0 A;  5KFG A;  4OZL A;  5E3C A;  3BUE A;  1FEH A;  1TWF A;  4JI6 J;  4BBR C;  3OEP A;  1PSD A;  1Q5V A;  2P8I A;  4JI5 F;  2B4U A;  2BM1 A;  1TL4 A;  3I0R A;  5DQI A;  1F93 A;  3SV4 A;  2XMV A;  1WTF A;  1RT5 A;  1VLO A;  4KGX B;  2QA4 G;  3AFG A;  1J2V A;  3HXA A;  1WKK A;  4FXV A;  1Y0H A;  4F36 A;  1RUS A;  5HMX A;  3G4S S;  4WF9 Q;  1M90 T;  1S9E B;  1JXE A;  2Y9H A;  4NYP A;  2H54 B;  2KZM A;  5HMY A;  5CD4 A;  3PW0 A;  3G86 A;  1VLY A;  2GQ2 A;  1N0U A;  3VAK A;  3G87 A;  2KT3 A;  3M4O C;  4OIO A;  3S15 K;  4C11 B;  3IR7 B;  1S1T A;  3QT7 A;  2Y3Y A;  3KMS A;  4ZLL A;  3MEE A;  2MQP A;  2L48 A;  3R9L A;  5IP9 K;  3HKW A;  4ECY A;  1PJ5 A;  4XO0 A;  1NK0 A;  4EBE A;  1Y1V C;  4DPT A;  5B0A A;  5CH7 B;  4YY3 F;  1Q4R A;  1CBK A;  2HND A;  3PYE A;  3G6V A;  4W4M A;  2HHV A;  2GSO A;  3J7A 1;  2AJF E;  2GX8 A;  2V6A A;  2O3D A;  2M3D A;  3ICL A;  4JI8 F;  4ZVU B;  2F4V J;  3IRX B;  2A1B A;  4HT7 A;  3ETO A;  2P8T A;  2D9O A;  4F4A A;  2EFO A;  2ZIT A;  4ZP9 A;  4DV7 J;  3H4D A;  1S57 A;  4I2Q B;  1I94 J;  1LW2 A;  2CYY A;  5HRO A;  2VV5 A;  3NWG A;  4QIE A;  1A6L A;  2HHH J;  1JLQ A;  3RAM A;  2YX1 A;  3GCW P;  2MSS A;  5L1J A;  4DR3 J;  4WU2 A;  2HIQ A;  4A48 A;  5IYD C;  2JDJ A;  2E2H K;  4DR7 F;  2KL8 A;  4KHP F;  1SIZ A;  3MM6 A;  2Y0B B;  4X4O A;  4EK2 A;  1VQ4 S;  1Y5I B;  4LSN B;  1S97 A;  3T01 A;  4KTQ A;  2JA5 K;  1S10 A;  2DNL A;  4P10 A;  4X4P A;  2PHC B;  4ZPA A;  1E6V A;  2X3D A;  1RXO B;  3R2D J;  2WTF A;  1WD6 A;  4LVO P;  5E41 A;  3PNI A;  2XS7 A;  2GVD A;  1U6Z A;  1UZH A;  5M2P A;  2RQ4 A;  4X4S A;  1UWB B;  3N01 A;  4CM0 A;  2VDH A;  1SC3 B;  1GX6 A;  2MXY A;  3EM1 A;  3R5B A;  2L41 A;  4GKJ J;  4KFB B;  1TWH C;  2H4Y B;  5L1L A;  1NDC A;  5RUB A;  1NH8 A;  1I1G A;  3LAL A;  5GAG U;  3GTQ C;  1JMT A;  3VQS A;  3WDO A;  4KIA A;  1DHM A;  3LA0 A;  2RH3 A;  4DV2 F;  1EP4 B;  2FHO B;  4GO5 X;  2QA2 A;  4ATN A;  3MMA B;  2R2T A;  4OZ0 A;  2NVY A;  1RU0 A;  1BC6 A;  2ZHB A;  4TU8 A;  3S8S A;  5DDR C;  4ERD A;  2OI2 A;  1ARO P;  3PM9 A;  3T1Y J;  1R0A B;  1JLB B;  2E7V A;  3BPS P;  3PX6 A;  1VQ7 S;  4JV2 A;  2ZBI A;  4CIO A;  3HHL A;  2L3M A;  5HN0 A;  1KFD A;  1VBZ A;  3S1N C;  4A3B C;  4YB6 A;  1OWX A;  3HOU C;  2UP1 A;  1OY9 A;  2M9K A;  2ZUE A;  2K06 A;  2C3Y A;  3WIU A;  1CSJ A;  1EQM A;  4YQW A;  1DUR A;  2DHS A;  1FKA F;  2CZV C;  1QJH A;  4RNM A;  4BC9 A;  2RHS B;  3L7P A;  2E5G A;  3I96 A;  1S0N A;  4CH7 A;  1XZP B;  2GMJ A;  4RUA A;  5GAG I;  3ZZY A;  1UJ4 A;  4YS2 A;  3KHH A;  1K47 A;  1LEO A;  1UET A;  1NRK A;  4C11 A;  4LUB A;  4PEO A;  4CLT A;  4CH1 A;  5KT2 A;  2WVD A;  4Q44 A;  1Y1W A;  3H0G K;  4GO7 X;  4RW9 B;  4RU2 A;  4K4S A;  4IRC A;  3OVS A;  3PRB A;  4OYP A;  4KM9 A;  3TJ8 A;  4JI7 J;  2I5J B;  4KDD A;  1R7I A;  4ED1 A;  4RW7 B;  1N36 J;  2DR8 A;  4C6A A;  9ATC B;  2ZZM A;  4JI7 F;  1S1U A;  1ZTT A;  1SJ4 P;  2CPZ A;  3V6K A;  4OI1 A;  1P8G A;  3ZZR A;  3I0S A;  1AXQ A;  3D1Q A;  2V5H G;  1F9E B;  4Y2A A;  4WE1 A;  1CS4 B;  2ZE2 A;  3SZ2 A;  1VQ9 S;  2BAN A;  2ZBQ A;  4EGL A;  3EGZ A;  1USO A;  4KAW X;  3VV2 B;  2XO7 A;  1U2R A;  4J9N A;  1KSP A;  1LW0 A;  4L74 A;  2AGO A;  3HD1 A;  3MHY A;  2V4J B;  3CME S;  3UI3 A;  1NDK A;  1T0T V;  1KLM B;  4PXB A;  3S2H C;  4NYZ A;  5F3Z A;  4QJV B;  1RTZ A;  5KTQ A;  2VDI A;  2OPS B;  3TX0 A;  2XWX A;  3TAR A;  5D0R A;  1HD1 A;  5ADZ A;  2W2O P;  1IBK F;  2V4Q A;  3PR5 B;  2NXE A;  2W7P A;  2R92 A;  4CO5 A;  1VH2 A;  1LK7 A;  1RHJ B;  1QY7 A;  3FKI K;  4AE5 A;  4FPI A;  2E1A A;  2WBM A;  2C2Z B;  3Q8P B;  1PJ6 A;  4LF6 F;  3AA8 A;  3KK3 A;  3T1A A;  2JEG A;  2UVW A;  2NUH A;  2MQQ A;  1S0V A;  4ZPB A;  4YOE A;  1VGX A;  1GQE A;  3G82 A;  4ZVF A;  2H5E A;  1DQA A;  4NRU A;  5BYQ A;  5KG4 A;  3GTJ A;  4OYI A;  3AXM A;  1WF2 A;  3PDN A;  4K50 A;  4A3M K;  4A3K C;  1JIH A;  2DGO A;  5IOS A;  1KR4 A;  2B4V A;  1FT8 A;  1I3Q K;  3SBM A;  4DDQ A;  1O25 A;  2M5Y A;  5LXR A;  1X5T A;  4UTG A;  2EFG A;  3C3L A;  1VOM A;  3MUM P;  4NA1 A;  3GTM A;  3W5Z A;  3KLI A;  4WZM A;  2V8G A;  4QR2 A;  3GDZ A;  4USK A;  5AJ3 J;  2MY7 A;  2KKH A;  2NYH A;  3OXL A;  3W1Y C;  1K8A T;  1X5P A;  2XSJ B;  1C1C B;  2Z4P A;  4C7Q A;  2CUY A;  2AJ1 A;  3LPY A;  2R7S A;  4LF4 J;  1MSW D;  4CLY A;  2RKI A;  1TEL A;  4GZY A;  2YNH A;  4K4Y A;  3MPW A;  4XK8 C;  1AUS L;  1RZM A;  3LH2 S;  3KLF A;  1MG7 A;  2DR7 A;  3S1M C;  3KLG B;  2AJQ A;  4B9V A;  2U2F A;  3TVZ A;  2OUG A;  1JKH A;  4USH A;  3K7A C;  1V3R A;  3PAC A;  3MOZ A;  3MPY A;  3QIP B;  4A8X A;  2ZKU A;  3KXD A;  4XCH A;  3HLU A;  2V2Q A;  1AFI A;  1QVG R;  4WIQ A;  2KHD A;  3CWJ A;  5A8K A;  4KM8 A;  4Y2K A;  2ZE2 B;  3CJ5 A;  1PKU A;  1I94 F;  2FJD B;  3EYZ A;  2FHK A;  1TWH A;  2PMH A;  3DLH A;  3MM7 A;  2JLF A;  3MUT P;  1S77 D;  2GO9 A;  2YQ0 A;  5FD1 A;  3GTO C;  1T9T A;  4ED2 A;  2OHD A;  4WJ3 M;  1NH7 A;  1TUV A;  1HNW F;  3Q83 A;  1D8Y A;  2FB0 A;  2W24 A;  2KTQ A;  2QFJ A;  3BGL A;  4AL5 A;  1IQ0 A;  1S1V B;  1IXK A;  3GMG A;  3BGR A;  4JI5 J;  2YWF A;  1X8D A;  3W2W B;  1XJW B;  4NLS A;  2E2J K;  1SL1 A;  4ZP8 A;  4ZVQ B;  5B0G A;  5C25 B;  2HRY A;  4I69 A;  5J2Q B;  2ZOF A;  1FEE A;  1M1H A;  3GB0 A;  4BXX C;  3OSP A;  5C25 A;  4A3K K;  2VIH A;  2YNI A;  4MH8 A;  2ZH8 A;  4M5K A;  4K5R A;  2A10 A;  5KFJ A;  2VL1 A;  1FNX H;  1ZXO A;  4ZVG A;  4URS A;  1QM9 A;  1TL7 A;  4B08 A;  2DGT A;  3V4M A;  3M8P A;  3M9O B;  2ZJR Q;  1S6P B;  4QU7 A;  3GTP K;  4K4U A;  3AAW B;  1ZYQ A;  3NAI A;  5HVG A;  1UPP A;  5C4X K;  3P96 A;  4XPC A;  2AMC B;  1GK8 A;  1EET B;  3H8Y A;  1TVR B;  3CCT A;  4B9S A;  3SIP B;  1XNQ F;  2BKP A;  2GGP A;  3I4P A;  3D4J A;  5CZV A;  3OTB A;  3TJ9 A;  4DQP A;  2PMZ D;  3EDR B;  2BE2 B;  1MN9 A;  1OJ4 A;  4C8L A;  2D41 A;  2GCF A;  1WIH A;  1S12 A;  3BKF A;  4CCH A;  2DYA A;  1UEV A;  3RAX A;  3CJ8 A;  1JNZ B;  2J5A A;  3M1V A;  3GTP A;  1T8E A;  2I1R A;  4EYH B;  5IS2 A;  3UDL A;  2WBR A;  3ADA C;  4Y0F A;  2QFI A;  3ZO7 A;  3I9Z A;  2Z58 B;  3K5L A;  1KQF B;  5ETT A;  2MZS A;  5IQ6 A;  4MKY A;  2B5J B;  4UOF A;  4RPF A;  4G7H A;  1SC4 B;  5K8M A;  1RTH B;  4M5H A;  3G4A A;  3B8H A;  1CQM A;  3A1Y G;  4WFN Q;  1W25 A;  5BR8 F;  4KHP J;  3N5B A;  4ZA1 A;  4B3M F;  1MRO B;  1R0C B;  3Q89 A;  4QWA A;  1T9Y A;  1PYO B;  2XCO A;  2HS0 A;  1HI0 P;  3FOE A;  4NZ0 A;  4ID8 A;  1NXI A;  4K5S A;  4CLS A;  3GFX A;  2KRR A;  3UNY A;  4ZJO A;  3OR1 A;  3SSR A;  4DXL A;  1MU2 A;  5IYC K;  1FRM A;  1NLK L;  2WAQ L;  2P5M A;  4QW8 A;  4DSI A;  4NOI A;  2K1R B;  1C1B A;  2XMJ A;  1F5B A;  5L39 A;  2YPZ A;  1R43 A;  2HVE A;  3L7U A;  1TL5 A;  2BR0 A;  2BOA A;  3FSX A;  2PT0 A;  2FLN A;  4MFB B;  2PEH A;  5LM7 E;  3W9H A;  5D4N A;  1X60 A;  1M5H A;  2HWT A;  1XMB A;  1NO8 A;  1IKV A;  3M8Q B;  2KWA A;  2ZD1 A;  4ED7 A;  4RNN A;  2QSW A;  4X4N A;  1ZPW X;  1I51 B;  2D7S A;  4C3I K;  1VIS A;  3U02 A;  1Y9O A;  1RK8 A;  1X5O A;  3DN9 A;  1Q53 A;  2JOQ A;  3O6Q A;  4C3K A;  1FJE B;  2B63 A;  1VK3 A;  4MQ9 A;  1QUP A;  1W7W A;  2KHC A;  1R8H A;  4USJ C;  4FXW A;  2MQO A;  1F9H A;  1TWC A;  4OMF G;  2KU7 A;  3A8J A;  1LWF A;  1NME B;  2B7C B;  4DQS A;  1JJH A;  1F3V A;  1WTB A;  1HNI A;  1ACM B;  4HHJ A;  4LSL B;  1VCT A;  3DFE A;  3JYT A;  3CF5 Q;  1DCO A;  3NY0 A;  4BLB A;  1SKW A;  3LUY A;  2QJ3 A;  3PYD A;  1N48 A;  4A8S A;  4MTP A;  5H9F K;  1YJ9 S;  3GWC A;  4NCB A;  3M30 B;  3FOF A;  1LXJ A;  2BW2 A;  3QT5 A;  1RAD B;  4WFB Q;  3NUH A;  2AEM A;  4F26 A;  1M0S A;  2Z2M A;  1ZH5 A;  4FBU A;  4PWD B;  4M5M A;  2E66 A;  1LXN A;  1AZS B;  1V9O A;  4J9P A;  3VVU A;  3I4M C;  2OEJ A;  1U1N A;  2R7Q A;  1QTM A;  3QFW A;  5GAH U;  1FFG B;  5BJR A;  4C3L A;  5THW A;  4KGM A;  2HHS A;  3HDS A;  2QEX S;  3C15 A;  2BYC A;  2VG7 A;  3DGP A;  5JVO A;  1WHW A;  2VFU A;  4C3H C;  3GE9 A;  4XTT A;  4OX9 J;  3MM8 B;  3TA2 A;  4LJZ A;  3GP9 A;  4OIN A;  1NJX A;  2VF3 A;  3M8Y A;  1NDP A;  2WSF C;  5EWE A;  5K14 A;  2W8K A;  3NKY A;  3UE2 A;  3PR4 A;  1SI9 A;  4QIW D;  4TY9 A;  4OJH A;  3EXC X;  2RH6 A;  3FFI A;  3FQK A;  4FVC A;  2M7S A;  3Q23 A;  1X5S A;  2YH0 A;  1C2P A;  1ZPV A;  3PO3 C;  4MYU A;  1UL3 A;  2C3O A;  2CJY B;  3MDF A;  3LAM A;  3PO5 A;  2ASD A;  2V50 A;  3BGU A;  1SV5 B;  5ETR A;  2VQF F;  3M3Y C;  4O3Q A;  1W26 A;  2PI5 A;  2AYE A;  5D15 A;  3GFH A;  2LEP A;  1U24 A;  3MD3 A;  5C4J C;  2H5I B;  4WTY A;  2D6F C;  4RNF A;  2E2H A;  2CQH A;  2E5L F;  3PFE A;  4DR5 F;  1ULR A;  3CNQ P;  3KLE A;  1ZM2 A;  3SSS A;  4YFX A;  2AX1 A;  2GAG C;  4USV A;  1CC8 A;  2JVR A;  3DRR A;  2B9X A;  5L8R C;  3F44 A;  1KFS A;  2EKN A;  4FZV A;  5HQL A;  4PG4 A;  1ZVU A;  2DGX A;  5EWF A;  2HPU A;  1K83 K;  2OLW A;  5KFX A;  4LF9 J;  2EG2 A;  2VUG A;  3BJY A;  4A3F K;  1NK5 A;  1U48 A;  4WZQ A;  4PWD A;  1FNO A;  2OP5 A;  4OV6 A;  5D77 A;  1KD1 T;  2XTJ P;  1TKT B;  4NYO A;  3E51 A;  4ZS6 A;  1L5U A;  2EW9 A;  4NCG A;  3OW2 R;  2FY8 A;  3T1Y F;  2OSQ A;  5J2P B;  7FD1 A;  1AFJ A;  1TQL A;  4N77 A;  3EGV A;  1KLM A;  1FO1 A;  3PIO Q;  2OTL S;  3J7Z 5;  1ELO A;  2LLZ A;  4C2M A;  4UZB A;  2AYM A;  4NLV A;  2ALY B;  3UR3 C;  2QA4 S;  1MU2 B;  4DFP A;  3N0C A;  4YHH F;  2O66 A;  2HNZ B;  3SQO P;  1LWX A;  2N3L A;  3GCX P;  1JJ4 A;  2KT5 A;  3WC0 A;  1NDL A;  1CG2 A;  3B4D A;  3FEY B;  2C2D A;  2YU9 K;  1CJT B;  3DM2 B;  5F8J A;  2DNP A;  4DLG A;  3BV8 A;  3H5U A;  3GTG K;  1JK9 B;  5A2Q Y;  2Z2L A;  4MYT A;  5G4D A;  1TR0 A;  1JLA A;  3S1R C;  3HOX K;  4CLK A;  4C4W A;  5AT1 B;  5C42 A;  2HFU A;  1Q78 A;  2BOP A;  1JLG B;  1VQ6 S;  2GHW A;  3R27 A;  3M2R A;  4NCG B;  1FWK A;  4TVA B;  2BVZ A;  3PHE A;  2GQQ A;  4P5B A;  2FJW A;  5IYB K;  2RQK A;  2VBW A;  2DIT A;  1VC5 A;  1U8S A;  1AT1 B;  2L9N A;  2OML A;  1N33 J;  2WW4 A;  2VBX A;  2DVI A;  2Y1R I;  2JLG A;  4EO8 A;  4LF7 J;  3RRH A;  2UUW A;  1RAI B;  3AQO A;  4A8K A;  4CM2 A;  4DR3 F;  1WUU A;  4O23 A;  3CCU S;  3J7Z T;  3I4N K;  3MCM A;  3OR1 B;  3MMB A;  2A6E A;  2MYF A;  5F8I A;  3HZE A;  3D1H A;  4KGZ B;  1REV B;  2CIM A;  3DDI A;  1TWC C;  4KYZ A;  4ETZ A;  1VBX A;  1CS4 A;  4ZH4 A;  2WK4 A;  2B4O A;  2DCL A;  2XZW A;  3C14 A;  4HI1 A;  1RAO A;  4NXN J;  1RT4 A;  2F4V F;  3NEK A;  4U96 A;  3BBC A;  3BS9 A;  1UVI A;  1FDN A;  4DU7 A;  2RD5 C;  4ZVO B;  4CLU A;  4GTA A;  1TWG K;  5IM0 B;  2WB4 A;  4DQI A;  1Y1V A;  4USM A;  5HL7 Q;  3BSN A;  3MF5 A;  5LMN F;  2ALZ A;  4MEY A;  2W7O A;  1M5O C;  2R93 C;  4NMX A;  2ZOM A;  2YNI B;  3E2E A;  5CYQ B;  2HBZ B;  3S01 A;  1Q16 B;  3PO4 A;  3UNG C;  5HQM A;  4OFZ A;  3VGV A;  1WHV A;  1K9M T;  1FER A;  4FS1 A;  3KWM A;  2FJE B;  1NU4 A;  3ZNJ 1;  4OYZ A;  2PSZ A;  3D0G E;  5CZX A;  5KT7 A;  5I4M A;  2HAF A;  4ES1 A;  3KDO A;  3RRG A;  1I3Q C;  1QSY A;  2CNO B;  1HD0 A;  2GJ2 A;  4K8R A;  2CZ4 A;  2NYI A;  5KFD A;  1MN7 A;  2BZ2 A;  3BGO P;  4RX6 A;  3DHX A;  1HL6 A;  3GG1 A;  4KPC A;  2XI2 A;  1ZA2 B;  3FDS A;  4DI6 A;  3X3U A;  4R5P A;  2D69 A;  2KYZ A;  4B3T J;  4B3S J;  4TU7 A;  2CVE A;  4DQQ A;  3K7R A;  3OL6 A;  1U2F A;  1FTC A;  4RNO A;  2IM0 A;  4LQY A;  3IS9 A;  1FRH A;  1NCL A;  2J9E A;  3TQE A;  1UZD A;  3CT9 A;  3HCX A;  2UXB F;  2VAS A;  2R7Z K;  2BBE A;  2BJD A;  1RT1 A;  2DIV A;  1N5Y B;  2GHP A;  2MQ8 A;  2CNL B;  2JJ4 D;  4I2Q A;  3TYT A;  3H4B A;  1LK5 A;  2NVQ C;  1YX2 A;  4WYL A;  2FDN A;  3S2D K;  2VH7 A;  4LF7 F;  4KFB A;  1F3F A;  4YHH J;  2ABY A;  4IRK A;  3IRX A;  5TMC A;  4EU0 A;  4RBU A;  3QLH B;  2IM1 A;  5A8W A;  1NEE A;  3GG0 A;  4DS5 A;  1HQU B;  1R9T C;  5ETP A;  2AEF A;  3G9C A;  2ILY A;  3LP1 B;  4KR0 B;  1N52 B;  1A0O B;  3TR5 A;  4RBV A;  2OKQ A;  2DPI A;  3AT1 B;  2RSQ A;  4LRE A;  2Q1L A;  3PEJ A;  2R92 K;  1WEY A;  2ZC3 A;  3H2V E;  1MLA A;  1S99 A;  2ATL A;  2FVR A;  1NPP A;  1FJG F;  2F8M A;  2YKN A;  3AQP A;  2R7R A;  1OYD A;  2HHW A;  4O0I A;  4LSN A;  3U1L A;  2IM3 A;  3PKY A;  1HAR A;  2FIU A;  4DX7 A;  2IMW P;  4UUX A;  3QNW B;  3P4U B;  2XY6 A;  3JQM A;  2WOM B;  4RWW A;  3T6J A;  1EQ0 A;  1NPR A;  1W2I A;  1X9W A;  3MWB A;  2KRB A;  2NRE A;  1HW9 A;  1RT6 B;  4QWB A;  3PZP A;  3L4J A;  3TI0 A;  4F0K A;  1NBE B;  3DXS X;  4WP8 A;  3B78 A;  2FZG B;  4RW6 B;  4C8K A;  1WG4 A;  1TZ0 A;  1RTJ B;  1FX2 A;  2I6W A;  3QX3 A;  2LCW A;  4ED4 A;  3POT A;  4KRW A;  1HI8 A;  4YFK A;  4AQY F;  2G0J A;  1WQG A;  1NHU A;  1R8P A;  3FSI A;  1J6X A;  1DRZ A;  2WB1 D;  4Q2M A;  2KVI A;  2XCQ A;  3CJK B;  3LGH A;  4OQJ A;  3NWR A;  4KB2 A;  3AJ2 A;  4U67 Q;  3GSD A;  1IM6 A;  1RKJ A;  1EAR A;  1H7X A;  1FFS B;  5F8H A;  2Z30 B;  4Y52 C;  4RR5 A;  2HBQ B;  1TFW A;  5C4X C;  3MMC B;  3DLL Q;  4OX8 A;  3ZNU A;  4L72 B;  1ZET A;  3CGI A;  5A8R A;  5KFI A;  1PG5 B;  5E3A A;  4ILL A;  3PEH A;  2CPD A;  1BE4 A;  1N6Q B;  1NUE A;  1RA7 A;  2N82 B;  3GJT B;  4N56 A;  1U2C A;  4CO2 A;  2I2Y A;  4XLP A;  2CQC A;  4DL4 A;  4DSK A;  2A18 A;  2CJX B;  5FJ4 A;  2IJR A;  4R8U B;  2B9W A;  5DM6 Q;  3Q8Q B;  4WTO B;  2PFD A;  1WI8 A;  2IRY A;  4IG0 A;  4ZVE A;  5KG5 A;  1FKO A;  4FN5 A;  2B8Q A;  2LXF A;  1RTI B;  2C1E B;  1TK0 A;  2V2Z A;  3K2Y A;  3TUZ C;  3KFW X;  3D6F B;  1BWE A;  3QWU A;  3KG0 A;  4O0N A;  4HVZ A;  4N8O A;  3CJS A;  1VJQ A;  2HND B;  2CWK A;  4WFY A;  2HNY B;  3KG4 A;  4NLY A;  1WG5 A;  3F0N A;  5JVG Q;  3HF5 A;  4GFQ A;  3SQG B;  3HHK A;  1HMV B;  1QAY A;  2FYX A;  3CB4 A;  4JI2 J;  2BQ3 A;  1SH0 A;  3OTE A;  1G4C A;  3UVJ B;  1FKP B;  3QSY B;  3B82 A;  1CJU B;  5F9L A;  2GQC A;  4DSE A;  2LEC A;  5MLC V;  4FYV B;  5CCM A;  3L3C A;  1Q82 T;  1GMV A;  2UXC F;  4USU A;  3C8Y A;  4KHM A;  1HBN A;  4B3S F;  1Q8L A;  3S1M K;  5KFQ A;  2H65 B;  4NXM F;  5B0B A;  4FF3 A;  2R2U A;  2PFF B;  1WEZ A;  2BJ8 A;  3MM7 B;  3OPK A;  2ZNY A;  2P9E A;  3UFC X;  2LYV A;  1X4D A;  2XCA A;  3JAM U;  4PQU B;  1R9T K;  1TU0 B;  4IQX A;  1HHS A;  5ITH A;  1U47 A;  1DD5 A;  4CWB A;  2ILZ A;  3LTO A;  3HJF A;  3CCM S;  2XSJ A;  4DV6 F;  2OO4 A;  3M32 A;  1GXT A;  3HO1 A;  2NVQ K;  1HBU A;  2DRB A;  1D1U A;  3M6U A;  2CVI A;  1UV7 A;  3V6D A;  3IFE A;  3I4M K;  2LEB A;  1TWA K;  4MKV A;  3TUJ C;  2DPJ A;  1YRT A;  2ROE A;  5GAD I;  1S9E A;  3KMQ A;  3OVB A;  2IHR 1;  5LSO A;  1DBD A;  4XDC A;  4X4R A;  2B63 K;  5J1E A;  4FYX B;  6AT1 B;  2XM3 A;  2QE5 A;  5K5M A;  2CQB A;  3R5A A;  1EET A;  2FHJ A;  1BJT A;  1TK5 A;  2EBG A;  1KLN A;  3SMZ A;  5L46 A;  2CDR B;  4ED3 A;  2HZV A;  4IOC Q;  3RW6 A;  2FJB B;  2I5J A;  1RT2 A;  2YNG B;  3D9B A;  1VI7 A;  3POT B;  3KK2 A;  2Y1L B;  1Q86 T;  3N9U C;  2CPE A;  4LBI A;  1CJK B;  2DNG A;  1NSA A;  1T03 A;  1WDD A;  3TAN A;  1WAC A;  1HNX F;  3DI6 B;  1U1M A;  2I9S A;  4HR2 A;  2Y0S L;  4USI A;  4LBP A;  5B7W A;  4KC5 A;  1GXL A;  4ZCM A;  1BWV A;  2J9D E;  1Q95 G;  2XSF A;  3VTI A;  1HYS B;  1M5K C;  4Y3C A;  3MMJ A;  2JX2 A;  1DQ9 A;  3S1T A;  2GC8 A;  1ZOT A;  3FVY A;  1SJ3 P;  4H4O A;  1XXB A;  4PPZ A;  1VRT B;  1VC0 A;  2AU0 A;  3QGH A;  4JV0 A;  3W66 A;  4XSZ A;  2DIS A;  2JA7 K;  2ZBP A;  3AH6 A;  4A8W A;  2BE2 A;  1SL2 A;  4PQU A;  2R8I A;  4MEX A;  3N3Y A;  4OLO A;  1YWX A;  3L95 X;  2HQD A;  3UD4 P;  3A4T A;  2EEY A;  2DGU A;  3N5F A;  3HOZ K;  2CPI A;  3VAG A;  3MM8 A;  4OIX A;  3EGW B;  4LR2 A;  4I4B A;  3KK2 B;  1NSK L;  1WC3 A;  1QLN A;  2Q79 A;  2N4D A;  4B3O A;  3CD7 A;  3DRP A;  1T9W A;  2WVB A;  2N7Y A;  3UDC A;  5HMZ A;  3TEG A;  3SFU A;  1SJQ A;  3AHP A;  2COL A;  3B54 A;  1VQM S;  4LR7 A;  3ZFV A;  1MML A;  4LF1 A;  4DUY J;  2ZJP Q;  2IPO B;  4IFY B;  1ZS6 A;  5KFC A;  2JA7 A;  5I42 B;  4LRD A;  4DN9 A;  2JA6 C;  3HXM A;  3O44 A;  4IKA A;  2BM0 A;  4DSJ A;  4Q43 A;  2V2V A;  5HLF A;  2HHX A;  4IR1 A;  1R3N A;  4DR2 J;  2FY1 A;  3CIZ A;  3VQT A;  4P75 A;  3OFH A;  1LKZ A;  1FRK A;  2ZH2 A;  5DG7 A;  3DLG A;  2DEI A;  4KH1 B;  6FDR A;  1XPP A;  3LP0 A;  2QL9 B;  1UWA A;  3KUH A;  4XSX A;  2VC0 A;  3GTG C;  4TYA A;  3ILJ A;  2VHG A;  1Q7Y T;  4HL9 A;  1XZP A;  4OI2 A;  4Q8E A;  4IO1 A;  5DQH A;  4TLR A;  4X6A K;  1TL1 A;  1VRT A;  4FDF A;  2IBO A;  3PX4 A;  1X31 C;  2E1P A;  5TJ3 A;  1N34 F;  4M5J A;  4OLP A;  2IYI A;  4CQ1 A;  2XMK A;  4RZR A;  4P7T A;  1HR0 F;  4OIR A;  3FFI B;  1IR2 A;  3DCA A;  4A3C C;  2QLX A;  1RYS A;  2V6U A;  4LF8 J;  3CVK A;  1EB0 A;  2V94 A;  3OJS A;  3PYF A;  1VK8 A;  1IKX B;  1V5I B;  4F67 A;  4X62 J;  2D3Z A;  4B3R F;  4TNO A;  2A2D A;  5D0E A;  2A3J A;  5IZH A;  2YU9 C;  4B9L A;  1RA6 A;  5GMD A;  3V2U C;  1ICE B;  2L9W A;  4R8U A;  1SKR A;  4DF8 A;  5EN1 A;  2PEB A;  1JLQ B;  5I3P A;  1VJW A;  2H51 B;  1HMV A;  4KSE B;  3CUL A;  1SXL A;  1WC1 A;  2U1A A;  1I6V A;  4JV1 A;  1DAX A;  1T95 A;  2B9Y A;  3GTG A;  5ETQ A;  2RML A;  4I2P A;  4BKW A;  4X64 J;  4DBQ A;  2RNE A;  2W9A A;  1HQM A;  4Q5V A;  5KFO A;  1IWG A;  1XK8 A;  4LQ3 A;  1RHM B;  3VCD A;  1BHN A;  1S1T B;  4DZD A;  5FLX Y;  1PIE A;  1RAE B;  2DGQ A;  4AND A;  4PUO A;  2JA5 A;  1V5V A;  2V6T A;  2G0C A;  3H2L A;  1U1L A;  3DLB A;  1J6W A;  1L3U A;  3I31 A;  4OHW A;  3CO9 A;  2M8H A;  5L1K A;  2I0X A;  5KFU A;  4RMF A;  1UFW A;  4N47 A;  4DOZ A;  4Z2X A;  1BY9 A;  4IOB A;  3EDQ B;  1BDF A;  3V4I B;  2VIC A;  4ECZ A;  2H1Y A;  3L4B C;  3HVT A;  3W9J A;  1S9G B;  4C2M C;  1QUV A;  3GLJ A;  2XMT A;  1Z2Z A;  4UY8 T;  4ELV A;  1RAG B;  4H54 A;  2CKW A;  1VBK A;  1M1K T;  4KB7 A;  1PYS B;  4EI2 A;  4BC7 A;  2VBZ A;  1I50 K;  3Q22 A;  4R0J A;  2F1F A;  5C2C A;  1VFJ A;  4RW9 A;  1TL3 B;  3HKZ D;  3T5H A;  3GTK K;  1RBA A;  4XIU A;  3F41 A;  2W4D A;  3UCG A;  2MPU A;  4OYA A;  2XEX A;  4KPY A;  2VQE J;  4OV1 A;  2V8D A;  4DL3 A;  1NAQ A;  2D9P A;  4ENO A;  3E3X A;  3IWN C;  1I6H C;  4OZ3 A;  4CT8 A;  4ZPD A;  4KMH A;  1X4C A;  1S6P A;  1H2U X;  2W9B A;  4ZPW R;  3QID A;  5KT5 A;  1HWI A;  1VQK S;  3NS5 A;  2ZWO A;  1KWM A;  1MWZ A;  3CJ0 A;  4ICL A;  3TP2 A;  2NS1 B;  3TZZ A;  4LRB A;  2E2I A;  2R92 C;  3M9N B;  4LSZ B;  4DL2 A;  2AV5 A;  3THV A;  4NI2 B;  3KK1 B;  2CNN B;  1PC5 A;  5D3G A;  4JP8 A;  2VOO A;  3JS9 A;  3DI6 A;  1N0V C;  2YWK A;  5IOL A;  2PC6 A;  2OIH A;  3KHL A;  5HO4 A;  5LJ3 Y;  1FWP A;  1HPZ B;  4YEA A;  3QZ7 A;  1O26 A;  4FM9 A;  3T6B A;  3FGV A;  4ES3 A;  9RUB A;  5K8P A;  1VHI A;  1X9S A;  4IFV A;  1N5Y A;  2OAU A;  1V6H A;  3RG6 A;  1Q5Y A;  4G7O A;  3LP2 A;  3CCQ S;  3R3T A;  3VR1 A;  4QWE A;  3K8V A;  2RGR A;  4G0U A;  1J98 A;  1I5O B;  1RT5 B;  1S5Z A;  2WSE C;  3IBC B;  2CFA A;  3GR0 A;  4E8U A;  3FMB A;  1AB8 A;  3KUG A;  5B0F A;  2J0X A;  4IO9 Q;  2VOD A;  2CQP A;  4BS2 A;  2DNQ A;  3QYY A;  1B0V A;  4DG1 A;  2YKP A;  2V69 A;  1LWC A;  3BKT A;  1Q79 A;  4IR9 A;  4C0B A;  4JI1 J;  3R5J B;  2YKO A;  5I3Q A;  3HHE A;  4JYA F;  3W60 A;  4KHR A;  1K0T A;  3TRG A;  4DJB A;  1RT7 A;  2LQ9 A;  2UUA J;  4MKB A;  3OUY B;  2HHU A;  2ZJQ Q;  3HSZ A;  3K89 A;  1VRU B;  3DLE A;  5A8W B;  1E6Y B;  2DHH A;  4OZ5 A;  4RJV A;  2FPH X;  1LWE B;  2GS8 A;  2YXL A;  1WWH A;  1K73 T;  2HFN A;  1IBC B;  2FQQ B;  2BAC A;  2CJA A;  4NEY A;  4W92 B;  4IH6 A;  1N5Q A;  4BWM A;  1T3N A;  4DPU A;  1B7F A;  3FEX B;  2XUL A;  1DAR A;  2AGP A;  3Q86 A;  4AUK A;  2FJX A;  5B09 A;  4QIV A;  1JLC A;  2DGV A;  4P72 A;  2Y8Y A;  1F0X A;  4JV5 F;  1UJ6 A;  2J0W A;  2CRL A;  2QT7 A;  3M30 A;  4K4T A;  1SJF A;  2NVT K;  3R5C A;  3GV8 B;  2XZD B;  5EHH A;  2BKN A;  3RU0 A;  2R7T A;  3QT6 A;  4I0W A;  2OEK A;  3MM9 B;  1N32 F;  2A6M A;  3VAJ A;  2A68 A;  3MR2 A;  3TZX A;  4U7U K;  4K59 A;  5HJX A;  4NLX A;  2IA0 A;  3DYA B;  2KG0 A;  3JSB A;  1N5V A;  1HQE B;  3D68 A;  4FXD A;  2C2K B;  1QD1 A;  1N5S A;  2AYG A;  4Q0B B;  5EGY A;  4KT0 C;  4QZV B;  3DOK A;  1HBO B;  3EVO A;  5HK4 A;  2PGC A;  3CUN A;  2OFG X;  3V6D B;  4DL7 A;  1RLD A;  5HVH A;  3A13 A;  2OPP B;  2F63 A;  4U95 A;  4UF4 A;  2PMW A;  1TTH B;  3R2C J;  3PXG a;  3S1N K;  4G0W A;  3AA9 A;  2RB7 A;  4ID5 A;  1U49 A;  2DXE A;  1EIY B;  5D0H A;  3CCJ S;  3GTJ K;  3UD3 P;  2B9E A;  2YQ3 A;  2HKE A;  3VGT A;  1FA0 A;  4NZ6 A;  2UVU A;  2GSU A;  3JTN A;  1Z1Z A;  5AXL A;  5M5X K;  2EFV A;  3CAG A;  2LA6 A;  4O2D A;  2E2I C;  3MUV P;  2MB0 B;  1XXC A;  3FQL A;  3EMT A;  2HFO A;  1VJE A;  1IKV B;  4NL5 A;  3PG9 A;  4OJ3 A;  1D0E A;  2J7U A;  2K2P A;  1P9Y A;  3LW5 C;  4OI4 A;  2P5V A;  4AFF A;  2FLO A;  3UQS A;  2LDI A;  1K0V A;  4B3R J;  2J76 E;  1CPZ A;  4X62 F;  1KQK A;  3QAT A;  3JST A;  4DX6 A;  1RT3 B;  2E9R X;  4BY7 K;  1EX8 A;  4JI8 J;  4X66 F;  2NCK L;  1HR0 J;  2AF6 A;  3HHL C;  4OX7 A;  4A8Q A;  3GR1 A;  1SQG A;  2R93 K;  5CAB A;  4PYA A;  3C46 A;  1WCM K;  3RBX A;  3RR8 A;  1FXL A;  2DTJ A;  3T1H F;  3MTK A;  2K7K A;  2CJB A;  1U1K A;  3U27 A;  3ET6 A;  1RE1 B;  4G0V A;  1H72 C;  3SEO A;  3CED A;  4DL6 A;  3IM8 A;  2IJF A;  4ED8 A;  2ASY A;  1X7V A;  1J5O A;  2Q6B A;  5KFT A;  1KBR A;  1RCX B;  4UT4 A;  2HHT A;  2HNZ A;  1KOH A;  1CVJ A;  4RW4 B;  1SJR A;  4A3J C;  1VQS A;  3ZC4 A;  1N32 J;  1OS5 A;  5B0E A;  3VZI A;  2NVX C;  3PJ9 A;  5HBM B;  2QLB B;  3AOD A;  3HT0 A;  4DR2 F;  3F56 A;  2CWX A;  2BEF A;  5IP7 K;  2C3M A;  2ZZT A;  3HSJ A;  1Y4Z B;  1R8C A;  4X4T A;  4HI2 A;  3FRZ A;  1O2A A;  4Y7N C;  4QIW L;  3UW1 A;  1GE9 A;  2PA3 A;  3D5M A;  2OPQ A;  1JQW A;  3MFH A;  3S1Q C;  2G1H A;  3DOM B;  1S6U A;  5JUM A;  4QPT A;  3KTQ A;  3D6H B;  5KFY A;  3ENW A;  3M3Y K;  4HAC A;  1WC5 A;  3H20 A;  3BO3 A;  5K8O A;  2G4B A;  2E7W A;  3Q8Y A;  2Y1J A;  4ZJL A;  3CJ2 A;  3S15 C;  3PRD A;  3P49 B;  3IPJ A;  3M2U A;  4CLL A;  2YKM A;  3BEG B;  3GTL A;  5KFE A;  2APO A;  2JC0 A;  1EH1 A;  3S16 K;  1JB0 C;  3MEC B;  4WWS A;  4PXE A;  2AWZ A;  1WJ9 A;  1IUJ A;  5HJY A;  2GSN A;  2MZJ A;  3RBZ A;  3R1H A;  3PHT A;  1YK9 A;  3EZO A;  1XEZ A;  1IBA A;  4YR3 A;  3HOZ C;  4OZ1 A;  1BQN A;  5F8G A;  5LJ5 Y;  3H40 A;  2GIQ A;  3NNH A;  3DOL A;  4F3M A;  1KTV A;  3GJS B;  3QAE A;  2WVF A;  1RWV B;  4X4U A;  3KLE B;  3CJR A;  3L09 A;  3OPF A;  4M8L A;  4C3H K;  1GNK A;  2HGM A;  2NVT C;  2QG9 B;  2YNF A;  3DGV A;  3GTL K;  2GGP B;  1FF2 A;  2FLP A;  4DR7 J;  3M05 A;  2XHC A;  3OT9 A;  1CQN A;  1TWG A;  2YKN B;  1XR7 A;  2C3U A;  1FI4 A;  5B0D A;  1F9N A;  1J5E F;  3DOL B;  1JLE B;  3CDE A;  4DV1 F;  2ZKT A;  1UEK A;  4L73 A;  4KGV B;  2HK2 A;  1F5C A;  3MM5 A;  4Y65 A;  1YBA A;  5K14 B;  1F7V A;  3T1H J;  4YB7 A;  3LP1 A;  3FKB A;  2MTL A;  4ZJQ A;  3ONQ A;  1RWU A;  3D28 A;  5IT9 U;  2XCP A;  2VG5 B;  3IG1 B;  5M2R A;  1S1W A;  1RU1 A;  2E5I A;  1ITP A;  3W64 A;  2XWY A;  1FES A;  4D3H A;  1TWF C;  1FXD A;  2N3O A;  3KLH A;  4I7F B;  4K4Z A;  1YJW S;  2DHG A;  2CQD A;  2NSB A;  1WC6 A;  3TQ1 A;  3IN5 A;  4FVM A;  3B6B A;  1S4F A;  1YLX A;  1TKD A;  3OD2 A;  3NP5 A;  2BRK A;  5H9E J;  1G7C B;  4GTF A;  3DMJ A;  4HH0 A;  4G1Q A;  1EP4 A;  1FE0 A;  2HBR B;  4IYQ A;  1Y1W C;  3ITH A;  3C2P A;  4Y28 C;  1OYE A;  2B6A A;  1YRX A;  1N8R T;  2YKA A;  3MAA B;  3KLI B;  2KFY A;  4E0D A;  5IOT A;  1UVJ A;  1RHU B;  1SV5 A;  4O3O A;  1R6V A;  4UST A;  2X51 A;  1X4A A;  3H59 A;  4NXM J;  4HHH A;  1NKB A;  2ZOG A;  2MKJ A;  2DB1 A;  3ITH B;  2GVD B;  4JI6 F;  4PG8 A;  5IV4 A;  1Q8I A;  4NLO A;  2H9Z A;  2JL9 A;  1TWA C;  1VYA A;  1UVK A;  1HQU A;  2YNH B;  2YVS A;  3I82 A;  3T9N A;  1JLA B;  3IR5 B;  5LXY A;  5J1P A;  3GFY A;  3R97 A;  2CQ0 A;  4JI1 F;  3EE3 A;  2CG8 A;  4HDG A;  4ZCI A;  3MOJ B;  3G96 A;  3BRE A;  4LR8 A;  1N5T A;  2UUC J;  2NVY C;  3GTY X;  2CAD A;  3SCK E;  4QOT A;  1YZ7 A;  4ED6 A;  3V6H A;  4OIQ A;  3OV7 A;  3ENA A;  3BSC A;  1XQI A;  3IG1 A;  2B7B B;  1UVN A;  2AZ1 A;  2IAJ A;  1CEZ A;  2FHJ D;  3SCL E;  3FBF A;  5C44 C;  2RF2 A;  4UW2 A;  3N0V A;  4FNH A;  2K1R A;  3IGV A;  1SH2 A;  4F4X A;  1C0A A;  1SBR A;  4UQG A;  4WIL A;  3N79 A;  3RBD A;  1SKU B;  2ACY A;  2XYG B;  1VQP S;  3CDU A;  2EBE A;  4KAR A;  1RYR A;  2J6S A;  3EX7 B;  2MZ1 A;  1EHW A;  2OPR A;  2HW3 A;  1QAJ A;  3G8S A;  4PCQ A;  1Q81 T;  1IWA A;  3LOU A;  4RW8 A;  2ZFZ A;  3IAM 9;  2IMO A;  2YTC A;  2DH9 A;  2HQF A;  4K4W A;  1FTR A;  1SB6 A;  4KV8 A;  1M1G A;  4ECV A;  2PN6 A;  1F2G A;  5FLM K;  4O3S A;  3IA0 A;  4J9Q A;  4CRJ A;  5DLG A;  2W2Q P;  1S72 S;  3NMR A;  2YBV A;  4DSF A;  3A8E A;  4WJ4 A;  2VB6 A;  2MJU A;  4ILR A;  3M7V A;  1HNV B;  1X4B A;  4F25 A;  3IR6 B;  3BP8 C;  2IDL A;  3JTP A;  3LO3 A;  3HMJ G;  1ZYR A;  4ZMM A;  3W2W A;  1SFO A;  5J2M B;  2GNK A;  4OHZ A;  2W25 A;  4CDI A;  3FZ2 A;  2X7I A;  2JA8 C;  1B4B A;  1DCP A;  4AQY J;  3NGS A;  1BD6 A;  3MM5 B;  4J9S A;  1B64 A;  3DRR B;  2XZT B;  3JSM A;  1U4B A;  4A4J A;  4EZ9 A;  4E98 A;  4KMA A;  4WFA Q;  3JYT B;  4M5G A;  1G51 A;  3M2V B;  2HQ3 A;  1NZA A;  4IQM A;  1MRO A;  2HFV A;  1UVL A;  4ZCK A;  2OPQ B;  2ZM6 J;  3DMJ B;  2MQL A;  3GTO K;  3JAM Y;  4ZN1 A;  3BSO A;  1MWQ A;  1WQF A;  3F73 A;  4TU9 A;  2RKI B;  3NG8 A;  3M8P B;  1RWO B;  4W90 B;  1E6Y A;  2F40 A;  1NK8 A;  3PO2 C;  2WRM A;  1SFO K;  3FCH A;  3W7B A;  4LIW A;  5HBM A;  3RZD C;  1S4E A;  3UO0 A;  4HTJ A;  4A3J K;  1AUD A;  4ECW A;  2YU9 A;  1DFD A;  1F9F A;  4L75 A;  3QMQ A;  3AB4 B;  4DV3 J;  2F8H A;  3KHG A;  5M5Y K;  3AY0 A;  2V8H A;  4O4G B;  2DJW A;  4QYZ J;  3NGT A;  3T5K A;  2W2M P;  1XNR J;  4GTC A;  2HQC A;  1IVZ A;  2VA2 A;  4P5A A;  4KB4 A;  2RUS A;  1RI7 A;  3P5B P;  4PWU A;  3QBC A;  2CQG A;  2UUB F;  3ISN D;  3IS9 B;  1FJ7 A;  1B70 B;  4KMD A;  4QQB A;  3G71 S;  3MPU B;  1NSQ A;  2E1C A;  4MKA A;  3WHI A;  4UUW A;  2NVY K;  1RT3 A;  1DTQ B;  5DDQ C;  3LPE A;  3WOD A;  5HP1 B;  5JXS A;  1KHV A;  4F4Y A;  2UVR A;  1RJJ A;  2YWH A;  1T9U A;  4A8Y A;  1RHR B;  5KFV A;  4UZC A;  2WON B;  2KG1 A;  1E6V B;  3IGN A;  5D78 A;  2KI2 A;  1UTA A;  4LT6 A;  5KFP A;  3SCJ E;  2Y1I A;  3RW7 A;  4YME A;  1J6V A;  2SXL A;  4LFA J;  4GVL A;  4X4V A;  4QWD A;  3HT3 A;  1BQN B;  2VG7 B;  3DGP B;  4DFK A;  3RRK A;  3OSN A;  2C2R A;  2CPY A;  1Y10 A;  3I5A A;  2HRU A;  2W01 A;  2P6S A;  5FLM C;  2E5J A;  3OUY A;  3KJV B;  2Z0G A;  2VJV A;  4QBU A;  2JA7 C;  4BBY A;  2XGP A;  4Q45 A;  4BBR K;  4CH0 S;  5D4D A;  2VPY B;  4KAS A;  1BQM A;  4PG5 A;  1GXU A;  1SPB P;  2ZH4 A;  1UA0 A;  4KBI A;  3IM9 A;  1D9D A;  4K2J A;  2XMM A;  3M6X A;  5GMK a;  3M2U B;  4U7C A;  3MML B;  3GTJ C;  1Y1W K;  3HX9 A;  3FBE A;  1KHW A;  3LAK A;  3SDE A;  4EMD A;  2MLZ A;  1RAA B;  2R7Z C;  2ZWP A;  1IN0 A;  2B51 A;  3I0S B;  2BE5 A;  2CJK A;  2P6T A;  4O3N A;  3FCV A;  4GVB A;  3W3S A;  3QGP A;  2HIY A;  1RBO B;  2YNF B;  1TL3 A;  1X0P A;  2JLE A;  5C44 K;  4I68 A;  1S0O A;  1WKJ A;  3M2V A;  4P2S A;  1TVR A;  1MMN A;  3M8Q A;  4IDK A;  2RRA A;  5FDL A;  3S0X A;  4LQ9 A;  3OFG A;  2M8D B;  5A6P A;  3V81 B;  4GC7 A;  3MM6 B;  3RBE A;  2RHQ B;  4QWC A;  3TEH B;  2ASL A;  3DYA A;  2HS3 A;  1QE1 A;  3OBI A;  2VKR A;  2R9L A;  4LOW A;  2JFK A;  5KFA A;  4RU9 A;  1UVM A;  4HT5 A;  5J2M A;  1DLO B;  3G4C A;  4Y34 A;  5FJ8 K;  1FX4 A;  3MI7 X;  5JJB A;  1VC6 A;  4FKY A;  4M1X A;  4A3G K; 
#chains in the Genus database with same CATH homology
 1X31 C;  3TTG A;  1PJ5 A;  3TFI A;  1PJ6 A;  3TFH A;  3A8I A;  3AD8 C;  1XZP A;  2GAH C;  1XZQ B;  1WSV A;  3GSI A;  1YX2 A;  3A8J A;  1WSR A;  1WOO A;  1V5V A;  4PAB A;  1WOP A;  5L46 A;  2GAG C;  3GEH A;  1XZQ A;  4PAA A;  3ADA C;  3AD7 C;  3TFJ A;  3A8K A;  4P9S A;  1VRQ C;  1WOS A;  3GEE A;  3GIR A;  1XZP B;  1VLO A;  1PJ7 A;  3AD9 C;  3GEI A;  1WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...