1TWGK

Rna polymerase ii complexed with ctp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twgK00
2WB1L 2A6HA 3S17C 1I50C 3M3YC 3S2HC 5C3EC 3PO2C 4QIWD 1XPPA 5IYCC 3S2HK 2BE5A 1I50K 4LK0A 2PMZL 5IYCK 3S1RC 4ZH4A 3EQLA 5C3EK 2JA7C 2NVYK 3S17K 1Y1VK 2WAQD 5FJ8K 4Q4ZA 4BY1C 4A3FC 1WCMC 3CQZK 4QJVA 3HOUK 4XSZA 3S14K 3S1NK 1SMYA 1TWHC 4X6AC 1Y1WC 1K83C 4XSXA 3S1MC 1TWCC 4A3FK 4JK1A 4A93C 3HOUC 4A3LK 5M5XK 3HOZC 4A3EK 3FKIK 2YU9K 4C3IK 4A3DK 2R93K 3WODA 3PO3C 3PO2K 4LLGA 4YG2A 4BBRK 3GTJK 2E2HK 4OINA 3GTPC 3M4OK 4C3JK 4G7HA 3HOXK 1TWGK 5C4XK 3HOWC 1I3QC 2PA8D 4YFXA 5FLMC 2E2JC 2NVQC 3HOYC 4A3KC 4A3GC 5C4XC 4OIPA 2JA5K 4BXXC 4A3GK 5M5WK 2E2IK 3GTJC 2E2HC 2E2JK 3GTPK 3RZDC 4OIQA 4G7OA 2PA8L 3DXJA 1SFOK 3GTGC 2JA6C 1I6HK 1R9TK 4NOIA 2NVXC 5C4JK 4BY7C 2O5IA 4AYBL 4Y7NK 2B63K 3HKZD 4A3LC 2A6EA 1R9TC 4BBSC 2JA6K 2R93C 1SFOC 4MEXA 4A3DC 3H0GC 5IP7K 1BDFA 4Y7NC 4AYBD 3S1MK 3GTGK 1K83K 2WB1D 5IP9K 3RZOC 5FLMK 2NVQK 4QJVB 2VUMK 3H3VL 3HOYK 3S14C 3S2DK 3S1RK 4OIOA 2JA5C 3S1NC 4XLPA 3I4NK 2NVYC 3S1QC 1YNNA 2O5JA 3GTLC 4A3JC 4A3BC 4GZYA 1TWGC 3HOWK 3HOXC 3S1QK 4A3IC 4BBRC 4KN7A 2PPBA 3GTQK 3HOVK 1TWCK 3M3YK 3GTKC 4G7ZA 5IYDC 3GTMK 1YNJA 4LJZA 2JA8K 4MEYA 3GTOC 2R7ZK 4C2MK 4C3HK 2CW0A 2JA7K 2R7ZC 5IYBC 1IW7A 3GTQC 2NVTK 1Y1VC 2WAQL 5C4JC 5IP7C 3GTKK 2NVXK 3H0GK 4BY7K 1I6HC 3S16C 4BBSK 1ZYRA 4A3JK 4A3BK 3GTLK 2B63C 4MQ9A 4KN4A 2E2IC 2PMZD 4BXXK 4KMUA 2R92C 3RZDK 2VUMC 1TWAC 1TWFK 5C44C 3K7AC 5IP9C 3RZOK 3I4NC 3H3VD 2R92K 3HKZL 3S15C 3S2DC 5TMFA 3K7AK 4Y52C 3M4OC 4LK1A 1TWAK 1TWFC 4A3MK 3I4MC 5M3MK 1HQMA 4XLNA 4A3EC 2Y0SD 2YU9C 2NVTC 4A3CC 4YFNA 3PO3K 4A93K 4Q5SA 2A69A 3S16K 4A3MC 3FKIC 3I4MK 4A3CK 3HOZK 5TMCA 1I6VA 4Y52K 1WCMK 3CQZC 4BY1K 2Y0SL 2JA8C 5IYBK 4YFKA 3GTMC 1Y1WK 5IYDK 1TWHK 4OIRA 4A3KK 4QIWL 5M5YK 4X6AK 5C44K 2A68A 3GTOK 1I3QK 5D4DA 3HOVC 3S15K 4A3IK 5M3FK
chains in the Genus database with same CATH superfamily
2A6HA 1I50C 1F9NA 3AD7C 3PO2C 1XPPA 5E68A 2BE5A 3S2HK 4KATA 5JFEA 3S1RC 2NVYK 3Q3QA 2NVYA 2WAQD 2CFAA 4BY1C 3HOUK 4A3FC 4G0WA 4XSZA 1C0AA 1TWHC 1Y1WC 4P5BA 3HOUC 3AD9C 3BUEA 4A3EK 1O26A 1UV7A 3WODA 3G4CA 1WOOA 3L4KA 3PO2K 3GTJK 3L4JA 4OINA 2GSUA 3GTPC 1O24A 1WQHA 4C3JK 3M4OK 1ZXOA 3HOWC 2PHCB 1WOSA 1V5VA 2NVQC 4A3KC 4A3GC 1VRQC 5C4XC 1PJ6A 4BXXC 2E2JK 4OIQA 1R9TA 3GTGC 4GTEA 1R9TK 1VJEA 2GSNA 4NOIA 2NVXC 3G4AA 2EBBA 2GAHC 5IOTA 2O5IA 2B63K 2B63A 4KM9A 3OPFA 1K83K 4GTLA 3RZOC 1TWAA 2V6UA 3S14C 2VUMK 2P5MA 4OIOA 2V6SA 1EK8A 1BJTA 3LPXA 4A3IC 1TWCA 2PPBA 4KN7A 3HOVK 1TWCK 1X31C 3S0XA 3M3YK 3VA7A 1YNJA 4LJZA 4GTCA 4MEYA 2JA7A 1IQ0A 4BLAA 2JA7K 2R7ZC 3FHZA 1Y1VC 5IP7C 4A3JK 3SZYA 2B63C 1DD5A 2PMZD 4BXXK 4M1XA 5IP9C 1PJ5A 3GIRA 4GT9A 1F93A 3N3YA 3JSTA 1JOEA 1B4BA 3K7AK 4LR2A 5TMFA 4J3NA 3M4OC 1TWFC 4FZBA 3ADAC 1HQMA 1DCPA 5M3MK 4A3EC 1O25A 3S16K 3FKIC 3IPJA 5CJ9A 1I6VA 1GE9A 5IYBK 4YFKA 5IYDK 1Y1WK 1Y1WA 2A68A 3GTOK 2V6TA 1XZQB 5M3FK 5CHPA 1O2AA 3SZZA 1I50K 4LK0A 5TJ3A 3TFHA 2R7ZA 1O29A 1K83A 2JA7C 1ZVUA 1Y1VK 4Q4ZA 3CQZK 4QJVA 3GTKA 1SMYA 5L46A 3S1MC 1TWCC 4A3LK 5M5XK 2ZUEA 2YU9K 2GSOA 1BS2A 3FKIK 4C3IK 4KB4A 4LLGA 4BBRK 1IL2A 2E2HK 3HXAA 3HOXK 1I3QC 4WJ3M 4KMDA 1J6WA 3TFJA 2JA5K 4P5AA 1SFOA 4DDQA 1SFOK 2W7VA 1DCHA 5C4JK 4BY7C 1BGWA 1SFOC 4A3DC 5IOQA 5IP7K 4AYBD 3GTGK 2WB1D 2NVQK 3S2DK 4XLPA 3GTPA 4KDDA 1YNNA 4KASA 3GTLC 4G0UA 4A3BC 3HOWK 3BP3A 5EGEA 3GEIA 1PJ7A 2Y3PA 1IE0A 1YX2A 3MMLB 3GTKC 3GTOA 2D6FC 3GTMK 1XXBA 1L0WA 2JA8K 4PABA 4C2MK 4BLBA 3N0BA 5IYBC 1O28A 3GTQC 1XXAA 2NVTK 1TWGA 2XCOA 3H0GK 3V4GA 2NVXK 1I6HC 4A3BK 1F7VA 1VLOA 3TFIA 4KMUA 2R92C 1TWFK 3K7AC 1TWFA 3GTJA 2R92K 1DCOA 3A8KA 4C3JC 3S2DC 3FKIA 2KWAA 1O2BA 2FQOA 1B4AA 3AQPA 3LAJA 4A3CC 2A69A 5TMCA 4ILDA 1WCMK 4BY1K 2JA8C 3GTQA 1ZBSA 3GTMC 2XCQA 1TWHK 4KB2A 3CAGA 4QIWL 4OIRA 1TWHA 1O2FB 4GFQA 3S15K 4O2DA 2FQTA 2WB1L 3M3YC 1IBAA 3S2HC 5C3EC 1HI9A 2PMZL 4ZH4A 5JVOA 3AH5A 3S17K 4FM9A 4G0VA 5FJ8K 3S14K 1AB4A 4X6AC 1K83C 4RMFA 4A93C 2CFAB 3HOZC 1F7UA 4A3DK 4YG2A 1USOA 5FLMC 2E2JC 1VGXA 1USMA 4OIPA 4A3GK 5M5WK 2E2IK 3H0GA 2E2HC 3RZDC 2PA8L 3NUHA 1I3QA 4AYBL 4Y7NK 4A3LC 3HKZD 2JA6A 2A6EA 1R9TC 4BBSC 2JA6K 4MEXA 4C3IC 1JQWA 1EH1A 3T00A 3T02A 3S1MK 4KAWX 3HOYK 4LOWA 4GTBA 3T01A 2P8TA 3S1QC 2O5JA 3LAPA 4A3JC 4GZYA 1TWGC 4WJ4A 3S1QK 1ZQ1C 2RH6A 4KM8A 3GTQK 4G7ZA 5IYDC 1EI6A 3A8JA 3FOEA 3GTOC 2R7ZK 2CW0A 4KARA 2WAQL 3GTKK 5IOSA 1J6XA 3S16C 3GTLA 4BBSK 1ZYRA 3GTLK 4MQ9A 4KN4A 2YU9A 1KQ4A 3RZDK 2VUMC 1TWAC 2E2HA 1XZQA 3H3VD 1J6VA 4Y52C 4LK1A 3I4MC 2NVTC 4YFNA 3PO3K 4A93K 1WIHA 4Q5SA 4A3MC 3HOZK 4C2MC 1WORA 1Y1VA 2Y0SL 3QX3A 4GTFA 2GAGC 5M5YK 4XCHA 5C44K 1I3QK 4A3IK 3S17C 1J98A 4QIWD 5IYCC 1WSRA 5IYCK 5HL8A 3EQLA 5C3EK 1O27A 1INNA 3AQOA 1EFWA 1WCMC 1XZPA 1G51A 3S1NK 4KMHA 4XSXA 4A3FK 4JK1A 3GTMA 3OEPA 1IS1A 2R93K 3PO3C 1I50A 4G7HA 1TWGK 3AD8C 4WILA 5C4XK 2NVXA 2PA8D 4YFXA 2XCRB 3HOYC 3CQZA 1JVIA 4KC6A 3GTJC 3GTPK 3OREA 1WQFA 4G7OA 3DXJA 2JA6C 1I6HK 1WSVA 2R92A 2ZFZA 5EGHA 3TTGA 2R93C 1ISEA 3H0GC 1BDFA 4Y7NC 4GTAA 3GEHA 1VH2A 5IP9K 4BKWA 1WOPA 5FLMK 3N0CA 4QJVB 3H3VL 3S1NC 3S1RK 2JA5C 1WCMA 3I4NK 3ERED 2NVYC 3HOXC 4KMAA 3GEEA 4BBRC 5IORA 2RGRA 1RU0A 4C3HK 1WQGA 3A8IA 1IW7A 4C45A 5C4JC 4BY7K 3FOFA 4PAAA 3BP8C 4AH6A 2E2IC 2JA5A 2JH3A 5C44C 3RZOK 3I4NC 3S15C 3HKZL 1TWAK 2R93A 4A3MK 4XLNA 2VUMA 1EQRA 2YU9C 2Y0SD 2E2IA 3GTGA 1YCLA 3GSIA 3I4MK 3GDZA 4A3CK 4P9SA 4Y52K 1XZPB 3CQZC 2ZUFA 4X6AK 1XXCA 4A3KK 4C3HC 4GTDA 5D4DA 3HOVC 4LQYA
chains in the Genus database with same CATH topology
2WB1L 2A6HA 3S17C 1I50C 3M3YC 3S2HC 5C3EC 3PO2C 4QIWD 1XPPA 5IYCC 3S2HK 2BE5A 1I50K 4LK0A 2PMZL 5IYCK 3S1RC 4ZH4A 3EQLA 5C3EK 2JA7C 2NVYK 3S17K 1Y1VK 2WAQD 5FJ8K 4Q4ZA 4BY1C 4A3FC 1WCMC 3CQZK 4QJVA 3HOUK 4XSZA 3S14K 3S1NK 1SMYA 1TWHC 4X6AC 1Y1WC 1K83C 4XSXA 3S1MC 1TWCC 4A3FK 4JK1A 4A93C 3HOUC 4A3LK 5M5XK 3HOZC 4A3EK 3FKIK 2YU9K 4C3IK 4A3DK 2R93K 3WODA 3PO3C 3PO2K 4LLGA 4YG2A 4BBRK 3GTJK 2E2HK 4OINA 3GTPC 3M4OK 4C3JK 4G7HA 3HOXK 1TWGK 5C4XK 3HOWC 1I3QC 2PA8D 4YFXA 5FLMC 2E2JC 2NVQC 3HOYC 4A3KC 4A3GC 5C4XC 4OIPA 2JA5K 4BXXC 4A3GK 5M5WK 2E2IK 3GTJC 2E2HC 2E2JK 3GTPK 3RZDC 4OIQA 4G7OA 2PA8L 3DXJA 1SFOK 3GTGC 2JA6C 1I6HK 1R9TK 4NOIA 2NVXC 5C4JK 4BY7C 2O5IA 4AYBL 4Y7NK 2B63K 3HKZD 4A3LC 2A6EA 1R9TC 4BBSC 2JA6K 2R93C 1SFOC 4MEXA 4A3DC 3H0GC 5IP7K 1BDFA 4Y7NC 4AYBD 3S1MK 3GTGK 1K83K 2WB1D 5IP9K 3RZOC 5FLMK 2NVQK 4QJVB 2VUMK 3H3VL 3HOYK 3S14C 3S2DK 3S1RK 4OIOA 2JA5C 3S1NC 4XLPA 3I4NK 2NVYC 3S1QC 1YNNA 2O5JA 3GTLC 4A3JC 4A3BC 4GZYA 1TWGC 3HOWK 3HOXC 3S1QK 4A3IC 4BBRC 4KN7A 2PPBA 3GTQK 3HOVK 1TWCK 3M3YK 3GTKC 4G7ZA 5IYDC 3GTMK 1YNJA 4LJZA 2JA8K 4MEYA 3GTOC 2R7ZK 4C2MK 4C3HK 2CW0A 2JA7K 2R7ZC 5IYBC 1IW7A 3GTQC 2NVTK 1Y1VC 2WAQL 5C4JC 5IP7C 3GTKK 2NVXK 3H0GK 4BY7K 1I6HC 3S16C 4BBSK 1ZYRA 4A3JK 4A3BK 3GTLK 2B63C 4MQ9A 4KN4A 2E2IC 2PMZD 4BXXK 4KMUA 2R92C 3RZDK 2VUMC 1TWAC 1TWFK 5C44C 3K7AC 5IP9C 3RZOK 3I4NC 3H3VD 2R92K 3HKZL 3S15C 3S2DC 5TMFA 3K7AK 4Y52C 3M4OC 4LK1A 1TWAK 1TWFC 4A3MK 3I4MC 5M3MK 1HQMA 4XLNA 4A3EC 2Y0SD 2YU9C 2NVTC 4A3CC 4YFNA 3PO3K 4A93K 4Q5SA 2A69A 3S16K 4A3MC 3FKIC 3I4MK 4A3CK 3HOZK 5TMCA 1I6VA 4Y52K 1WCMK 3CQZC 4BY1K 2Y0SL 2JA8C 5IYBK 4YFKA 3GTMC 1Y1WK 5IYDK 1TWHK 4OIRA 4A3KK 4QIWL 5M5YK 4X6AK 5C44K 2A68A 3GTOK 1I3QK 5D4DA 3HOVC 3S15K 4A3IK 5M3FK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 L;  2A6H A;  3S17 C;  1I50 C;  3M3Y C;  3S2H C;  5C3E C;  3PO2 C;  4QIW D;  1XPP A;  5IYC C;  3S2H K;  2BE5 A;  1I50 K;  4LK0 A;  2PMZ L;  5IYC K;  3S1R C;  4ZH4 A;  3EQL A;  5C3E K;  2JA7 C;  2NVY K;  3S17 K;  1Y1V K;  2WAQ D;  5FJ8 K;  4Q4Z A;  4BY1 C;  4A3F C;  1WCM C;  3CQZ K;  4QJV A;  3HOU K;  4XSZ A;  3S14 K;  3S1N K;  1SMY A;  1TWH C;  4X6A C;  1Y1W C;  1K83 C;  4XSX A;  3S1M C;  1TWC C;  4A3F K;  4JK1 A;  4A93 C;  3HOU C;  4A3L K;  5M5X K;  3HOZ C;  4A3E K;  3FKI K;  2YU9 K;  4C3I K;  4A3D K;  2R93 K;  3WOD A;  3PO3 C;  3PO2 K;  4LLG A;  4YG2 A;  4BBR K;  3GTJ K;  2E2H K;  4OIN A;  3GTP C;  3M4O K;  4C3J K;  4G7H A;  3HOX K;  1TWG K;  5C4X K;  3HOW C;  1I3Q C;  2PA8 D;  4YFX A;  5FLM C;  2E2J C;  2NVQ C;  3HOY C;  4A3K C;  4A3G C;  5C4X C;  4OIP A;  2JA5 K;  4BXX C;  4A3G K;  5M5W K;  2E2I K;  3GTJ C;  2E2H C;  2E2J K;  3GTP K;  3RZD C;  4OIQ A;  4G7O A;  2PA8 L;  3DXJ A;  1SFO K;  3GTG C;  2JA6 C;  1I6H K;  1R9T K;  4NOI A;  2NVX C;  5C4J K;  4BY7 C;  2O5I A;  4AYB L;  4Y7N K;  2B63 K;  3HKZ D;  4A3L C;  2A6E A;  1R9T C;  4BBS C;  2JA6 K;  2R93 C;  1SFO C;  4MEX A;  4A3D C;  3H0G C;  5IP7 K;  1BDF A;  4Y7N C;  4AYB D;  3S1M K;  3GTG K;  1K83 K;  2WB1 D;  5IP9 K;  3RZO C;  5FLM K;  2NVQ K;  4QJV B;  2VUM K;  3H3V L;  3HOY K;  3S14 C;  3S2D K;  3S1R K;  4OIO A;  2JA5 C;  3S1N C;  4XLP A;  3I4N K;  2NVY C;  3S1Q C;  1YNN A;  2O5J A;  3GTL C;  4A3J C;  4A3B C;  4GZY A;  1TWG C;  3HOW K;  3HOX C;  3S1Q K;  4A3I C;  4BBR C;  4KN7 A;  2PPB A;  3GTQ K;  3HOV K;  1TWC K;  3M3Y K;  3GTK C;  4G7Z A;  5IYD C;  3GTM K;  1YNJ A;  4LJZ A;  2JA8 K;  4MEY A;  3GTO C;  2R7Z K;  4C2M K;  4C3H K;  2CW0 A;  2JA7 K;  2R7Z C;  5IYB C;  1IW7 A;  3GTQ C;  2NVT K;  1Y1V C;  2WAQ L;  5C4J C;  5IP7 C;  3GTK K;  2NVX K;  3H0G K;  4BY7 K;  1I6H C;  3S16 C;  4BBS K;  1ZYR A;  4A3J K;  4A3B K;  3GTL K;  2B63 C;  4MQ9 A;  4KN4 A;  2E2I C;  2PMZ D;  4BXX K;  4KMU A;  2R92 C;  3RZD K;  2VUM C;  1TWA C;  1TWF K;  5C44 C;  3K7A C;  5IP9 C;  3RZO K;  3I4N C;  3H3V D;  2R92 K;  3HKZ L;  3S15 C;  3S2D C;  5TMF A;  3K7A K;  4Y52 C;  3M4O C;  4LK1 A;  1TWA K;  1TWF C;  4A3M K;  3I4M C;  5M3M K;  1HQM A;  4XLN A;  4A3E C;  2Y0S D;  2YU9 C;  2NVT C;  4A3C C;  4YFN A;  3PO3 K;  4A93 K;  4Q5S A;  2A69 A;  3S16 K;  4A3M C;  3FKI C;  3I4M K;  4A3C K;  3HOZ K;  5TMC A;  1I6V A;  4Y52 K;  1WCM K;  3CQZ C;  4BY1 K;  2Y0S L;  2JA8 C;  5IYB K;  4YFK A;  3GTM C;  1Y1W K;  5IYD K;  1TWH K;  4OIR A;  4A3K K;  4QIW L;  5M5Y K;  4X6A K;  5C44 K;  2A68 A;  3GTO K;  1I3Q K;  5D4D A;  3HOV C;  3S15 K;  4A3I K;  5M3F K; 
#chains in the Genus database with same CATH topology
 2A6H A;  1I50 C;  1F9N A;  3AD7 C;  3PO2 C;  1XPP A;  5E68 A;  2BE5 A;  3S2H K;  4KAT A;  5JFE A;  3S1R C;  2NVY K;  3Q3Q A;  2NVY A;  2WAQ D;  2CFA A;  4BY1 C;  3HOU K;  4A3F C;  4G0W A;  4XSZ A;  1C0A A;  1TWH C;  1Y1W C;  4P5B A;  3HOU C;  3AD9 C;  3BUE A;  4A3E K;  1O26 A;  1UV7 A;  3WOD A;  3G4C A;  1WOO A;  3L4K A;  3PO2 K;  3GTJ K;  3L4J A;  4OIN A;  2GSU A;  3GTP C;  1O24 A;  1WQH A;  4C3J K;  3M4O K;  1ZXO A;  3HOW C;  2PHC B;  1WOS A;  1V5V A;  2NVQ C;  4A3K C;  4A3G C;  1VRQ C;  5C4X C;  1PJ6 A;  4BXX C;  2E2J K;  4OIQ A;  1R9T A;  3GTG C;  4GTE A;  1R9T K;  1VJE A;  2GSN A;  4NOI A;  2NVX C;  3G4A A;  2EBB A;  2GAH C;  5IOT A;  2O5I A;  2B63 K;  2B63 A;  4KM9 A;  3OPF A;  1K83 K;  4GTL A;  3RZO C;  1TWA A;  2V6U A;  3S14 C;  2VUM K;  2P5M A;  4OIO A;  2V6S A;  1EK8 A;  1BJT A;  3LPX A;  4A3I C;  1TWC A;  2PPB A;  4KN7 A;  3HOV K;  1TWC K;  1X31 C;  3S0X A;  3M3Y K;  3VA7 A;  1YNJ A;  4LJZ A;  4GTC A;  4MEY A;  2JA7 A;  1IQ0 A;  4BLA A;  2JA7 K;  2R7Z C;  3FHZ A;  1Y1V C;  5IP7 C;  4A3J K;  3SZY A;  2B63 C;  1DD5 A;  2PMZ D;  4BXX K;  4M1X A;  5IP9 C;  1PJ5 A;  3GIR A;  4GT9 A;  1F93 A;  3N3Y A;  3JST A;  1JOE A;  1B4B A;  3K7A K;  4LR2 A;  5TMF A;  4J3N A;  3M4O C;  1TWF C;  4FZB A;  3ADA C;  1HQM A;  1DCP A;  5M3M K;  4A3E C;  1O25 A;  3S16 K;  3FKI C;  3IPJ A;  5CJ9 A;  1I6V A;  1GE9 A;  5IYB K;  4YFK A;  5IYD K;  1Y1W K;  1Y1W A;  2A68 A;  3GTO K;  2V6T A;  1XZQ B;  5M3F K;  5CHP A;  1O2A A;  3SZZ A;  1I50 K;  4LK0 A;  5TJ3 A;  3TFH A;  2R7Z A;  1O29 A;  1K83 A;  2JA7 C;  1ZVU A;  1Y1V K;  4Q4Z A;  3CQZ K;  4QJV A;  3GTK A;  1SMY A;  5L46 A;  3S1M C;  1TWC C;  4A3L K;  5M5X K;  2ZUE A;  2YU9 K;  2GSO A;  1BS2 A;  3FKI K;  4C3I K;  4KB4 A;  4LLG A;  4BBR K;  1IL2 A;  2E2H K;  3HXA A;  3HOX K;  1I3Q C;  4WJ3 M;  4KMD A;  1J6W A;  3TFJ A;  2JA5 K;  4P5A A;  1SFO A;  4DDQ A;  1SFO K;  2W7V A;  1DCH A;  5C4J K;  4BY7 C;  1BGW A;  1SFO C;  4A3D C;  5IOQ A;  5IP7 K;  4AYB D;  3GTG K;  2WB1 D;  2NVQ K;  3S2D K;  4XLP A;  3GTP A;  4KDD A;  1YNN A;  4KAS A;  3GTL C;  4G0U A;  4A3B C;  3HOW K;  3BP3 A;  5EGE A;  3GEI A;  1PJ7 A;  2Y3P A;  1IE0 A;  1YX2 A;  3MML B;  3GTK C;  3GTO A;  2D6F C;  3GTM K;  1XXB A;  1L0W A;  2JA8 K;  4PAB A;  4C2M K;  4BLB A;  3N0B A;  5IYB C;  1O28 A;  3GTQ C;  1XXA A;  2NVT K;  1TWG A;  2XCO A;  3H0G K;  3V4G A;  2NVX K;  1I6H C;  4A3B K;  1F7V A;  1VLO A;  3TFI A;  4KMU A;  2R92 C;  1TWF K;  3K7A C;  1TWF A;  3GTJ A;  2R92 K;  1DCO A;  3A8K A;  4C3J C;  3S2D C;  3FKI A;  2KWA A;  1O2B A;  2FQO A;  1B4A A;  3AQP A;  3LAJ A;  4A3C C;  2A69 A;  5TMC A;  4ILD A;  1WCM K;  4BY1 K;  2JA8 C;  3GTQ A;  1ZBS A;  3GTM C;  2XCQ A;  1TWH K;  4KB2 A;  3CAG A;  4QIW L;  4OIR A;  1TWH A;  1O2F B;  4GFQ A;  3S15 K;  4O2D A;  2FQT A;  2WB1 L;  3M3Y C;  1IBA A;  3S2H C;  5C3E C;  1HI9 A;  2PMZ L;  4ZH4 A;  5JVO A;  3AH5 A;  3S17 K;  4FM9 A;  4G0V A;  5FJ8 K;  3S14 K;  1AB4 A;  4X6A C;  1K83 C;  4RMF A;  4A93 C;  2CFA B;  3HOZ C;  1F7U A;  4A3D K;  4YG2 A;  1USO A;  5FLM C;  2E2J C;  1VGX A;  1USM A;  4OIP A;  4A3G K;  5M5W K;  2E2I K;  3H0G A;  2E2H C;  3RZD C;  2PA8 L;  3NUH A;  1I3Q A;  4AYB L;  4Y7N K;  4A3L C;  3HKZ D;  2JA6 A;  2A6E A;  1R9T C;  4BBS C;  2JA6 K;  4MEX A;  4C3I C;  1JQW A;  1EH1 A;  3T00 A;  3T02 A;  3S1M K;  4KAW X;  3HOY K;  4LOW A;  4GTB A;  3T01 A;  2P8T A;  3S1Q C;  2O5J A;  3LAP A;  4A3J C;  4GZY A;  1TWG C;  4WJ4 A;  3S1Q K;  1ZQ1 C;  2RH6 A;  4KM8 A;  3GTQ K;  4G7Z A;  5IYD C;  1EI6 A;  3A8J A;  3FOE A;  3GTO C;  2R7Z K;  2CW0 A;  4KAR A;  2WAQ L;  3GTK K;  5IOS A;  1J6X A;  3S16 C;  3GTL A;  4BBS K;  1ZYR A;  3GTL K;  4MQ9 A;  4KN4 A;  2YU9 A;  1KQ4 A;  3RZD K;  2VUM C;  1TWA C;  2E2H A;  1XZQ A;  3H3V D;  1J6V A;  4Y52 C;  4LK1 A;  3I4M C;  2NVT C;  4YFN A;  3PO3 K;  4A93 K;  1WIH A;  4Q5S A;  4A3M C;  3HOZ K;  4C2M C;  1WOR A;  1Y1V A;  2Y0S L;  3QX3 A;  4GTF A;  2GAG C;  5M5Y K;  4XCH A;  5C44 K;  1I3Q K;  4A3I K;  3S17 C;  1J98 A;  4QIW D;  5IYC C;  1WSR A;  5IYC K;  5HL8 A;  3EQL A;  5C3E K;  1O27 A;  1INN A;  3AQO A;  1EFW A;  1WCM C;  1XZP A;  1G51 A;  3S1N K;  4KMH A;  4XSX A;  4A3F K;  4JK1 A;  3GTM A;  3OEP A;  1IS1 A;  2R93 K;  3PO3 C;  1I50 A;  4G7H A;  1TWG K;  3AD8 C;  4WIL A;  5C4X K;  2NVX A;  2PA8 D;  4YFX A;  2XCR B;  3HOY C;  3CQZ A;  1JVI A;  4KC6 A;  3GTJ C;  3GTP K;  3ORE A;  1WQF A;  4G7O A;  3DXJ A;  2JA6 C;  1I6H K;  1WSV A;  2R92 A;  2ZFZ A;  5EGH A;  3TTG A;  2R93 C;  1ISE A;  3H0G C;  1BDF A;  4Y7N C;  4GTA A;  3GEH A;  1VH2 A;  5IP9 K;  4BKW A;  1WOP A;  5FLM K;  3N0C A;  4QJV B;  3H3V L;  3S1N C;  3S1R K;  2JA5 C;  1WCM A;  3I4N K;  3ERE D;  2NVY C;  3HOX C;  4KMA A;  3GEE A;  4BBR C;  5IOR A;  2RGR A;  1RU0 A;  4C3H K;  1WQG A;  3A8I A;  1IW7 A;  4C45 A;  5C4J C;  4BY7 K;  3FOF A;  4PAA A;  3BP8 C;  4AH6 A;  2E2I C;  2JA5 A;  2JH3 A;  5C44 C;  3RZO K;  3I4N C;  3S15 C;  3HKZ L;  1TWA K;  2R93 A;  4A3M K;  4XLN A;  2VUM A;  1EQR A;  2YU9 C;  2Y0S D;  2E2I A;  3GTG A;  1YCL A;  3GSI A;  3I4M K;  3GDZ A;  4A3C K;  4P9S A;  4Y52 K;  1XZP B;  3CQZ C;  2ZUF A;  4X6A K;  1XXC A;  4A3K K;  4C3H C;  4GTD A;  5D4D A;  3HOV C;  4LQY A; 
#chains in the Genus database with same CATH homology
 2WB1 L;  2A6H A;  3S17 C;  1I50 C;  3M3Y C;  3S2H C;  5C3E C;  3PO2 C;  4QIW D;  1XPP A;  5IYC C;  3S2H K;  2BE5 A;  1I50 K;  4LK0 A;  2PMZ L;  5IYC K;  3S1R C;  4ZH4 A;  3EQL A;  5C3E K;  2JA7 C;  2NVY K;  3S17 K;  1Y1V K;  2WAQ D;  5FJ8 K;  4Q4Z A;  4BY1 C;  4A3F C;  1WCM C;  3CQZ K;  4QJV A;  3HOU K;  4XSZ A;  3S14 K;  3S1N K;  1SMY A;  1TWH C;  4X6A C;  1Y1W C;  1K83 C;  4XSX A;  3S1M C;  1TWC C;  4A3F K;  4JK1 A;  4A93 C;  3HOU C;  4A3L K;  5M5X K;  3HOZ C;  4A3E K;  3FKI K;  2YU9 K;  4C3I K;  4A3D K;  2R93 K;  3WOD A;  3PO3 C;  3PO2 K;  4LLG A;  4YG2 A;  4BBR K;  3GTJ K;  2E2H K;  4OIN A;  3GTP C;  3M4O K;  4C3J K;  4G7H A;  3HOX K;  1TWG K;  5C4X K;  3HOW C;  1I3Q C;  2PA8 D;  4YFX A;  5FLM C;  2E2J C;  2NVQ C;  3HOY C;  4A3K C;  4A3G C;  5C4X C;  4OIP A;  2JA5 K;  4BXX C;  4A3G K;  5M5W K;  2E2I K;  3GTJ C;  2E2H C;  2E2J K;  3GTP K;  3RZD C;  4OIQ A;  4G7O A;  2PA8 L;  3DXJ A;  1SFO K;  3GTG C;  2JA6 C;  1I6H K;  1R9T K;  4NOI A;  2NVX C;  5C4J K;  4BY7 C;  2O5I A;  4AYB L;  4Y7N K;  2B63 K;  3HKZ D;  4A3L C;  2A6E A;  1R9T C;  4BBS C;  2JA6 K;  2R93 C;  1SFO C;  4MEX A;  4A3D C;  3H0G C;  5IP7 K;  1BDF A;  4Y7N C;  4AYB D;  3S1M K;  3GTG K;  1K83 K;  2WB1 D;  5IP9 K;  3RZO C;  5FLM K;  2NVQ K;  4QJV B;  2VUM K;  3H3V L;  3HOY K;  3S14 C;  3S2D K;  3S1R K;  4OIO A;  2JA5 C;  3S1N C;  4XLP A;  3I4N K;  2NVY C;  3S1Q C;  1YNN A;  2O5J A;  3GTL C;  4A3J C;  4A3B C;  4GZY A;  1TWG C;  3HOW K;  3HOX C;  3S1Q K;  4A3I C;  4BBR C;  4KN7 A;  2PPB A;  3GTQ K;  3HOV K;  1TWC K;  3M3Y K;  3GTK C;  4G7Z A;  5IYD C;  3GTM K;  1YNJ A;  4LJZ A;  2JA8 K;  4MEY A;  3GTO C;  2R7Z K;  4C2M K;  4C3H K;  2CW0 A;  2JA7 K;  2R7Z C;  5IYB C;  1IW7 A;  3GTQ C;  2NVT K;  1Y1V C;  2WAQ L;  5C4J C;  5IP7 C;  3GTK K;  2NVX K;  3H0G K;  4BY7 K;  1I6H C;  3S16 C;  4BBS K;  1ZYR A;  4A3J K;  4A3B K;  3GTL K;  2B63 C;  4MQ9 A;  4KN4 A;  2E2I C;  2PMZ D;  4BXX K;  4KMU A;  2R92 C;  3RZD K;  2VUM C;  1TWA C;  1TWF K;  5C44 C;  3K7A C;  5IP9 C;  3RZO K;  3I4N C;  3H3V D;  2R92 K;  3HKZ L;  3S15 C;  3S2D C;  5TMF A;  3K7A K;  4Y52 C;  3M4O C;  4LK1 A;  1TWA K;  1TWF C;  4A3M K;  3I4M C;  5M3M K;  1HQM A;  4XLN A;  4A3E C;  2Y0S D;  2YU9 C;  2NVT C;  4A3C C;  4YFN A;  3PO3 K;  4A93 K;  4Q5S A;  2A69 A;  3S16 K;  4A3M C;  3FKI C;  3I4M K;  4A3C K;  3HOZ K;  5TMC A;  1I6V A;  4Y52 K;  1WCM K;  3CQZ C;  4BY1 K;  2Y0S L;  2JA8 C;  5IYB K;  4YFK A;  3GTM C;  1Y1W K;  5IYD K;  1TWH K;  4OIR A;  4A3K K;  4QIW L;  5M5Y K;  4X6A K;  5C44 K;  2A68 A;  3GTO K;  1I3Q K;  5D4D A;  3HOV C;  3S15 K;  4A3I K;  5M3F K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...