1TWGK

Rna polymerase ii complexed with ctp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twgK00
3M4OK 4A3KC 4A3IC 3S1RC 4A3LK 4Q4ZA 2R7ZK 2BE5A 2E2HK 3GTQC 3PO3C 3S15K 4JK1A 2PMZD 3K7AC 4QIWD 2A69A 3GTPK 2A6EA 3RZDC 3M3YK 1I50C 1WCMK 3CQZK 4LJZA 5C4XK 3S1NK 3FKIC 3DXJA 4KMUA 2A68A 5TMFA 4Y7NC 3HOXC 3I4MC 4A3JC 4A3GK 3GTLC 4XLPA 2PA8D 2WAQL 1TWFC 4C3JK 2WB1L 4OINA 3H0GC 5IP9C 5C4JK 5FLMK 4A3LC 4QJVB 4OIOA 3M4OC 4C3HK 5M5XK 2B63C 3S2HK 3HOWK 1K83K 2R7ZC 5IYDK 4XSXA 3EQLA 1TWAK 4BY1C 1XPPA 3S15C 2R93C 4A3MK 3GTPC 2NVYK 1ZYRA 1Y1VK 1WCMC 2E2JC 4BBRK 3M3YC 3GTOK 5C3EK 5C4XC 3S1NC 4A3EK 1TWCC 3I4NK 5C44C 1HQMA 2O5IA 2JA5K 4AYBL 4YFKA 2E2IK 4YFXA 3HOVK 4MEYA 3HOYK 5C4JC 5FLMC 4ZH4A 2JA7K 4G7OA 5IYDC 3HOWC 1K83C 4C2MK 1SFOK 1TWAC 1Y1WK 3HOZK 2PMZL 4BBSK 3GTMK 4QIWL 1BDFA 3HKZL 1I3QC 4A3MC 2CW0A 2NVYC 5IYBK 1Y1VC 5M5YK 3H3VL 1R9TC 5C3EC 2E2HC 3I4NC 2YU9K 2NVQK 1TWHK 3GTKK 2Y0SL 2JA5C 4LK1A 4OIPA 4MEXA 3HOVC 4G7ZA 2NVXK 3PO2K 3S1MK 2WAQD 3CQZC 3HOYC 3S16K 4A3DK 2JA7C 1YNNA 5IYCK 3GTGK 4MQ9A 4NOIA 1YNJA 2A6HA 3S1RK 4A3GC 3S14K 1SFOC 3GTQK 4A3CK 4X6AK 4KN4A 1Y1WC 3HOZC 4BBSC 3GTMC 5FJ8K 1SMYA 5IP7K 5IYBC 1TWGK 2JA6K 4OIQA 1I50K 3GTJK 2VUMK 4BY7K 4KN7A 3S2HC 5D4DA 4A3BK 3S1QK 4A3JK 1TWHC 2NVQC 4A3FK 2NVTK 5M3MK 3RZOK 5M5WK 4BBRC 3WODA 2NVXC 2PPBA 2JA8K 1TWFK 3GTOC 3PO2C 1I6HK 4A3EC 2R92K 4A3DC 5IP9K 5IYCC 1I6VA 2B63K 4YG2A 3S14C 4A3CC 3S2DK 2PA8L 2E2IC 4GZYA 4X6AC 4BY1K 2R93K 4YFNA 4LLGA 3HOUK 5IP7C 1TWGC 3HKZD 1IW7A 2WB1D 2JA6C 5TMCA 3H3VD 4BXXK 2E2JK 4Y52K 3GTJC 2VUMC 3S17K 4BY7C 4A93K 4A3KK 4A3IK 4C3IK 1TWCK 4A3BC 3S1QC 3PO3K 4Q5SA 4QJVA 4A3FC 2NVTC 5C44K 2Y0SD 3K7AK 3RZOC 4OIRA 3RZDK 2JA8C 2O5JA 1I6HC 2R92C 3FKIK 4Y7NK 3HOXK 4G7HA 2YU9C 3I4MK 3GTKC 4XSZA 3GTLK 3S2DC 5M3FK 4AYBD 3HOUC 3S1MC 4Y52C 3S16C 1I3QK 4XLNA 4BXXC 3H0GK 4LK0A 1R9TK 3S17C 3GTGC 4A93C
chains in the Genus database with same CATH superfamily
3M4OK 4GFQA 4A3IC 4WILA 4Q4ZA 1EI6A 2BE5A 3GTQC 2R7ZK 4WJ3M 4LR2A 3K7AC 2A69A 1EH1A 3BP3A 3M3YK 4FM9A 3CQZK 4LJZA 1USOA 3FKIC 5TMFA 2A68A 3HOXC 5EGHA 2NVYA 4A3GK 1O27A 3G4AA 4C3JK 4OINA 2WB1L 5C4JK 5FLMK 3OEPA 4A3LC 1PJ5A 1J6VA 4OIOA 5M5XK 3N0CA 4XSXA 1TWAK 3S15C 2R93C 4G0VA 3TFHA 3GTOK 1XXAA 3GTMA 4XCHA 2GAGC 3GIRA 3GEHA 4J3NA 1HQMA 5IOSA 2O5IA 2V6SA 4AYBL 4GTCA 4BLAA 3TFIA 3HOVK 2GSOA 2YU9A 2FQTA 1TWHA 2JA7K 1XXCA 4C3HC 4KM9A 4GT9A 2D6FC 1I3QC 2CFAB 1Y1VC 3N0BA 3AD9C 2E2HC 2FQOA 5TJ3A 1I50A 2VUMA 1VGXA 3T02A 2WAQD 4RMFA 5IYCK 3GTGK 4MQ9A 4NOIA 3GTQK 1Y1WC 3HOZC 4BBSC 2R92A 2V6UA 3A8KA 4P5BA 1JVIA 1DCPA 1GE9A 1JQWA 2RH6A 5M3MK 3RZOK 2NVXC 3PO2C 1TWCA 1HI9A 4A3DC 3N3YA 1PJ6A 1WOSA 2E2IC 2R93K 3SZZA 4LLGA 4KASA 3GDZA 2JA6C 2GSNA 3H3VD 4BXXK 4M1XA 1ZBSA 3GTJC 3S17K 4BY7C 5CHPA 4Q5SA 1IBAA 3FOFA 3ADAC 3RZDK 2JA8C 2R7ZA 5IOTA 5JFEA 4G7HA 3GTKC 3S2DC 3CQZA 1IL2A 3BP8C 3S16C 1I3QK 1YX2A 4XLNA 3H0GK 4LK0A 2JH3A 1WOPA 2E2HK 3PO3C 4JK1A 3OREA 3GTPK 2A6EA 1WCMK 4G0WA 1TWAA 1UV7A 1F7VA 4G0UA 3GTLC 3GTOA 4XLPA 1X31C 1TWFC 5IP9C 2B63C 3HOWK 1K83K 3EQLA 2JA7A 4A3MK 3A8IA 5C4XC 4C45A 3S1NC 1O26A 4C3IC 3I4NK 2Y3PA 1RU0A 4KMHA 2JA5K 2E2IK 3HOYK 4ZH4A 4P5AA 4G7OA 1O29A 1USMA 5IYDC 1SFOK 1XZQA 2PHCB 3HKZL 4GTFA 3GTGA 1J6WA 2NVYC 1R9TC 1V5VA 5C3EC 4BLBA 4PABA 3GTQA 3MMLB 1PJ7A 3GTKK 1WOOA 1EQRA 4G7ZA 3S16K 4C2MC 2A6HA 3S14K 4KN4A 3GTMC 3AH5A 5IYBC 1TWGK 3BUEA 4GTEA 1B4AA 4KN7A 2R93A 4A3BK 2NVQC 1TWHC 4A3FK 4KB4A 2NVTK 5HL8A 3GEEA 5M5WK 3NUHA 4KM8A 1TWFK 1YCLA 1I6HK 4A3EC 5IP9K 1INNA 4KMAA 2XCRB 2B63K 4A3CC 4X6AC 4GZYA 4YFNA 3HOUK 5IP7C 2W7VA 2ZUEA 1IW7A 1WQGA 5TMCA 2VUMC 4A93K 4A3IK 4C3IK 3S1QC 4QJVA 3H0GA 2Y0SD 3K7AK 1KQ4A 4OIRA 1BJTA 2O5JA 2E2HA 2R92C 3FKIK 3LPXA 3HOXK 3GTPA 2XCQA 4AH6A 1WCMA 3HXAA 2EBBA 2KWAA 3S1MC 4Y52C 4DDQA 1R9TK 4A3LK 4PAAA 4A3KC 3S1RC 3T00A 3S15K 2PMZD 1ZVUA 1ZQ1C 1K83A 5CJ9A 3DXJA 4KMUA 4Y7NC 4KAWX 3I4MC 4A3JC 1VH2A 3AQPA 2PA8D 2WAQL 2JA5A 3M4OC 1VLOA 3AD7C 4C3HK 2E2IA 2R7ZC 3GSIA 5E68A 4BY1C 1XPPA 4P9SA 1Y1VK 2E2JC 3M3YC 1SFOA 3JSTA 4A3EK 3L4KA 1WQFA 4KATA 5C44C 3L4JA 4YFKA 3TFJA 4YFXA 3Q3QA 4MEYA 1AB4A 5C4JC 2P8TA 5FLMC 3GTKA 4KARA 1O25A 1TWAC 4FZBA 1Y1WK 2PMZL 3HOZK 4BBSK 1BDFA 2CW0A 3H3VL 5M5YK 5IORA 4ILDA 1TWGA 1O24A 4LK1A 4OIPA 4MEXA 3HOVC 2NVXK 3PO2K 3S1MK 2GSUA 4A3DK 2JA7C 3S1RK 2ZUFA 1XXBA 5FJ8K 2JA6K 3V4GA 1DD5A 2B63A 3GTJK 4BY7K 4GTAA 3S2HC 1JOEA 5EGEA 5L46A 4A3JK 4LOWA 3AD8C 4O2DA 4BBRC 3WODA 2JA8K 2PPBA 1IS1A 1XZQB 3TTGA 5IYCC 1VRQC 1I6VA 3S2DK 4BY1K 3QX3A 3FKIA 2E2JK 2GAHC 4GTLA 3ERED 3PO3K 5C44K 1R9TA 1VJEA 3RZOC 1L0WA 2P5MA 2YU9C 1EFWA 4KB2A 4XSZA 1J6XA 3IPJA 3GTLK 1O2AA 3FHZA 4BXXC 3S17C 5IOQA 2RGRA 3OPFA 1WQHA 4QIWD 3RZDC 1I50C 1B4BA 5C4XK 3S1NK 1DCHA 2CFAA 1I3QA 3VA7A 1Y1VA 1XZPA 3H0GC 3S0XA 4QJVB 4KC6A 3S2HK 5IYDK 1BS2A 1F9NA 1XZPB 1O28A 1J98A 3GTPC 2NVYK 1ZYRA 1WCMC 4BBRK 5C3EK 1DCOA 1Y1WA 4GTDA 1TWCC 4KDDA 3A8JA 3SZYA 1IQ0A 3HOWC 1K83C 4C2MK 2NVXA 4KMDA 3GTMK 4QIWL 3LAJA 4A3MC 5IYBK 1ZXOA 1WORA 2ZFZA 4LQYA 3I4NC 2YU9K 2NVQK 1TWHK 2JA6A 2Y0SL 2JA5C 3GTJA 3CQZC 1EK8A 3HOYC 3FOEA 1YNNA 4A3GC 1YNJA 1SFOC 1ISEA 4A3CK 4X6AK 1G51A 4C3JC 1SMYA 4WJ4A 5IP7K 3AQOA 1WIHA 4OIQA 1I50K 2VUMK 3CAGA 5D4DA 3S1QK 3G4CA 1BGWA 1O2BA 1IE0A 1F7UA 3GTOC 2R92K 4BKWA 1F93A 2XCOA 4YG2A 3S14C 2PA8L 1TWGC 3HKZD 4Y52K 2WB1D 5JVOA 3GTLA 4A3KK 1TWCK 1C0AA 4A3BC 1TWFA 4A3FC 2NVTC 1WSVA 2V6TA 3GEIA 3T01A 1WSRA 1I6HC 4Y7NK 3LAPA 3I4MK 4GTBA 5M3FK 4AYBD 3HOUC 1O2FB 3GTGC 4A93C
chains in the Genus database with same CATH topology
3M4OK 4A3KC 4A3IC 3S1RC 4A3LK 4Q4ZA 2R7ZK 2BE5A 2E2HK 3GTQC 3PO3C 3S15K 4JK1A 2PMZD 3K7AC 4QIWD 2A69A 3GTPK 2A6EA 3RZDC 3M3YK 1I50C 1WCMK 3CQZK 4LJZA 5C4XK 3S1NK 3FKIC 3DXJA 4KMUA 2A68A 5TMFA 4Y7NC 3HOXC 3I4MC 4A3JC 4A3GK 3GTLC 4XLPA 2PA8D 2WAQL 1TWFC 4C3JK 2WB1L 4OINA 3H0GC 5IP9C 5C4JK 5FLMK 4A3LC 4QJVB 4OIOA 3M4OC 4C3HK 5M5XK 2B63C 3S2HK 3HOWK 1K83K 2R7ZC 5IYDK 4XSXA 3EQLA 1TWAK 4BY1C 1XPPA 3S15C 2R93C 4A3MK 3GTPC 2NVYK 1ZYRA 1Y1VK 1WCMC 2E2JC 4BBRK 3M3YC 3GTOK 5C3EK 5C4XC 3S1NC 4A3EK 1TWCC 3I4NK 5C44C 1HQMA 2O5IA 2JA5K 4AYBL 4YFKA 2E2IK 4YFXA 3HOVK 4MEYA 3HOYK 5C4JC 5FLMC 4ZH4A 2JA7K 4G7OA 5IYDC 3HOWC 1K83C 4C2MK 1SFOK 1TWAC 1Y1WK 3HOZK 2PMZL 4BBSK 3GTMK 4QIWL 1BDFA 3HKZL 1I3QC 4A3MC 2CW0A 2NVYC 5IYBK 1Y1VC 5M5YK 3H3VL 1R9TC 5C3EC 2E2HC 3I4NC 2YU9K 2NVQK 1TWHK 3GTKK 2Y0SL 2JA5C 4LK1A 4OIPA 4MEXA 3HOVC 4G7ZA 2NVXK 3PO2K 3S1MK 2WAQD 3CQZC 3HOYC 3S16K 4A3DK 2JA7C 1YNNA 5IYCK 3GTGK 4MQ9A 4NOIA 1YNJA 2A6HA 3S1RK 4A3GC 3S14K 1SFOC 3GTQK 4A3CK 4X6AK 4KN4A 1Y1WC 3HOZC 4BBSC 3GTMC 5FJ8K 1SMYA 5IP7K 5IYBC 1TWGK 2JA6K 4OIQA 1I50K 3GTJK 2VUMK 4BY7K 4KN7A 3S2HC 5D4DA 4A3BK 3S1QK 4A3JK 1TWHC 2NVQC 4A3FK 2NVTK 5M3MK 3RZOK 5M5WK 4BBRC 3WODA 2NVXC 2PPBA 2JA8K 1TWFK 3GTOC 3PO2C 1I6HK 4A3EC 2R92K 4A3DC 5IP9K 5IYCC 1I6VA 2B63K 4YG2A 3S14C 4A3CC 3S2DK 2PA8L 2E2IC 4GZYA 4X6AC 4BY1K 2R93K 4YFNA 4LLGA 3HOUK 5IP7C 1TWGC 3HKZD 1IW7A 2WB1D 2JA6C 5TMCA 3H3VD 4BXXK 2E2JK 4Y52K 3GTJC 2VUMC 3S17K 4BY7C 4A93K 4A3KK 4A3IK 4C3IK 1TWCK 4A3BC 3S1QC 3PO3K 4Q5SA 4QJVA 4A3FC 2NVTC 5C44K 2Y0SD 3K7AK 3RZOC 4OIRA 3RZDK 2JA8C 2O5JA 1I6HC 2R92C 3FKIK 4Y7NK 3HOXK 4G7HA 2YU9C 3I4MK 3GTKC 4XSZA 3GTLK 3S2DC 5M3FK 4AYBD 3HOUC 3S1MC 4Y52C 3S16C 1I3QK 4XLNA 4BXXC 3H0GK 4LK0A 1R9TK 3S17C 3GTGC 4A93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  4A3K C;  4A3I C;  3S1R C;  4A3L K;  4Q4Z A;  2R7Z K;  2BE5 A;  2E2H K;  3GTQ C;  3PO3 C;  3S15 K;  4JK1 A;  2PMZ D;  3K7A C;  4QIW D;  2A69 A;  3GTP K;  2A6E A;  3RZD C;  3M3Y K;  1I50 C;  1WCM K;  3CQZ K;  4LJZ A;  5C4X K;  3S1N K;  3FKI C;  3DXJ A;  4KMU A;  2A68 A;  5TMF A;  4Y7N C;  3HOX C;  3I4M C;  4A3J C;  4A3G K;  3GTL C;  4XLP A;  2PA8 D;  2WAQ L;  1TWF C;  4C3J K;  2WB1 L;  4OIN A;  3H0G C;  5IP9 C;  5C4J K;  5FLM K;  4A3L C;  4QJV B;  4OIO A;  3M4O C;  4C3H K;  5M5X K;  2B63 C;  3S2H K;  3HOW K;  1K83 K;  2R7Z C;  5IYD K;  4XSX A;  3EQL A;  1TWA K;  4BY1 C;  1XPP A;  3S15 C;  2R93 C;  4A3M K;  3GTP C;  2NVY K;  1ZYR A;  1Y1V K;  1WCM C;  2E2J C;  4BBR K;  3M3Y C;  3GTO K;  5C3E K;  5C4X C;  3S1N C;  4A3E K;  1TWC C;  3I4N K;  5C44 C;  1HQM A;  2O5I A;  2JA5 K;  4AYB L;  4YFK A;  2E2I K;  4YFX A;  3HOV K;  4MEY A;  3HOY K;  5C4J C;  5FLM C;  4ZH4 A;  2JA7 K;  4G7O A;  5IYD C;  3HOW C;  1K83 C;  4C2M K;  1SFO K;  1TWA C;  1Y1W K;  3HOZ K;  2PMZ L;  4BBS K;  3GTM K;  4QIW L;  1BDF A;  3HKZ L;  1I3Q C;  4A3M C;  2CW0 A;  2NVY C;  5IYB K;  1Y1V C;  5M5Y K;  3H3V L;  1R9T C;  5C3E C;  2E2H C;  3I4N C;  2YU9 K;  2NVQ K;  1TWH K;  3GTK K;  2Y0S L;  2JA5 C;  4LK1 A;  4OIP A;  4MEX A;  3HOV C;  4G7Z A;  2NVX K;  3PO2 K;  3S1M K;  2WAQ D;  3CQZ C;  3HOY C;  3S16 K;  4A3D K;  2JA7 C;  1YNN A;  5IYC K;  3GTG K;  4MQ9 A;  4NOI A;  1YNJ A;  2A6H A;  3S1R K;  4A3G C;  3S14 K;  1SFO C;  3GTQ K;  4A3C K;  4X6A K;  4KN4 A;  1Y1W C;  3HOZ C;  4BBS C;  3GTM C;  5FJ8 K;  1SMY A;  5IP7 K;  5IYB C;  1TWG K;  2JA6 K;  4OIQ A;  1I50 K;  3GTJ K;  2VUM K;  4BY7 K;  4KN7 A;  3S2H C;  5D4D A;  4A3B K;  3S1Q K;  4A3J K;  1TWH C;  2NVQ C;  4A3F K;  2NVT K;  5M3M K;  3RZO K;  5M5W K;  4BBR C;  3WOD A;  2NVX C;  2PPB A;  2JA8 K;  1TWF K;  3GTO C;  3PO2 C;  1I6H K;  4A3E C;  2R92 K;  4A3D C;  5IP9 K;  5IYC C;  1I6V A;  2B63 K;  4YG2 A;  3S14 C;  4A3C C;  3S2D K;  2PA8 L;  2E2I C;  4GZY A;  4X6A C;  4BY1 K;  2R93 K;  4YFN A;  4LLG A;  3HOU K;  5IP7 C;  1TWG C;  3HKZ D;  1IW7 A;  2WB1 D;  2JA6 C;  5TMC A;  3H3V D;  4BXX K;  2E2J K;  4Y52 K;  3GTJ C;  2VUM C;  3S17 K;  4BY7 C;  4A93 K;  4A3K K;  4A3I K;  4C3I K;  1TWC K;  4A3B C;  3S1Q C;  3PO3 K;  4Q5S A;  4QJV A;  4A3F C;  2NVT C;  5C44 K;  2Y0S D;  3K7A K;  3RZO C;  4OIR A;  3RZD K;  2JA8 C;  2O5J A;  1I6H C;  2R92 C;  3FKI K;  4Y7N K;  3HOX K;  4G7H A;  2YU9 C;  3I4M K;  3GTK C;  4XSZ A;  3GTL K;  3S2D C;  5M3F K;  4AYB D;  3HOU C;  3S1M C;  4Y52 C;  3S16 C;  1I3Q K;  4XLN A;  4BXX C;  3H0G K;  4LK0 A;  1R9T K;  3S17 C;  3GTG C;  4A93 C; 
#chains in the Genus database with same CATH topology
 3M4O K;  4GFQ A;  4A3I C;  4WIL A;  4Q4Z A;  1EI6 A;  2BE5 A;  3GTQ C;  2R7Z K;  4WJ3 M;  4LR2 A;  3K7A C;  2A69 A;  1EH1 A;  3BP3 A;  3M3Y K;  4FM9 A;  3CQZ K;  4LJZ A;  1USO A;  3FKI C;  5TMF A;  2A68 A;  3HOX C;  5EGH A;  2NVY A;  4A3G K;  1O27 A;  3G4A A;  4C3J K;  4OIN A;  2WB1 L;  5C4J K;  5FLM K;  3OEP A;  4A3L C;  1PJ5 A;  1J6V A;  4OIO A;  5M5X K;  3N0C A;  4XSX A;  1TWA K;  3S15 C;  2R93 C;  4G0V A;  3TFH A;  3GTO K;  1XXA A;  3GTM A;  4XCH A;  2GAG C;  3GIR A;  3GEH A;  4J3N A;  1HQM A;  5IOS A;  2O5I A;  2V6S A;  4AYB L;  4GTC A;  4BLA A;  3TFI A;  3HOV K;  2GSO A;  2YU9 A;  2FQT A;  1TWH A;  2JA7 K;  1XXC A;  4C3H C;  4KM9 A;  4GT9 A;  2D6F C;  1I3Q C;  2CFA B;  1Y1V C;  3N0B A;  3AD9 C;  2E2H C;  2FQO A;  5TJ3 A;  1I50 A;  2VUM A;  1VGX A;  3T02 A;  2WAQ D;  4RMF A;  5IYC K;  3GTG K;  4MQ9 A;  4NOI A;  3GTQ K;  1Y1W C;  3HOZ C;  4BBS C;  2R92 A;  2V6U A;  3A8K A;  4P5B A;  1JVI A;  1DCP A;  1GE9 A;  1JQW A;  2RH6 A;  5M3M K;  3RZO K;  2NVX C;  3PO2 C;  1TWC A;  1HI9 A;  4A3D C;  3N3Y A;  1PJ6 A;  1WOS A;  2E2I C;  2R93 K;  3SZZ A;  4LLG A;  4KAS A;  3GDZ A;  2JA6 C;  2GSN A;  3H3V D;  4BXX K;  4M1X A;  1ZBS A;  3GTJ C;  3S17 K;  4BY7 C;  5CHP A;  4Q5S A;  1IBA A;  3FOF A;  3ADA C;  3RZD K;  2JA8 C;  2R7Z A;  5IOT A;  5JFE A;  4G7H A;  3GTK C;  3S2D C;  3CQZ A;  1IL2 A;  3BP8 C;  3S16 C;  1I3Q K;  1YX2 A;  4XLN A;  3H0G K;  4LK0 A;  2JH3 A;  1WOP A;  2E2H K;  3PO3 C;  4JK1 A;  3ORE A;  3GTP K;  2A6E A;  1WCM K;  4G0W A;  1TWA A;  1UV7 A;  1F7V A;  4G0U A;  3GTL C;  3GTO A;  4XLP A;  1X31 C;  1TWF C;  5IP9 C;  2B63 C;  3HOW K;  1K83 K;  3EQL A;  2JA7 A;  4A3M K;  3A8I A;  5C4X C;  4C45 A;  3S1N C;  1O26 A;  4C3I C;  3I4N K;  2Y3P A;  1RU0 A;  4KMH A;  2JA5 K;  2E2I K;  3HOY K;  4ZH4 A;  4P5A A;  4G7O A;  1O29 A;  1USM A;  5IYD C;  1SFO K;  1XZQ A;  2PHC B;  3HKZ L;  4GTF A;  3GTG A;  1J6W A;  2NVY C;  1R9T C;  1V5V A;  5C3E C;  4BLB A;  4PAB A;  3GTQ A;  3MML B;  1PJ7 A;  3GTK K;  1WOO A;  1EQR A;  4G7Z A;  3S16 K;  4C2M C;  2A6H A;  3S14 K;  4KN4 A;  3GTM C;  3AH5 A;  5IYB C;  1TWG K;  3BUE A;  4GTE A;  1B4A A;  4KN7 A;  2R93 A;  4A3B K;  2NVQ C;  1TWH C;  4A3F K;  4KB4 A;  2NVT K;  5HL8 A;  3GEE A;  5M5W K;  3NUH A;  4KM8 A;  1TWF K;  1YCL A;  1I6H K;  4A3E C;  5IP9 K;  1INN A;  4KMA A;  2XCR B;  2B63 K;  4A3C C;  4X6A C;  4GZY A;  4YFN A;  3HOU K;  5IP7 C;  2W7V A;  2ZUE A;  1IW7 A;  1WQG A;  5TMC A;  2VUM C;  4A93 K;  4A3I K;  4C3I K;  3S1Q C;  4QJV A;  3H0G A;  2Y0S D;  3K7A K;  1KQ4 A;  4OIR A;  1BJT A;  2O5J A;  2E2H A;  2R92 C;  3FKI K;  3LPX A;  3HOX K;  3GTP A;  2XCQ A;  4AH6 A;  1WCM A;  3HXA A;  2EBB A;  2KWA A;  3S1M C;  4Y52 C;  4DDQ A;  1R9T K;  4A3L K;  4PAA A;  4A3K C;  3S1R C;  3T00 A;  3S15 K;  2PMZ D;  1ZVU A;  1ZQ1 C;  1K83 A;  5CJ9 A;  3DXJ A;  4KMU A;  4Y7N C;  4KAW X;  3I4M C;  4A3J C;  1VH2 A;  3AQP A;  2PA8 D;  2WAQ L;  2JA5 A;  3M4O C;  1VLO A;  3AD7 C;  4C3H K;  2E2I A;  2R7Z C;  3GSI A;  5E68 A;  4BY1 C;  1XPP A;  4P9S A;  1Y1V K;  2E2J C;  3M3Y C;  1SFO A;  3JST A;  4A3E K;  3L4K A;  1WQF A;  4KAT A;  5C44 C;  3L4J A;  4YFK A;  3TFJ A;  4YFX A;  3Q3Q A;  4MEY A;  1AB4 A;  5C4J C;  2P8T A;  5FLM C;  3GTK A;  4KAR A;  1O25 A;  1TWA C;  4FZB A;  1Y1W K;  2PMZ L;  3HOZ K;  4BBS K;  1BDF A;  2CW0 A;  3H3V L;  5M5Y K;  5IOR A;  4ILD A;  1TWG A;  1O24 A;  4LK1 A;  4OIP A;  4MEX A;  3HOV C;  2NVX K;  3PO2 K;  3S1M K;  2GSU A;  4A3D K;  2JA7 C;  3S1R K;  2ZUF A;  1XXB A;  5FJ8 K;  2JA6 K;  3V4G A;  1DD5 A;  2B63 A;  3GTJ K;  4BY7 K;  4GTA A;  3S2H C;  1JOE A;  5EGE A;  5L46 A;  4A3J K;  4LOW A;  3AD8 C;  4O2D A;  4BBR C;  3WOD A;  2JA8 K;  2PPB A;  1IS1 A;  1XZQ B;  3TTG A;  5IYC C;  1VRQ C;  1I6V A;  3S2D K;  4BY1 K;  3QX3 A;  3FKI A;  2E2J K;  2GAH C;  4GTL A;  3ERE D;  3PO3 K;  5C44 K;  1R9T A;  1VJE A;  3RZO C;  1L0W A;  2P5M A;  2YU9 C;  1EFW A;  4KB2 A;  4XSZ A;  1J6X A;  3IPJ A;  3GTL K;  1O2A A;  3FHZ A;  4BXX C;  3S17 C;  5IOQ A;  2RGR A;  3OPF A;  1WQH A;  4QIW D;  3RZD C;  1I50 C;  1B4B A;  5C4X K;  3S1N K;  1DCH A;  2CFA A;  1I3Q A;  3VA7 A;  1Y1V A;  1XZP A;  3H0G C;  3S0X A;  4QJV B;  4KC6 A;  3S2H K;  5IYD K;  1BS2 A;  1F9N A;  1XZP B;  1O28 A;  1J98 A;  3GTP C;  2NVY K;  1ZYR A;  1WCM C;  4BBR K;  5C3E K;  1DCO A;  1Y1W A;  4GTD A;  1TWC C;  4KDD A;  3A8J A;  3SZY A;  1IQ0 A;  3HOW C;  1K83 C;  4C2M K;  2NVX A;  4KMD A;  3GTM K;  4QIW L;  3LAJ A;  4A3M C;  5IYB K;  1ZXO A;  1WOR A;  2ZFZ A;  4LQY A;  3I4N C;  2YU9 K;  2NVQ K;  1TWH K;  2JA6 A;  2Y0S L;  2JA5 C;  3GTJ A;  3CQZ C;  1EK8 A;  3HOY C;  3FOE A;  1YNN A;  4A3G C;  1YNJ A;  1SFO C;  1ISE A;  4A3C K;  4X6A K;  1G51 A;  4C3J C;  1SMY A;  4WJ4 A;  5IP7 K;  3AQO A;  1WIH A;  4OIQ A;  1I50 K;  2VUM K;  3CAG A;  5D4D A;  3S1Q K;  3G4C A;  1BGW A;  1O2B A;  1IE0 A;  1F7U A;  3GTO C;  2R92 K;  4BKW A;  1F93 A;  2XCO A;  4YG2 A;  3S14 C;  2PA8 L;  1TWG C;  3HKZ D;  4Y52 K;  2WB1 D;  5JVO A;  3GTL A;  4A3K K;  1TWC K;  1C0A A;  4A3B C;  1TWF A;  4A3F C;  2NVT C;  1WSV A;  2V6T A;  3GEI A;  3T01 A;  1WSR A;  1I6H C;  4Y7N K;  3LAP A;  3I4M K;  4GTB A;  5M3F K;  4AYB D;  3HOU C;  1O2F B;  3GTG C;  4A93 C; 
#chains in the Genus database with same CATH homology
 3M4O K;  4A3K C;  4A3I C;  3S1R C;  4A3L K;  4Q4Z A;  2R7Z K;  2BE5 A;  2E2H K;  3GTQ C;  3PO3 C;  3S15 K;  4JK1 A;  2PMZ D;  3K7A C;  4QIW D;  2A69 A;  3GTP K;  2A6E A;  3RZD C;  3M3Y K;  1I50 C;  1WCM K;  3CQZ K;  4LJZ A;  5C4X K;  3S1N K;  3FKI C;  3DXJ A;  4KMU A;  2A68 A;  5TMF A;  4Y7N C;  3HOX C;  3I4M C;  4A3J C;  4A3G K;  3GTL C;  4XLP A;  2PA8 D;  2WAQ L;  1TWF C;  4C3J K;  2WB1 L;  4OIN A;  3H0G C;  5IP9 C;  5C4J K;  5FLM K;  4A3L C;  4QJV B;  4OIO A;  3M4O C;  4C3H K;  5M5X K;  2B63 C;  3S2H K;  3HOW K;  1K83 K;  2R7Z C;  5IYD K;  4XSX A;  3EQL A;  1TWA K;  4BY1 C;  1XPP A;  3S15 C;  2R93 C;  4A3M K;  3GTP C;  2NVY K;  1ZYR A;  1Y1V K;  1WCM C;  2E2J C;  4BBR K;  3M3Y C;  3GTO K;  5C3E K;  5C4X C;  3S1N C;  4A3E K;  1TWC C;  3I4N K;  5C44 C;  1HQM A;  2O5I A;  2JA5 K;  4AYB L;  4YFK A;  2E2I K;  4YFX A;  3HOV K;  4MEY A;  3HOY K;  5C4J C;  5FLM C;  4ZH4 A;  2JA7 K;  4G7O A;  5IYD C;  3HOW C;  1K83 C;  4C2M K;  1SFO K;  1TWA C;  1Y1W K;  3HOZ K;  2PMZ L;  4BBS K;  3GTM K;  4QIW L;  1BDF A;  3HKZ L;  1I3Q C;  4A3M C;  2CW0 A;  2NVY C;  5IYB K;  1Y1V C;  5M5Y K;  3H3V L;  1R9T C;  5C3E C;  2E2H C;  3I4N C;  2YU9 K;  2NVQ K;  1TWH K;  3GTK K;  2Y0S L;  2JA5 C;  4LK1 A;  4OIP A;  4MEX A;  3HOV C;  4G7Z A;  2NVX K;  3PO2 K;  3S1M K;  2WAQ D;  3CQZ C;  3HOY C;  3S16 K;  4A3D K;  2JA7 C;  1YNN A;  5IYC K;  3GTG K;  4MQ9 A;  4NOI A;  1YNJ A;  2A6H A;  3S1R K;  4A3G C;  3S14 K;  1SFO C;  3GTQ K;  4A3C K;  4X6A K;  4KN4 A;  1Y1W C;  3HOZ C;  4BBS C;  3GTM C;  5FJ8 K;  1SMY A;  5IP7 K;  5IYB C;  1TWG K;  2JA6 K;  4OIQ A;  1I50 K;  3GTJ K;  2VUM K;  4BY7 K;  4KN7 A;  3S2H C;  5D4D A;  4A3B K;  3S1Q K;  4A3J K;  1TWH C;  2NVQ C;  4A3F K;  2NVT K;  5M3M K;  3RZO K;  5M5W K;  4BBR C;  3WOD A;  2NVX C;  2PPB A;  2JA8 K;  1TWF K;  3GTO C;  3PO2 C;  1I6H K;  4A3E C;  2R92 K;  4A3D C;  5IP9 K;  5IYC C;  1I6V A;  2B63 K;  4YG2 A;  3S14 C;  4A3C C;  3S2D K;  2PA8 L;  2E2I C;  4GZY A;  4X6A C;  4BY1 K;  2R93 K;  4YFN A;  4LLG A;  3HOU K;  5IP7 C;  1TWG C;  3HKZ D;  1IW7 A;  2WB1 D;  2JA6 C;  5TMC A;  3H3V D;  4BXX K;  2E2J K;  4Y52 K;  3GTJ C;  2VUM C;  3S17 K;  4BY7 C;  4A93 K;  4A3K K;  4A3I K;  4C3I K;  1TWC K;  4A3B C;  3S1Q C;  3PO3 K;  4Q5S A;  4QJV A;  4A3F C;  2NVT C;  5C44 K;  2Y0S D;  3K7A K;  3RZO C;  4OIR A;  3RZD K;  2JA8 C;  2O5J A;  1I6H C;  2R92 C;  3FKI K;  4Y7N K;  3HOX K;  4G7H A;  2YU9 C;  3I4M K;  3GTK C;  4XSZ A;  3GTL K;  3S2D C;  5M3F K;  4AYB D;  3HOU C;  3S1M C;  4Y52 C;  3S16 C;  1I3Q K;  4XLN A;  4BXX C;  3H0G K;  4LK0 A;  1R9T K;  3S17 C;  3GTG C;  4A93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...