1TWGK

Rna polymerase ii complexed with ctp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twgK00
4A3CK 2E2HK 2NVXK 1I50K 3PO3C 5TMFA 4A3LK 4BBRK 1I50C 4A3LC 5IYDC 2WAQL 5C3EC 3RZDK 2JA5K 4BY1K 5IP7K 4A3IC 4Y52K 2A6EA 1Y1WC 4YFXA 2JA6K 3HOWC 1YNJA 4JK1A 1TWFC 2R93K 1TWGK 4LK0A 4X6AC 4Y7NC 4A93C 1I3QK 5M3MK 4AYBD 3PO2C 3H0GC 5M5WK 3GTLK 1ZYRA 4C3IK 4A3JC 3S16K 2NVYC 3GTLC 3GTPK 2NVQC 3S16C 4G7OA 5IP9K 5FLMC 3HOUC 4XLNA 2NVTC 3GTJK 4YFNA 5C4JC 4YG2A 3M3YC 2BE5A 2YU9K 3S2HK 3GTMC 4A3DC 5C3EK 4XSXA 3RZDC 5IYCC 3HOZK 5IYDK 4AYBL 3GTQK 2O5JA 4A3BK 5IYCK 1SMYA 4A3EC 3K7AK 3M4OK 4OIOA 3I4NC 1Y1VK 4ZH4A 1I6HC 2R93C 3CQZK 1TWGC 2WAQD 4A3MK 2WB1D 5C4XK 3S14K 2PMZD 3WODA 3S14C 4BBSK 3GTKC 4G7HA 4BBSC 4QIWD 3HOVK 4KMUA 3S1MC 4BXXK 4A3KK 3FKIC 4NOIA 3GTOC 4OIPA 1I6VA 5M5YK 3EQLA 3H0GK 2E2JK 4A3JK 3HOXK 2PA8D 2E2JC 3S1NC 5C4JK 3PO3K 2YU9C 4A3DK 3GTMK 2Y0SL 5TMCA 2B63K 4BY7C 1TWCK 3S1RK 3RZOK 1TWCC 5IP7C 4A3IK 2R92K 5M3FK 3I4NK 3M4OC 2JA6C 4OIRA 3GTQC 3CQZC 4OINA 4A3BC 3S1QC 4KN4A 2O5IA 4A3EK 1TWHK 2A69A 3K7AC 4MQ9A 4XSZA 3GTGK 4GZYA 3HOYC 3GTKK 2E2IC 4Y7NK 4G7ZA 2NVXC 4BXXC 3I4MK 4A3KC 2WB1L 3I4MC 4KN7A 4C3JK 2PPBA 4LLGA 2JA5C 5C44K 4BY1C 3HOUK 3H3VL 3S17C 1XPPA 3S1NK 3S17K 5IYBC 3HOXC 1TWAC 2JA8C 4MEYA 5IYBK 3M3YK 1K83K 5D4DA 3S2HC 1WCMC 3HOZC 2PA8L 3RZOC 4A3GC 4X6AK 2R92C 3DXJA 2B63C 2R7ZC 4MEXA 4BY7K 3S1RC 1IW7A 2JA8K 2JA7C 1SFOC 1HQMA 4A3CC 2NVYK 3GTPC 1I6HK 2NVQK 2VUMC 4LJZA 3H3VD 3HKZD 5IP9C 5FLMK 5C4XC 3HOYK 3S1QK 2E2IK 4BBRC 4XLPA 4QJVA 1TWHC 1YNNA 5FJ8K 3GTGC 1BDFA 4YFKA 4C2MK 2PMZL 5C44C 3HOWK 1R9TK 3S15C 2A68A 1TWFK 4Y52C 1R9TC 4QIWL 1Y1WK 3S15K 4Q5SA 1Y1VC 3HKZL 3S2DC 4A3MC 1K83C 4QJVB 4Q4ZA 1WCMK 1I3QC 4A3FC 2VUMK 3PO2K 3S2DK 4A3GK 2A6HA 2CW0A 1TWAK 4C3HK 4A3FK 4A93K 4OIQA 1SFOK 4LK1A 3HOVC 3S1MK 3FKIK 3GTOK 2Y0SD 2R7ZK 5M5XK 2NVTK 3GTJC 2E2HC 2JA7K
chains in the Genus database with same CATH superfamily
1VH2A 3A8KA 2NVXK 3QX3A 1X31C 1O27A 4A3LC 3RZDK 2JA5K 4BY1K 5IP7K 1O2AA 1Y1WC 4YFXA 4BLBA 3TTGA 4JK1A 1WSVA 3CAGA 1TWGK 4P5BA 4X6AC 1YCLA 4C3IC 5M3MK 3S16K 4A3JC 3GTPK 4G7OA 1J6XA 3HOUC 4XLNA 2NVTC 1O2FB 3GEHA 1IBAA 4YG2A 1J6VA 5IYCC 1F7UA 1WOOA 1ZXOA 3I4NC 4ZH4A 4J3NA 5IOQA 4A3MK 1F9NA 4AH6A 2GSUA 4G7HA 4KMUA 4KMDA 3FKIC 3GTMA 1I6VA 5M5YK 3EQLA 3N0CA 3HOXK 3FOFA 5JVOA 2E2JC 3S1NC 3PO3K 1TWHA 2Y0SL 1VGXA 1B4BA 3GIRA 5IORA 3S1RK 3RZOK 1TWCC 1HI9A 5IP7C 5M3FK 3GTQC 1AB4A 4A3BC 4KN4A 2A69A 3K7AC 2B63A 3HXAA 4G7ZA 2WB1L 2FQOA 3I4MC 5E68A 1G51A 3SZYA 2GSOA 3S17K 5IYBC 2E2HA 3M3YK 5D4DA 2KWAA 1O28A 3NUHA 2R7ZC 1BS2A 1JOEA 3AH5A 1HQMA 5IOSA 5FLMK 4XLPA 4QJVA 1TWHC 3GTGC 4YFKA 4C2MK 2GSNA 3S15C 1Y1WK 3S2DC 4Q4ZA 4A3FC 1WCMK 1I3QC 2PHCB 4C3HK 4KAWX 2R93A 1IQ0A 4C45A 2Y0SD 2NVTK 3G4CA 4A3CK 1ISEA 5HL8A 3GDZA 3PO3C 1I50C 1ZQ1C 1YNJA 1TWFC 3GSIA 3GTQA 3A8JA 3AQOA 3Q3QA 4XCHA 3GTLK 4C3IK 4KDDA 1JVIA 3GTGA 3M3YC 1J6WA 2YU9K 3S2HK 3RZDC 4XSXA 1IL2A 1BJTA 3HOZK 4GTFA 2O5JA 5IYCK 1SMYA 3K7AK 2ZUEA 4OIOA 3S0XA 1Y1VK 4G0UA 2R93C 1WCMA 2WB1D 3S14K 1VRQC 3TFIA 3S14C 4LR2A 4BBSC 4WILA 1C0AA 4A3KK 3GTOC 3H0GK 4GTEA 2E2JK 1WSRA 4O2DA 4A3DK 3GTMK 4BY7C 1F93A 3G4AA 4A3IK 2R92K 1DCPA 4GFQA 1TWFA 4OINA 3HOYC 3ERED 4BXXC 4A3KC 1VJEA 1DCOA 2PPBA 4LLGA 1JQWA 5C44K 2JA5C 4BY1C 3S17C 1XPPA 3N3YA 3OEPA 4KMAA 3S1NK 1RU0A 3HOXC 4C3HC 1WCMC 2PA8L 2R92C 3DXJA 2B63C 4MEXA 1L0WA 1IW7A 2JA8K 2JA7C 3GTPC 5IP9C 5C4XC 5L46A 4BBRC 1XXBA 1YNNA 3SZZA 5FJ8K 3GEIA 1BDFA 1VLOA 4GTLA 4PABA 3LPXA 4P5AA 2XCRB 1R9TK 4C2MC 2A68A 1USOA 3FKIA 1Y1VC 3AD9C 2VUMA 4A3MC 3T00A 5IOTA 2CW0A 4A3FK 3VA7A 2R92A 4PAAA 1IE0A 3HOVC 3S1MK 4LK1A 1Y1WA 3GTOK 2R7ZK 4GT9A 2ZFZA 2GAGC 3BUEA 2GAHC 1I50K 1PJ6A 5TMFA 4A3LK 2Y3PA 4BBRK 4ILDA 3L4JA 3GTJA 5IYDC 2A6EA 5JFEA 3HOWC 2V6SA 2R93K 4LK0A 2P8TA 1Y1VA 4Y7NC 3T02A 1TWCA 1I3QK 4A93C 5M5WK 1ZYRA 2JH3A 2YU9A 3GTLC 2NVQC 5IP9K 4YFNA 2V6UA 3GTMC 1INNA 5C3EK 4LQYA 4GTBA 1V5VA 4A3BK 1XZQB 1I6HC 1TWGC 2CFAB 2WAQD 3T01A 5C4XK 2PMZD 1TWAA 1WQGA 1O24A 4BBSK 5EGEA 4QIWD 4BXXK 2W7VA 4OIPA 3A8IA 1WIHA 1PJ5A 2PA8D 2E2IA 3GEEA 5CJ9A 4BKWA 5TMCA 1TWCK 4KMHA 2JA6A 3AQPA 3I4NK 2V6TA 3OREA 3CQZC 3S1QC 2O5IA 3LAPA 3FHZA 3GTGK 4XSZA 4GZYA 3GTKK 4Y7NK 3V4GA 2NVXC 1F7VA 3I4MK 4KM8A 4FM9A 3AD8C 4KC6A 4LOWA 4C3JK 3HOUK 3H3VL 1WQHA 4MEYA 5IYBK 2P5MA 1TWGA 3HOZC 4KB2A 3RZOC 4A3GC 4X6AK 3S1RC 3JSTA 4A3CC 2NVYK 1EI6A 2NVQK 3H3VD 4LJZA 4KB4A 3HOYK 2PMZL 1TWFK 4Y52C 1R9TC 4QIWL 4M1XA 3BP3A 2JA7A 3S2DK 2A6HA 1TWAK 3AD7C 4OIQA 1SFOK 3BP8C 5M5XK 3IPJA 2JA7K 2JA8C 2E2HK 4GTAA 1DD5A 4KATA 1UV7A 5C3EC 2WAQL 4A3IC 4Y52K 4DDQA 2NVYA 2JA6K 1WORA 4KARA 1YX2A 3PO2C 4AYBD 3H0GC 2CFAA 2FQTA 2NVYC 3S16C 1O25A 5FLMC 1XXAA 3GTJK 2XCQA 5C4JC 2RH6A 2BE5A 4A3DC 5IYDK 1O29A 1BGWA 1DCHA 4AYBL 3FOEA 4RMFA 3GTQK 4A3EC 3M4OK 2XCOA 3CQZK 4GTDA 3WODA 1J98A 1K83A 3GTKC 1EQRA 3OPFA 1EFWA 3HOVK 1O26A 3S1MC 1XZQA 4NOIA 2JA5A 4A3JK 2NVXA 5C4JK 3N0BA 2YU9C 2B63K 3H0GA 1IS1A 3CQZA 3GTPA 3M4OC 2JA6C 4WJ3M 4OIRA 1SFOA 3L4KA 3TFHA 4A3EK 2R7ZA 1TWHK 4MQ9A 1O2BA 1XXCA 2E2IC 1B4AA 1I50A 1WOPA 4KN7A 1USMA 2ZUFA 1WOSA 3GTOA 1EH1A 1ZVUA 1XZPA 3ADAC 1TWAC 1EK8A 3S2HC 1K83K 5EGHA 4BY7K 1I3QA 3TFJA 1SFOC 1KQ4A 5CHPA 1I6HK 2VUMC 3HKZD 2EBBA 1R9TA 1ZBSA 4P9SA 3S1QK 2E2IK 4WJ4A 4G0VA 3LAJA 1PJ7A 4C3JC 5TJ3A 4GTCA 3MMLB 4KM9A 4BLAA 5C44C 3HOWK 3GTLA 1WQFA 4G0WA 3S15K 4Q5SA 3HKZL 1GE9A 1K83C 4KASA 4QJVB 3GTKA 3PO2K 4A3GK 2RGRA 4FZBA 1XZPB 4A93K 3FKIK 2D6FC 2VUMK 3GTJC 2E2HC
chains in the Genus database with same CATH topology
4A3CK 2E2HK 2NVXK 1I50K 3PO3C 5TMFA 4A3LK 4BBRK 1I50C 4A3LC 5IYDC 2WAQL 5C3EC 3RZDK 2JA5K 4BY1K 5IP7K 4A3IC 4Y52K 2A6EA 1Y1WC 4YFXA 2JA6K 3HOWC 1YNJA 4JK1A 1TWFC 2R93K 1TWGK 4LK0A 4X6AC 4Y7NC 4A93C 1I3QK 5M3MK 4AYBD 3PO2C 3H0GC 5M5WK 3GTLK 1ZYRA 4C3IK 4A3JC 3S16K 2NVYC 3GTLC 3GTPK 2NVQC 3S16C 4G7OA 5IP9K 5FLMC 3HOUC 4XLNA 2NVTC 3GTJK 4YFNA 5C4JC 4YG2A 3M3YC 2BE5A 2YU9K 3S2HK 3GTMC 4A3DC 5C3EK 4XSXA 3RZDC 5IYCC 3HOZK 5IYDK 4AYBL 3GTQK 2O5JA 4A3BK 5IYCK 1SMYA 4A3EC 3K7AK 3M4OK 4OIOA 3I4NC 1Y1VK 4ZH4A 1I6HC 2R93C 3CQZK 1TWGC 2WAQD 4A3MK 2WB1D 5C4XK 3S14K 2PMZD 3WODA 3S14C 4BBSK 3GTKC 4G7HA 4BBSC 4QIWD 3HOVK 4KMUA 3S1MC 4BXXK 4A3KK 3FKIC 4NOIA 3GTOC 4OIPA 1I6VA 5M5YK 3EQLA 3H0GK 2E2JK 4A3JK 3HOXK 2PA8D 2E2JC 3S1NC 5C4JK 3PO3K 2YU9C 4A3DK 3GTMK 2Y0SL 5TMCA 2B63K 4BY7C 1TWCK 3S1RK 3RZOK 1TWCC 5IP7C 4A3IK 2R92K 5M3FK 3I4NK 3M4OC 2JA6C 4OIRA 3GTQC 3CQZC 4OINA 4A3BC 3S1QC 4KN4A 2O5IA 4A3EK 1TWHK 2A69A 3K7AC 4MQ9A 4XSZA 3GTGK 4GZYA 3HOYC 3GTKK 2E2IC 4Y7NK 4G7ZA 2NVXC 4BXXC 3I4MK 4A3KC 2WB1L 3I4MC 4KN7A 4C3JK 2PPBA 4LLGA 2JA5C 5C44K 4BY1C 3HOUK 3H3VL 3S17C 1XPPA 3S1NK 3S17K 5IYBC 3HOXC 1TWAC 2JA8C 4MEYA 5IYBK 3M3YK 1K83K 5D4DA 3S2HC 1WCMC 3HOZC 2PA8L 3RZOC 4A3GC 4X6AK 2R92C 3DXJA 2B63C 2R7ZC 4MEXA 4BY7K 3S1RC 1IW7A 2JA8K 2JA7C 1SFOC 1HQMA 4A3CC 2NVYK 3GTPC 1I6HK 2NVQK 2VUMC 4LJZA 3H3VD 3HKZD 5IP9C 5FLMK 5C4XC 3HOYK 3S1QK 2E2IK 4BBRC 4XLPA 4QJVA 1TWHC 1YNNA 5FJ8K 3GTGC 1BDFA 4YFKA 4C2MK 2PMZL 5C44C 3HOWK 1R9TK 3S15C 2A68A 1TWFK 4Y52C 1R9TC 4QIWL 1Y1WK 3S15K 4Q5SA 1Y1VC 3HKZL 3S2DC 4A3MC 1K83C 4QJVB 4Q4ZA 1WCMK 1I3QC 4A3FC 2VUMK 3PO2K 3S2DK 4A3GK 2A6HA 2CW0A 1TWAK 4C3HK 4A3FK 4A93K 4OIQA 1SFOK 4LK1A 3HOVC 3S1MK 3FKIK 3GTOK 2Y0SD 2R7ZK 5M5XK 2NVTK 3GTJC 2E2HC 2JA7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C K;  2E2H K;  2NVX K;  1I50 K;  3PO3 C;  5TMF A;  4A3L K;  4BBR K;  1I50 C;  4A3L C;  5IYD C;  2WAQ L;  5C3E C;  3RZD K;  2JA5 K;  4BY1 K;  5IP7 K;  4A3I C;  4Y52 K;  2A6E A;  1Y1W C;  4YFX A;  2JA6 K;  3HOW C;  1YNJ A;  4JK1 A;  1TWF C;  2R93 K;  1TWG K;  4LK0 A;  4X6A C;  4Y7N C;  4A93 C;  1I3Q K;  5M3M K;  4AYB D;  3PO2 C;  3H0G C;  5M5W K;  3GTL K;  1ZYR A;  4C3I K;  4A3J C;  3S16 K;  2NVY C;  3GTL C;  3GTP K;  2NVQ C;  3S16 C;  4G7O A;  5IP9 K;  5FLM C;  3HOU C;  4XLN A;  2NVT C;  3GTJ K;  4YFN A;  5C4J C;  4YG2 A;  3M3Y C;  2BE5 A;  2YU9 K;  3S2H K;  3GTM C;  4A3D C;  5C3E K;  4XSX A;  3RZD C;  5IYC C;  3HOZ K;  5IYD K;  4AYB L;  3GTQ K;  2O5J A;  4A3B K;  5IYC K;  1SMY A;  4A3E C;  3K7A K;  3M4O K;  4OIO A;  3I4N C;  1Y1V K;  4ZH4 A;  1I6H C;  2R93 C;  3CQZ K;  1TWG C;  2WAQ D;  4A3M K;  2WB1 D;  5C4X K;  3S14 K;  2PMZ D;  3WOD A;  3S14 C;  4BBS K;  3GTK C;  4G7H A;  4BBS C;  4QIW D;  3HOV K;  4KMU A;  3S1M C;  4BXX K;  4A3K K;  3FKI C;  4NOI A;  3GTO C;  4OIP A;  1I6V A;  5M5Y K;  3EQL A;  3H0G K;  2E2J K;  4A3J K;  3HOX K;  2PA8 D;  2E2J C;  3S1N C;  5C4J K;  3PO3 K;  2YU9 C;  4A3D K;  3GTM K;  2Y0S L;  5TMC A;  2B63 K;  4BY7 C;  1TWC K;  3S1R K;  3RZO K;  1TWC C;  5IP7 C;  4A3I K;  2R92 K;  5M3F K;  3I4N K;  3M4O C;  2JA6 C;  4OIR A;  3GTQ C;  3CQZ C;  4OIN A;  4A3B C;  3S1Q C;  4KN4 A;  2O5I A;  4A3E K;  1TWH K;  2A69 A;  3K7A C;  4MQ9 A;  4XSZ A;  3GTG K;  4GZY A;  3HOY C;  3GTK K;  2E2I C;  4Y7N K;  4G7Z A;  2NVX C;  4BXX C;  3I4M K;  4A3K C;  2WB1 L;  3I4M C;  4KN7 A;  4C3J K;  2PPB A;  4LLG A;  2JA5 C;  5C44 K;  4BY1 C;  3HOU K;  3H3V L;  3S17 C;  1XPP A;  3S1N K;  3S17 K;  5IYB C;  3HOX C;  1TWA C;  2JA8 C;  4MEY A;  5IYB K;  3M3Y K;  1K83 K;  5D4D A;  3S2H C;  1WCM C;  3HOZ C;  2PA8 L;  3RZO C;  4A3G C;  4X6A K;  2R92 C;  3DXJ A;  2B63 C;  2R7Z C;  4MEX A;  4BY7 K;  3S1R C;  1IW7 A;  2JA8 K;  2JA7 C;  1SFO C;  1HQM A;  4A3C C;  2NVY K;  3GTP C;  1I6H K;  2NVQ K;  2VUM C;  4LJZ A;  3H3V D;  3HKZ D;  5IP9 C;  5FLM K;  5C4X C;  3HOY K;  3S1Q K;  2E2I K;  4BBR C;  4XLP A;  4QJV A;  1TWH C;  1YNN A;  5FJ8 K;  3GTG C;  1BDF A;  4YFK A;  4C2M K;  2PMZ L;  5C44 C;  3HOW K;  1R9T K;  3S15 C;  2A68 A;  1TWF K;  4Y52 C;  1R9T C;  4QIW L;  1Y1W K;  3S15 K;  4Q5S A;  1Y1V C;  3HKZ L;  3S2D C;  4A3M C;  1K83 C;  4QJV B;  4Q4Z A;  1WCM K;  1I3Q C;  4A3F C;  2VUM K;  3PO2 K;  3S2D K;  4A3G K;  2A6H A;  2CW0 A;  1TWA K;  4C3H K;  4A3F K;  4A93 K;  4OIQ A;  1SFO K;  4LK1 A;  3HOV C;  3S1M K;  3FKI K;  3GTO K;  2Y0S D;  2R7Z K;  5M5X K;  2NVT K;  3GTJ C;  2E2H C;  2JA7 K; 
#chains in the Genus database with same CATH topology
 1VH2 A;  3A8K A;  2NVX K;  3QX3 A;  1X31 C;  1O27 A;  4A3L C;  3RZD K;  2JA5 K;  4BY1 K;  5IP7 K;  1O2A A;  1Y1W C;  4YFX A;  4BLB A;  3TTG A;  4JK1 A;  1WSV A;  3CAG A;  1TWG K;  4P5B A;  4X6A C;  1YCL A;  4C3I C;  5M3M K;  3S16 K;  4A3J C;  3GTP K;  4G7O A;  1J6X A;  3HOU C;  4XLN A;  2NVT C;  1O2F B;  3GEH A;  1IBA A;  4YG2 A;  1J6V A;  5IYC C;  1F7U A;  1WOO A;  1ZXO A;  3I4N C;  4ZH4 A;  4J3N A;  5IOQ A;  4A3M K;  1F9N A;  4AH6 A;  2GSU A;  4G7H A;  4KMU A;  4KMD A;  3FKI C;  3GTM A;  1I6V A;  5M5Y K;  3EQL A;  3N0C A;  3HOX K;  3FOF A;  5JVO A;  2E2J C;  3S1N C;  3PO3 K;  1TWH A;  2Y0S L;  1VGX A;  1B4B A;  3GIR A;  5IOR A;  3S1R K;  3RZO K;  1TWC C;  1HI9 A;  5IP7 C;  5M3F K;  3GTQ C;  1AB4 A;  4A3B C;  4KN4 A;  2A69 A;  3K7A C;  2B63 A;  3HXA A;  4G7Z A;  2WB1 L;  2FQO A;  3I4M C;  5E68 A;  1G51 A;  3SZY A;  2GSO A;  3S17 K;  5IYB C;  2E2H A;  3M3Y K;  5D4D A;  2KWA A;  1O28 A;  3NUH A;  2R7Z C;  1BS2 A;  1JOE A;  3AH5 A;  1HQM A;  5IOS A;  5FLM K;  4XLP A;  4QJV A;  1TWH C;  3GTG C;  4YFK A;  4C2M K;  2GSN A;  3S15 C;  1Y1W K;  3S2D C;  4Q4Z A;  4A3F C;  1WCM K;  1I3Q C;  2PHC B;  4C3H K;  4KAW X;  2R93 A;  1IQ0 A;  4C45 A;  2Y0S D;  2NVT K;  3G4C A;  4A3C K;  1ISE A;  5HL8 A;  3GDZ A;  3PO3 C;  1I50 C;  1ZQ1 C;  1YNJ A;  1TWF C;  3GSI A;  3GTQ A;  3A8J A;  3AQO A;  3Q3Q A;  4XCH A;  3GTL K;  4C3I K;  4KDD A;  1JVI A;  3GTG A;  3M3Y C;  1J6W A;  2YU9 K;  3S2H K;  3RZD C;  4XSX A;  1IL2 A;  1BJT A;  3HOZ K;  4GTF A;  2O5J A;  5IYC K;  1SMY A;  3K7A K;  2ZUE A;  4OIO A;  3S0X A;  1Y1V K;  4G0U A;  2R93 C;  1WCM A;  2WB1 D;  3S14 K;  1VRQ C;  3TFI A;  3S14 C;  4LR2 A;  4BBS C;  4WIL A;  1C0A A;  4A3K K;  3GTO C;  3H0G K;  4GTE A;  2E2J K;  1WSR A;  4O2D A;  4A3D K;  3GTM K;  4BY7 C;  1F93 A;  3G4A A;  4A3I K;  2R92 K;  1DCP A;  4GFQ A;  1TWF A;  4OIN A;  3HOY C;  3ERE D;  4BXX C;  4A3K C;  1VJE A;  1DCO A;  2PPB A;  4LLG A;  1JQW A;  5C44 K;  2JA5 C;  4BY1 C;  3S17 C;  1XPP A;  3N3Y A;  3OEP A;  4KMA A;  3S1N K;  1RU0 A;  3HOX C;  4C3H C;  1WCM C;  2PA8 L;  2R92 C;  3DXJ A;  2B63 C;  4MEX A;  1L0W A;  1IW7 A;  2JA8 K;  2JA7 C;  3GTP C;  5IP9 C;  5C4X C;  5L46 A;  4BBR C;  1XXB A;  1YNN A;  3SZZ A;  5FJ8 K;  3GEI A;  1BDF A;  1VLO A;  4GTL A;  4PAB A;  3LPX A;  4P5A A;  2XCR B;  1R9T K;  4C2M C;  2A68 A;  1USO A;  3FKI A;  1Y1V C;  3AD9 C;  2VUM A;  4A3M C;  3T00 A;  5IOT A;  2CW0 A;  4A3F K;  3VA7 A;  2R92 A;  4PAA A;  1IE0 A;  3HOV C;  3S1M K;  4LK1 A;  1Y1W A;  3GTO K;  2R7Z K;  4GT9 A;  2ZFZ A;  2GAG C;  3BUE A;  2GAH C;  1I50 K;  1PJ6 A;  5TMF A;  4A3L K;  2Y3P A;  4BBR K;  4ILD A;  3L4J A;  3GTJ A;  5IYD C;  2A6E A;  5JFE A;  3HOW C;  2V6S A;  2R93 K;  4LK0 A;  2P8T A;  1Y1V A;  4Y7N C;  3T02 A;  1TWC A;  1I3Q K;  4A93 C;  5M5W K;  1ZYR A;  2JH3 A;  2YU9 A;  3GTL C;  2NVQ C;  5IP9 K;  4YFN A;  2V6U A;  3GTM C;  1INN A;  5C3E K;  4LQY A;  4GTB A;  1V5V A;  4A3B K;  1XZQ B;  1I6H C;  1TWG C;  2CFA B;  2WAQ D;  3T01 A;  5C4X K;  2PMZ D;  1TWA A;  1WQG A;  1O24 A;  4BBS K;  5EGE A;  4QIW D;  4BXX K;  2W7V A;  4OIP A;  3A8I A;  1WIH A;  1PJ5 A;  2PA8 D;  2E2I A;  3GEE A;  5CJ9 A;  4BKW A;  5TMC A;  1TWC K;  4KMH A;  2JA6 A;  3AQP A;  3I4N K;  2V6T A;  3ORE A;  3CQZ C;  3S1Q C;  2O5I A;  3LAP A;  3FHZ A;  3GTG K;  4XSZ A;  4GZY A;  3GTK K;  4Y7N K;  3V4G A;  2NVX C;  1F7V A;  3I4M K;  4KM8 A;  4FM9 A;  3AD8 C;  4KC6 A;  4LOW A;  4C3J K;  3HOU K;  3H3V L;  1WQH A;  4MEY A;  5IYB K;  2P5M A;  1TWG A;  3HOZ C;  4KB2 A;  3RZO C;  4A3G C;  4X6A K;  3S1R C;  3JST A;  4A3C C;  2NVY K;  1EI6 A;  2NVQ K;  3H3V D;  4LJZ A;  4KB4 A;  3HOY K;  2PMZ L;  1TWF K;  4Y52 C;  1R9T C;  4QIW L;  4M1X A;  3BP3 A;  2JA7 A;  3S2D K;  2A6H A;  1TWA K;  3AD7 C;  4OIQ A;  1SFO K;  3BP8 C;  5M5X K;  3IPJ A;  2JA7 K;  2JA8 C;  2E2H K;  4GTA A;  1DD5 A;  4KAT A;  1UV7 A;  5C3E C;  2WAQ L;  4A3I C;  4Y52 K;  4DDQ A;  2NVY A;  2JA6 K;  1WOR A;  4KAR A;  1YX2 A;  3PO2 C;  4AYB D;  3H0G C;  2CFA A;  2FQT A;  2NVY C;  3S16 C;  1O25 A;  5FLM C;  1XXA A;  3GTJ K;  2XCQ A;  5C4J C;  2RH6 A;  2BE5 A;  4A3D C;  5IYD K;  1O29 A;  1BGW A;  1DCH A;  4AYB L;  3FOE A;  4RMF A;  3GTQ K;  4A3E C;  3M4O K;  2XCO A;  3CQZ K;  4GTD A;  3WOD A;  1J98 A;  1K83 A;  3GTK C;  1EQR A;  3OPF A;  1EFW A;  3HOV K;  1O26 A;  3S1M C;  1XZQ A;  4NOI A;  2JA5 A;  4A3J K;  2NVX A;  5C4J K;  3N0B A;  2YU9 C;  2B63 K;  3H0G A;  1IS1 A;  3CQZ A;  3GTP A;  3M4O C;  2JA6 C;  4WJ3 M;  4OIR A;  1SFO A;  3L4K A;  3TFH A;  4A3E K;  2R7Z A;  1TWH K;  4MQ9 A;  1O2B A;  1XXC A;  2E2I C;  1B4A A;  1I50 A;  1WOP A;  4KN7 A;  1USM A;  2ZUF A;  1WOS A;  3GTO A;  1EH1 A;  1ZVU A;  1XZP A;  3ADA C;  1TWA C;  1EK8 A;  3S2H C;  1K83 K;  5EGH A;  4BY7 K;  1I3Q A;  3TFJ A;  1SFO C;  1KQ4 A;  5CHP A;  1I6H K;  2VUM C;  3HKZ D;  2EBB A;  1R9T A;  1ZBS A;  4P9S A;  3S1Q K;  2E2I K;  4WJ4 A;  4G0V A;  3LAJ A;  1PJ7 A;  4C3J C;  5TJ3 A;  4GTC A;  3MML B;  4KM9 A;  4BLA A;  5C44 C;  3HOW K;  3GTL A;  1WQF A;  4G0W A;  3S15 K;  4Q5S A;  3HKZ L;  1GE9 A;  1K83 C;  4KAS A;  4QJV B;  3GTK A;  3PO2 K;  4A3G K;  2RGR A;  4FZB A;  1XZP B;  4A93 K;  3FKI K;  2D6F C;  2VUM K;  3GTJ C;  2E2H C; 
#chains in the Genus database with same CATH homology
 4A3C K;  2E2H K;  2NVX K;  1I50 K;  3PO3 C;  5TMF A;  4A3L K;  4BBR K;  1I50 C;  4A3L C;  5IYD C;  2WAQ L;  5C3E C;  3RZD K;  2JA5 K;  4BY1 K;  5IP7 K;  4A3I C;  4Y52 K;  2A6E A;  1Y1W C;  4YFX A;  2JA6 K;  3HOW C;  1YNJ A;  4JK1 A;  1TWF C;  2R93 K;  1TWG K;  4LK0 A;  4X6A C;  4Y7N C;  4A93 C;  1I3Q K;  5M3M K;  4AYB D;  3PO2 C;  3H0G C;  5M5W K;  3GTL K;  1ZYR A;  4C3I K;  4A3J C;  3S16 K;  2NVY C;  3GTL C;  3GTP K;  2NVQ C;  3S16 C;  4G7O A;  5IP9 K;  5FLM C;  3HOU C;  4XLN A;  2NVT C;  3GTJ K;  4YFN A;  5C4J C;  4YG2 A;  3M3Y C;  2BE5 A;  2YU9 K;  3S2H K;  3GTM C;  4A3D C;  5C3E K;  4XSX A;  3RZD C;  5IYC C;  3HOZ K;  5IYD K;  4AYB L;  3GTQ K;  2O5J A;  4A3B K;  5IYC K;  1SMY A;  4A3E C;  3K7A K;  3M4O K;  4OIO A;  3I4N C;  1Y1V K;  4ZH4 A;  1I6H C;  2R93 C;  3CQZ K;  1TWG C;  2WAQ D;  4A3M K;  2WB1 D;  5C4X K;  3S14 K;  2PMZ D;  3WOD A;  3S14 C;  4BBS K;  3GTK C;  4G7H A;  4BBS C;  4QIW D;  3HOV K;  4KMU A;  3S1M C;  4BXX K;  4A3K K;  3FKI C;  4NOI A;  3GTO C;  4OIP A;  1I6V A;  5M5Y K;  3EQL A;  3H0G K;  2E2J K;  4A3J K;  3HOX K;  2PA8 D;  2E2J C;  3S1N C;  5C4J K;  3PO3 K;  2YU9 C;  4A3D K;  3GTM K;  2Y0S L;  5TMC A;  2B63 K;  4BY7 C;  1TWC K;  3S1R K;  3RZO K;  1TWC C;  5IP7 C;  4A3I K;  2R92 K;  5M3F K;  3I4N K;  3M4O C;  2JA6 C;  4OIR A;  3GTQ C;  3CQZ C;  4OIN A;  4A3B C;  3S1Q C;  4KN4 A;  2O5I A;  4A3E K;  1TWH K;  2A69 A;  3K7A C;  4MQ9 A;  4XSZ A;  3GTG K;  4GZY A;  3HOY C;  3GTK K;  2E2I C;  4Y7N K;  4G7Z A;  2NVX C;  4BXX C;  3I4M K;  4A3K C;  2WB1 L;  3I4M C;  4KN7 A;  4C3J K;  2PPB A;  4LLG A;  2JA5 C;  5C44 K;  4BY1 C;  3HOU K;  3H3V L;  3S17 C;  1XPP A;  3S1N K;  3S17 K;  5IYB C;  3HOX C;  1TWA C;  2JA8 C;  4MEY A;  5IYB K;  3M3Y K;  1K83 K;  5D4D A;  3S2H C;  1WCM C;  3HOZ C;  2PA8 L;  3RZO C;  4A3G C;  4X6A K;  2R92 C;  3DXJ A;  2B63 C;  2R7Z C;  4MEX A;  4BY7 K;  3S1R C;  1IW7 A;  2JA8 K;  2JA7 C;  1SFO C;  1HQM A;  4A3C C;  2NVY K;  3GTP C;  1I6H K;  2NVQ K;  2VUM C;  4LJZ A;  3H3V D;  3HKZ D;  5IP9 C;  5FLM K;  5C4X C;  3HOY K;  3S1Q K;  2E2I K;  4BBR C;  4XLP A;  4QJV A;  1TWH C;  1YNN A;  5FJ8 K;  3GTG C;  1BDF A;  4YFK A;  4C2M K;  2PMZ L;  5C44 C;  3HOW K;  1R9T K;  3S15 C;  2A68 A;  1TWF K;  4Y52 C;  1R9T C;  4QIW L;  1Y1W K;  3S15 K;  4Q5S A;  1Y1V C;  3HKZ L;  3S2D C;  4A3M C;  1K83 C;  4QJV B;  4Q4Z A;  1WCM K;  1I3Q C;  4A3F C;  2VUM K;  3PO2 K;  3S2D K;  4A3G K;  2A6H A;  2CW0 A;  1TWA K;  4C3H K;  4A3F K;  4A93 K;  4OIQ A;  1SFO K;  4LK1 A;  3HOV C;  3S1M K;  3FKI K;  3GTO K;  2Y0S D;  2R7Z K;  5M5X K;  2NVT K;  3GTJ C;  2E2H C;  2JA7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...