1TWGK

Rna polymerase ii complexed with ctp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twgK00
1YNJA 4MQ9A 5FLMK 3GTOC 4AYBL 1R9TC 4OINA 4QIWL 5C4XK 3GTGK 3S2HC 2BE5A 2CW0A 1TWHC 3S14K 3HOUC 3S1MK 1K83C 4A3CK 4BBSK 2JA8C 3HOVC 4YFKA 3RZDC 2B63C 2NVTK 2NVQK 5TMFA 2PMZL 2VUMC 4G7OA 2JA7K 1I6HC 5M3MK 4XLPA 1TWAC 4Y7NC 2NVXC 3HOWC 3I4NK 3S17K 1Y1VC 5IP7K 3S15C 5C3EC 2PA8L 4A3IC 2NVYC 5C44C 1TWCK 2E2JC 1BDFA 2R92C 3GTKC 1TWGK 4A3MK 4KN7A 2O5IA 3GTMK 1XPPA 4KN4A 3GTLC 4AYBD 3S16K 5C4JC 4A3JC 4A3KC 2E2IC 1TWCC 4OIPA 3GTJC 3FKIC 5IYDK 4BY1K 5IYBK 4A3EK 3M4OK 4Y52K 1HQMA 2JA6K 3I4MK 4QJVA 3CQZC 1I6VA 1WCMK 5D4DA 3HOZK 3GTQK 2YU9C 5IP9K 1TWFC 5IYCK 4KMUA 4LLGA 3S1NK 1I50C 3HOXK 2PMZD 3S1QC 5TMCA 4MEYA 3GTPC 2R7ZK 4A3CC 4A3FK 1SFOK 3M3YK 4A3BK 2WB1L 3HOYK 4XSZA 3S2DC 2PA8D 2E2HK 1Y1WC 4A3LK 4BXXC 1I3QK 3EQLA 4BY7K 5M5YK 1ZYRA 3I4NC 2JA5K 1SMYA 2R93C 2A6EA 4A93C 3PO3K 4C2MK 2PPBA 4OIOA 4OIQA 4A3GC 3K7AK 4GZYA 5FJ8K 1YNNA 2A6HA 3GTOK 4LK0A 4BBRK 4C3JK 3S2HK 4X6AC 4A3EC 3PO2C 4A3DC 4BY1C 3H0GC 1TWHK 5FLMC 3HOUK 1K83K 3GTGC 2JA8K 5C4XC 3HOVK 2B63K 4YFNA 3S1RK 2WB1D 3S14C 4XSXA 4NOIA 4Q5SA 1I6HK 4G7HA 4Y7NK 1TWAK 2NVXK 3HOWK 3S1MC 4BBSC 1Y1VK 2NVTC 3S15K 5C3EK 4A3IK 2NVQC 5C44K 5M5WK 2E2JK 2JA7C 4ZH4A 2R92K 3GTKK 3S17C 1IW7A 3H3VL 5IP7C 4XLNA 3GTLK 3RZOK 4MEXA 4LK1A 4A3JK 4A3KK 2E2IK 3GTJK 1TWGC 2WAQL 4A3MC 4LJZA 3GTMC 1R9TK 4BBRC 3CQZK 3S16C 2A68A 5IYDC 2YU9K 4QJVB 1TWFK 4YG2A 4YFXA 1I50K 4Y52C 4JK1A 5IYBC 4G7ZA 4Q4ZA 2JA6C 3GTPK 3I4MC 3M4OC 3S1QK 3HKZD 4C3IK 1WCMC 3RZDK 3HOZC 3GTQC 5IP9C 5IYCC 3S1NC 2VUMK 3S2DK 3S1RC 5M3FK 1Y1WK 3HOXC 3HKZL 4BXXK 2R7ZC 4A3FC 1SFOC 3M3YC 2R93K 4A93K 4A3BC 3H3VD 2A69A 2NVYK 3HOYC 2E2HC 4A3LC 4A3GK 1I3QC 4BY7C 2O5JA 3DXJA 5M5XK 4OIRA 2JA5C 4C3HK 2WAQD 2Y0SD 3PO3C 3RZOC 3WODA 5C4JK 4X6AK 3K7AC 4QIWD 3PO2K 4A3DK 3FKIK 3H0GK 2Y0SL
chains in the Genus database with same CATH superfamily
2JH3A 2ZFZA 4AYBL 1TWFA 2CW0A 4KMHA 4A3CK 1F7UA 2JA8C 3HOVC 1DCPA 4YFKA 5EGHA 3BUEA 4KARA 1DD5A 3GIRA 3TTGA 5IP7K 3S15C 1EI6A 3LAPA 3GTKC 2ZUEA 3H0GA 4BLAA 2E2IC 4OIPA 5IYBK 4Y52K 2JA6K 3I4MK 3GEEA 4BLBA 1I6VA 1WCMK 3GTQK 2YU9C 4KAWX 5IP9K 5IYCK 1WOSA 4KMUA 3S1NK 1I50C 2R7ZA 3GTPC 1SFOK 5L46A 1HI9A 1XXCA 2JA5A 2P5MA 4A93C 1V5VA 2FQTA 1F7VA 3LAJA 4RMFA 4X6AC 4A3DC 4BY1C 1J6WA 1TWHK 1WORA 4GTEA 4GTLA 3JSTA 4GTCA 1SFOA 2WB1D 4XSXA 4Q5SA 1USOA 3G4AA 3GTKA 1YX2A 2JA7C 4ZH4A 2R92K 3S17C 4XLNA 1BJTA 3ADAC 3RZOK 4LK1A 4A3JK 4A3KK 3GTJK 1TWGC 3GTMC 4PAAA 4KASA 4O2DA 3CQZK 2D6FC 1I50A 4GTBA 5IYDC 4QJVB 3GTPA 4YG2A 1ZXOA 3S1QK 3OREA 5IOSA 3S1RC 5M3FK 4BXXK 4A3FC 3M3YC 4A3BC 3H3VD 3HOYC 2R92A 2E2HC 1PJ5A 4KDDA 1I3QC 3T02A 1PJ6A 4AH6A 4OIRA 1INNA 4P9SA 1IE0A 5C4JK 4OIQA 3CQZA 1YNJA 4MQ9A 3GTOC 1R9TC 4OINA 1WSRA 3S2HC 1XXBA 1O25A 3SZZA 3S14K 3HOUC 3S1MK 4BBSK 1WQHA 2NVTK 3RZDC 2JA7A 2NVQK 5TMFA 1AB4A 2VUMC 1I6HC 2NVXC 4KATA 2PA8L 4A3IC 2NVYC 1TWGA 1RU0A 2PHCB 3TFIA 4A3MK 2O5IA 3GTLC 4AYBD 2RH6A 1UV7A 1TWCC 3FKIC 4G0UA 1HQMA 3HOZK 1EQRA 1O28A 2EBBA 1VJEA 4LLGA 3HOXK 4A3CC 4MEYA 2R7ZK 2E2HA 4XSZA 2XCRB 1XZPA 4BY7K 5M5YK 2JA5K 1SMYA 2R93C 3T01A 4C2MK 4A3GC 3K7AK 1XZQA 4C3HC 1YNNA 1DCHA 2A6HA 3N3YA 4BBRK 4A3EC 5IOTA 1WQFA 5EGEA 1BS2A 5FLMC 3FHZA 3GTGC 2JA8K 5C4XC 3HOVK 1VLOA 3GSIA 1BGWA 3TFJA 3S15K 5M5WK 3A8JA 3GTKK 3SZYA 3GTLA 1WOPA 2E2IK 2WAQL 3S0XA 1O2AA 4LJZA 4GFQA 1F93A 3S16C 2GSUA 2A68A 2YU9K 1O29A 1EH1A 1I50K 1O27A 4JK1A 4G7ZA 3M4OC 4Q4ZA 1WOOA 3GTPK 1B4BA 1ZQ1C 2R93A 3A8KA 1JQWA 3L4JA 4A93K 2FQOA 3Q3QA 4FZBA 5CJ9A 2XCQA 4A3LC 4J3NA 3DXJA 5M5XK 2E2IA 3PO3C 3RZOC 4LOWA 3WODA 4KMDA 4X6AK 4QIWD 4A3DK 3AQOA 1PJ7A 4BY1K 3GTGA 1B4AA 2YU9A 4QIWL 1WIHA 4LR2A 4C3JC 2CFAB 1IS1A 1K83C 1L0WA 1IBAA 2B63C 1O24A 2PMZL 3IPJA 2JA7K 4G7OA 4LQYA 3HOWC 4XLPA 1TWAC 4Y7NC 3I4NK 3T00A 3S17K 1Y1VC 5E68A 5C3EC 4C45A 5C44C 1IQ0A 2E2JC 1BDFA 2V6UA 1TWGK 4KN7A 3GTMK 2RGRA 1WQGA 3NUHA 4KN4A 5C4JC 1IL2A 5IYDK 1USMA 2GAHC 3AQPA 3V4GA 4QJVA 1KQ4A 3GDZA 1TWFC 4KB4A 4M1XA 4A3FK 3M3YK 4C3IC 1O26A 4A3BK 3HOYK 4WILA 3S2DC 2PA8D 3AH5A 1Y1WC 2E2HK 1I3QK 1JOEA 4GT9A 4OIOA 2KWAA 3GTMA 3AD8C 3GTOK 3S2HK 2W7VA 1DCOA 3PO2C 3H0GC 3HOUK 2B63A 5TJ3A 4YFNA 1TWAA 1O2BA 2V6TA 5IORA 1I6HK 2NVXK 1VGXA 1O2FB 3N0CA 2P8TA 1I3QA 4A3IK 2Y3PA 5IP7C 4GTAA 3GTLK 3GTOA 1J6XA 5JVOA 1R9TA 5CHPA 1VH2A 3BP3A 5HL8A 4BBRC 2XCOA 4KC6A 5IYBC 4Y52C 2JA6C 3I4MC 3QX3A 2VUMA 1WCMC 1Y1WA 3GTQC 5IP9C 5IYCC 3S1NC 2NVXA 2NVYA 1SFOC 2R93K 1EK8A 1F9NA 4A3GK 2O5JA 4GTFA 3N0BA 3BP8C 4PABA 4C3HK 2WAQD 3L4KA 3CAGA 1TWCA 3FKIA 1ZVUA 5IOQA 4WJ4A 4A3EK 3ERED 5FLMK 3GTGK 4KB2A 3G4CA 5C4XK 2BE5A 1TWHC 3FOFA 5JFEA 4P5AA 4DDQA 5M3MK 1XXAA 2R92C 2GAGC 4BKWA 1XPPA 4P5BA 3S16K 4A3JC 4A3KC 2JA6A 3GTJC 3M4OK 1WCMA 4FM9A 3A8IA 3GTQA 4KM8A 4XCHA 3CQZC 3OEPA 5D4DA 4KMAA 4KM9A 1ISEA 2PMZD 3S1QC 5TMCA 2WB1L 4A3LK 4G0WA 4BXXC 3EQLA 1ZYRA 3I4NC 1VRQC 2A6EA 3AD9C 3PO3K 2PPBA 4GZYA 1ZBSA 5FJ8K 1WSVA 4LK0A 1TWHA 4C3JK 2GSOA 4WJ3M 1K83K 2GSNA 2CFAA 4GTDA 2B63K 1JVIA 3GEHA 3OPFA 3VA7A 3S1RK 3S14C 4NOIA 4G7HA 4Y7NK 1TWAK 3HOWK 3S1MC 4BBSC 3GEIA 1Y1VK 2NVTC 4G0VA 5C3EK 2NVQC 5C44K 2E2JK 1IW7A 3H3VL 3FOEA 3GTJA 2ZUFA 1X31C 4MEXA 1GE9A 1C0AA 4A3MC 3AD7C 4ILDA 1R9TK 1EFWA 1K83A 1TWFK 3LPXA 4YFXA 3HKZD 4C3IK 3HOZC 3RZDK 1G51A 2VUMK 1YCLA 3S2DK 1Y1WK 1J98A 1Y1VA 3HKZL 3HOXC 2R7ZC 1XZPB 1J6VA 2A69A 2NVYK 2V6SA 4BY7C 3HXAA 2JA5C 2Y0SD 1XZQB 4C2MC 3MMLB 3TFHA 3K7AC 1TWCK 3PO2K 3FKIK 3H0GK 2Y0SL
chains in the Genus database with same CATH topology
1YNJA 4MQ9A 5FLMK 3GTOC 4AYBL 1R9TC 4OINA 4QIWL 5C4XK 3GTGK 3S2HC 2BE5A 2CW0A 1TWHC 3S14K 3HOUC 3S1MK 1K83C 4A3CK 4BBSK 2JA8C 3HOVC 4YFKA 3RZDC 2B63C 2NVTK 2NVQK 5TMFA 2PMZL 2VUMC 4G7OA 2JA7K 1I6HC 5M3MK 4XLPA 1TWAC 4Y7NC 2NVXC 3HOWC 3I4NK 3S17K 1Y1VC 5IP7K 3S15C 5C3EC 2PA8L 4A3IC 2NVYC 5C44C 1TWCK 2E2JC 1BDFA 2R92C 3GTKC 1TWGK 4A3MK 4KN7A 2O5IA 3GTMK 1XPPA 4KN4A 3GTLC 4AYBD 3S16K 5C4JC 4A3JC 4A3KC 2E2IC 1TWCC 4OIPA 3GTJC 3FKIC 5IYDK 4BY1K 5IYBK 4A3EK 3M4OK 4Y52K 1HQMA 2JA6K 3I4MK 4QJVA 3CQZC 1I6VA 1WCMK 5D4DA 3HOZK 3GTQK 2YU9C 5IP9K 1TWFC 5IYCK 4KMUA 4LLGA 3S1NK 1I50C 3HOXK 2PMZD 3S1QC 5TMCA 4MEYA 3GTPC 2R7ZK 4A3CC 4A3FK 1SFOK 3M3YK 4A3BK 2WB1L 3HOYK 4XSZA 3S2DC 2PA8D 2E2HK 1Y1WC 4A3LK 4BXXC 1I3QK 3EQLA 4BY7K 5M5YK 1ZYRA 3I4NC 2JA5K 1SMYA 2R93C 2A6EA 4A93C 3PO3K 4C2MK 2PPBA 4OIOA 4OIQA 4A3GC 3K7AK 4GZYA 5FJ8K 1YNNA 2A6HA 3GTOK 4LK0A 4BBRK 4C3JK 3S2HK 4X6AC 4A3EC 3PO2C 4A3DC 4BY1C 3H0GC 1TWHK 5FLMC 3HOUK 1K83K 3GTGC 2JA8K 5C4XC 3HOVK 2B63K 4YFNA 3S1RK 2WB1D 3S14C 4XSXA 4NOIA 4Q5SA 1I6HK 4G7HA 4Y7NK 1TWAK 2NVXK 3HOWK 3S1MC 4BBSC 1Y1VK 2NVTC 3S15K 5C3EK 4A3IK 2NVQC 5C44K 5M5WK 2E2JK 2JA7C 4ZH4A 2R92K 3GTKK 3S17C 1IW7A 3H3VL 5IP7C 4XLNA 3GTLK 3RZOK 4MEXA 4LK1A 4A3JK 4A3KK 2E2IK 3GTJK 1TWGC 2WAQL 4A3MC 4LJZA 3GTMC 1R9TK 4BBRC 3CQZK 3S16C 2A68A 5IYDC 2YU9K 4QJVB 1TWFK 4YG2A 4YFXA 1I50K 4Y52C 4JK1A 5IYBC 4G7ZA 4Q4ZA 2JA6C 3GTPK 3I4MC 3M4OC 3S1QK 3HKZD 4C3IK 1WCMC 3RZDK 3HOZC 3GTQC 5IP9C 5IYCC 3S1NC 2VUMK 3S2DK 3S1RC 5M3FK 1Y1WK 3HOXC 3HKZL 4BXXK 2R7ZC 4A3FC 1SFOC 3M3YC 2R93K 4A93K 4A3BC 3H3VD 2A69A 2NVYK 3HOYC 2E2HC 4A3LC 4A3GK 1I3QC 4BY7C 2O5JA 3DXJA 5M5XK 4OIRA 2JA5C 4C3HK 2WAQD 2Y0SD 3PO3C 3RZOC 3WODA 5C4JK 4X6AK 3K7AC 4QIWD 3PO2K 4A3DK 3FKIK 3H0GK 2Y0SL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNJ A;  4MQ9 A;  5FLM K;  3GTO C;  4AYB L;  1R9T C;  4OIN A;  4QIW L;  5C4X K;  3GTG K;  3S2H C;  2BE5 A;  2CW0 A;  1TWH C;  3S14 K;  3HOU C;  3S1M K;  1K83 C;  4A3C K;  4BBS K;  2JA8 C;  3HOV C;  4YFK A;  3RZD C;  2B63 C;  2NVT K;  2NVQ K;  5TMF A;  2PMZ L;  2VUM C;  4G7O A;  2JA7 K;  1I6H C;  5M3M K;  4XLP A;  1TWA C;  4Y7N C;  2NVX C;  3HOW C;  3I4N K;  3S17 K;  1Y1V C;  5IP7 K;  3S15 C;  5C3E C;  2PA8 L;  4A3I C;  2NVY C;  5C44 C;  1TWC K;  2E2J C;  1BDF A;  2R92 C;  3GTK C;  1TWG K;  4A3M K;  4KN7 A;  2O5I A;  3GTM K;  1XPP A;  4KN4 A;  3GTL C;  4AYB D;  3S16 K;  5C4J C;  4A3J C;  4A3K C;  2E2I C;  1TWC C;  4OIP A;  3GTJ C;  3FKI C;  5IYD K;  4BY1 K;  5IYB K;  4A3E K;  3M4O K;  4Y52 K;  1HQM A;  2JA6 K;  3I4M K;  4QJV A;  3CQZ C;  1I6V A;  1WCM K;  5D4D A;  3HOZ K;  3GTQ K;  2YU9 C;  5IP9 K;  1TWF C;  5IYC K;  4KMU A;  4LLG A;  3S1N K;  1I50 C;  3HOX K;  2PMZ D;  3S1Q C;  5TMC A;  4MEY A;  3GTP C;  2R7Z K;  4A3C C;  4A3F K;  1SFO K;  3M3Y K;  4A3B K;  2WB1 L;  3HOY K;  4XSZ A;  3S2D C;  2PA8 D;  2E2H K;  1Y1W C;  4A3L K;  4BXX C;  1I3Q K;  3EQL A;  4BY7 K;  5M5Y K;  1ZYR A;  3I4N C;  2JA5 K;  1SMY A;  2R93 C;  2A6E A;  4A93 C;  3PO3 K;  4C2M K;  2PPB A;  4OIO A;  4OIQ A;  4A3G C;  3K7A K;  4GZY A;  5FJ8 K;  1YNN A;  2A6H A;  3GTO K;  4LK0 A;  4BBR K;  4C3J K;  3S2H K;  4X6A C;  4A3E C;  3PO2 C;  4A3D C;  4BY1 C;  3H0G C;  1TWH K;  5FLM C;  3HOU K;  1K83 K;  3GTG C;  2JA8 K;  5C4X C;  3HOV K;  2B63 K;  4YFN A;  3S1R K;  2WB1 D;  3S14 C;  4XSX A;  4NOI A;  4Q5S A;  1I6H K;  4G7H A;  4Y7N K;  1TWA K;  2NVX K;  3HOW K;  3S1M C;  4BBS C;  1Y1V K;  2NVT C;  3S15 K;  5C3E K;  4A3I K;  2NVQ C;  5C44 K;  5M5W K;  2E2J K;  2JA7 C;  4ZH4 A;  2R92 K;  3GTK K;  3S17 C;  1IW7 A;  3H3V L;  5IP7 C;  4XLN A;  3GTL K;  3RZO K;  4MEX A;  4LK1 A;  4A3J K;  4A3K K;  2E2I K;  3GTJ K;  1TWG C;  2WAQ L;  4A3M C;  4LJZ A;  3GTM C;  1R9T K;  4BBR C;  3CQZ K;  3S16 C;  2A68 A;  5IYD C;  2YU9 K;  4QJV B;  1TWF K;  4YG2 A;  4YFX A;  1I50 K;  4Y52 C;  4JK1 A;  5IYB C;  4G7Z A;  4Q4Z A;  2JA6 C;  3GTP K;  3I4M C;  3M4O C;  3S1Q K;  3HKZ D;  4C3I K;  1WCM C;  3RZD K;  3HOZ C;  3GTQ C;  5IP9 C;  5IYC C;  3S1N C;  2VUM K;  3S2D K;  3S1R C;  5M3F K;  1Y1W K;  3HOX C;  3HKZ L;  4BXX K;  2R7Z C;  4A3F C;  1SFO C;  3M3Y C;  2R93 K;  4A93 K;  4A3B C;  3H3V D;  2A69 A;  2NVY K;  3HOY C;  2E2H C;  4A3L C;  4A3G K;  1I3Q C;  4BY7 C;  2O5J A;  3DXJ A;  5M5X K;  4OIR A;  2JA5 C;  4C3H K;  2WAQ D;  2Y0S D;  3PO3 C;  3RZO C;  3WOD A;  5C4J K;  4X6A K;  3K7A C;  4QIW D;  3PO2 K;  4A3D K;  3FKI K;  3H0G K;  2Y0S L; 
#chains in the Genus database with same CATH topology
 2JH3 A;  2ZFZ A;  4AYB L;  1TWF A;  2CW0 A;  4KMH A;  4A3C K;  1F7U A;  2JA8 C;  3HOV C;  1DCP A;  4YFK A;  5EGH A;  3BUE A;  4KAR A;  1DD5 A;  3GIR A;  3TTG A;  5IP7 K;  3S15 C;  1EI6 A;  3LAP A;  3GTK C;  2ZUE A;  3H0G A;  4BLA A;  2E2I C;  4OIP A;  5IYB K;  4Y52 K;  2JA6 K;  3I4M K;  3GEE A;  4BLB A;  1I6V A;  1WCM K;  3GTQ K;  2YU9 C;  4KAW X;  5IP9 K;  5IYC K;  1WOS A;  4KMU A;  3S1N K;  1I50 C;  2R7Z A;  3GTP C;  1SFO K;  5L46 A;  1HI9 A;  1XXC A;  2JA5 A;  2P5M A;  4A93 C;  1V5V A;  2FQT A;  1F7V A;  3LAJ A;  4RMF A;  4X6A C;  4A3D C;  4BY1 C;  1J6W A;  1TWH K;  1WOR A;  4GTE A;  4GTL A;  3JST A;  4GTC A;  1SFO A;  2WB1 D;  4XSX A;  4Q5S A;  1USO A;  3G4A A;  3GTK A;  1YX2 A;  2JA7 C;  4ZH4 A;  2R92 K;  3S17 C;  4XLN A;  1BJT A;  3ADA C;  3RZO K;  4LK1 A;  4A3J K;  4A3K K;  3GTJ K;  1TWG C;  3GTM C;  4PAA A;  4KAS A;  4O2D A;  3CQZ K;  2D6F C;  1I50 A;  4GTB A;  5IYD C;  4QJV B;  3GTP A;  4YG2 A;  1ZXO A;  3S1Q K;  3ORE A;  5IOS A;  3S1R C;  5M3F K;  4BXX K;  4A3F C;  3M3Y C;  4A3B C;  3H3V D;  3HOY C;  2R92 A;  2E2H C;  1PJ5 A;  4KDD A;  1I3Q C;  3T02 A;  1PJ6 A;  4AH6 A;  4OIR A;  1INN A;  4P9S A;  1IE0 A;  5C4J K;  4OIQ A;  3CQZ A;  1YNJ A;  4MQ9 A;  3GTO C;  1R9T C;  4OIN A;  1WSR A;  3S2H C;  1XXB A;  1O25 A;  3SZZ A;  3S14 K;  3HOU C;  3S1M K;  4BBS K;  1WQH A;  2NVT K;  3RZD C;  2JA7 A;  2NVQ K;  5TMF A;  1AB4 A;  2VUM C;  1I6H C;  2NVX C;  4KAT A;  2PA8 L;  4A3I C;  2NVY C;  1TWG A;  1RU0 A;  2PHC B;  3TFI A;  4A3M K;  2O5I A;  3GTL C;  4AYB D;  2RH6 A;  1UV7 A;  1TWC C;  3FKI C;  4G0U A;  1HQM A;  3HOZ K;  1EQR A;  1O28 A;  2EBB A;  1VJE A;  4LLG A;  3HOX K;  4A3C C;  4MEY A;  2R7Z K;  2E2H A;  4XSZ A;  2XCR B;  1XZP A;  4BY7 K;  5M5Y K;  2JA5 K;  1SMY A;  2R93 C;  3T01 A;  4C2M K;  4A3G C;  3K7A K;  1XZQ A;  4C3H C;  1YNN A;  1DCH A;  2A6H A;  3N3Y A;  4BBR K;  4A3E C;  5IOT A;  1WQF A;  5EGE A;  1BS2 A;  5FLM C;  3FHZ A;  3GTG C;  2JA8 K;  5C4X C;  3HOV K;  1VLO A;  3GSI A;  1BGW A;  3TFJ A;  3S15 K;  5M5W K;  3A8J A;  3GTK K;  3SZY A;  3GTL A;  1WOP A;  2E2I K;  2WAQ L;  3S0X A;  1O2A A;  4LJZ A;  4GFQ A;  1F93 A;  3S16 C;  2GSU A;  2A68 A;  2YU9 K;  1O29 A;  1EH1 A;  1I50 K;  1O27 A;  4JK1 A;  4G7Z A;  3M4O C;  4Q4Z A;  1WOO A;  3GTP K;  1B4B A;  1ZQ1 C;  2R93 A;  3A8K A;  1JQW A;  3L4J A;  4A93 K;  2FQO A;  3Q3Q A;  4FZB A;  5CJ9 A;  2XCQ A;  4A3L C;  4J3N A;  3DXJ A;  5M5X K;  2E2I A;  3PO3 C;  3RZO C;  4LOW A;  3WOD A;  4KMD A;  4X6A K;  4QIW D;  4A3D K;  3AQO A;  1PJ7 A;  4BY1 K;  3GTG A;  1B4A A;  2YU9 A;  4QIW L;  1WIH A;  4LR2 A;  4C3J C;  2CFA B;  1IS1 A;  1K83 C;  1L0W A;  1IBA A;  2B63 C;  1O24 A;  2PMZ L;  3IPJ A;  2JA7 K;  4G7O A;  4LQY A;  3HOW C;  4XLP A;  1TWA C;  4Y7N C;  3I4N K;  3T00 A;  3S17 K;  1Y1V C;  5E68 A;  5C3E C;  4C45 A;  5C44 C;  1IQ0 A;  2E2J C;  1BDF A;  2V6U A;  1TWG K;  4KN7 A;  3GTM K;  2RGR A;  1WQG A;  3NUH A;  4KN4 A;  5C4J C;  1IL2 A;  5IYD K;  1USM A;  2GAH C;  3AQP A;  3V4G A;  4QJV A;  1KQ4 A;  3GDZ A;  1TWF C;  4KB4 A;  4M1X A;  4A3F K;  3M3Y K;  4C3I C;  1O26 A;  4A3B K;  3HOY K;  4WIL A;  3S2D C;  2PA8 D;  3AH5 A;  1Y1W C;  2E2H K;  1I3Q K;  1JOE A;  4GT9 A;  4OIO A;  2KWA A;  3GTM A;  3AD8 C;  3GTO K;  3S2H K;  2W7V A;  1DCO A;  3PO2 C;  3H0G C;  3HOU K;  2B63 A;  5TJ3 A;  4YFN A;  1TWA A;  1O2B A;  2V6T A;  5IOR A;  1I6H K;  2NVX K;  1VGX A;  1O2F B;  3N0C A;  2P8T A;  1I3Q A;  4A3I K;  2Y3P A;  5IP7 C;  4GTA A;  3GTL K;  3GTO A;  1J6X A;  5JVO A;  1R9T A;  5CHP A;  1VH2 A;  3BP3 A;  5HL8 A;  4BBR C;  2XCO A;  4KC6 A;  5IYB C;  4Y52 C;  2JA6 C;  3I4M C;  3QX3 A;  2VUM A;  1WCM C;  1Y1W A;  3GTQ C;  5IP9 C;  5IYC C;  3S1N C;  2NVX A;  2NVY A;  1SFO C;  2R93 K;  1EK8 A;  1F9N A;  4A3G K;  2O5J A;  4GTF A;  3N0B A;  3BP8 C;  4PAB A;  4C3H K;  2WAQ D;  3L4K A;  3CAG A;  1TWC A;  3FKI A;  1ZVU A;  5IOQ A;  4WJ4 A;  4A3E K;  3ERE D;  5FLM K;  3GTG K;  4KB2 A;  3G4C A;  5C4X K;  2BE5 A;  1TWH C;  3FOF A;  5JFE A;  4P5A A;  4DDQ A;  5M3M K;  1XXA A;  2R92 C;  2GAG C;  4BKW A;  1XPP A;  4P5B A;  3S16 K;  4A3J C;  4A3K C;  2JA6 A;  3GTJ C;  3M4O K;  1WCM A;  4FM9 A;  3A8I A;  3GTQ A;  4KM8 A;  4XCH A;  3CQZ C;  3OEP A;  5D4D A;  4KMA A;  4KM9 A;  1ISE A;  2PMZ D;  3S1Q C;  5TMC A;  2WB1 L;  4A3L K;  4G0W A;  4BXX C;  3EQL A;  1ZYR A;  3I4N C;  1VRQ C;  2A6E A;  3AD9 C;  3PO3 K;  2PPB A;  4GZY A;  1ZBS A;  5FJ8 K;  1WSV A;  4LK0 A;  1TWH A;  4C3J K;  2GSO A;  4WJ3 M;  1K83 K;  2GSN A;  2CFA A;  4GTD A;  2B63 K;  1JVI A;  3GEH A;  3OPF A;  3VA7 A;  3S1R K;  3S14 C;  4NOI A;  4G7H A;  4Y7N K;  1TWA K;  3HOW K;  3S1M C;  4BBS C;  3GEI A;  1Y1V K;  2NVT C;  4G0V A;  5C3E K;  2NVQ C;  5C44 K;  2E2J K;  1IW7 A;  3H3V L;  3FOE A;  3GTJ A;  2ZUF A;  1X31 C;  4MEX A;  1GE9 A;  1C0A A;  4A3M C;  3AD7 C;  4ILD A;  1R9T K;  1EFW A;  1K83 A;  1TWF K;  3LPX A;  4YFX A;  3HKZ D;  4C3I K;  3HOZ C;  3RZD K;  1G51 A;  2VUM K;  1YCL A;  3S2D K;  1Y1W K;  1J98 A;  1Y1V A;  3HKZ L;  3HOX C;  2R7Z C;  1XZP B;  1J6V A;  2A69 A;  2NVY K;  2V6S A;  4BY7 C;  3HXA A;  2JA5 C;  2Y0S D;  1XZQ B;  4C2M C;  3MML B;  3TFH A;  3K7A C;  1TWC K;  3PO2 K;  3FKI K;  3H0G K;  2Y0S L; 
#chains in the Genus database with same CATH homology
 1YNJ A;  4MQ9 A;  5FLM K;  3GTO C;  4AYB L;  1R9T C;  4OIN A;  4QIW L;  5C4X K;  3GTG K;  3S2H C;  2BE5 A;  2CW0 A;  1TWH C;  3S14 K;  3HOU C;  3S1M K;  1K83 C;  4A3C K;  4BBS K;  2JA8 C;  3HOV C;  4YFK A;  3RZD C;  2B63 C;  2NVT K;  2NVQ K;  5TMF A;  2PMZ L;  2VUM C;  4G7O A;  2JA7 K;  1I6H C;  5M3M K;  4XLP A;  1TWA C;  4Y7N C;  2NVX C;  3HOW C;  3I4N K;  3S17 K;  1Y1V C;  5IP7 K;  3S15 C;  5C3E C;  2PA8 L;  4A3I C;  2NVY C;  5C44 C;  1TWC K;  2E2J C;  1BDF A;  2R92 C;  3GTK C;  1TWG K;  4A3M K;  4KN7 A;  2O5I A;  3GTM K;  1XPP A;  4KN4 A;  3GTL C;  4AYB D;  3S16 K;  5C4J C;  4A3J C;  4A3K C;  2E2I C;  1TWC C;  4OIP A;  3GTJ C;  3FKI C;  5IYD K;  4BY1 K;  5IYB K;  4A3E K;  3M4O K;  4Y52 K;  1HQM A;  2JA6 K;  3I4M K;  4QJV A;  3CQZ C;  1I6V A;  1WCM K;  5D4D A;  3HOZ K;  3GTQ K;  2YU9 C;  5IP9 K;  1TWF C;  5IYC K;  4KMU A;  4LLG A;  3S1N K;  1I50 C;  3HOX K;  2PMZ D;  3S1Q C;  5TMC A;  4MEY A;  3GTP C;  2R7Z K;  4A3C C;  4A3F K;  1SFO K;  3M3Y K;  4A3B K;  2WB1 L;  3HOY K;  4XSZ A;  3S2D C;  2PA8 D;  2E2H K;  1Y1W C;  4A3L K;  4BXX C;  1I3Q K;  3EQL A;  4BY7 K;  5M5Y K;  1ZYR A;  3I4N C;  2JA5 K;  1SMY A;  2R93 C;  2A6E A;  4A93 C;  3PO3 K;  4C2M K;  2PPB A;  4OIO A;  4OIQ A;  4A3G C;  3K7A K;  4GZY A;  5FJ8 K;  1YNN A;  2A6H A;  3GTO K;  4LK0 A;  4BBR K;  4C3J K;  3S2H K;  4X6A C;  4A3E C;  3PO2 C;  4A3D C;  4BY1 C;  3H0G C;  1TWH K;  5FLM C;  3HOU K;  1K83 K;  3GTG C;  2JA8 K;  5C4X C;  3HOV K;  2B63 K;  4YFN A;  3S1R K;  2WB1 D;  3S14 C;  4XSX A;  4NOI A;  4Q5S A;  1I6H K;  4G7H A;  4Y7N K;  1TWA K;  2NVX K;  3HOW K;  3S1M C;  4BBS C;  1Y1V K;  2NVT C;  3S15 K;  5C3E K;  4A3I K;  2NVQ C;  5C44 K;  5M5W K;  2E2J K;  2JA7 C;  4ZH4 A;  2R92 K;  3GTK K;  3S17 C;  1IW7 A;  3H3V L;  5IP7 C;  4XLN A;  3GTL K;  3RZO K;  4MEX A;  4LK1 A;  4A3J K;  4A3K K;  2E2I K;  3GTJ K;  1TWG C;  2WAQ L;  4A3M C;  4LJZ A;  3GTM C;  1R9T K;  4BBR C;  3CQZ K;  3S16 C;  2A68 A;  5IYD C;  2YU9 K;  4QJV B;  1TWF K;  4YG2 A;  4YFX A;  1I50 K;  4Y52 C;  4JK1 A;  5IYB C;  4G7Z A;  4Q4Z A;  2JA6 C;  3GTP K;  3I4M C;  3M4O C;  3S1Q K;  3HKZ D;  4C3I K;  1WCM C;  3RZD K;  3HOZ C;  3GTQ C;  5IP9 C;  5IYC C;  3S1N C;  2VUM K;  3S2D K;  3S1R C;  5M3F K;  1Y1W K;  3HOX C;  3HKZ L;  4BXX K;  2R7Z C;  4A3F C;  1SFO C;  3M3Y C;  2R93 K;  4A93 K;  4A3B C;  3H3V D;  2A69 A;  2NVY K;  3HOY C;  2E2H C;  4A3L C;  4A3G K;  1I3Q C;  4BY7 C;  2O5J A;  3DXJ A;  5M5X K;  4OIR A;  2JA5 C;  4C3H K;  2WAQ D;  2Y0S D;  3PO3 C;  3RZO C;  3WOD A;  5C4J K;  4X6A K;  3K7A C;  4QIW D;  3PO2 K;  4A3D K;  3FKI K;  3H0G K;  2Y0S L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...