1TWGK

Rna polymerase ii complexed with ctp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twgK00
4MEYA 5M5XK 4A3MK 2PA8D 3S2HK 3M3YC 3K7AC 4G7OA 1SFOK 2NVYK 4A3JC 5C4XK 2PMZD 3HOVC 3I4MK 1WCMC 3WODA 2E2HC 2PMZL 1XPPA 3S14K 2O5IA 4BY1C 3K7AK 3M3YK 4BBRC 2JA5C 4A3CC 4MEXA 1TWFC 1IW7A 4C2MK 3M4OK 4A3JK 1K83C 3S16C 2JA7C 2R7ZC 1WCMK 2E2HK 2WAQD 4LJZA 4XLNA 2WAQL 3DXJA 4BY1K 4BBRK 2JA5K 2NVXC 2R92C 4A3CK 1TWFK 4YFNA 4A93C 4A3LC 3S2DC 4C3IK 1K83K 3S16K 2JA7K 2R7ZK 1YNNA 4KN7A 4A3EC 3S1RK 2YU9C 4YFXA 2NVXK 3GTPC 3S17C 4A3LK 4A93K 3S15C 3S2DK 2A6HA 4MQ9A 5M3MK 2O5JA 4A3EK 4AYBL 4BBSC 5C4JC 4OIOA 2WB1D 5M5WK 5M5YK 5C44C 3GTPK 3S17K 4LLGA 4Y52C 4YFKA 4C3HK 5M3FK 3S15K 2WB1L 3RZOC 4LK1A 3HOVK 1R9TC 4BBSK 4A3DC 3HOWC 3CQZC 3HKZL 5IYCC 4BY7C 3GTOC 5C44K 4JK1A 3FKIC 3H3VL 4Y52K 3RZDC 4G7HA 3RZOK 4GZYA 3GTMC 3HOYC 4QIWD 3GTQC 1R9TK 4XSXA 5D4DA 4A3KC 2R93C 4A3DK 4QIWL 1I6HC 3HOWK 2B63C 3S1MC 3CQZK 5IYCK 3I4NC 4BY7K 4Q4ZA 3GTOK 4A3IC 4X6AC 4QJVB 2E2IC 3FKIK 5IYDC 1ZYRA 3RZDK 2R92K 3PO2C 1Y1VC 4OIPA 4BXXK 3GTMK 1I3QC 3H0GC 3HOYK 4AYBD 3GTQK 1HQMA 3HOZC 3EQLA 3GTJC 2R93K 2NVQC 2B63K 4G7ZA 2A69A 3I4NK 4KN4A 2VUMC 3S1MK 4X6AK 2YU9K 3PO2K 5IYDK 2CW0A 4A3GC 1Y1VK 2JA8C 3HOXC 1I3QK 3H0GK 1I50C 4KMUA 3HOZK 3GTJK 3HKZD 2A6EA 4C3JK 2NVTC 2NVQK 2VUMK 5IYBC 5C4JK 2NVYC 4OINA 3H3VD 1Y1WC 1SMYA 4A3GK 2Y0SD 4ZH4A 5C3EC 2PPBA 2JA8K 4XLPA 3HOXK 3GTGC 2Y0SL 1I50K 3S14C 5IP9C 5IP7C 1YNJA 4Q5SA 2PA8L 2NVTK 4A3BC 5IYBK 3M4OC 1Y1WK 3PO3C 5FJ8K 5C3EK 2BE5A 2JA6C 5TMFA 3S1QC 1TWGC 3GTGK 3GTKC 4OIQA 5IP9K 5IP7K 4A3KK 1TWCC 5TMCA 3HOUC 3S1NC 4A3FC 4A3BK 5FLMC 1TWHC 1I6HK 1I6VA 4Y7NC 1TWAC 3PO3K 2E2JC 4A3IK 2E2IK 4BXXC 1BDFA 2JA6K 3GTLC 1TWGK 3S1RC 4A3MC 3GTKK 3S1QK 1TWCK 4XSZA 3HOUK 3S1NK 4A3FK 3S2HC 5FLMK 1TWHK 4OIRA 4Y7NK 1TWAK 1SFOC 2E2JK 4QJVA 4YG2A 5C4XC 3I4MC 4LK0A 4NOIA 2A68A 3GTLK
chains in the Genus database with same CATH superfamily
3OREA 1XZQA 4C3HC 3V4GA 4G7OA 1SFOK 2NVYK 4A3JC 3I4MK 2E2HC 2CFAA 1XPPA 4A3CC 1TWFC 1ZQ1C 1O2AA 1WIHA 5IOSA 1K83C 2JA7C 2R7ZC 2WAQD 2WAQL 2R92C 1O28A 3S2DC 4GTLA 3MMLB 4KARA 4YFXA 3S17C 4A93K 1Y1VA 3S15C 5JFEA 5M3MK 4KAWX 3GTJA 1WQHA 1DCHA 4OIOA 1VGXA 4YFKA 4KATA 3FOFA 4BBSK 3G4AA 3HOWC 3CQZC 4BY7C 1WOPA 1XZPA 3FKIC 3H3VL 4Y52K 3GTMC 4KB2A 1O29A 1F93A 3I4NC 2P8TA 4FZBA 4QJVB 1ZYRA 3RZDK 1ZVUA 3H0GC 3HOYK 2GSOA 3TFHA 1XZQB 2B63K 3S1MK 2A69A 1IE0A 2VUMA 4WILA 2XCRB 2YU9K 5IYDK 4A3GC 5IORA 3A8JA 2CFAB 2EBBA 1I50A 4J3NA 2GAHC 2VUMK 2NVYC 4OINA 4BKWA 1B4AA 4WJ4A 4P5BA 2PPBA 2JA8K 3JSTA 1EFWA 1I50K 1AB4A 4KM9A 4LOWA 3SZZA 2D6FC 5IYBK 3PO3C 4GFQA 3A8IA 2V6SA 5TMFA 1TWGC 3TFJA 5IP9K 1TWCA 3S1NC 4A3BK 1I6HK 5FLMC 1WQGA 1TWAC 4A3IK 1K83A 2JA7A 2JA6K 3GTLC 5E68A 4G0VA 1ZXOA 4GTDA 1TWCK 1IL2A 3S2HC 2E2JK 4BXXK 3GIRA 4A3MK 2PA8D 3LAPA 3G4CA 3M3YC 3K7AC 5C4XK 2PMZD 1WCMC 3BUEA 3WODA 2PMZL 2RH6A 2GAGC 2O5IA 2JA5C 3S0XA 1YX2A 1VRQC 3HXAA 4C2MK 4MEXA 1J98A 3S16C 3QX3A 4GTBA 2ZFZA 2GSNA 4BY1K 4BBRK 1WOSA 3VA7A 1J6VA 4A3LC 3GTMA 1YNNA 4GT9A 3TTGA 5CJ9A 3S1RK 4KMHA 2YU9C 2NVXK 3GTPA 3GEHA 1KQ4A 2O5JA 4A3EK 4AYBL 5C44C 1PJ6A 3GTPK 4LLGA 3FOEA 4KMDA 1DCPA 3HOVK 1R9TC 4KMAA 1WORA 3HKZL 5IYCC 3GTOA 4JK1A 3TFIA 4G7HA 5CHPA 3RZOK 3AQPA 4RMFA 3AD8C 3GTQC 5D4DA 4KB4A 2R93C 1IBAA 4A3DK 1I6HC 3GTOK 4A3IC 3PO2C 2E2IA 4OIPA 1I3QC 1WSRA 3CAGA 1WQFA 3AD7C 4C3JC 4G7ZA 4X6AK 2CW0A 1XXAA 1Y1VK 4G0UA 4WJ3M 3Q3QA 3HOZK 2XCOA 3GTJK 2NVTC 2NVQK 3N3YA 3H3VD 1Y1WA 1JOEA 1SMYA 2Y0SD 4ZH4A 5C3EC 5TJ3A 3HOXK 4GTAA 2Y0SL 3GTGC 5IP7C 1YNJA 1Y1WK 5EGHA 5FJ8K 3S1QC 1B4BA 1O27A 3GTKA 1F7UA 4A3KK 3HOUC 4M1XA 1TWHA 4Y7NC 5JVOA 3AD9C 1BDFA 4PAAA 3S1RC 3GTKK 4A3FK 1TWHK 1SFOC 1EQRA 4GTCA 5EGEA 3I4MC 2KWAA 2A68A 1O26A 1VJEA 1WSVA 3A8KA 1IS1A 3L4JA 3HOVC 1UV7A 3LAJA 3NUHA 2E2HA 3ERED 3S14K 1XXBA 1TWFA 3M4OK 4A3JK 2R7ZA 1R9TA 2E2HK 4LJZA 3OPFA 2RGRA 4XLNA 3DXJA 1JVIA 4LQYA 4G0WA 4A3CK 4A93C 2R92A 2ZUFA 1TWFK 1K83K 2JA7K 2R7ZK 4KN7A 2R93A 1O25A 3T01A 3ADAC 3S2DK 5IOQA 2A6HA 1GE9A 4BBSC 1VLOA 4KASA 2WB1D 4DDQA 5M5WK 5M5YK 3S17K 4Y52C 3S15K 2WB1L 4LK1A 3SZYA 3T02A 3CQZA 1BGWA 3FKIA 3RZDC 1ISEA 3HOYC 4QIWD 1ZBSA 4KM8A 4XSXA 4A3KC 4QIWL 3HOWK 2B63C 1O2BA 3CQZK 3S1MC 4BY7K 4BLBA 4Q4ZA 3FKIK 5IYDC 3GTMK 3H0GA 4AYBD 1HQMA 1V5VA 1BJTA 4KN4A 2VUMC 3I4NK 1DCOA 1G51A 1RU0A 2JA8C 4P5AA 3H0GK 1I50C 4O2DA 3HKZD 1O24A 2XCQA 3GEIA 5IYBC 5C4JK 2NVYA 4A3GK 1JQWA 3GEEA 2V6TA 5IP9C 1IQ0A 3S14C 4Q5SA 4A3BC 3M4OC 3IPJA 2BE5A 2JA6C 5IOTA 1O2FB 1USOA 1TWGA 1TWCC 4XCHA 3PO3K 1TWAA 2E2JC 3AH5A 2E2IK 1C0AA 4BXXC 1TWGK 3GTLA 4A3MC 4XSZA 3S1NK 2FQTA 3BP3A 3LPXA 5FLMK 4OIRA 1TWAK 5C4XC 4GTEA 1X31C 4LK0A 3GTLK 4MEYA 5M5XK 3FHZA 3S2HK 4C2MC 2P5MA 3GDZA 1WCMA 3L4KA 3K7AK 4BY1C 4BBRC 3M3YK 2JA5A 1IW7A 3T00A 1HI9A 1WCMK 1F9NA 2JH3A 2JA5K 2NVXC 3OEPA 4YFNA 4C3IK 3S16K 4PABA 4A3EC 5L46A 2B63A 2YU9A 4KC6A 3GTPC 4A3LK 1INNA 1USMA 1J6WA 4MQ9A 1L0WA 5C4JC 2V6UA 4KDDA 3N0BA 4C3HK 5M3FK 4ILDA 3RZOC 1F7VA 2Y3PA 2PHCB 4A3DC 1BS2A 4C45A 3GTOC 5C44K 2W7VA 4LR2A 4GZYA 1R9TK 3GTQA 5IYCK 4X6AC 1DD5A 2E2IC 2R92K 1EI6A 1Y1VC 2JA6A 1I3QA 3GTQK 3HOZC 3EQLA 3GTJC 2R93K 2NVQC 3PO2K 3HOXC 1I3QK 5HL8A 2FQOA 4KMUA 1VH2A 4P9SA 2A6EA 4C3JK 3BP8C 1Y1WC 1J6XA 1PJ5A 1EK8A 4XLPA 3GSIA 3GTGA 2PA8L 1XZPB 2NVTK 2ZUEA 1WOOA 1XXCA 1PJ7A 5C3EK 3N0CA 3GTGK 3GTKC 4OIQA 5IP7K 4AH6A 5TMCA 4A3FC 1TWHC 1I6VA 4C3IC 4GTFA 3S1QK 2GSUA 3HOUK 2NVXA 1YCLA 4Y7NK 4BLAA 1SFOA 4QJVA 1EH1A 4YG2A 4NOIA 3AQOA 4FM9A
chains in the Genus database with same CATH topology
4MEYA 5M5XK 4A3MK 2PA8D 3S2HK 3M3YC 3K7AC 4G7OA 1SFOK 2NVYK 4A3JC 5C4XK 2PMZD 3HOVC 3I4MK 1WCMC 3WODA 2E2HC 2PMZL 1XPPA 3S14K 2O5IA 4BY1C 3K7AK 3M3YK 4BBRC 2JA5C 4A3CC 4MEXA 1TWFC 1IW7A 4C2MK 3M4OK 4A3JK 1K83C 3S16C 2JA7C 2R7ZC 1WCMK 2E2HK 2WAQD 4LJZA 4XLNA 2WAQL 3DXJA 4BY1K 4BBRK 2JA5K 2NVXC 2R92C 4A3CK 1TWFK 4YFNA 4A93C 4A3LC 3S2DC 4C3IK 1K83K 3S16K 2JA7K 2R7ZK 1YNNA 4KN7A 4A3EC 3S1RK 2YU9C 4YFXA 2NVXK 3GTPC 3S17C 4A3LK 4A93K 3S15C 3S2DK 2A6HA 4MQ9A 5M3MK 2O5JA 4A3EK 4AYBL 4BBSC 5C4JC 4OIOA 2WB1D 5M5WK 5M5YK 5C44C 3GTPK 3S17K 4LLGA 4Y52C 4YFKA 4C3HK 5M3FK 3S15K 2WB1L 3RZOC 4LK1A 3HOVK 1R9TC 4BBSK 4A3DC 3HOWC 3CQZC 3HKZL 5IYCC 4BY7C 3GTOC 5C44K 4JK1A 3FKIC 3H3VL 4Y52K 3RZDC 4G7HA 3RZOK 4GZYA 3GTMC 3HOYC 4QIWD 3GTQC 1R9TK 4XSXA 5D4DA 4A3KC 2R93C 4A3DK 4QIWL 1I6HC 3HOWK 2B63C 3S1MC 3CQZK 5IYCK 3I4NC 4BY7K 4Q4ZA 3GTOK 4A3IC 4X6AC 4QJVB 2E2IC 3FKIK 5IYDC 1ZYRA 3RZDK 2R92K 3PO2C 1Y1VC 4OIPA 4BXXK 3GTMK 1I3QC 3H0GC 3HOYK 4AYBD 3GTQK 1HQMA 3HOZC 3EQLA 3GTJC 2R93K 2NVQC 2B63K 4G7ZA 2A69A 3I4NK 4KN4A 2VUMC 3S1MK 4X6AK 2YU9K 3PO2K 5IYDK 2CW0A 4A3GC 1Y1VK 2JA8C 3HOXC 1I3QK 3H0GK 1I50C 4KMUA 3HOZK 3GTJK 3HKZD 2A6EA 4C3JK 2NVTC 2NVQK 2VUMK 5IYBC 5C4JK 2NVYC 4OINA 3H3VD 1Y1WC 1SMYA 4A3GK 2Y0SD 4ZH4A 5C3EC 2PPBA 2JA8K 4XLPA 3HOXK 3GTGC 2Y0SL 1I50K 3S14C 5IP9C 5IP7C 1YNJA 4Q5SA 2PA8L 2NVTK 4A3BC 5IYBK 3M4OC 1Y1WK 3PO3C 5FJ8K 5C3EK 2BE5A 2JA6C 5TMFA 3S1QC 1TWGC 3GTGK 3GTKC 4OIQA 5IP9K 5IP7K 4A3KK 1TWCC 5TMCA 3HOUC 3S1NC 4A3FC 4A3BK 5FLMC 1TWHC 1I6HK 1I6VA 4Y7NC 1TWAC 3PO3K 2E2JC 4A3IK 2E2IK 4BXXC 1BDFA 2JA6K 3GTLC 1TWGK 3S1RC 4A3MC 3GTKK 3S1QK 1TWCK 4XSZA 3HOUK 3S1NK 4A3FK 3S2HC 5FLMK 1TWHK 4OIRA 4Y7NK 1TWAK 1SFOC 2E2JK 4QJVA 4YG2A 5C4XC 3I4MC 4LK0A 4NOIA 2A68A 3GTLK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEY A;  5M5X K;  4A3M K;  2PA8 D;  3S2H K;  3M3Y C;  3K7A C;  4G7O A;  1SFO K;  2NVY K;  4A3J C;  5C4X K;  2PMZ D;  3HOV C;  3I4M K;  1WCM C;  3WOD A;  2E2H C;  2PMZ L;  1XPP A;  3S14 K;  2O5I A;  4BY1 C;  3K7A K;  3M3Y K;  4BBR C;  2JA5 C;  4A3C C;  4MEX A;  1TWF C;  1IW7 A;  4C2M K;  3M4O K;  4A3J K;  1K83 C;  3S16 C;  2JA7 C;  2R7Z C;  1WCM K;  2E2H K;  2WAQ D;  4LJZ A;  4XLN A;  2WAQ L;  3DXJ A;  4BY1 K;  4BBR K;  2JA5 K;  2NVX C;  2R92 C;  4A3C K;  1TWF K;  4YFN A;  4A93 C;  4A3L C;  3S2D C;  4C3I K;  1K83 K;  3S16 K;  2JA7 K;  2R7Z K;  1YNN A;  4KN7 A;  4A3E C;  3S1R K;  2YU9 C;  4YFX A;  2NVX K;  3GTP C;  3S17 C;  4A3L K;  4A93 K;  3S15 C;  3S2D K;  2A6H A;  4MQ9 A;  5M3M K;  2O5J A;  4A3E K;  4AYB L;  4BBS C;  5C4J C;  4OIO A;  2WB1 D;  5M5W K;  5M5Y K;  5C44 C;  3GTP K;  3S17 K;  4LLG A;  4Y52 C;  4YFK A;  4C3H K;  5M3F K;  3S15 K;  2WB1 L;  3RZO C;  4LK1 A;  3HOV K;  1R9T C;  4BBS K;  4A3D C;  3HOW C;  3CQZ C;  3HKZ L;  5IYC C;  4BY7 C;  3GTO C;  5C44 K;  4JK1 A;  3FKI C;  3H3V L;  4Y52 K;  3RZD C;  4G7H A;  3RZO K;  4GZY A;  3GTM C;  3HOY C;  4QIW D;  3GTQ C;  1R9T K;  4XSX A;  5D4D A;  4A3K C;  2R93 C;  4A3D K;  4QIW L;  1I6H C;  3HOW K;  2B63 C;  3S1M C;  3CQZ K;  5IYC K;  3I4N C;  4BY7 K;  4Q4Z A;  3GTO K;  4A3I C;  4X6A C;  4QJV B;  2E2I C;  3FKI K;  5IYD C;  1ZYR A;  3RZD K;  2R92 K;  3PO2 C;  1Y1V C;  4OIP A;  4BXX K;  3GTM K;  1I3Q C;  3H0G C;  3HOY K;  4AYB D;  3GTQ K;  1HQM A;  3HOZ C;  3EQL A;  3GTJ C;  2R93 K;  2NVQ C;  2B63 K;  4G7Z A;  2A69 A;  3I4N K;  4KN4 A;  2VUM C;  3S1M K;  4X6A K;  2YU9 K;  3PO2 K;  5IYD K;  2CW0 A;  4A3G C;  1Y1V K;  2JA8 C;  3HOX C;  1I3Q K;  3H0G K;  1I50 C;  4KMU A;  3HOZ K;  3GTJ K;  3HKZ D;  2A6E A;  4C3J K;  2NVT C;  2NVQ K;  2VUM K;  5IYB C;  5C4J K;  2NVY C;  4OIN A;  3H3V D;  1Y1W C;  1SMY A;  4A3G K;  2Y0S D;  4ZH4 A;  5C3E C;  2PPB A;  2JA8 K;  4XLP A;  3HOX K;  3GTG C;  2Y0S L;  1I50 K;  3S14 C;  5IP9 C;  5IP7 C;  1YNJ A;  4Q5S A;  2PA8 L;  2NVT K;  4A3B C;  5IYB K;  3M4O C;  1Y1W K;  3PO3 C;  5FJ8 K;  5C3E K;  2BE5 A;  2JA6 C;  5TMF A;  3S1Q C;  1TWG C;  3GTG K;  3GTK C;  4OIQ A;  5IP9 K;  5IP7 K;  4A3K K;  1TWC C;  5TMC A;  3HOU C;  3S1N C;  4A3F C;  4A3B K;  5FLM C;  1TWH C;  1I6H K;  1I6V A;  4Y7N C;  1TWA C;  3PO3 K;  2E2J C;  4A3I K;  2E2I K;  4BXX C;  1BDF A;  2JA6 K;  3GTL C;  1TWG K;  3S1R C;  4A3M C;  3GTK K;  3S1Q K;  1TWC K;  4XSZ A;  3HOU K;  3S1N K;  4A3F K;  3S2H C;  5FLM K;  1TWH K;  4OIR A;  4Y7N K;  1TWA K;  1SFO C;  2E2J K;  4QJV A;  4YG2 A;  5C4X C;  3I4M C;  4LK0 A;  4NOI A;  2A68 A;  3GTL K; 
#chains in the Genus database with same CATH topology
 3ORE A;  1XZQ A;  4C3H C;  3V4G A;  4G7O A;  1SFO K;  2NVY K;  4A3J C;  3I4M K;  2E2H C;  2CFA A;  1XPP A;  4A3C C;  1TWF C;  1ZQ1 C;  1O2A A;  1WIH A;  5IOS A;  1K83 C;  2JA7 C;  2R7Z C;  2WAQ D;  2WAQ L;  2R92 C;  1O28 A;  3S2D C;  4GTL A;  3MML B;  4KAR A;  4YFX A;  3S17 C;  4A93 K;  1Y1V A;  3S15 C;  5JFE A;  5M3M K;  4KAW X;  3GTJ A;  1WQH A;  1DCH A;  4OIO A;  1VGX A;  4YFK A;  4KAT A;  3FOF A;  4BBS K;  3G4A A;  3HOW C;  3CQZ C;  4BY7 C;  1WOP A;  1XZP A;  3FKI C;  3H3V L;  4Y52 K;  3GTM C;  4KB2 A;  1O29 A;  1F93 A;  3I4N C;  2P8T A;  4FZB A;  4QJV B;  1ZYR A;  3RZD K;  1ZVU A;  3H0G C;  3HOY K;  2GSO A;  3TFH A;  1XZQ B;  2B63 K;  3S1M K;  2A69 A;  1IE0 A;  2VUM A;  4WIL A;  2XCR B;  2YU9 K;  5IYD K;  4A3G C;  5IOR A;  3A8J A;  2CFA B;  2EBB A;  1I50 A;  4J3N A;  2GAH C;  2VUM K;  2NVY C;  4OIN A;  4BKW A;  1B4A A;  4WJ4 A;  4P5B A;  2PPB A;  2JA8 K;  3JST A;  1EFW A;  1I50 K;  1AB4 A;  4KM9 A;  4LOW A;  3SZZ A;  2D6F C;  5IYB K;  3PO3 C;  4GFQ A;  3A8I A;  2V6S A;  5TMF A;  1TWG C;  3TFJ A;  5IP9 K;  1TWC A;  3S1N C;  4A3B K;  1I6H K;  5FLM C;  1WQG A;  1TWA C;  4A3I K;  1K83 A;  2JA7 A;  2JA6 K;  3GTL C;  5E68 A;  4G0V A;  1ZXO A;  4GTD A;  1TWC K;  1IL2 A;  3S2H C;  2E2J K;  4BXX K;  3GIR A;  4A3M K;  2PA8 D;  3LAP A;  3G4C A;  3M3Y C;  3K7A C;  5C4X K;  2PMZ D;  1WCM C;  3BUE A;  3WOD A;  2PMZ L;  2RH6 A;  2GAG C;  2O5I A;  2JA5 C;  3S0X A;  1YX2 A;  1VRQ C;  3HXA A;  4C2M K;  4MEX A;  1J98 A;  3S16 C;  3QX3 A;  4GTB A;  2ZFZ A;  2GSN A;  4BY1 K;  4BBR K;  1WOS A;  3VA7 A;  1J6V A;  4A3L C;  3GTM A;  1YNN A;  4GT9 A;  3TTG A;  5CJ9 A;  3S1R K;  4KMH A;  2YU9 C;  2NVX K;  3GTP A;  3GEH A;  1KQ4 A;  2O5J A;  4A3E K;  4AYB L;  5C44 C;  1PJ6 A;  3GTP K;  4LLG A;  3FOE A;  4KMD A;  1DCP A;  3HOV K;  1R9T C;  4KMA A;  1WOR A;  3HKZ L;  5IYC C;  3GTO A;  4JK1 A;  3TFI A;  4G7H A;  5CHP A;  3RZO K;  3AQP A;  4RMF A;  3AD8 C;  3GTQ C;  5D4D A;  4KB4 A;  2R93 C;  1IBA A;  4A3D K;  1I6H C;  3GTO K;  4A3I C;  3PO2 C;  2E2I A;  4OIP A;  1I3Q C;  1WSR A;  3CAG A;  1WQF A;  3AD7 C;  4C3J C;  4G7Z A;  4X6A K;  2CW0 A;  1XXA A;  1Y1V K;  4G0U A;  4WJ3 M;  3Q3Q A;  3HOZ K;  2XCO A;  3GTJ K;  2NVT C;  2NVQ K;  3N3Y A;  3H3V D;  1Y1W A;  1JOE A;  1SMY A;  2Y0S D;  4ZH4 A;  5C3E C;  5TJ3 A;  3HOX K;  4GTA A;  2Y0S L;  3GTG C;  5IP7 C;  1YNJ A;  1Y1W K;  5EGH A;  5FJ8 K;  3S1Q C;  1B4B A;  1O27 A;  3GTK A;  1F7U A;  4A3K K;  3HOU C;  4M1X A;  1TWH A;  4Y7N C;  5JVO A;  3AD9 C;  1BDF A;  4PAA A;  3S1R C;  3GTK K;  4A3F K;  1TWH K;  1SFO C;  1EQR A;  4GTC A;  5EGE A;  3I4M C;  2KWA A;  2A68 A;  1O26 A;  1VJE A;  1WSV A;  3A8K A;  1IS1 A;  3L4J A;  3HOV C;  1UV7 A;  3LAJ A;  3NUH A;  2E2H A;  3ERE D;  3S14 K;  1XXB A;  1TWF A;  3M4O K;  4A3J K;  2R7Z A;  1R9T A;  2E2H K;  4LJZ A;  3OPF A;  2RGR A;  4XLN A;  3DXJ A;  1JVI A;  4LQY A;  4G0W A;  4A3C K;  4A93 C;  2R92 A;  2ZUF A;  1TWF K;  1K83 K;  2JA7 K;  2R7Z K;  4KN7 A;  2R93 A;  1O25 A;  3T01 A;  3ADA C;  3S2D K;  5IOQ A;  2A6H A;  1GE9 A;  4BBS C;  1VLO A;  4KAS A;  2WB1 D;  4DDQ A;  5M5W K;  5M5Y K;  3S17 K;  4Y52 C;  3S15 K;  2WB1 L;  4LK1 A;  3SZY A;  3T02 A;  3CQZ A;  1BGW A;  3FKI A;  3RZD C;  1ISE A;  3HOY C;  4QIW D;  1ZBS A;  4KM8 A;  4XSX A;  4A3K C;  4QIW L;  3HOW K;  2B63 C;  1O2B A;  3CQZ K;  3S1M C;  4BY7 K;  4BLB A;  4Q4Z A;  3FKI K;  5IYD C;  3GTM K;  3H0G A;  4AYB D;  1HQM A;  1V5V A;  1BJT A;  4KN4 A;  2VUM C;  3I4N K;  1DCO A;  1G51 A;  1RU0 A;  2JA8 C;  4P5A A;  3H0G K;  1I50 C;  4O2D A;  3HKZ D;  1O24 A;  2XCQ A;  3GEI A;  5IYB C;  5C4J K;  2NVY A;  4A3G K;  1JQW A;  3GEE A;  2V6T A;  5IP9 C;  1IQ0 A;  3S14 C;  4Q5S A;  4A3B C;  3M4O C;  3IPJ A;  2BE5 A;  2JA6 C;  5IOT A;  1O2F B;  1USO A;  1TWG A;  1TWC C;  4XCH A;  3PO3 K;  1TWA A;  2E2J C;  3AH5 A;  2E2I K;  1C0A A;  4BXX C;  1TWG K;  3GTL A;  4A3M C;  4XSZ A;  3S1N K;  2FQT A;  3BP3 A;  3LPX A;  5FLM K;  4OIR A;  1TWA K;  5C4X C;  4GTE A;  1X31 C;  4LK0 A;  3GTL K;  4MEY A;  5M5X K;  3FHZ A;  3S2H K;  4C2M C;  2P5M A;  3GDZ A;  1WCM A;  3L4K A;  3K7A K;  4BY1 C;  4BBR C;  3M3Y K;  2JA5 A;  1IW7 A;  3T00 A;  1HI9 A;  1WCM K;  1F9N A;  2JH3 A;  2JA5 K;  2NVX C;  3OEP A;  4YFN A;  4C3I K;  3S16 K;  4PAB A;  4A3E C;  5L46 A;  2B63 A;  2YU9 A;  4KC6 A;  3GTP C;  4A3L K;  1INN A;  1USM A;  1J6W A;  4MQ9 A;  1L0W A;  5C4J C;  2V6U A;  4KDD A;  3N0B A;  4C3H K;  5M3F K;  4ILD A;  3RZO C;  1F7V A;  2Y3P A;  2PHC B;  4A3D C;  1BS2 A;  4C45 A;  3GTO C;  5C44 K;  2W7V A;  4LR2 A;  4GZY A;  1R9T K;  3GTQ A;  5IYC K;  4X6A C;  1DD5 A;  2E2I C;  2R92 K;  1EI6 A;  1Y1V C;  2JA6 A;  1I3Q A;  3GTQ K;  3HOZ C;  3EQL A;  3GTJ C;  2R93 K;  2NVQ C;  3PO2 K;  3HOX C;  1I3Q K;  5HL8 A;  2FQO A;  4KMU A;  1VH2 A;  4P9S A;  2A6E A;  4C3J K;  3BP8 C;  1Y1W C;  1J6X A;  1PJ5 A;  1EK8 A;  4XLP A;  3GSI A;  3GTG A;  2PA8 L;  1XZP B;  2NVT K;  2ZUE A;  1WOO A;  1XXC A;  1PJ7 A;  5C3E K;  3N0C A;  3GTG K;  3GTK C;  4OIQ A;  5IP7 K;  4AH6 A;  5TMC A;  4A3F C;  1TWH C;  1I6V A;  4C3I C;  4GTF A;  3S1Q K;  2GSU A;  3HOU K;  2NVX A;  1YCL A;  4Y7N K;  4BLA A;  1SFO A;  4QJV A;  1EH1 A;  4YG2 A;  4NOI A;  3AQO A;  4FM9 A; 
#chains in the Genus database with same CATH homology
 4MEY A;  5M5X K;  4A3M K;  2PA8 D;  3S2H K;  3M3Y C;  3K7A C;  4G7O A;  1SFO K;  2NVY K;  4A3J C;  5C4X K;  2PMZ D;  3HOV C;  3I4M K;  1WCM C;  3WOD A;  2E2H C;  2PMZ L;  1XPP A;  3S14 K;  2O5I A;  4BY1 C;  3K7A K;  3M3Y K;  4BBR C;  2JA5 C;  4A3C C;  4MEX A;  1TWF C;  1IW7 A;  4C2M K;  3M4O K;  4A3J K;  1K83 C;  3S16 C;  2JA7 C;  2R7Z C;  1WCM K;  2E2H K;  2WAQ D;  4LJZ A;  4XLN A;  2WAQ L;  3DXJ A;  4BY1 K;  4BBR K;  2JA5 K;  2NVX C;  2R92 C;  4A3C K;  1TWF K;  4YFN A;  4A93 C;  4A3L C;  3S2D C;  4C3I K;  1K83 K;  3S16 K;  2JA7 K;  2R7Z K;  1YNN A;  4KN7 A;  4A3E C;  3S1R K;  2YU9 C;  4YFX A;  2NVX K;  3GTP C;  3S17 C;  4A3L K;  4A93 K;  3S15 C;  3S2D K;  2A6H A;  4MQ9 A;  5M3M K;  2O5J A;  4A3E K;  4AYB L;  4BBS C;  5C4J C;  4OIO A;  2WB1 D;  5M5W K;  5M5Y K;  5C44 C;  3GTP K;  3S17 K;  4LLG A;  4Y52 C;  4YFK A;  4C3H K;  5M3F K;  3S15 K;  2WB1 L;  3RZO C;  4LK1 A;  3HOV K;  1R9T C;  4BBS K;  4A3D C;  3HOW C;  3CQZ C;  3HKZ L;  5IYC C;  4BY7 C;  3GTO C;  5C44 K;  4JK1 A;  3FKI C;  3H3V L;  4Y52 K;  3RZD C;  4G7H A;  3RZO K;  4GZY A;  3GTM C;  3HOY C;  4QIW D;  3GTQ C;  1R9T K;  4XSX A;  5D4D A;  4A3K C;  2R93 C;  4A3D K;  4QIW L;  1I6H C;  3HOW K;  2B63 C;  3S1M C;  3CQZ K;  5IYC K;  3I4N C;  4BY7 K;  4Q4Z A;  3GTO K;  4A3I C;  4X6A C;  4QJV B;  2E2I C;  3FKI K;  5IYD C;  1ZYR A;  3RZD K;  2R92 K;  3PO2 C;  1Y1V C;  4OIP A;  4BXX K;  3GTM K;  1I3Q C;  3H0G C;  3HOY K;  4AYB D;  3GTQ K;  1HQM A;  3HOZ C;  3EQL A;  3GTJ C;  2R93 K;  2NVQ C;  2B63 K;  4G7Z A;  2A69 A;  3I4N K;  4KN4 A;  2VUM C;  3S1M K;  4X6A K;  2YU9 K;  3PO2 K;  5IYD K;  2CW0 A;  4A3G C;  1Y1V K;  2JA8 C;  3HOX C;  1I3Q K;  3H0G K;  1I50 C;  4KMU A;  3HOZ K;  3GTJ K;  3HKZ D;  2A6E A;  4C3J K;  2NVT C;  2NVQ K;  2VUM K;  5IYB C;  5C4J K;  2NVY C;  4OIN A;  3H3V D;  1Y1W C;  1SMY A;  4A3G K;  2Y0S D;  4ZH4 A;  5C3E C;  2PPB A;  2JA8 K;  4XLP A;  3HOX K;  3GTG C;  2Y0S L;  1I50 K;  3S14 C;  5IP9 C;  5IP7 C;  1YNJ A;  4Q5S A;  2PA8 L;  2NVT K;  4A3B C;  5IYB K;  3M4O C;  1Y1W K;  3PO3 C;  5FJ8 K;  5C3E K;  2BE5 A;  2JA6 C;  5TMF A;  3S1Q C;  1TWG C;  3GTG K;  3GTK C;  4OIQ A;  5IP9 K;  5IP7 K;  4A3K K;  1TWC C;  5TMC A;  3HOU C;  3S1N C;  4A3F C;  4A3B K;  5FLM C;  1TWH C;  1I6H K;  1I6V A;  4Y7N C;  1TWA C;  3PO3 K;  2E2J C;  4A3I K;  2E2I K;  4BXX C;  1BDF A;  2JA6 K;  3GTL C;  1TWG K;  3S1R C;  4A3M C;  3GTK K;  3S1Q K;  1TWC K;  4XSZ A;  3HOU K;  3S1N K;  4A3F K;  3S2H C;  5FLM K;  1TWH K;  4OIR A;  4Y7N K;  1TWA K;  1SFO C;  2E2J K;  4QJV A;  4YG2 A;  5C4X C;  3I4M C;  4LK0 A;  4NOI A;  2A68 A;  3GTL K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...