1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
molecule keywords GLUCOSE PERMEASE
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
3BP8C 1O2FB 3BP3A 3IPJA 1IBAA
chains in the Genus database with same CATH superfamily
1L0WA 3GTGK 1VH2A 2EBBA 4PABA 3GEIA 3FKIK 5CHPA 4GTDA 4X6AC 2JA7A 3GTGA 1I3QC 5E68A 4A3BC 3S16C 2E2IA 5EGHA 4LK1A 3HOXC 5C3EK 4ZH4A 5IP9K 5TMFA 5TMCA 1RU0A 4YG2A 3HOWC 3S14C 2E2JK 4A93K 5C44K 2JA8K 1TWHC 3GTLK 1IL2A 1I50A 3TFHA 2JA8C 1KQ4A 4BBRC 3GTQA 2XCQA 4QIWD 1YNNA 2E2JC 4A93C 4KMDA 3M4OK 3ERED 1Y1VC 4LK0A 2V6TA 3NUHA 1XZPB 4A3CC 3GEEA 1O2FB 5C3EC 3FKIA 4OIRA 2NVYA 2R7ZK 3GTPA 2GAGC 2A6HA 3OPFA 4C3IK 4DDQA 5C4JC 1R9TA 1O24A 1V5VA 3S1MK 4WJ3M 1DCPA 5C4XC 4QIWL 3HOZK 4A3CK 1Y1WA 1J6XA 4BY1K 5JVOA 4LR2A 1PJ7A 4MQ9A 4P9SA 3N0BA 4A3EK 4C3HC 3GTPK 2KWAA 1O2BA 3BUEA 1DCOA 4YFNA 2Y0SD 5L46A 4O2DA 2XCOA 2B63K 4GTLA 1WSRA 4LLGA 2GSUA 1WCMA 1I3QK 3GTKA 3M3YK 4A3LC 3HXAA 4A3GK 5M5XK 3S17C 1JVIA 3EQLA 1F7UA 3H3VD 3H0GA 4OIOA 1F7VA 4X6AK 1Y1VK 5M3MK 1JQWA 3S1NC 5IORA 3TFIA 4AYBD 2E2HK 1WIHA 1TWGK 3Q3QA 4BBRK 2E2HA 3T00A 4C2MK 3K7AC 1O26A 4KARA 2ZUFA 3LAJA 4G0VA 2NVQC 2R93A 3GTOC 1DD5A 5C44C 4A3MK 4G7OA 4GTCA 3GTJK 5IYDK 3HKZL 1TWGC 4FM9A 3HOYC 2CW0A 1BDFA 4BY1C 3RZOK 3TFJA 2E2HC 5IOTA 3T01A 1SFOK 2JA5C 2FQTA 3LAPA 1XZPA 1B4AA 1TWFK 4A3KC 4BY7C 1WQFA 3GTGC 3A8JA 3GTLA 1VLOA 2XCRB 1O2AA 4Q5SA 3M4OC 2NVYK 3S2DK 2VUMC 3AD8C 2O5JA 3PO2K 1WCMK 1O29A 4LJZA 3S1QC 3S15C 1DCHA 3ADAC 5IYBK 5FJ8K 4C45A 3GTLC 3GTMA 2YU9K 3S15K 3K7AK 3OREA 4KM9A 2P5MA 4A3FC 1EQRA 2FQOA 2V6UA 1I6VA 2VUMK 3PO3K 1J6VA 4G0WA 3IPJA 4A3KK 5TJ3A 3HOUK 1WOPA 1XXAA 3FKIC 2E2IK 4G7HA 4A3LK 2JA6K 3L4JA 1YCLA 1WOSA 2GAHC 1K83K 3HOVK 2PA8L 2B63A 1I6HK 4P5BA 3N3YA 4QJVA 1TWHK 4G0UA 5M5YK 1TWAA 4M1XA 3HOZC 2CFAA 1VRQC 3RZDK 1TWCK 1WCMC 4Q4ZA 3T02A 4KMUA 4OIPA 4GZYA 1SMYA 5C4XK 1G51A 1O28A 3H0GC 5IYCK 3I4MK 4QJVB 3FOFA 1ZYRA 3CQZC 4XSXA 1ZBSA 4C3JK 4GTAA 4MEXA 1SFOC 2JA5K 2R7ZC 2ZFZA 1EK8A 1F93A 2R93K 2RGRA 3H3VL 1USOA 3DXJA 2JA7C 3CQZA 5M3FK 5IYDC 1IS1A 4GT9A 1BGWA 1C0AA 3A8KA 5D4DA 1EFWA 3L4KA 1XXBA 1XPPA 1J98A 2GSOA 3S2DC 3V4GA 1ZVUA 2JA5A 4A3IK 1AB4A 4KN7A 1YNJA 1IW7A 1I50K 4BXXC 3WODA 1IBAA 3OEPA 3GTKK 1INNA 4XSZA 3AH5A 2A69A 4JK1A 2P8TA 5IP7C 2R92K 2WB1D 4BLAA 4A3GC 3HKZD 3M3YC 2R92C 1I50C 4Y7NK 4BXXK 1Y1VA 1UV7A 4KN4A 1WQGA 3AD7C 1B4BA 3GIRA 2ZUEA 1TWCC 2PA8D 4KB4A 1ZQ1C 3GTPC 4A3DC 4XLNA 2YU9C 4RMFA 4Y52C 1I6HC 3TTGA 3S14K 4C2MC 2WAQD 3HOVC 3PO2C 1WSVA 4LOWA 1R9TC 1J6WA 4ILDA 3SZZA 2CFAB 2NVTK 4PAAA 5JFEA 3S16K 2YU9A 4G7ZA 3CAGA 5C4JK 3AQPA 3GEHA 2JA6A 5IOSA 4A3BK 3H0GK 3AD9C 3GSIA 4J3NA 3HOUC 1TWFC 1XZQA 3BP8C 1K83A 2PHCB 1EH1A 1R9TK 3GTKC 1HI9A 2A6EA 2GSNA 1USMA 3S1RC 3FHZA 3I4NC 1JOEA 4KM8A 3RZDC 1WQHA 3S0XA 3JSTA 1TWFA 1XZQB 3GTOK 1K83C 2RH6A 4GTBA 4BBSK 4A3DK 1BJTA 3N0CA 2WAQL 2O5IA 3I4NK 3BP3A 5HL8A 5FLMK 4KATA 1IQ0A 5EGEA 2JA7K 1XXCA 1Y1WK 3S1NK 3G4CA 3HOWK 1TWAK 1VJEA 4Y7NC 2R93C 4C3JC 5IP9C 1I3QA 2E2IC 1WOOA 1O25A 1HQMA 2PPBA 3CQZK 3GTOA 1F9NA 1O27A 4A3IC 4A3FK 1SFOA 3FOEA 4OIQA 1GE9A 4YFXA 3GTJC 3S1QK 4A3MC 1EI6A 3GTQC 4C3HK 4XCHA 4GTFA 4BLBA 2NVQK 1VGXA 1TWHA 5IOQA 2VUMA 4LQYA 5M5WK 1X31C 4A3JK 2A68A 2PMZD 4WJ4A 3AQOA 4P5AA 2V6SA 3GTJA 4OINA 3VA7A 2NVYC 4NOIA 4FZBA 3GTMK 4AH6A 1PJ6A 4C3IC 4KMHA 5IYCC 3I4MC 1Y1WC 1ZXOA 4MEYA 3GTMC 3RZOC 1TWCA 2R92A 4A3JC 2NVTC 3S2HK 4GTEA 4KDDA 4BBSC 4XLPA 2BE5A 4GFQA 5IYBC 1WORA 2PMZL 2W7VA 5CJ9A 4KMAA 2NVXC 2JA6C 3S2HC 3HOXK 2D6FC 1IE0A 1YX2A 3QX3A 3S1MC 4AYBL 4BY7K 1ISEA 4KB2A 4WILA 3G4AA 5IP7K 3PO3C 2NVXA 3S17K 2B63C 3A8IA 5FLMC 3GDZA 1TWAC 1PJ5A 2NVXK 2WB1L 4KC6A 2JH3A 4YFKA 1BS2A 3HOYK 2Y0SL 3SZYA 2Y3PA 2R7ZA 3GTQK 3MMLB 3LPXA 1TWGA 4Y52K 4A3EC 4KAWX 4KASA 3S1RK 4BKWA
chains in the Genus database with same CATH topology
3BP8C 1O2FB 3BP3A 3IPJA 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 C;  1O2F B;  3BP3 A;  3IPJ A;  1IBA A; 
#chains in the Genus database with same CATH topology
 1L0W A;  3GTG K;  1VH2 A;  2EBB A;  4PAB A;  3GEI A;  3FKI K;  5CHP A;  4GTD A;  4X6A C;  2JA7 A;  3GTG A;  1I3Q C;  5E68 A;  4A3B C;  3S16 C;  2E2I A;  5EGH A;  4LK1 A;  3HOX C;  5C3E K;  4ZH4 A;  5IP9 K;  5TMF A;  5TMC A;  1RU0 A;  4YG2 A;  3HOW C;  3S14 C;  2E2J K;  4A93 K;  5C44 K;  2JA8 K;  1TWH C;  3GTL K;  1IL2 A;  1I50 A;  3TFH A;  2JA8 C;  1KQ4 A;  4BBR C;  3GTQ A;  2XCQ A;  4QIW D;  1YNN A;  2E2J C;  4A93 C;  4KMD A;  3M4O K;  3ERE D;  1Y1V C;  4LK0 A;  2V6T A;  3NUH A;  1XZP B;  4A3C C;  3GEE A;  1O2F B;  5C3E C;  3FKI A;  4OIR A;  2NVY A;  2R7Z K;  3GTP A;  2GAG C;  2A6H A;  3OPF A;  4C3I K;  4DDQ A;  5C4J C;  1R9T A;  1O24 A;  1V5V A;  3S1M K;  4WJ3 M;  1DCP A;  5C4X C;  4QIW L;  3HOZ K;  4A3C K;  1Y1W A;  1J6X A;  4BY1 K;  5JVO A;  4LR2 A;  1PJ7 A;  4MQ9 A;  4P9S A;  3N0B A;  4A3E K;  4C3H C;  3GTP K;  2KWA A;  1O2B A;  3BUE A;  1DCO A;  4YFN A;  2Y0S D;  5L46 A;  4O2D A;  2XCO A;  2B63 K;  4GTL A;  1WSR A;  4LLG A;  2GSU A;  1WCM A;  1I3Q K;  3GTK A;  3M3Y K;  4A3L C;  3HXA A;  4A3G K;  5M5X K;  3S17 C;  1JVI A;  3EQL A;  1F7U A;  3H3V D;  3H0G A;  4OIO A;  1F7V A;  4X6A K;  1Y1V K;  5M3M K;  1JQW A;  3S1N C;  5IOR A;  3TFI A;  4AYB D;  2E2H K;  1WIH A;  1TWG K;  3Q3Q A;  4BBR K;  2E2H A;  3T00 A;  4C2M K;  3K7A C;  1O26 A;  4KAR A;  2ZUF A;  3LAJ A;  4G0V A;  2NVQ C;  2R93 A;  3GTO C;  1DD5 A;  5C44 C;  4A3M K;  4G7O A;  4GTC A;  3GTJ K;  5IYD K;  3HKZ L;  1TWG C;  4FM9 A;  3HOY C;  2CW0 A;  1BDF A;  4BY1 C;  3RZO K;  3TFJ A;  2E2H C;  5IOT A;  3T01 A;  1SFO K;  2JA5 C;  2FQT A;  3LAP A;  1XZP A;  1B4A A;  1TWF K;  4A3K C;  4BY7 C;  1WQF A;  3GTG C;  3A8J A;  3GTL A;  1VLO A;  2XCR B;  1O2A A;  4Q5S A;  3M4O C;  2NVY K;  3S2D K;  2VUM C;  3AD8 C;  2O5J A;  3PO2 K;  1WCM K;  1O29 A;  4LJZ A;  3S1Q C;  3S15 C;  1DCH A;  3ADA C;  5IYB K;  5FJ8 K;  4C45 A;  3GTL C;  3GTM A;  2YU9 K;  3S15 K;  3K7A K;  3ORE A;  4KM9 A;  2P5M A;  4A3F C;  1EQR A;  2FQO A;  2V6U A;  1I6V A;  2VUM K;  3PO3 K;  1J6V A;  4G0W A;  3IPJ A;  4A3K K;  5TJ3 A;  3HOU K;  1WOP A;  1XXA A;  3FKI C;  2E2I K;  4G7H A;  4A3L K;  2JA6 K;  3L4J A;  1YCL A;  1WOS A;  2GAH C;  1K83 K;  3HOV K;  2PA8 L;  2B63 A;  1I6H K;  4P5B A;  3N3Y A;  4QJV A;  1TWH K;  4G0U A;  5M5Y K;  1TWA A;  4M1X A;  3HOZ C;  2CFA A;  1VRQ C;  3RZD K;  1TWC K;  1WCM C;  4Q4Z A;  3T02 A;  4KMU A;  4OIP A;  4GZY A;  1SMY A;  5C4X K;  1G51 A;  1O28 A;  3H0G C;  5IYC K;  3I4M K;  4QJV B;  3FOF A;  1ZYR A;  3CQZ C;  4XSX A;  1ZBS A;  4C3J K;  4GTA A;  4MEX A;  1SFO C;  2JA5 K;  2R7Z C;  2ZFZ A;  1EK8 A;  1F93 A;  2R93 K;  2RGR A;  3H3V L;  1USO A;  3DXJ A;  2JA7 C;  3CQZ A;  5M3F K;  5IYD C;  1IS1 A;  4GT9 A;  1BGW A;  1C0A A;  3A8K A;  5D4D A;  1EFW A;  3L4K A;  1XXB A;  1XPP A;  1J98 A;  2GSO A;  3S2D C;  3V4G A;  1ZVU A;  2JA5 A;  4A3I K;  1AB4 A;  4KN7 A;  1YNJ A;  1IW7 A;  1I50 K;  4BXX C;  3WOD A;  1IBA A;  3OEP A;  3GTK K;  1INN A;  4XSZ A;  3AH5 A;  2A69 A;  4JK1 A;  2P8T A;  5IP7 C;  2R92 K;  2WB1 D;  4BLA A;  4A3G C;  3HKZ D;  3M3Y C;  2R92 C;  1I50 C;  4Y7N K;  4BXX K;  1Y1V A;  1UV7 A;  4KN4 A;  1WQG A;  3AD7 C;  1B4B A;  3GIR A;  2ZUE A;  1TWC C;  2PA8 D;  4KB4 A;  1ZQ1 C;  3GTP C;  4A3D C;  4XLN A;  2YU9 C;  4RMF A;  4Y52 C;  1I6H C;  3TTG A;  3S14 K;  4C2M C;  2WAQ D;  3HOV C;  3PO2 C;  1WSV A;  4LOW A;  1R9T C;  1J6W A;  4ILD A;  3SZZ A;  2CFA B;  2NVT K;  4PAA A;  5JFE A;  3S16 K;  2YU9 A;  4G7Z A;  3CAG A;  5C4J K;  3AQP A;  3GEH A;  2JA6 A;  5IOS A;  4A3B K;  3H0G K;  3AD9 C;  3GSI A;  4J3N A;  3HOU C;  1TWF C;  1XZQ A;  3BP8 C;  1K83 A;  2PHC B;  1EH1 A;  1R9T K;  3GTK C;  1HI9 A;  2A6E A;  2GSN A;  1USM A;  3S1R C;  3FHZ A;  3I4N C;  1JOE A;  4KM8 A;  3RZD C;  1WQH A;  3S0X A;  3JST A;  1TWF A;  1XZQ B;  3GTO K;  1K83 C;  2RH6 A;  4GTB A;  4BBS K;  4A3D K;  1BJT A;  3N0C A;  2WAQ L;  2O5I A;  3I4N K;  3BP3 A;  5HL8 A;  5FLM K;  4KAT A;  1IQ0 A;  5EGE A;  2JA7 K;  1XXC A;  1Y1W K;  3S1N K;  3G4C A;  3HOW K;  1TWA K;  1VJE A;  4Y7N C;  2R93 C;  4C3J C;  5IP9 C;  1I3Q A;  2E2I C;  1WOO A;  1O25 A;  1HQM A;  2PPB A;  3CQZ K;  3GTO A;  1F9N A;  1O27 A;  4A3I C;  4A3F K;  1SFO A;  3FOE A;  4OIQ A;  1GE9 A;  4YFX A;  3GTJ C;  3S1Q K;  4A3M C;  1EI6 A;  3GTQ C;  4C3H K;  4XCH A;  4GTF A;  4BLB A;  2NVQ K;  1VGX A;  1TWH A;  5IOQ A;  2VUM A;  4LQY A;  5M5W K;  1X31 C;  4A3J K;  2A68 A;  2PMZ D;  4WJ4 A;  3AQO A;  4P5A A;  2V6S A;  3GTJ A;  4OIN A;  3VA7 A;  2NVY C;  4NOI A;  4FZB A;  3GTM K;  4AH6 A;  1PJ6 A;  4C3I C;  4KMH A;  5IYC C;  3I4M C;  1Y1W C;  1ZXO A;  4MEY A;  3GTM C;  3RZO C;  1TWC A;  2R92 A;  4A3J C;  2NVT C;  3S2H K;  4GTE A;  4KDD A;  4BBS C;  4XLP A;  2BE5 A;  4GFQ A;  5IYB C;  1WOR A;  2PMZ L;  2W7V A;  5CJ9 A;  4KMA A;  2NVX C;  2JA6 C;  3S2H C;  3HOX K;  2D6F C;  1IE0 A;  1YX2 A;  3QX3 A;  3S1M C;  4AYB L;  4BY7 K;  1ISE A;  4KB2 A;  4WIL A;  3G4A A;  5IP7 K;  3PO3 C;  2NVX A;  3S17 K;  2B63 C;  3A8I A;  5FLM C;  3GDZ A;  1TWA C;  1PJ5 A;  2NVX K;  2WB1 L;  4KC6 A;  2JH3 A;  4YFK A;  1BS2 A;  3HOY K;  2Y0S L;  3SZY A;  2Y3P A;  2R7Z A;  3GTQ K;  3MML B;  3LPX A;  1TWG A;  4Y52 K;  4A3E C;  4KAW X;  4KAS A;  3S1R K;  4BKW A; 
#chains in the Genus database with same CATH homology
 3BP8 C;  1O2F B;  3BP3 A;  3IPJ A;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...