1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE PERMEASE
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
3BP3A 1O2FB 3IPJA 3BP8C 1IBAA
chains in the Genus database with same CATH superfamily
1J6WA 1RU0A 5TJ3A 3H3VL 1TWCC 3GTKK 4G0WA 2R7ZA 1K83K 3K7AK 3HXAA 5C44C 2NVQC 3EQLA 5IYCC 2E2IK 3S2HK 3RZDC 1R9TC 1KQ4A 2A69A 2A6EA 3GTQA 3HOWC 4MEXA 1SFOK 4P5AA 3GTLK 2R7ZC 4WJ4A 1YX2A 4GT9A 2P8TA 5C4XK 2NVXK 2D6FC 3CQZA 3GIRA 1AB4A 3QX3A 1TWAA 1O26A 5L46A 5C3EK 3GTQC 4GTDA 3FKIA 4ILDA 4O2DA 4BXXK 4C3HC 1WQFA 3H0GK 1F93A 1O25A 3M3YK 3FKIC 1IS1A 3S1MC 2PMZD 4WILA 4A3JC 1F7UA 4PAAA 4A3IK 2E2JK 3PO3C 4KMAA 2FQOA 1BGWA 3S2DK 4Q5SA 1WSRA 4KB4A 3VA7A 5FLMK 2V6TA 2JA6C 4A93C 1X31C 3JSTA 3AD7C 1HI9A 1USMA 4G7ZA 1O24A 2JH3A 4LK0A 3CAGA 4LR2A 3TFIA 3GTGK 4A3KK 3GTOK 5EGEA 4A3BC 3GSIA 1BDFA 4A3CK 3S17C 1XXAA 1YCLA 4MQ9A 4BKWA 3A8JA 5HL8A 1WCMK 2R93C 2CFAB 1DCHA 2VUMK 2GAGC 4A3FK 1YNNA 4X6AC 3G4AA 3AH5A 5CHPA 3V4GA 1JVIA 4OIOA 5M5YK 1B4BA 2R92K 1WORA 3HOZC 3S1NC 1EFWA 1USOA 2Y0SD 3Q3QA 3PO2C 4BY7C 3L4KA 4GZYA 3RZOC 4GTLA 1I6HK 4A3GC 4XSXA 5C4JK 3I4NK 3GTKA 2B63K 3OREA 4BBSK 1K83A 1I50C 1ZVUA 4J3NA 2ZUEA 4KDDA 4AYBD 1XPPA 3BP3A 2YU9K 4LLGA 3GTKC 1SFOA 1VH2A 1VJEA 4LJZA 1K83C 4KASA 4RMFA 4C2MK 2NVXA 3BUEA 4P9SA 2E2IC 4FM9A 5IP9K 4YFXA 4A3MK 2JA7C 4GTFA 1SFOC 3GTLC 1Y1WK 3HOYK 4C45A 3HOUK 2CFAA 2NVXC 1DD5A 4FZBA 2EBBA 3GTPK 4XCHA 1TWGK 3H0GA 1VRQC 3GTMK 1IE0A 2NVTK 1IW7A 3S0XA 4BXXC 2JA5A 4C3IK 3S1RC 3H0GC 1O28A 1V5VA 4P5BA 3SZZA 3GEIA 3S16K 2PMZL 1O29A 3M3YC 4JK1A 3LAPA 4Y7NK 2KWAA 3GEHA 2GAHC 3I4MK 1IL2A 4A3IC 4KATA 4WJ3M 3S2DC 4AH6A 4M1XA 1ZBSA 3G4CA 2PHCB 4KMHA 1IBAA 3GTGA 3GTOA 2GSOA 3HOXK 3GEEA 2WB1D 4C3JC 4LK1A 3BP8C 3CQZC 3L4JA 1WCMA 1TWAC 1TWHK 4QIWD 4BBRK 3GTGC 2WAQD 4A3KC 3GTOC 2VUMA 4A3CC 4G7OA 2JA5K 1WSVA 1WCMC 4YFKA 1Y1VK 2R92A 2JA8K 3OPFA 4KMDA 4KC6A 1EI6A 2ZUFA 1BS2A 4DDQA 4NOIA 3M4OK 5D4DA 2Y0SL 1XZPB 4A3LK 4KM8A 1ZYRA 2B63A 4KM9A 2O5IA 3FOEA 4BY1K 1SMYA 1I6HC 3RZDK 3IPJA 1R9TK 2YU9A 1I3QK 5C4JC 3HKZD 3I4NC 1WIHA 2B63C 4KB2A 1O2FB 5FJ8K 1J6XA 5EGHA 3ERED 2E2HK 1EQRA 3T00A 3AQPA 2YU9C 1DCOA 1J98A 3N0BA 1O2BA 1Y1WA 3HOVK 4A3DK 2RH6A 4C2MC 1YNJA 4GTEA 3GTPA 1TWGA 5IP9C 4A3MC 1F7VA 4YFNA 3GTMA 2GSUA 1Y1WC 1XXBA 3HOYC 3HOUC 2PA8D 3GTPC 1EK8A 1TWGC 3SZYA 5IP7K 1IQ0A 5CJ9A 4OIRA 4A3EK 2NVTC 1O27A 4KN4A 5JFEA 1XZPA 2JA6K 2CW0A 3S16C 4BLBA 1I6VA 3K7AC 4Y7NC 4QJVA 3S2HC 5E68A 3WODA 4A3BK 3MMLB 1TWFK 1BJTA 2A6HA 1EH1A 5M5XK 5C4XC 3TFJA 4GFQA 3AD9C 1TWHA 1J6VA 1PJ5A 4G7HA 5IYDK 4Y52K 5C3EC 1VGXA 4BLAA 2WAQL 1GE9A 3HOZK 3S1NK 1Y1VA 1JOEA 2P5MA 3S14K 1ZQ1C 4G0UA 2JA5C 2XCQA 5M3FK 1Y1VC 4A3GK 1XZQA 2A68A 5TMCA 2E2JC 2JA8C 4XLNA 1O2AA 3GTJK 3M4OC 5FLMC 3ADAC 1R9TA 4A3LC 1PJ7A 5M3MK 1I3QA 1XXCA 5IOTA 4KN7A 4BY1C 2E2HA 3HKZL 2JA7K 4Q4ZA 1I3QC 4OIPA 5IYBK 4YG2A 1G51A 2E2HC 3FOFA 3A8IA 2VUMC 2NVYK 4A3FC 3S15K 3S1QK 3NUHA 1WOSA 2GSNA 4A3JK 3HOVC 1F9NA 4A3DC 2XCRB 3A8KA 3AD8C 1JQWA 3S1RK 4G0VA 2R92C 1TWCK 2PA8L 1INNA 3N3YA 4KARA 4KMUA 3H3VD 3OEPA 4OINA 5C44K 2NVQK 5IYCK 2FQTA 2Y3PA 4QJVB 2JA6A 5IP7C 3HOWK 2R7ZK 4A3EC 4AYBL 4BBSC 4KAWX 2O5JA 4XLPA 1C0AA 3GTQK 3GDZA 1WOPA 2XCOA 2PPBA 5M5WK 1TWFA 1DCPA 4C3JK 5IOSA 4C3HK 3CQZK 4MEYA 1TWAK 3T01A 1VLOA 2R93A 4GTCA 3T02A 1TWFC 4LQYA 3FKIK 3S1MK 4OIQA 3AQOA 4XSZA 1PJ6A 1B4AA 5IYDC 3DXJA 4LOWA 4Y52C 3GTMC 3PO3K 1XZQB 5IORA 4C3IC 2V6SA 1HQMA 4A93K 3LPXA 5TMFA 1WQGA 3S14C 1I50A 3GTJA 3I4MC 4ZH4A 3S17K 1L0WA 3GTJC 1UV7A 2WB1L 2R93K 3FHZA 2E2IA 4GTAA 3LAJA 3HOXC 2JA7A 4X6AK 1ZXOA 3TFHA 4QIWL 3GTLA 1TWHC 3N0CA 3TTGA 4BBRC 2BE5A 1ISEA 1WOOA 2NVYA 2RGRA 2ZFZA 1WQHA 5IYBC 3PO2K 4BY7K 2V6UA 3RZOK 2W7VA 2NVYC 1TWCA 3S15C 5JVOA 3S1QC 4PABA 1I50K 5IOQA 4GTBA
chains in the Genus database with same CATH topology
3BP3A 1O2FB 3IPJA 3BP8C 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP3 A;  1O2F B;  3IPJ A;  3BP8 C;  1IBA A; 
#chains in the Genus database with same CATH topology
 1J6W A;  1RU0 A;  5TJ3 A;  3H3V L;  1TWC C;  3GTK K;  4G0W A;  2R7Z A;  1K83 K;  3K7A K;  3HXA A;  5C44 C;  2NVQ C;  3EQL A;  5IYC C;  2E2I K;  3S2H K;  3RZD C;  1R9T C;  1KQ4 A;  2A69 A;  2A6E A;  3GTQ A;  3HOW C;  4MEX A;  1SFO K;  4P5A A;  3GTL K;  2R7Z C;  4WJ4 A;  1YX2 A;  4GT9 A;  2P8T A;  5C4X K;  2NVX K;  2D6F C;  3CQZ A;  3GIR A;  1AB4 A;  3QX3 A;  1TWA A;  1O26 A;  5L46 A;  5C3E K;  3GTQ C;  4GTD A;  3FKI A;  4ILD A;  4O2D A;  4BXX K;  4C3H C;  1WQF A;  3H0G K;  1F93 A;  1O25 A;  3M3Y K;  3FKI C;  1IS1 A;  3S1M C;  2PMZ D;  4WIL A;  4A3J C;  1F7U A;  4PAA A;  4A3I K;  2E2J K;  3PO3 C;  4KMA A;  2FQO A;  1BGW A;  3S2D K;  4Q5S A;  1WSR A;  4KB4 A;  3VA7 A;  5FLM K;  2V6T A;  2JA6 C;  4A93 C;  1X31 C;  3JST A;  3AD7 C;  1HI9 A;  1USM A;  4G7Z A;  1O24 A;  2JH3 A;  4LK0 A;  3CAG A;  4LR2 A;  3TFI A;  3GTG K;  4A3K K;  3GTO K;  5EGE A;  4A3B C;  3GSI A;  1BDF A;  4A3C K;  3S17 C;  1XXA A;  1YCL A;  4MQ9 A;  4BKW A;  3A8J A;  5HL8 A;  1WCM K;  2R93 C;  2CFA B;  1DCH A;  2VUM K;  2GAG C;  4A3F K;  1YNN A;  4X6A C;  3G4A A;  3AH5 A;  5CHP A;  3V4G A;  1JVI A;  4OIO A;  5M5Y K;  1B4B A;  2R92 K;  1WOR A;  3HOZ C;  3S1N C;  1EFW A;  1USO A;  2Y0S D;  3Q3Q A;  3PO2 C;  4BY7 C;  3L4K A;  4GZY A;  3RZO C;  4GTL A;  1I6H K;  4A3G C;  4XSX A;  5C4J K;  3I4N K;  3GTK A;  2B63 K;  3ORE A;  4BBS K;  1K83 A;  1I50 C;  1ZVU A;  4J3N A;  2ZUE A;  4KDD A;  4AYB D;  1XPP A;  3BP3 A;  2YU9 K;  4LLG A;  3GTK C;  1SFO A;  1VH2 A;  1VJE A;  4LJZ A;  1K83 C;  4KAS A;  4RMF A;  4C2M K;  2NVX A;  3BUE A;  4P9S A;  2E2I C;  4FM9 A;  5IP9 K;  4YFX A;  4A3M K;  2JA7 C;  4GTF A;  1SFO C;  3GTL C;  1Y1W K;  3HOY K;  4C45 A;  3HOU K;  2CFA A;  2NVX C;  1DD5 A;  4FZB A;  2EBB A;  3GTP K;  4XCH A;  1TWG K;  3H0G A;  1VRQ C;  3GTM K;  1IE0 A;  2NVT K;  1IW7 A;  3S0X A;  4BXX C;  2JA5 A;  4C3I K;  3S1R C;  3H0G C;  1O28 A;  1V5V A;  4P5B A;  3SZZ A;  3GEI A;  3S16 K;  2PMZ L;  1O29 A;  3M3Y C;  4JK1 A;  3LAP A;  4Y7N K;  2KWA A;  3GEH A;  2GAH C;  3I4M K;  1IL2 A;  4A3I C;  4KAT A;  4WJ3 M;  3S2D C;  4AH6 A;  4M1X A;  1ZBS A;  3G4C A;  2PHC B;  4KMH A;  1IBA A;  3GTG A;  3GTO A;  2GSO A;  3HOX K;  3GEE A;  2WB1 D;  4C3J C;  4LK1 A;  3BP8 C;  3CQZ C;  3L4J A;  1WCM A;  1TWA C;  1TWH K;  4QIW D;  4BBR K;  3GTG C;  2WAQ D;  4A3K C;  3GTO C;  2VUM A;  4A3C C;  4G7O A;  2JA5 K;  1WSV A;  1WCM C;  4YFK A;  1Y1V K;  2R92 A;  2JA8 K;  3OPF A;  4KMD A;  4KC6 A;  1EI6 A;  2ZUF A;  1BS2 A;  4DDQ A;  4NOI A;  3M4O K;  5D4D A;  2Y0S L;  1XZP B;  4A3L K;  4KM8 A;  1ZYR A;  2B63 A;  4KM9 A;  2O5I A;  3FOE A;  4BY1 K;  1SMY A;  1I6H C;  3RZD K;  3IPJ A;  1R9T K;  2YU9 A;  1I3Q K;  5C4J C;  3HKZ D;  3I4N C;  1WIH A;  2B63 C;  4KB2 A;  1O2F B;  5FJ8 K;  1J6X A;  5EGH A;  3ERE D;  2E2H K;  1EQR A;  3T00 A;  3AQP A;  2YU9 C;  1DCO A;  1J98 A;  3N0B A;  1O2B A;  1Y1W A;  3HOV K;  4A3D K;  2RH6 A;  4C2M C;  1YNJ A;  4GTE A;  3GTP A;  1TWG A;  5IP9 C;  4A3M C;  1F7V A;  4YFN A;  3GTM A;  2GSU A;  1Y1W C;  1XXB A;  3HOY C;  3HOU C;  2PA8 D;  3GTP C;  1EK8 A;  1TWG C;  3SZY A;  5IP7 K;  1IQ0 A;  5CJ9 A;  4OIR A;  4A3E K;  2NVT C;  1O27 A;  4KN4 A;  5JFE A;  1XZP A;  2JA6 K;  2CW0 A;  3S16 C;  4BLB A;  1I6V A;  3K7A C;  4Y7N C;  4QJV A;  3S2H C;  5E68 A;  3WOD A;  4A3B K;  3MML B;  1TWF K;  1BJT A;  2A6H A;  1EH1 A;  5M5X K;  5C4X C;  3TFJ A;  4GFQ A;  3AD9 C;  1TWH A;  1J6V A;  1PJ5 A;  4G7H A;  5IYD K;  4Y52 K;  5C3E C;  1VGX A;  4BLA A;  2WAQ L;  1GE9 A;  3HOZ K;  3S1N K;  1Y1V A;  1JOE A;  2P5M A;  3S14 K;  1ZQ1 C;  4G0U A;  2JA5 C;  2XCQ A;  5M3F K;  1Y1V C;  4A3G K;  1XZQ A;  2A68 A;  5TMC A;  2E2J C;  2JA8 C;  4XLN A;  1O2A A;  3GTJ K;  3M4O C;  5FLM C;  3ADA C;  1R9T A;  4A3L C;  1PJ7 A;  5M3M K;  1I3Q A;  1XXC A;  5IOT A;  4KN7 A;  4BY1 C;  2E2H A;  3HKZ L;  2JA7 K;  4Q4Z A;  1I3Q C;  4OIP A;  5IYB K;  4YG2 A;  1G51 A;  2E2H C;  3FOF A;  3A8I A;  2VUM C;  2NVY K;  4A3F C;  3S15 K;  3S1Q K;  3NUH A;  1WOS A;  2GSN A;  4A3J K;  3HOV C;  1F9N A;  4A3D C;  2XCR B;  3A8K A;  3AD8 C;  1JQW A;  3S1R K;  4G0V A;  2R92 C;  1TWC K;  2PA8 L;  1INN A;  3N3Y A;  4KAR A;  4KMU A;  3H3V D;  3OEP A;  4OIN A;  5C44 K;  2NVQ K;  5IYC K;  2FQT A;  2Y3P A;  4QJV B;  2JA6 A;  5IP7 C;  3HOW K;  2R7Z K;  4A3E C;  4AYB L;  4BBS C;  4KAW X;  2O5J A;  4XLP A;  1C0A A;  3GTQ K;  3GDZ A;  1WOP A;  2XCO A;  2PPB A;  5M5W K;  1TWF A;  1DCP A;  4C3J K;  5IOS A;  4C3H K;  3CQZ K;  4MEY A;  1TWA K;  3T01 A;  1VLO A;  2R93 A;  4GTC A;  3T02 A;  1TWF C;  4LQY A;  3FKI K;  3S1M K;  4OIQ A;  3AQO A;  4XSZ A;  1PJ6 A;  1B4A A;  5IYD C;  3DXJ A;  4LOW A;  4Y52 C;  3GTM C;  3PO3 K;  1XZQ B;  5IOR A;  4C3I C;  2V6S A;  1HQM A;  4A93 K;  3LPX A;  5TMF A;  1WQG A;  3S14 C;  1I50 A;  3GTJ A;  3I4M C;  4ZH4 A;  3S17 K;  1L0W A;  3GTJ C;  1UV7 A;  2WB1 L;  2R93 K;  3FHZ A;  2E2I A;  4GTA A;  3LAJ A;  3HOX C;  2JA7 A;  4X6A K;  1ZXO A;  3TFH A;  4QIW L;  3GTL A;  1TWH C;  3N0C A;  3TTG A;  4BBR C;  2BE5 A;  1ISE A;  1WOO A;  2NVY A;  2RGR A;  2ZFZ A;  1WQH A;  5IYB C;  3PO2 K;  4BY7 K;  2V6U A;  3RZO K;  2W7V A;  2NVY C;  1TWC A;  3S15 C;  5JVO A;  3S1Q C;  4PAB A;  1I50 K;  5IOQ A;  4GTB A; 
#chains in the Genus database with same CATH homology
 3BP3 A;  1O2F B;  3IPJ A;  3BP8 C;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...