1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
molecule keywords GLUCOSE PERMEASE
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
3BP8C 3BP3A 3IPJA 1O2FB 1IBAA
chains in the Genus database with same CATH superfamily
1WOOA 4A3KK 1F7UA 3FOEA 2NVQK 4YFXA 3GTPK 1GE9A 2JA7K 3LPXA 4BY1C 4A3BC 4GTCA 1XZQB 1ZVUA 3I4NK 4LOWA 4G0WA 3S16K 1J6WA 3T01A 3GTGA 3I4MC 1R9TK 3S2HK 3GDZA 3K7AC 1WSVA 3HXAA 2YU9K 2CFAA 1XPPA 2JA8K 3MMLB 1Y1WA 3H0GA 3HOXK 4OIRA 2NVTK 1F9NA 2R93C 2JA6A 3GTJK 3GTMK 4A3MC 4G0VA 2R92C 1ZYRA 1XZPA 1HI9A 3HKZL 3ADAC 3BP8C 3G4CA 2GAGC 3ERED 1IQ0A 4LJZA 3PO3C 3HOWK 3M3YC 2GSNA 1I6VA 3AD8C 2NVXC 2B63K 1EFWA 3S1RC 2R7ZC 2GAHC 3EQLA 1BGWA 1TWAK 4Y7NK 3S1MK 5IYDK 4KMAA 4XLNA 2NVYA 3GTKA 4LQYA 4YFKA 1TWGC 4GTDA 2XCRB 2R93A 1Y1WC 4C2MK 4BBSC 2WAQD 2A68A 4G7ZA 4A3EC 4A3GK 1ISEA 1JVIA 1XZQA 4KDDA 1PJ6A 4C3IC 3GTGC 3HOZK 4A3LC 4OIQA 2WB1L 1IS1A 1K83C 4KB2A 4XLPA 1UV7A 1SFOC 3S0XA 3AQPA 4OIPA 4KN7A 1O28A 4J3NA 2A6EA 4LR2A 1J6VA 3FKIC 5TJ3A 3PO3K 4MQ9A 2D6FC 4A3DK 5FJ8K 3GTOA 2E2IA 1V5VA 1B4BA 4A3FK 1R9TA 2R92K 3GTMC 1HQMA 4PABA 1I50C 2P5MA 2ZFZA 1I3QC 2JA5K 1WQFA 4G0UA 1YNNA 4A3DC 1I6HC 1IE0A 5IYCC 1WOSA 4GT9A 5TMFA 2E2JK 4GZYA 1DCOA 4Y52K 3I4NC 4QJVB 3S17C 2Y0SL 4NOIA 5C3EC 4FM9A 2V6UA 4WJ3M 1ZQ1C 3DXJA 3GEHA 3GTPC 4A3JC 3GEEA 4WILA 3TTGA 3GTGK 3M4OK 3A8KA 3IPJA 1DCHA 3HOVK 3A8JA 1USMA 5IOQA 2GSUA 1Y1WK 2VUMK 1SMYA 1X31C 3HOUK 4ILDA 4BBRK 1SFOA 4KC6A 3T02A 3AH5A 5IYDC 3S1MC 5JVOA 4Y7NC 3RZOK 1INNA 4C3HC 5IP7K 5C4XC 3RZOC 5L46A 2WB1D 3JSTA 5D4DA 1TWFC 3S1NK 1BJTA 1G51A 4YG2A 1O27A 4BBRC 1TWCK 3HOUC 4C45A 1PJ7A 2Y3PA 1ZBSA 2VUMC 1XXCA 2GSOA 1DCPA 1PJ5A 1L0WA 1TWAA 1O2FB 5C44K 3OEPA 5IORA 3GTQC 1XXAA 3M4OC 3S1QC 4A3JK 2NVTC 3HOXC 2R93K 1O25A 3SZZA 1O29A 3G4AA 3OREA 4KB4A 5HL8A 2YU9C 5C3EK 2RH6A 3GSIA 3H0GC 2JA6C 1R9TC 3T00A 4JK1A 5CJ9A 2JA5A 1O26A 1EI6A 2FQTA 4Y52C 1WIHA 1JQWA 2ZUEA 3GTLC 3HKZD 3WODA 3S16C 4G7HA 3GTLK 3L4KA 4KMUA 3RZDC 3Q3QA 4G7OA 4XCHA 1VJEA 1KQ4A 1XZPB 1I3QK 4GTAA 1I50K 1WORA 2NVQC 3S1QK 2E2HA 4DDQA 1WCMA 2P8TA 4A3FC 3CQZA 1IBAA 4BLAA 5M5XK 3S15C 3GTOK 5C4JK 4WJ4A 2E2IK 5IYBK 1IL2A 3QX3A 3V4GA 2R92A 4BLBA 3FKIK 4OIOA 1WQGA 1TWCC 2WAQL 2Y0SD 1XXBA 1WOPA 4BKWA 1TWFK 5FLMC 2NVXA 3LAPA 1USOA 1SFOK 3N0BA 3FHZA 4KM8A 1C0AA 4BY7C 2FQOA 3CQZC 3S14K 3CAGA 4FZBA 5EGHA 4C3JC 4Q5SA 1TWHK 4XSZA 3HOZC 1VRQC 3BUEA 5IP9C 4A3EK 1Y1VC 2A69A 3HOVC 5IOSA 4KMDA 4C2MC 4BBSK 2CW0A 5E68A 1TWGK 4AH6A 1O2BA 1VLOA 2O5IA 2R7ZA 4XSXA 4LK1A 1TWAC 2BE5A 3S17K 2VUMA 4GTFA 5TMCA 4YFNA 3TFJA 2W7VA 4ZH4A 2NVYC 3H3VL 2B63C 2E2JC 4P9SA 1F93A 5IYCK 4KASA 4OINA 4QIWL 3HOWC 3M3YK 3GTQA 1I6HK 1WCMC 2PHCB 2E2HC 3GEIA 2JA5C 4A3MK 4KN4A 2JA7A 1TWCA 1Y1VK 4Q4ZA 1IW7A 3GTJC 3LAJA 3NUHA 1YCLA 1I3QA 4LLGA 4A93K 4P5AA 1ZXOA 1B4AA 3H3VD 1TWHC 4PAAA 4C3JK 3S2HC 3I4MK 3CQZK 3S14C 4BY7K 2XCOA 1VGXA 2JH3A 4RMFA 4MEYA 4X6AK 4P5BA 1YX2A 2YU9A 2RGRA 4M1XA 3A8IA 5FLMK 4KMHA 4X6AC 2V6TA 1K83K 3GTJA 4BY1K 4A3BK 5M5YK 2O5JA 2JA7C 3GTMA 4QJVA 1J6XA 5EGEA 3SZYA 5C4JC 2E2IC 4A3LK 3GTOC 3GTLA 1WQHA 4A93C 4MEXA 4C3IK 1J98A 4GTEA 3GTPA 4LK0A 4A3GC 1EH1A 4A3IC 2B63A 4GTLA 1O2AA 1I50A 2EBBA 3AD7C 3FOFA 2XCQA 2E2HK 3VA7A 1WCMK 3PO2K 1BDFA 1TWGA 4BXXK 3RZDK 2PA8D 1WSRA 1EK8A 2PMZD 1O24A 3S2DK 2NVYK 1BS2A 3GTKK 2R7ZK 3AD9C 3FKIA 3S1RK 5M5WK 1TWFA 3H0GK 2NVXK 2JA6K 4AYBD 3HOYK 3L4JA 4A3CC 2A6HA 3N3YA 2ZUFA 4KARA 3BP3A 1DD5A 3GTQK 3N0CA 2PA8L 5C44C 1TWHA 2PMZL 1AB4A 5IP9K 2CFAB 1RU0A 5M3MK 4A3CK 2JA8C 3OPFA 1JOEA 1Y1VA 3HOYC 1EQRA 4KM9A 2PPBA 3K7AK 4AYBL 3S1NC 4KATA 5M3FK 4O2DA 4QIWD 5IOTA 3GTKC 4GTBA 1VH2A 2V6SA 5C4XK 5IP7C 3S2DC 4C3HK 5CHPA 4BXXC 4GFQA 3PO2C 3TFHA 1F7VA 2KWAA 4A3IK 5IYBC 1K83A 4A3KC 3S15K 3GIRA 1YNJA 5JFEA 4KAWX 3AQOA 3TFIA
chains in the Genus database with same CATH topology
3BP8C 3BP3A 3IPJA 1O2FB 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 C;  3BP3 A;  3IPJ A;  1O2F B;  1IBA A; 
#chains in the Genus database with same CATH topology
 1WOO A;  4A3K K;  1F7U A;  3FOE A;  2NVQ K;  4YFX A;  3GTP K;  1GE9 A;  2JA7 K;  3LPX A;  4BY1 C;  4A3B C;  4GTC A;  1XZQ B;  1ZVU A;  3I4N K;  4LOW A;  4G0W A;  3S16 K;  1J6W A;  3T01 A;  3GTG A;  3I4M C;  1R9T K;  3S2H K;  3GDZ A;  3K7A C;  1WSV A;  3HXA A;  2YU9 K;  2CFA A;  1XPP A;  2JA8 K;  3MML B;  1Y1W A;  3H0G A;  3HOX K;  4OIR A;  2NVT K;  1F9N A;  2R93 C;  2JA6 A;  3GTJ K;  3GTM K;  4A3M C;  4G0V A;  2R92 C;  1ZYR A;  1XZP A;  1HI9 A;  3HKZ L;  3ADA C;  3BP8 C;  3G4C A;  2GAG C;  3ERE D;  1IQ0 A;  4LJZ A;  3PO3 C;  3HOW K;  3M3Y C;  2GSN A;  1I6V A;  3AD8 C;  2NVX C;  2B63 K;  1EFW A;  3S1R C;  2R7Z C;  2GAH C;  3EQL A;  1BGW A;  1TWA K;  4Y7N K;  3S1M K;  5IYD K;  4KMA A;  4XLN A;  2NVY A;  3GTK A;  4LQY A;  4YFK A;  1TWG C;  4GTD A;  2XCR B;  2R93 A;  1Y1W C;  4C2M K;  4BBS C;  2WAQ D;  2A68 A;  4G7Z A;  4A3E C;  4A3G K;  1ISE A;  1JVI A;  1XZQ A;  4KDD A;  1PJ6 A;  4C3I C;  3GTG C;  3HOZ K;  4A3L C;  4OIQ A;  2WB1 L;  1IS1 A;  1K83 C;  4KB2 A;  4XLP A;  1UV7 A;  1SFO C;  3S0X A;  3AQP A;  4OIP A;  4KN7 A;  1O28 A;  4J3N A;  2A6E A;  4LR2 A;  1J6V A;  3FKI C;  5TJ3 A;  3PO3 K;  4MQ9 A;  2D6F C;  4A3D K;  5FJ8 K;  3GTO A;  2E2I A;  1V5V A;  1B4B A;  4A3F K;  1R9T A;  2R92 K;  3GTM C;  1HQM A;  4PAB A;  1I50 C;  2P5M A;  2ZFZ A;  1I3Q C;  2JA5 K;  1WQF A;  4G0U A;  1YNN A;  4A3D C;  1I6H C;  1IE0 A;  5IYC C;  1WOS A;  4GT9 A;  5TMF A;  2E2J K;  4GZY A;  1DCO A;  4Y52 K;  3I4N C;  4QJV B;  3S17 C;  2Y0S L;  4NOI A;  5C3E C;  4FM9 A;  2V6U A;  4WJ3 M;  1ZQ1 C;  3DXJ A;  3GEH A;  3GTP C;  4A3J C;  3GEE A;  4WIL A;  3TTG A;  3GTG K;  3M4O K;  3A8K A;  3IPJ A;  1DCH A;  3HOV K;  3A8J A;  1USM A;  5IOQ A;  2GSU A;  1Y1W K;  2VUM K;  1SMY A;  1X31 C;  3HOU K;  4ILD A;  4BBR K;  1SFO A;  4KC6 A;  3T02 A;  3AH5 A;  5IYD C;  3S1M C;  5JVO A;  4Y7N C;  3RZO K;  1INN A;  4C3H C;  5IP7 K;  5C4X C;  3RZO C;  5L46 A;  2WB1 D;  3JST A;  5D4D A;  1TWF C;  3S1N K;  1BJT A;  1G51 A;  4YG2 A;  1O27 A;  4BBR C;  1TWC K;  3HOU C;  4C45 A;  1PJ7 A;  2Y3P A;  1ZBS A;  2VUM C;  1XXC A;  2GSO A;  1DCP A;  1PJ5 A;  1L0W A;  1TWA A;  1O2F B;  5C44 K;  3OEP A;  5IOR A;  3GTQ C;  1XXA A;  3M4O C;  3S1Q C;  4A3J K;  2NVT C;  3HOX C;  2R93 K;  1O25 A;  3SZZ A;  1O29 A;  3G4A A;  3ORE A;  4KB4 A;  5HL8 A;  2YU9 C;  5C3E K;  2RH6 A;  3GSI A;  3H0G C;  2JA6 C;  1R9T C;  3T00 A;  4JK1 A;  5CJ9 A;  2JA5 A;  1O26 A;  1EI6 A;  2FQT A;  4Y52 C;  1WIH A;  1JQW A;  2ZUE A;  3GTL C;  3HKZ D;  3WOD A;  3S16 C;  4G7H A;  3GTL K;  3L4K A;  4KMU A;  3RZD C;  3Q3Q A;  4G7O A;  4XCH A;  1VJE A;  1KQ4 A;  1XZP B;  1I3Q K;  4GTA A;  1I50 K;  1WOR A;  2NVQ C;  3S1Q K;  2E2H A;  4DDQ A;  1WCM A;  2P8T A;  4A3F C;  3CQZ A;  1IBA A;  4BLA A;  5M5X K;  3S15 C;  3GTO K;  5C4J K;  4WJ4 A;  2E2I K;  5IYB K;  1IL2 A;  3QX3 A;  3V4G A;  2R92 A;  4BLB A;  3FKI K;  4OIO A;  1WQG A;  1TWC C;  2WAQ L;  2Y0S D;  1XXB A;  1WOP A;  4BKW A;  1TWF K;  5FLM C;  2NVX A;  3LAP A;  1USO A;  1SFO K;  3N0B A;  3FHZ A;  4KM8 A;  1C0A A;  4BY7 C;  2FQO A;  3CQZ C;  3S14 K;  3CAG A;  4FZB A;  5EGH A;  4C3J C;  4Q5S A;  1TWH K;  4XSZ A;  3HOZ C;  1VRQ C;  3BUE A;  5IP9 C;  4A3E K;  1Y1V C;  2A69 A;  3HOV C;  5IOS A;  4KMD A;  4C2M C;  4BBS K;  2CW0 A;  5E68 A;  1TWG K;  4AH6 A;  1O2B A;  1VLO A;  2O5I A;  2R7Z A;  4XSX A;  4LK1 A;  1TWA C;  2BE5 A;  3S17 K;  2VUM A;  4GTF A;  5TMC A;  4YFN A;  3TFJ A;  2W7V A;  4ZH4 A;  2NVY C;  3H3V L;  2B63 C;  2E2J C;  4P9S A;  1F93 A;  5IYC K;  4KAS A;  4OIN A;  4QIW L;  3HOW C;  3M3Y K;  3GTQ A;  1I6H K;  1WCM C;  2PHC B;  2E2H C;  3GEI A;  2JA5 C;  4A3M K;  4KN4 A;  2JA7 A;  1TWC A;  1Y1V K;  4Q4Z A;  1IW7 A;  3GTJ C;  3LAJ A;  3NUH A;  1YCL A;  1I3Q A;  4LLG A;  4A93 K;  4P5A A;  1ZXO A;  1B4A A;  3H3V D;  1TWH C;  4PAA A;  4C3J K;  3S2H C;  3I4M K;  3CQZ K;  3S14 C;  4BY7 K;  2XCO A;  1VGX A;  2JH3 A;  4RMF A;  4MEY A;  4X6A K;  4P5B A;  1YX2 A;  2YU9 A;  2RGR A;  4M1X A;  3A8I A;  5FLM K;  4KMH A;  4X6A C;  2V6T A;  1K83 K;  3GTJ A;  4BY1 K;  4A3B K;  5M5Y K;  2O5J A;  2JA7 C;  3GTM A;  4QJV A;  1J6X A;  5EGE A;  3SZY A;  5C4J C;  2E2I C;  4A3L K;  3GTO C;  3GTL A;  1WQH A;  4A93 C;  4MEX A;  4C3I K;  1J98 A;  4GTE A;  3GTP A;  4LK0 A;  4A3G C;  1EH1 A;  4A3I C;  2B63 A;  4GTL A;  1O2A A;  1I50 A;  2EBB A;  3AD7 C;  3FOF A;  2XCQ A;  2E2H K;  3VA7 A;  1WCM K;  3PO2 K;  1BDF A;  1TWG A;  4BXX K;  3RZD K;  2PA8 D;  1WSR A;  1EK8 A;  2PMZ D;  1O24 A;  3S2D K;  2NVY K;  1BS2 A;  3GTK K;  2R7Z K;  3AD9 C;  3FKI A;  3S1R K;  5M5W K;  1TWF A;  3H0G K;  2NVX K;  2JA6 K;  4AYB D;  3HOY K;  3L4J A;  4A3C C;  2A6H A;  3N3Y A;  2ZUF A;  4KAR A;  3BP3 A;  1DD5 A;  3GTQ K;  3N0C A;  2PA8 L;  5C44 C;  1TWH A;  2PMZ L;  1AB4 A;  5IP9 K;  2CFA B;  1RU0 A;  5M3M K;  4A3C K;  2JA8 C;  3OPF A;  1JOE A;  1Y1V A;  3HOY C;  1EQR A;  4KM9 A;  2PPB A;  3K7A K;  4AYB L;  3S1N C;  4KAT A;  5M3F K;  4O2D A;  4QIW D;  5IOT A;  3GTK C;  4GTB A;  1VH2 A;  2V6S A;  5C4X K;  5IP7 C;  3S2D C;  4C3H K;  5CHP A;  4BXX C;  4GFQ A;  3PO2 C;  3TFH A;  1F7V A;  2KWA A;  4A3I K;  5IYB C;  1K83 A;  4A3K C;  3S15 K;  3GIR A;  1YNJ A;  5JFE A;  4KAW X;  3AQO A;  3TFI A; 
#chains in the Genus database with same CATH homology
 3BP8 C;  3BP3 A;  3IPJ A;  1O2F B;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...