1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE PERMEASE
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
3IPJA 3BP8C 1O2FB 1IBAA 3BP3A
chains in the Genus database with same CATH superfamily
3GTQK 3HXAA 4ILDA 2JA5A 2JH3A 1I3QA 2PA8D 5M3MK 4GTLA 2YU9A 3LPXA 4KN7A 2R92A 3OREA 1Y1WA 3HOZK 4J3NA 4A3MK 3S2DC 4A3JC 3HKZD 1VJEA 1AB4A 1F7UA 3HOYC 3GEIA 4PAAA 1Y1VA 4WILA 2WB1L 2JA5K 3GTJK 1I3QK 1YNJA 2GAHC 4XSZA 2Y0SL 4KB2A 1TWFA 2EBBA 4OIQA 2VUMK 1Y1WK 2YU9K 1X31C 4MEYA 3GTOC 5M5YK 4P9SA 3S1NC 2O5JA 4KATA 3S15K 1I6HK 1Y1VK 1XZQB 2GSOA 4FM9A 4GTDA 2NVXC 1TWCC 1J98A 4FZBA 2JA8C 2WB1D 3GIRA 4G0WA 3AH5A 3S16C 5IP7C 4KARA 1EFWA 1O25A 1YNNA 2CFAB 5M3FK 2Y0SD 4A3DC 4XCHA 1ZYRA 3GTOA 1INNA 4KM9A 4A3JK 3HOYK 3BUEA 4JK1A 5FLMC 1WCMC 1F9NA 4GT9A 2V6UA 1TWCA 4KMDA 2NVXA 5C3EC 1GE9A 4BBRC 1USOA 1J6XA 4NOIA 3K7AC 4LLGA 2V6SA 3GTOK 3S1QC 1IL2A 3QX3A 1DD5A 1IE0A 3S1NK 3TFHA 4YFNA 3LAJA 3L4JA 1WIHA 1C0AA 4QIWL 4A3GC 1I6VA 2NVXK 1TWCK 1WCMA 5JVOA 1EI6A 1EH1A 3AD8C 2PPBA 1PJ5A 2JA8K 2JA7C 3S2HC 5IYDC 3S14C 4MEXA 1O27A 5JFEA 2A68A 1XXAA 5IP7K 3S16K 4A3DK 4G7OA 4A3LC 3MMLB 2B63C 1XPPA 4C45A 4KASA 5FLMK 1WCMK 2VUMC 3BP8C 3FKIC 1O29A 5C3EK 2R93C 2A6HA 4KMHA 4BBRK 3TFJA 5M5XK 2JA7A 2Y3PA 4XLNA 2NVYC 3K7AK 2GAGC 3LAPA 3I4NC 3S1QK 2O5IA 4WJ4A 1DCPA 2E2IC 2B63A 3GTJA 1I50C 3CAGA 4A3GK 1O24A 1WOOA 1WSRA 4RMFA 5TMCA 2CW0A 1TWHC 4G7HA 2VUMA 3S1RC 2JA7K 3CQZC 5TJ3A 3FKIA 5IYCC 3S2HK 5IYDK 4GFQA 3GTMC 3S14K 1JQWA 2R93A 3H3VL 2KWAA 1O2FB 3SZZA 3V4GA 4A3EC 4G0UA 2NVYA 3AQPA 4A3LK 2PMZD 2B63K 4C3HC 5E68A 3A8JA 4Y52K 2E2IA 2V6TA 1I50A 3L4KA 3PO2C 3FKIK 3S1MC 4A3BC 1WOSA 3S0XA 1ZXOA 3BP3A 3S17C 2R93K 1F7VA 1TWHA 3PO3C 3CQZA 2ZUFA 4KMUA 2NVYK 1R9TC 3GTMA 2E2HC 3I4NK 4LR2A 3FHZA 3H3VD 1ZBSA 2E2IK 1EQRA 3RZDC 1XZQA 3OPFA 1I50K 1XZPB 1WSVA 1TWHK 4KM8A 5IP9C 4A3CC 3S1RK 3SZYA 3CQZK 4MQ9A 5IYCK 3GTMK 1BJTA 2GSUA 1J6WA 4KC6A 2CFAA 4A3EK 3H0GC 4DDQA 1O26A 1R9TA 2E2HA 2R7ZC 4BLBA 4BY7C 3T00A 2ZUEA 4C3HK 4GTAA 1WQGA 1WOPA 3FOEA 1ZQ1C 4BKWA 4G7ZA 4LOWA 3PO2K 3S1MK 4A3BK 4GTCA 1BGWA 3GTLC 3S17K 3T01A 4P5AA 3PO3K 3HOVC 1R9TK 4A3KC 2E2HK 2WAQL 4PABA 2E2JC 5C44C 5CJ9A 4QJVB 3H0GA 4WJ3M 1F93A 2R7ZA 3RZDK 4BLAA 3A8IA 5EGEA 1XXBA 4LQYA 3A8KA 4Y7NC 3WODA 4A3CK 5IP9K 1HI9A 3GEHA 3VA7A 3GTLA 3HOWC 4BY1C 4GZYA 4Y52C 4LK0A 3DXJA 1WORA 3H0GK 4GTEA 5M5WK 5FJ8K 1O2AA 3N0CA 2R7ZK 4BY7K 5TMFA 4QIWD 4KAWX 2XCOA 3M4OC 3IPJA 1IS1A 4A3FC 4A93C 1PJ7A 4YFXA 3GTLK 1YCLA 4XLPA 3GTKC 1EK8A 3I4MC 3HOVK 4A3KK 2E2JK 2A6EA 1BDFA 4C3IC 1WQFA 5C44K 1KQ4A 3HKZL 4C3JC 4KMAA 4O2DA 4YG2A 1WQHA 3RZOC 3N0BA 4Y7NK 2JA6C 4GTBA 5D4DA 3GTPC 1TWFC 1ZVUA 1TWGC 1O28A 3HOWK 2NVQC 4BBSC 3GTKA 4KDDA 4BY1K 3GSIA 3AD7C 4OINA 5C4XC 4ZH4A 3GTGC 3M4OK 1IBAA 5EGHA 4A3FK 4A93K 4KB4A 4YFKA 2GSNA 1V5VA 1O2BA 2NVTC 2JA6A 3OEPA 1VH2A 3GTKK 1HQMA 3I4MK 4OIOA 3GTPA 1TWGA 2PHCB 4C3IK 3T02A 4XSXA 5IOQA 3M3YC 2R92K 3HOXC 1JOEA 4C3JK 1J6VA 1XZPA 3GTGA 3HOUC 5IYBC 1IW7A 3RZOK 1PJ6A 4AYBL 2P5MA 5IOTA 2JA6K 4BXXC 4AH6A 4LK1A 3AD9C 3GTPK 1TWFK 1TWGK 1USMA 1SFOC 2NVQK 1DCHA 3N3YA 4BBSK 2FQTA 1L0WA 5C4JC 3GDZA 4GTFA 5C4XK 4LJZA 2RH6A 3Q3QA 3G4CA 3GTGK 3S2DK 1K83C 3ADAC 1YX2A 4Q5SA 1ISEA 4Q4ZA 1B4BA 4A3IC 5IORA 2A69A 3TFIA 3NUHA 2NVTK 1IQ0A 3AQOA 3G4AA 1RU0A 4AYBD 2ZFZA 2FQOA 4C2MC 1TWAC 1SFOA 5CHPA 2D6FC 4QJVA 3ERED 3M3YK 2RGRA 2XCQA 1UV7A 3HOXK 4X6AC 3GTQC 5IOSA 2P8TA 3HOUK 5IYBK 1K83A 3GEEA 3TTGA 1JVIA 4BXXK 2WAQD 1SFOK 3HOZC 4M1XA 4A3MC 4OIPA 4P5BA 5C4JK 1TWAA 1VRQC 4OIRA 1B4AA 4G0VA 4KN4A 3FOFA 2JA5C 3GTJC 2PA8L 1K83K 1I3QC 3GTQA 1XXCA 1VGXA 4A3IK 1DCOA 1VLOA 1Y1WC 2YU9C 2R92C 2BE5A 5HL8A 2XCRB 1SMYA 4C2MK 1TWAK 3S15C 1I6HC 1BS2A 2PMZL 3JSTA 1Y1VC 2W7VA 1G51A 5L46A 3EQLA 4X6AK
chains in the Genus database with same CATH topology
3IPJA 3BP8C 1O2FB 1IBAA 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  3BP8 C;  1O2F B;  1IBA A;  3BP3 A; 
#chains in the Genus database with same CATH topology
 3GTQ K;  3HXA A;  4ILD A;  2JA5 A;  2JH3 A;  1I3Q A;  2PA8 D;  5M3M K;  4GTL A;  2YU9 A;  3LPX A;  4KN7 A;  2R92 A;  3ORE A;  1Y1W A;  3HOZ K;  4J3N A;  4A3M K;  3S2D C;  4A3J C;  3HKZ D;  1VJE A;  1AB4 A;  1F7U A;  3HOY C;  3GEI A;  4PAA A;  1Y1V A;  4WIL A;  2WB1 L;  2JA5 K;  3GTJ K;  1I3Q K;  1YNJ A;  2GAH C;  4XSZ A;  2Y0S L;  4KB2 A;  1TWF A;  2EBB A;  4OIQ A;  2VUM K;  1Y1W K;  2YU9 K;  1X31 C;  4MEY A;  3GTO C;  5M5Y K;  4P9S A;  3S1N C;  2O5J A;  4KAT A;  3S15 K;  1I6H K;  1Y1V K;  1XZQ B;  2GSO A;  4FM9 A;  4GTD A;  2NVX C;  1TWC C;  1J98 A;  4FZB A;  2JA8 C;  2WB1 D;  3GIR A;  4G0W A;  3AH5 A;  3S16 C;  5IP7 C;  4KAR A;  1EFW A;  1O25 A;  1YNN A;  2CFA B;  5M3F K;  2Y0S D;  4A3D C;  4XCH A;  1ZYR A;  3GTO A;  1INN A;  4KM9 A;  4A3J K;  3HOY K;  3BUE A;  4JK1 A;  5FLM C;  1WCM C;  1F9N A;  4GT9 A;  2V6U A;  1TWC A;  4KMD A;  2NVX A;  5C3E C;  1GE9 A;  4BBR C;  1USO A;  1J6X A;  4NOI A;  3K7A C;  4LLG A;  2V6S A;  3GTO K;  3S1Q C;  1IL2 A;  3QX3 A;  1DD5 A;  1IE0 A;  3S1N K;  3TFH A;  4YFN A;  3LAJ A;  3L4J A;  1WIH A;  1C0A A;  4QIW L;  4A3G C;  1I6V A;  2NVX K;  1TWC K;  1WCM A;  5JVO A;  1EI6 A;  1EH1 A;  3AD8 C;  2PPB A;  1PJ5 A;  2JA8 K;  2JA7 C;  3S2H C;  5IYD C;  3S14 C;  4MEX A;  1O27 A;  5JFE A;  2A68 A;  1XXA A;  5IP7 K;  3S16 K;  4A3D K;  4G7O A;  4A3L C;  3MML B;  2B63 C;  1XPP A;  4C45 A;  4KAS A;  5FLM K;  1WCM K;  2VUM C;  3BP8 C;  3FKI C;  1O29 A;  5C3E K;  2R93 C;  2A6H A;  4KMH A;  4BBR K;  3TFJ A;  5M5X K;  2JA7 A;  2Y3P A;  4XLN A;  2NVY C;  3K7A K;  2GAG C;  3LAP A;  3I4N C;  3S1Q K;  2O5I A;  4WJ4 A;  1DCP A;  2E2I C;  2B63 A;  3GTJ A;  1I50 C;  3CAG A;  4A3G K;  1O24 A;  1WOO A;  1WSR A;  4RMF A;  5TMC A;  2CW0 A;  1TWH C;  4G7H A;  2VUM A;  3S1R C;  2JA7 K;  3CQZ C;  5TJ3 A;  3FKI A;  5IYC C;  3S2H K;  5IYD K;  4GFQ A;  3GTM C;  3S14 K;  1JQW A;  2R93 A;  3H3V L;  2KWA A;  1O2F B;  3SZZ A;  3V4G A;  4A3E C;  4G0U A;  2NVY A;  3AQP A;  4A3L K;  2PMZ D;  2B63 K;  4C3H C;  5E68 A;  3A8J A;  4Y52 K;  2E2I A;  2V6T A;  1I50 A;  3L4K A;  3PO2 C;  3FKI K;  3S1M C;  4A3B C;  1WOS A;  3S0X A;  1ZXO A;  3BP3 A;  3S17 C;  2R93 K;  1F7V A;  1TWH A;  3PO3 C;  3CQZ A;  2ZUF A;  4KMU A;  2NVY K;  1R9T C;  3GTM A;  2E2H C;  3I4N K;  4LR2 A;  3FHZ A;  3H3V D;  1ZBS A;  2E2I K;  1EQR A;  3RZD C;  1XZQ A;  3OPF A;  1I50 K;  1XZP B;  1WSV A;  1TWH K;  4KM8 A;  5IP9 C;  4A3C C;  3S1R K;  3SZY A;  3CQZ K;  4MQ9 A;  5IYC K;  3GTM K;  1BJT A;  2GSU A;  1J6W A;  4KC6 A;  2CFA A;  4A3E K;  3H0G C;  4DDQ A;  1O26 A;  1R9T A;  2E2H A;  2R7Z C;  4BLB A;  4BY7 C;  3T00 A;  2ZUE A;  4C3H K;  4GTA A;  1WQG A;  1WOP A;  3FOE A;  1ZQ1 C;  4BKW A;  4G7Z A;  4LOW A;  3PO2 K;  3S1M K;  4A3B K;  4GTC A;  1BGW A;  3GTL C;  3S17 K;  3T01 A;  4P5A A;  3PO3 K;  3HOV C;  1R9T K;  4A3K C;  2E2H K;  2WAQ L;  4PAB A;  2E2J C;  5C44 C;  5CJ9 A;  4QJV B;  3H0G A;  4WJ3 M;  1F93 A;  2R7Z A;  3RZD K;  4BLA A;  3A8I A;  5EGE A;  1XXB A;  4LQY A;  3A8K A;  4Y7N C;  3WOD A;  4A3C K;  5IP9 K;  1HI9 A;  3GEH A;  3VA7 A;  3GTL A;  3HOW C;  4BY1 C;  4GZY A;  4Y52 C;  4LK0 A;  3DXJ A;  1WOR A;  3H0G K;  4GTE A;  5M5W K;  5FJ8 K;  1O2A A;  3N0C A;  2R7Z K;  4BY7 K;  5TMF A;  4QIW D;  4KAW X;  2XCO A;  3M4O C;  3IPJ A;  1IS1 A;  4A3F C;  4A93 C;  1PJ7 A;  4YFX A;  3GTL K;  1YCL A;  4XLP A;  3GTK C;  1EK8 A;  3I4M C;  3HOV K;  4A3K K;  2E2J K;  2A6E A;  1BDF A;  4C3I C;  1WQF A;  5C44 K;  1KQ4 A;  3HKZ L;  4C3J C;  4KMA A;  4O2D A;  4YG2 A;  1WQH A;  3RZO C;  3N0B A;  4Y7N K;  2JA6 C;  4GTB A;  5D4D A;  3GTP C;  1TWF C;  1ZVU A;  1TWG C;  1O28 A;  3HOW K;  2NVQ C;  4BBS C;  3GTK A;  4KDD A;  4BY1 K;  3GSI A;  3AD7 C;  4OIN A;  5C4X C;  4ZH4 A;  3GTG C;  3M4O K;  1IBA A;  5EGH A;  4A3F K;  4A93 K;  4KB4 A;  4YFK A;  2GSN A;  1V5V A;  1O2B A;  2NVT C;  2JA6 A;  3OEP A;  1VH2 A;  3GTK K;  1HQM A;  3I4M K;  4OIO A;  3GTP A;  1TWG A;  2PHC B;  4C3I K;  3T02 A;  4XSX A;  5IOQ A;  3M3Y C;  2R92 K;  3HOX C;  1JOE A;  4C3J K;  1J6V A;  1XZP A;  3GTG A;  3HOU C;  5IYB C;  1IW7 A;  3RZO K;  1PJ6 A;  4AYB L;  2P5M A;  5IOT A;  2JA6 K;  4BXX C;  4AH6 A;  4LK1 A;  3AD9 C;  3GTP K;  1TWF K;  1TWG K;  1USM A;  1SFO C;  2NVQ K;  1DCH A;  3N3Y A;  4BBS K;  2FQT A;  1L0W A;  5C4J C;  3GDZ A;  4GTF A;  5C4X K;  4LJZ A;  2RH6 A;  3Q3Q A;  3G4C A;  3GTG K;  3S2D K;  1K83 C;  3ADA C;  1YX2 A;  4Q5S A;  1ISE A;  4Q4Z A;  1B4B A;  4A3I C;  5IOR A;  2A69 A;  3TFI A;  3NUH A;  2NVT K;  1IQ0 A;  3AQO A;  3G4A A;  1RU0 A;  4AYB D;  2ZFZ A;  2FQO A;  4C2M C;  1TWA C;  1SFO A;  5CHP A;  2D6F C;  4QJV A;  3ERE D;  3M3Y K;  2RGR A;  2XCQ A;  1UV7 A;  3HOX K;  4X6A C;  3GTQ C;  5IOS A;  2P8T A;  3HOU K;  5IYB K;  1K83 A;  3GEE A;  3TTG A;  1JVI A;  4BXX K;  2WAQ D;  1SFO K;  3HOZ C;  4M1X A;  4A3M C;  4OIP A;  4P5B A;  5C4J K;  1TWA A;  1VRQ C;  4OIR A;  1B4A A;  4G0V A;  4KN4 A;  3FOF A;  2JA5 C;  3GTJ C;  2PA8 L;  1K83 K;  1I3Q C;  3GTQ A;  1XXC A;  1VGX A;  4A3I K;  1DCO A;  1VLO A;  1Y1W C;  2YU9 C;  2R92 C;  2BE5 A;  5HL8 A;  2XCR B;  1SMY A;  4C2M K;  1TWA K;  3S15 C;  1I6H C;  1BS2 A;  2PMZ L;  3JST A;  1Y1V C;  2W7V A;  1G51 A;  5L46 A;  3EQL A;  4X6A K; 
#chains in the Genus database with same CATH homology
 3IPJ A;  3BP8 C;  1O2F B;  1IBA A;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...