1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE PERMEASE
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
1IBAA 3IPJA 1O2FB 3BP3A 3BP8C
chains in the Genus database with same CATH superfamily
4C3HK 5C3EC 4A3IC 4KB4A 4G7HA 4PABA 4C3JK 4A3DC 3PO2K 1JVIA 1R9TC 3GDZA 3GTPK 1WCMA 3PO3C 1I6HK 3S1RK 5C3EK 1WSRA 1Y1VA 2W7VA 4KB2A 3T01A 4G0WA 3HOVC 1EI6A 1Y1WC 4KM8A 3Q3QA 4BY7C 1O2AA 4KARA 3L4JA 3FOEA 2VUMK 2PPBA 2NVQC 2JA5K 3LPXA 5M5WK 3SZYA 4A3BK 5CJ9A 4BY7K 2XCQA 3ERED 4A93C 4YFKA 1IL2A 1DD5A 1JQWA 3FKIK 3BP3A 4FM9A 4YFNA 2A6HA 4A3FK 1BDFA 4WJ3M 3SZZA 4AH6A 3FOFA 3GTGA 5C4XK 4J3NA 5C4JK 2WB1L 3TFIA 4QJVB 4C45A 4MEYA 3HOYK 4KDDA 2NVYA 3S16K 1SFOC 2JA6C 2B63C 4AYBD 4BLAA 4XLPA 1TWFA 3GTKC 2GAHC 4GT9A 4X6AC 1XPPA 3FKIA 2WB1D 4ZH4A 4QIWD 2B63K 1TWGK 3M3YK 5HL8A 1IQ0A 4A3JK 4P5AA 4GTDA 5TJ3A 2E2HC 1K83A 2NVXA 1AB4A 3T02A 4OIQA 3HOWC 1XZPA 3HOUC 2JH3A 5IYCK 3AD7C 2E2HK 1INNA 4Y7NC 3S1QC 2O5JA 3RZDK 1I50C 3S17C 1BJTA 3CAGA 3K7AC 4GTAA 3LAPA 4OIPA 3T00A 3S2HK 3CQZK 2R93A 1L0WA 4YFXA 4Y7NK 2GSNA 4Y52C 2O5IA 1TWGA 3S15C 5JVOA 1Y1VC 5IP7C 3S17K 2E2IA 1TWCC 3GTQC 3H0GA 1WOSA 2R7ZC 1WOPA 4A3CC 3GTOK 2R92A 1PJ5A 2YU9K 4XCHA 3GTMC 5D4DA 4LR2A 4BBSK 3HOZK 3N0BA 2JA7C 5C44C 3WODA 5IP7K 1TWCK 3GEHA 4G0VA 3I4MK 2BE5A 2JA7K 5C44K 2CFAB 3GTLA 4A3IK 4JK1A 3N0CA 4A3DK 1R9TK 5L46A 4KASA 3GTJA 2GSUA 1ZBSA 3PO3K 1TWHA 3IPJA 1F93A 2WAQL 3HOVK 1G51A 2E2JC 3GEEA 3H3VL 5IP9C 1Y1WK 3OREA 4XSZA 2NVYC 1WSVA 5FLMC 5TMFA 1IW7A 1TWFC 4O2DA 5IOTA 2NVQK 3OEPA 5M5YK 4BBRC 1J6WA 2XCRB 3A8JA 3GTPA 1USMA 1WQFA 3AQOA 5TMCA 5E68A 1O2BA 1EQRA 3I4NC 3S1MC 4A93K 3S1NC 2A68A 4P5BA 3VA7A 2Y0SL 3A8KA 2WAQD 3S0XA 4BBRK 3H3VD 4MQ9A 2ZUEA 1O25A 2GAGC 5IOQA 1IS1A 1K83C 4LJZA 3S1MK 1C0AA 3S2DC 5IORA 4GTEA 2VUMA 3M4OC 3L4KA 2JA5A 1Y1WA 4PAAA 1I3QC 1YX2A 1KQ4A 1SFOK 3TFHA 3TTGA 4G7ZA 1USOA 2JA6K 3S2DK 2ZUFA 1VRQC 2NVTC 3GTKK 5IYBC 1J6XA 3RZOC 4OIOA 2V6TA 5EGEA 3JSTA 4P9SA 1O27A 3N3YA 3A8IA 4A3LC 4C3IC 4A3KC 4X6AK 2JA8C 1TWAC 2E2IC 1F9NA 1YNNA 3AQPA 2NVTK 2A69A 2R92C 3AD9C 1XZQB 4BY1C 4KC6A 3ADAC 2RH6A 2ZFZA 5IYDC 4XSXA 4C3IK 4A3LK 1XZPB 4BXXC 2EBBA 2PHCB 3DXJA 1GE9A 1IBAA 2PMZL 2V6UA 3LAJA 5CHPA 3HOWK 3HOUK 1EFWA 3GEIA 4Q5SA 4M1XA 1WCMC 3S1QK 2B63A 4A3MC 1I50K 3K7AK 3S14C 2A6EA 4C2MC 3OPFA 4GTFA 4RMFA 2FQOA 3TFJA 4Y52K 2PMZD 4BLBA 3S15K 1Y1VK 4A3MK 5M3MK 1DCHA 1O29A 3GTQK 4A3CK 2R7ZK 4Q4ZA 4G0UA 5M3FK 1ZYRA 1PJ6A 2E2HA 3GTMK 1J98A 1VLOA 4C3HC 4KMDA 4GTBA 4DDQA 2FQTA 4C3JC 3PO2C 1VJEA 3CQZA 5EGHA 3GTGC 4GTLA 4GTCA 4XLNA 3S1RC 1ZXOA 1I50A 1VGXA 1WQHA 4WJ4A 4A3EC 1HI9A 3GTOA 4OINA 2CFAA 3G4CA 2YU9A 1PJ7A 4G7OA 3GTGK 4KN7A 4KM9A 2VUMC 1O2FB 1X31C 4GZYA 2JA5C 1TWCA 3GTQA 4A3EK 5IOSA 2R7ZA 4A3BC 2E2JK 5IP9K 3GTMA 2NVYK 4FZBA 3FKIC 2P8TA 2JA7A 2XCOA 5FLMK 1TWFK 1YNJA 5FJ8K 4A3FC 1XXAA 4KMHA 3EQLA 1R9TA 4A3GC 2CW0A 5C4XC 4YG2A 4KATA 3I4NK 5C4JC 2NVXC 4AYBL 3S1NK 4LK1A 2D6FC 1ZQ1C 4WILA 1VH2A 4ILDA 4A3GK 3HOYC 3MMLB 1EH1A 1WORA 1O28A 3HOXC 3S16C 4OIRA 1K83K 4QJVA 2NVXK 4QIWL 3FHZA 2Y0SD 3AD8C 4KMAA 3M4OK 4LLGA 4LOWA 1HQMA 1O24A 2R93C 2PA8L 3HXAA 3HOXK 4KMUA 1I3QK 2GSOA 3V4GA 2Y3PA 1TWGC 3M3YC 3HKZL 1J6VA 3BP8C 3H0GC 5IYBK 3RZOK 2R93K 4A3JC 1YCLA 4GFQA 1EK8A 1IE0A 4BKWA 1WQGA 1RU0A 4A3KK 4KN4A 2JA8K 1TWAK 2E2IK 1SMYA 4LK0A 3H0GK 2PA8D 2R92K 5IYCC 1DCPA 1WIHA 1I6VA 4BY1K 1B4BA 4NOIA 3BUEA 1UV7A 1XZQA 1WOOA 3HKZD 3RZDC 3AH5A 1SFOA 1V5VA 4BXXK 2JA6A 5IYDK 3GTLC 4LQYA 3GTKA 3S2HC 3CQZC 3NUHA 1JOEA 1B4AA 1ZVUA 2KWAA 1DCOA 1I3QA 3GSIA 3GTJC 2P5MA 1WCMK 3GIRA 1TWHC 3G4AA 3GTLK 4KAWX 3GTOC 3S14K 4MEXA 2RGRA 2YU9C 1XXBA 4C2MK 1F7VA 3GTJK 4BBSC 1BS2A 1TWHK 3QX3A 3HOZC 1TWAA 1XXCA 5M5XK 2V6SA 3I4MC 3GTPC 1ISEA 1O26A 1BGWA 1F7UA 1I6HC 5JFEA
chains in the Genus database with same CATH topology
1IBAA 3IPJA 1O2FB 3BP3A 3BP8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBA A;  3IPJ A;  1O2F B;  3BP3 A;  3BP8 C; 
#chains in the Genus database with same CATH topology
 4C3H K;  5C3E C;  4A3I C;  4KB4 A;  4G7H A;  4PAB A;  4C3J K;  4A3D C;  3PO2 K;  1JVI A;  1R9T C;  3GDZ A;  3GTP K;  1WCM A;  3PO3 C;  1I6H K;  3S1R K;  5C3E K;  1WSR A;  1Y1V A;  2W7V A;  4KB2 A;  3T01 A;  4G0W A;  3HOV C;  1EI6 A;  1Y1W C;  4KM8 A;  3Q3Q A;  4BY7 C;  1O2A A;  4KAR A;  3L4J A;  3FOE A;  2VUM K;  2PPB A;  2NVQ C;  2JA5 K;  3LPX A;  5M5W K;  3SZY A;  4A3B K;  5CJ9 A;  4BY7 K;  2XCQ A;  3ERE D;  4A93 C;  4YFK A;  1IL2 A;  1DD5 A;  1JQW A;  3FKI K;  3BP3 A;  4FM9 A;  4YFN A;  2A6H A;  4A3F K;  1BDF A;  4WJ3 M;  3SZZ A;  4AH6 A;  3FOF A;  3GTG A;  5C4X K;  4J3N A;  5C4J K;  2WB1 L;  3TFI A;  4QJV B;  4C45 A;  4MEY A;  3HOY K;  4KDD A;  2NVY A;  3S16 K;  1SFO C;  2JA6 C;  2B63 C;  4AYB D;  4BLA A;  4XLP A;  1TWF A;  3GTK C;  2GAH C;  4GT9 A;  4X6A C;  1XPP A;  3FKI A;  2WB1 D;  4ZH4 A;  4QIW D;  2B63 K;  1TWG K;  3M3Y K;  5HL8 A;  1IQ0 A;  4A3J K;  4P5A A;  4GTD A;  5TJ3 A;  2E2H C;  1K83 A;  2NVX A;  1AB4 A;  3T02 A;  4OIQ A;  3HOW C;  1XZP A;  3HOU C;  2JH3 A;  5IYC K;  3AD7 C;  2E2H K;  1INN A;  4Y7N C;  3S1Q C;  2O5J A;  3RZD K;  1I50 C;  3S17 C;  1BJT A;  3CAG A;  3K7A C;  4GTA A;  3LAP A;  4OIP A;  3T00 A;  3S2H K;  3CQZ K;  2R93 A;  1L0W A;  4YFX A;  4Y7N K;  2GSN A;  4Y52 C;  2O5I A;  1TWG A;  3S15 C;  5JVO A;  1Y1V C;  5IP7 C;  3S17 K;  2E2I A;  1TWC C;  3GTQ C;  3H0G A;  1WOS A;  2R7Z C;  1WOP A;  4A3C C;  3GTO K;  2R92 A;  1PJ5 A;  2YU9 K;  4XCH A;  3GTM C;  5D4D A;  4LR2 A;  4BBS K;  3HOZ K;  3N0B A;  2JA7 C;  5C44 C;  3WOD A;  5IP7 K;  1TWC K;  3GEH A;  4G0V A;  3I4M K;  2BE5 A;  2JA7 K;  5C44 K;  2CFA B;  3GTL A;  4A3I K;  4JK1 A;  3N0C A;  4A3D K;  1R9T K;  5L46 A;  4KAS A;  3GTJ A;  2GSU A;  1ZBS A;  3PO3 K;  1TWH A;  3IPJ A;  1F93 A;  2WAQ L;  3HOV K;  1G51 A;  2E2J C;  3GEE A;  3H3V L;  5IP9 C;  1Y1W K;  3ORE A;  4XSZ A;  2NVY C;  1WSV A;  5FLM C;  5TMF A;  1IW7 A;  1TWF C;  4O2D A;  5IOT A;  2NVQ K;  3OEP A;  5M5Y K;  4BBR C;  1J6W A;  2XCR B;  3A8J A;  3GTP A;  1USM A;  1WQF A;  3AQO A;  5TMC A;  5E68 A;  1O2B A;  1EQR A;  3I4N C;  3S1M C;  4A93 K;  3S1N C;  2A68 A;  4P5B A;  3VA7 A;  2Y0S L;  3A8K A;  2WAQ D;  3S0X A;  4BBR K;  3H3V D;  4MQ9 A;  2ZUE A;  1O25 A;  2GAG C;  5IOQ A;  1IS1 A;  1K83 C;  4LJZ A;  3S1M K;  1C0A A;  3S2D C;  5IOR A;  4GTE A;  2VUM A;  3M4O C;  3L4K A;  2JA5 A;  1Y1W A;  4PAA A;  1I3Q C;  1YX2 A;  1KQ4 A;  1SFO K;  3TFH A;  3TTG A;  4G7Z A;  1USO A;  2JA6 K;  3S2D K;  2ZUF A;  1VRQ C;  2NVT C;  3GTK K;  5IYB C;  1J6X A;  3RZO C;  4OIO A;  2V6T A;  5EGE A;  3JST A;  4P9S A;  1O27 A;  3N3Y A;  3A8I A;  4A3L C;  4C3I C;  4A3K C;  4X6A K;  2JA8 C;  1TWA C;  2E2I C;  1F9N A;  1YNN A;  3AQP A;  2NVT K;  2A69 A;  2R92 C;  3AD9 C;  1XZQ B;  4BY1 C;  4KC6 A;  3ADA C;  2RH6 A;  2ZFZ A;  5IYD C;  4XSX A;  4C3I K;  4A3L K;  1XZP B;  4BXX C;  2EBB A;  2PHC B;  3DXJ A;  1GE9 A;  1IBA A;  2PMZ L;  2V6U A;  3LAJ A;  5CHP A;  3HOW K;  3HOU K;  1EFW A;  3GEI A;  4Q5S A;  4M1X A;  1WCM C;  3S1Q K;  2B63 A;  4A3M C;  1I50 K;  3K7A K;  3S14 C;  2A6E A;  4C2M C;  3OPF A;  4GTF A;  4RMF A;  2FQO A;  3TFJ A;  4Y52 K;  2PMZ D;  4BLB A;  3S15 K;  1Y1V K;  4A3M K;  5M3M K;  1DCH A;  1O29 A;  3GTQ K;  4A3C K;  2R7Z K;  4Q4Z A;  4G0U A;  5M3F K;  1ZYR A;  1PJ6 A;  2E2H A;  3GTM K;  1J98 A;  1VLO A;  4C3H C;  4KMD A;  4GTB A;  4DDQ A;  2FQT A;  4C3J C;  3PO2 C;  1VJE A;  3CQZ A;  5EGH A;  3GTG C;  4GTL A;  4GTC A;  4XLN A;  3S1R C;  1ZXO A;  1I50 A;  1VGX A;  1WQH A;  4WJ4 A;  4A3E C;  1HI9 A;  3GTO A;  4OIN A;  2CFA A;  3G4C A;  2YU9 A;  1PJ7 A;  4G7O A;  3GTG K;  4KN7 A;  4KM9 A;  2VUM C;  1O2F B;  1X31 C;  4GZY A;  2JA5 C;  1TWC A;  3GTQ A;  4A3E K;  5IOS A;  2R7Z A;  4A3B C;  2E2J K;  5IP9 K;  3GTM A;  2NVY K;  4FZB A;  3FKI C;  2P8T A;  2JA7 A;  2XCO A;  5FLM K;  1TWF K;  1YNJ A;  5FJ8 K;  4A3F C;  1XXA A;  4KMH A;  3EQL A;  1R9T A;  4A3G C;  2CW0 A;  5C4X C;  4YG2 A;  4KAT A;  3I4N K;  5C4J C;  2NVX C;  4AYB L;  3S1N K;  4LK1 A;  2D6F C;  1ZQ1 C;  4WIL A;  1VH2 A;  4ILD A;  4A3G K;  3HOY C;  3MML B;  1EH1 A;  1WOR A;  1O28 A;  3HOX C;  3S16 C;  4OIR A;  1K83 K;  4QJV A;  2NVX K;  4QIW L;  3FHZ A;  2Y0S D;  3AD8 C;  4KMA A;  3M4O K;  4LLG A;  4LOW A;  1HQM A;  1O24 A;  2R93 C;  2PA8 L;  3HXA A;  3HOX K;  4KMU A;  1I3Q K;  2GSO A;  3V4G A;  2Y3P A;  1TWG C;  3M3Y C;  3HKZ L;  1J6V A;  3BP8 C;  3H0G C;  5IYB K;  3RZO K;  2R93 K;  4A3J C;  1YCL A;  4GFQ A;  1EK8 A;  1IE0 A;  4BKW A;  1WQG A;  1RU0 A;  4A3K K;  4KN4 A;  2JA8 K;  1TWA K;  2E2I K;  1SMY A;  4LK0 A;  3H0G K;  2PA8 D;  2R92 K;  5IYC C;  1DCP A;  1WIH A;  1I6V A;  4BY1 K;  1B4B A;  4NOI A;  3BUE A;  1UV7 A;  1XZQ A;  1WOO A;  3HKZ D;  3RZD C;  3AH5 A;  1SFO A;  1V5V A;  4BXX K;  2JA6 A;  5IYD K;  3GTL C;  4LQY A;  3GTK A;  3S2H C;  3CQZ C;  3NUH A;  1JOE A;  1B4A A;  1ZVU A;  2KWA A;  1DCO A;  1I3Q A;  3GSI A;  3GTJ C;  2P5M A;  1WCM K;  3GIR A;  1TWH C;  3G4A A;  3GTL K;  4KAW X;  3GTO C;  3S14 K;  4MEX A;  2RGR A;  2YU9 C;  1XXB A;  4C2M K;  1F7V A;  3GTJ K;  4BBS C;  1BS2 A;  1TWH K;  3QX3 A;  3HOZ C;  1TWA A;  1XXC A;  5M5X K;  2V6S A;  3I4M C;  3GTP C;  1ISE A;  1O26 A;  1BGW A;  1F7U A;  1I6H C;  5JFE A; 
#chains in the Genus database with same CATH homology
 1IBA A;  3IPJ A;  1O2F B;  3BP3 A;  3BP8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...