1IBAA

Glucose permease (domain iib), nmr, 11 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords GLUCOSE PERMEASE
publication title Solution structure of the IIB domain of the glucose transporter of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 1996-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1ibaA00
3IPJA 1O2FB 3BP8C 3BP3A 1IBAA
chains in the Genus database with same CATH superfamily
4WJ4A 2PHCB 4QJVB 2R7ZA 5EGEA 4GT9A 4GZYA 3JSTA 1EFWA 5IYBK 2O5IA 4GTDA 3SZZA 1O29A 1Y1VK 3HXAA 2PMZL 4KATA 2JA6A 1DCOA 4G0VA 2E2JK 3FOEA 1WQFA 2CFAB 2CW0A 1K83K 3HOYK 1TWFC 1ZVUA 3GTQA 5TMFA 5IORA 4C3HK 1F93A 2JA8C 5C3EK 4OIOA 3GTLC 3M4OK 5M5WK 3S1MK 2O5JA 2E2IC 2NVXK 4A3GC 1YX2A 3S14C 1WQGA 1XZQB 4A3LC 4WILA 3S15C 4A3MC 5IYCK 4Y52C 3NUHA 3GIRA 4BBSC 1EH1A 1WCMC 3HOVC 2R92C 3LAJA 4P5BA 3GTGA 1BJTA 4XSXA 2E2HC 2B63C 2RH6A 4KN4A 4Q5SA 5C4XC 3PO3K 4A3MK 2NVTK 1TWHC 3TTGA 4FM9A 5TJ3A 4G7OA 1TWAK 1I3QC 4A3JC 1TWGC 1V5VA 4C3IC 2A6HA 2A69A 2R7ZC 3GTOA 3K7AC 5IP7C 4A3IK 2VUMK 4BBRC 2E2HK 4KMUA 2E2IA 3IPJA 4J3NA 5E68A 3G4CA 3AQOA 4GFQA 2ZFZA 2JA6C 1R9TC 2P5MA 3AD7C 4X6AC 1XZPA 5M5YK 5IOQA 2R7ZK 1XPPA 4A3DK 1TWCA 4A3CC 1VLOA 1B4AA 2JA5A 1WCMA 1O24A 2ZUEA 3V4GA 4PAAA 1YCLA 3GEHA 4XCHA 5C4JK 4XSZA 1EK8A 2B63A 2JA6K 3S2DC 3FKIA 1IS1A 4KC6A 2GSNA 4GTFA 4YFXA 5CHPA 3RZDC 3H3VL 2GAHC 3I4MK 3GTQK 3H3VD 4BXXK 4A3KC 3I4NK 1O2BA 1IBAA 3CQZK 2NVQK 3S17C 2R93A 1BS2A 4G0WA 2V6UA 5JVOA 1USOA 3OEPA 5C44K 1SFOA 2JA7K 4MEXA 3GTMA 3HOXK 4ZH4A 5FJ8K 1HI9A 1I50K 2A6EA 3T00A 2YU9K 3GTGC 1XXCA 3TFIA 1GE9A 4C45A 2XCQA 4KM8A 3RZOC 4LJZA 1Y1WA 3N3YA 4KMAA 4LOWA 3BUEA 1R9TA 3GTJA 1HQMA 5L46A 3S17K 4A93C 2WAQD 3N0CA 4DDQA 3DXJA 1WSVA 4KB4A 5HL8A 4A3FC 4AH6A 3S1QC 4KARA 1VH2A 3GTOC 2GSUA 1IE0A 1X31C 2BE5A 3G4AA 3GTPA 4XLNA 1UV7A 3L4JA 1J6VA 3ERED 1WORA 3GDZA 4Y7NC 1TWFK 3FHZA 1JVIA 1O28A 3GTKA 2NVYA 4A3FK 1BGWA 1J6XA 2JA8K 3LPXA 4OIPA 3VA7A 4A3EC 3AD9C 3OPFA 3GTLK 4OINA 1TWCC 3BP3A 4KMHA 1IQ0A 4KB2A 5FLMC 2WB1L 4JK1A 2E2IK 3HOUC 4GTAA 4QJVA 2JA5C 4YFKA 1Y1VA 4A3GK 2WB1D 2D6FC 4Y7NK 1EQRA 2EBBA 3AH5A 1ZXOA 3S14K 3FKIC 2RGRA 1G51A 4A3LK 2PA8D 3QX3A 3TFHA 4GTEA 1K83A 3HKZD 3SZYA 3S15K 4Y52K 1IW7A 1C0AA 2V6TA 1ZBSA 1TWCK 2CFAA 4A3BC 1WOPA 4BBSK 2R93C 2JA5K 1WCMK 3HOVK 2R92K 1AB4A 3AQPA 1DD5A 1SFOC 1L0WA 3HOWC 3GTMC 2FQTA 2B63K 4C3JC 2A68A 5C4XK 4GTCA 2NVXA 5TMCA 1O26A 1TWHK 3TFJA 1BDFA 3S16C 1Y1WC 1I3QK 4A3JK 1TWGK 1VJEA 3H0GC 3GTJC 4C3IK 2GAGC 3GSIA 3CAGA 1XZQA 1DCPA 4WJ3M 3K7AK 5IP7K 1PJ7A 4BBRK 1F7VA 1VGXA 3HOZC 4YFNA 4Q4ZA 5IP9C 3PO2C 3N0BA 3GTPC 1B4BA 2Y3PA 1R9TK 3Q3QA 4OIQA 4X6AK 3GTKC 2NVYC 1J6WA 4C2MC 4A3CK 4LLGA 1PJ5A 4KASA 4BLAA 2VUMA 4LQYA 1ISEA 2P8TA 3S2DK 5IYBC 1YNJA 4BLBA 3A8IA 1O2AA 1Y1VC 3RZDK 2XCOA 4A3KK 1F9NA 5M3FK 2WAQL 4C2MK 3H0GA 2ZUFA 1WSRA 1K83C 3HOYC 4C3HC 1USMA 1I6HC 3L4KA 4KM9A 5C3EC 4QIWL 3GTGK 2JH3A 4QIWD 1WQHA 4GTLA 1O25A 3RZOK 3M4OC 2PMZD 3S1MC 4YG2A 3S0XA 3A8KA 4O2DA 4RMFA 2NVXC 4A93K 4MEYA 3ADAC 1WIHA 1INNA 1DCHA 4LR2A 1I6HK 4P9SA 4G7ZA 3CQZA 3S1QK 4AYBL 1O27A 5M3MK 5IYCC 1ZYRA 4KMDA 5EGHA 3GTOK 4LK0A 4AYBD 2KWAA 2JA7A 4G7HA 3S2HC 3AD8C 2W7VA 4P5AA 1I50A 5D4DA 2YU9A 4BKWA 3T02A 2PA8L 2FQOA 5CJ9A 1XZPB 3GEEA 4KN7A 1KQ4A 4PABA 3HKZL 3PO3C 1WOOA 1EI6A 4A3EK 2NVTC 4BY7C 3M3YC 3GEIA 3S2HK 1WOSA 1TWAC 5FLMK 3FOFA 3HOUK 5IYDC 4A3IC 2VUMC 3FKIK 4KDDA 5M5XK 1J98A 2Y0SL 1YNNA 4KAWX 1F7UA 1TWFA 5IOTA 4OIRA 2Y0SD 4BY7K 3M3YK 4A3BK 3EQLA 2XCRB 4BY1C 2R93K 4MQ9A 5IYDK 3GTLA 1SFOK 4A3DC 3HOWK 3GTMK 4C3JK 3S1NC 4XLPA 3BP8C 4G0UA 1IL2A 2GSOA 4M1XA 4NOIA 5C4JC 3LAPA 3A8JA 1XXAA 1JOEA 3S1RC 3S16K 1Y1WK 3OREA 3T01A 4GTBA 3H0GK 3GTJK 1PJ6A 4BY1K 3I4MC 3GTQC 4BXXC 1RU0A 3I4NC 1TWAA 1I6VA 3S1NK 3CQZC 2NVQC 3HOZK 2R92A 5IP9K 5JFEA 5C44C 2PPBA 1XXBA 4LK1A 2JA7C 3PO2K 2E2HA 3HOXC 3S1RK 1ZQ1C 4ILDA 3GTPK 5IOSA 1VRQC 1I50C 2YU9C 3WODA 1JQWA 3MMLB 1SMYA 2V6SA 1TWHA 1O2FB 3GTKK 2NVYK 2E2JC 1I3QA 1TWGA 4FZBA
chains in the Genus database with same CATH topology
3IPJA 1O2FB 3BP8C 3BP3A 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  1O2F B;  3BP8 C;  3BP3 A;  1IBA A; 
#chains in the Genus database with same CATH topology
 4WJ4 A;  2PHC B;  4QJV B;  2R7Z A;  5EGE A;  4GT9 A;  4GZY A;  3JST A;  1EFW A;  5IYB K;  2O5I A;  4GTD A;  3SZZ A;  1O29 A;  1Y1V K;  3HXA A;  2PMZ L;  4KAT A;  2JA6 A;  1DCO A;  4G0V A;  2E2J K;  3FOE A;  1WQF A;  2CFA B;  2CW0 A;  1K83 K;  3HOY K;  1TWF C;  1ZVU A;  3GTQ A;  5TMF A;  5IOR A;  4C3H K;  1F93 A;  2JA8 C;  5C3E K;  4OIO A;  3GTL C;  3M4O K;  5M5W K;  3S1M K;  2O5J A;  2E2I C;  2NVX K;  4A3G C;  1YX2 A;  3S14 C;  1WQG A;  1XZQ B;  4A3L C;  4WIL A;  3S15 C;  4A3M C;  5IYC K;  4Y52 C;  3NUH A;  3GIR A;  4BBS C;  1EH1 A;  1WCM C;  3HOV C;  2R92 C;  3LAJ A;  4P5B A;  3GTG A;  1BJT A;  4XSX A;  2E2H C;  2B63 C;  2RH6 A;  4KN4 A;  4Q5S A;  5C4X C;  3PO3 K;  4A3M K;  2NVT K;  1TWH C;  3TTG A;  4FM9 A;  5TJ3 A;  4G7O A;  1TWA K;  1I3Q C;  4A3J C;  1TWG C;  1V5V A;  4C3I C;  2A6H A;  2A69 A;  2R7Z C;  3GTO A;  3K7A C;  5IP7 C;  4A3I K;  2VUM K;  4BBR C;  2E2H K;  4KMU A;  2E2I A;  3IPJ A;  4J3N A;  5E68 A;  3G4C A;  3AQO A;  4GFQ A;  2ZFZ A;  2JA6 C;  1R9T C;  2P5M A;  3AD7 C;  4X6A C;  1XZP A;  5M5Y K;  5IOQ A;  2R7Z K;  1XPP A;  4A3D K;  1TWC A;  4A3C C;  1VLO A;  1B4A A;  2JA5 A;  1WCM A;  1O24 A;  2ZUE A;  3V4G A;  4PAA A;  1YCL A;  3GEH A;  4XCH A;  5C4J K;  4XSZ A;  1EK8 A;  2B63 A;  2JA6 K;  3S2D C;  3FKI A;  1IS1 A;  4KC6 A;  2GSN A;  4GTF A;  4YFX A;  5CHP A;  3RZD C;  3H3V L;  2GAH C;  3I4M K;  3GTQ K;  3H3V D;  4BXX K;  4A3K C;  3I4N K;  1O2B A;  1IBA A;  3CQZ K;  2NVQ K;  3S17 C;  2R93 A;  1BS2 A;  4G0W A;  2V6U A;  5JVO A;  1USO A;  3OEP A;  5C44 K;  1SFO A;  2JA7 K;  4MEX A;  3GTM A;  3HOX K;  4ZH4 A;  5FJ8 K;  1HI9 A;  1I50 K;  2A6E A;  3T00 A;  2YU9 K;  3GTG C;  1XXC A;  3TFI A;  1GE9 A;  4C45 A;  2XCQ A;  4KM8 A;  3RZO C;  4LJZ A;  1Y1W A;  3N3Y A;  4KMA A;  4LOW A;  3BUE A;  1R9T A;  3GTJ A;  1HQM A;  5L46 A;  3S17 K;  4A93 C;  2WAQ D;  3N0C A;  4DDQ A;  3DXJ A;  1WSV A;  4KB4 A;  5HL8 A;  4A3F C;  4AH6 A;  3S1Q C;  4KAR A;  1VH2 A;  3GTO C;  2GSU A;  1IE0 A;  1X31 C;  2BE5 A;  3G4A A;  3GTP A;  4XLN A;  1UV7 A;  3L4J A;  1J6V A;  3ERE D;  1WOR A;  3GDZ A;  4Y7N C;  1TWF K;  3FHZ A;  1JVI A;  1O28 A;  3GTK A;  2NVY A;  4A3F K;  1BGW A;  1J6X A;  2JA8 K;  3LPX A;  4OIP A;  3VA7 A;  4A3E C;  3AD9 C;  3OPF A;  3GTL K;  4OIN A;  1TWC C;  3BP3 A;  4KMH A;  1IQ0 A;  4KB2 A;  5FLM C;  2WB1 L;  4JK1 A;  2E2I K;  3HOU C;  4GTA A;  4QJV A;  2JA5 C;  4YFK A;  1Y1V A;  4A3G K;  2WB1 D;  2D6F C;  4Y7N K;  1EQR A;  2EBB A;  3AH5 A;  1ZXO A;  3S14 K;  3FKI C;  2RGR A;  1G51 A;  4A3L K;  2PA8 D;  3QX3 A;  3TFH A;  4GTE A;  1K83 A;  3HKZ D;  3SZY A;  3S15 K;  4Y52 K;  1IW7 A;  1C0A A;  2V6T A;  1ZBS A;  1TWC K;  2CFA A;  4A3B C;  1WOP A;  4BBS K;  2R93 C;  2JA5 K;  1WCM K;  3HOV K;  2R92 K;  1AB4 A;  3AQP A;  1DD5 A;  1SFO C;  1L0W A;  3HOW C;  3GTM C;  2FQT A;  2B63 K;  4C3J C;  2A68 A;  5C4X K;  4GTC A;  2NVX A;  5TMC A;  1O26 A;  1TWH K;  3TFJ A;  1BDF A;  3S16 C;  1Y1W C;  1I3Q K;  4A3J K;  1TWG K;  1VJE A;  3H0G C;  3GTJ C;  4C3I K;  2GAG C;  3GSI A;  3CAG A;  1XZQ A;  1DCP A;  4WJ3 M;  3K7A K;  5IP7 K;  1PJ7 A;  4BBR K;  1F7V A;  1VGX A;  3HOZ C;  4YFN A;  4Q4Z A;  5IP9 C;  3PO2 C;  3N0B A;  3GTP C;  1B4B A;  2Y3P A;  1R9T K;  3Q3Q A;  4OIQ A;  4X6A K;  3GTK C;  2NVY C;  1J6W A;  4C2M C;  4A3C K;  4LLG A;  1PJ5 A;  4KAS A;  4BLA A;  2VUM A;  4LQY A;  1ISE A;  2P8T A;  3S2D K;  5IYB C;  1YNJ A;  4BLB A;  3A8I A;  1O2A A;  1Y1V C;  3RZD K;  2XCO A;  4A3K K;  1F9N A;  5M3F K;  2WAQ L;  4C2M K;  3H0G A;  2ZUF A;  1WSR A;  1K83 C;  3HOY C;  4C3H C;  1USM A;  1I6H C;  3L4K A;  4KM9 A;  5C3E C;  4QIW L;  3GTG K;  2JH3 A;  4QIW D;  1WQH A;  4GTL A;  1O25 A;  3RZO K;  3M4O C;  2PMZ D;  3S1M C;  4YG2 A;  3S0X A;  3A8K A;  4O2D A;  4RMF A;  2NVX C;  4A93 K;  4MEY A;  3ADA C;  1WIH A;  1INN A;  1DCH A;  4LR2 A;  1I6H K;  4P9S A;  4G7Z A;  3CQZ A;  3S1Q K;  4AYB L;  1O27 A;  5M3M K;  5IYC C;  1ZYR A;  4KMD A;  5EGH A;  3GTO K;  4LK0 A;  4AYB D;  2KWA A;  2JA7 A;  4G7H A;  3S2H C;  3AD8 C;  2W7V A;  4P5A A;  1I50 A;  5D4D A;  2YU9 A;  4BKW A;  3T02 A;  2PA8 L;  2FQO A;  5CJ9 A;  1XZP B;  3GEE A;  4KN7 A;  1KQ4 A;  4PAB A;  3HKZ L;  3PO3 C;  1WOO A;  1EI6 A;  4A3E K;  2NVT C;  4BY7 C;  3M3Y C;  3GEI A;  3S2H K;  1WOS A;  1TWA C;  5FLM K;  3FOF A;  3HOU K;  5IYD C;  4A3I C;  2VUM C;  3FKI K;  4KDD A;  5M5X K;  1J98 A;  2Y0S L;  1YNN A;  4KAW X;  1F7U A;  1TWF A;  5IOT A;  4OIR A;  2Y0S D;  4BY7 K;  3M3Y K;  4A3B K;  3EQL A;  2XCR B;  4BY1 C;  2R93 K;  4MQ9 A;  5IYD K;  3GTL A;  1SFO K;  4A3D C;  3HOW K;  3GTM K;  4C3J K;  3S1N C;  4XLP A;  3BP8 C;  4G0U A;  1IL2 A;  2GSO A;  4M1X A;  4NOI A;  5C4J C;  3LAP A;  3A8J A;  1XXA A;  1JOE A;  3S1R C;  3S16 K;  1Y1W K;  3ORE A;  3T01 A;  4GTB A;  3H0G K;  3GTJ K;  1PJ6 A;  4BY1 K;  3I4M C;  3GTQ C;  4BXX C;  1RU0 A;  3I4N C;  1TWA A;  1I6V A;  3S1N K;  3CQZ C;  2NVQ C;  3HOZ K;  2R92 A;  5IP9 K;  5JFE A;  5C44 C;  2PPB A;  1XXB A;  4LK1 A;  2JA7 C;  3PO2 K;  2E2H A;  3HOX C;  3S1R K;  1ZQ1 C;  4ILD A;  3GTP K;  5IOS A;  1VRQ C;  1I50 C;  2YU9 C;  3WOD A;  1JQW A;  3MML B;  1SMY A;  2V6S A;  1TWH A;  1O2F B;  3GTK K;  2NVY K;  2E2J C;  1I3Q A;  1TWG A;  4FZB A; 
#chains in the Genus database with same CATH homology
 3IPJ A;  1O2F B;  3BP8 C;  3BP3 A;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...