3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Ligase
molecule keywords Arginyl-tRNA synthetase
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
1IQ0A 3GDZA 1F7UA 1BS2A 2ZUFA 2ZUEA 1F7VA
chains in the Genus database with same CATH superfamily
2NVQC 3Q3QA 1TWCA 2R7ZC 4C2MC 3GTKK 1XPPA 4FZBA 5FLMC 3S1QK 2E2HK 1O2BA 4G0VA 3DXJA 2GSOA 2ZFZA 4C3IK 2R7ZK 4LK0A 2PMZD 4BXXC 3H3VL 2XCRB 3LAJA 3HOVC 2VUMK 1WCMC 2W7VA 4A3MK 4C3HK 2RGRA 3S15C 3RZOC 1X31C 4BXXK 1C0AA 2R93K 3EQLA 2Y0SL 3HOXC 1TWCK 3OEPA 3T00A 3HOWK 1Y1VK 2V6SA 4P5BA 5M5YK 1XZPA 4A3FC 4A3KC 3GEEA 1PJ7A 3AD7C 1IQ0A 3BP3A 4JK1A 3QX3A 2XCQA 4MEYA 2XCOA 4A3GK 3FKIA 1INNA 1TWFK 3S2DK 5C4XC 2JA7C 4Y52C 1YCLA 1PJ6A 2JA7A 1DCOA 1J6VA 1TWHK 2Y3PA 3S16K 1I3QA 4KARA 2JH3A 3IPJA 3S14K 1ZQ1C 5IP7C 5IYCK 3CQZC 1AB4A 2YU9A 4LR2A 2CFAA 1HI9A 1VH2A 1EQRA 4YFNA 1WSVA 4QIWL 5M3FK 2JA8K 1HQMA 2RH6A 4C3JK 1GE9A 4DDQA 2PA8D 1Y1VC 3AD8C 4A3FK 1TWAA 1USOA 3I4NK 4OIRA 3GTOC 4GT9A 4X6AK 1J98A 4KATA 2B63A 2A69A 3AH5A 1KQ4A 1VLOA 3GTMA 4GFQA 5TMCA 3PO3K 3GTKC 1SMYA 4G7ZA 3M4OK 4GZYA 1F7VA 3GTPK 5M5XK 1DCPA 3AQOA 1I50K 5IYBK 4GTAA 1YNNA 4GTDA 3BUEA 1F9NA 3S1NK 1O25A 2PA8L 1TWHC 1VGXA 4A3IK 1EH1A 5C3EC 1EFWA 5EGHA 4PAAA 4A3BK 3GIRA 4KM8A 3GTOA 2NVYC 3L4JA 3S1QC 1TWAC 2E2IK 1JVIA 3N0CA 2PMZL 3H3VD 4A93C 2ZUFA 3S1RC 4KN7A 2NVXK 4ILDA 3FKIK 2Y0SD 2GAGC 1EK8A 3GTOK 3S2HK 3TFJA 4GTEA 3GEIA 5L46A 4Y7NC 3GDZA 5IORA 1WOOA 1ZVUA 2E2HC 4MEXA 2JA7K 2P8TA 4AH6A 4C3IC 3I4MK 3JSTA 2V6TA 2CW0A 1IBAA 2WB1L 1VRQC 3A8JA 2JA5C 2B63C 4OIOA 1O26A 4A3EK 1IW7A 2JA6A 4QJVA 3ERED 4A3IC 3GTGC 4ZH4A 1TWGK 3AD9C 3AQPA 4A3DC 5C44K 4BY1C 3N0BA 3GTGA 4A3BC 3N3YA 2O5IA 1I6VA 1TWAK 2E2IC 3K7AC 4GTFA 2A6HA 2NVTK 4Q5SA 4AYBL 4A3JC 4BBRC 2BE5A 2WB1D 3K7AK 1XZPB 4LLGA 1YX2A 2NVXC 4A3KK 5IP9C 2R92K 1USMA 3GTLA 1J6WA 5IOTA 4FM9A 3L4KA 3GTPA 4BBSC 1WOSA 2E2JK 5IP9K 2R92C 3S1MC 3VA7A 4C2MK 3GSIA 4G7OA 1K83K 3CQZK 4KM9A 4AYBD 2A6EA 3SZYA 3GTQC 3HOZC 4Y52K 2YU9C 3S1MK 1XZQA 3GTQA 1K83C 3H0GK 2WAQD 5IYBC 1I50C 2GAHC 2EBBA 4BY1K 5IP7K 1R9TC 4KB2A 3GTJC 3FHZA 3H0GC 2R93C 1DCHA 5FLMK 2NVXA 1WCMA 4LQYA 4XSXA 4XSZA 4KN4A 4WILA 3HOYC 2NVYK 3S0XA 1ISEA 5M5WK 2PPBA 3SZZA 3S17K 4C3JC 1L0WA 3GTLC 3RZDK 3MMLB 4M1XA 1BJTA 1WOPA 1TWFA 4GTLA 1O29A 3TTGA 1TWGA 4QJVB 4A3CC 2PHCB 4P9SA 1R9TA 3S2HC 2JA6K 3PO2K 2B63K 2NVYA 1J6XA 1I50A 4KMDA 2D6FC 1ZBSA 4OIPA 5TJ3A 4C3HC 3WODA 1JOEA 2NVQK 5IYDC 1TWHA 1VJEA 1WIHA 1IS1A 5IYCC 5C4XK 3S2DC 3GTKA 5FJ8K 1IE0A 4MQ9A 4O2DA 2FQOA 1G51A 4XLPA 1R9TK 4A3EC 2VUMC 4PABA 3HOUK 2VUMA 1TWGC 5JFEA 1B4AA 4NOIA 4LJZA 3M3YK 2A68A 4A93K 4A3LK 1BS2A 3HOYK 3BP8C 3HOUC 3S1RK 3ADAC 4J3NA 3FOEA 2E2JC 4WJ4A 5E68A 1Y1VA 3FKIC 4BBRK 4XCHA 5C4JK 1K83A 1BGWA 3GEHA 4KAWX 2KWAA 5CJ9A 4A3GC 3PO2C 2GSUA 4KMUA 4BBSK 2ZUEA 4GTCA 4KMHA 1I3QC 1F93A 5D4DA 2E2HA 3M4OC 1WORA 1O27A 1Y1WC 3S16C 4LOWA 4A3DK 3S15K 3HOZK 3S14C 4C45A 2O5JA 5JVOA 1PJ5A 2WAQL 5IOQA 1TWCC 1O28A 3V4GA 3S17C 3HOWC 2V6UA 1I6HC 4KDDA 3RZDC 3GTMC 4G0UA 2NVTC 3A8KA 2P5MA 4A3LC 4A3MC 1XZQB 1JQWA 3CAGA 1I6HK 4A3CK 1BDFA 1V5VA 3GTJA 1F7UA 1UV7A 1XXBA 5C3EK 2JA5K 1WQHA 1WCMK 4WJ3M 3OPFA 3NUHA 4KASA 1SFOK 2YU9K 4BLAA 1TWFC 3G4AA 1SFOC 4LK1A 5EGEA 5CHPA 3H0GA 3TFIA 2FQTA 5C44C 3FOFA 4P5AA 3LPXA 4Y7NK 3T01A 1RU0A 3OREA 1DD5A 2R93A 1WSRA 5TMFA 3I4MC 3LAPA 3M3YC 4OIQA 5IYDK 3CQZA 2GSNA 3GTPC 4G7HA 3GTGK 1O2AA 4X6AC 3S1NC 4YG2A 3G4CA 4BLBA 1XXAA 1YNJA 3A8IA 4KC6A 3HKZD 4XLNA 5IOSA 4RMFA 1ZXOA 4YFKA 3PO3C 3HOVK 1IL2A 4QIWD 2JA8C 4Q4ZA 2R7ZA 4BY7K 4GTBA 4OINA 3RZOK 1I3QK 3GTMK 4YFXA 2E2IA 1WQFA 3HOXK 3I4NC 1O24A 4BY7C 1Y1WA 3HXAA 3GTJK 4BKWA 1EI6A 3T02A 4A3JK 1O2FB 1ZYRA 3HKZL 2CFAB 2JA5A 1WQGA 3GTQK 1B4BA 2JA6C 5HL8A 5C4JC 2R92A 4KMAA 3GTLK 1SFOA 1XXCA 3TFHA 1Y1WK 5M3MK 4G0WA 4KB4A
chains in the Genus database with same CATH topology
1IQ0A 3GDZA 1F7UA 1BS2A 2ZUFA 2ZUEA 1F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ0 A;  3GDZ A;  1F7U A;  1BS2 A;  2ZUF A;  2ZUE A;  1F7V A; 
#chains in the Genus database with same CATH topology
 2NVQ C;  3Q3Q A;  1TWC A;  2R7Z C;  4C2M C;  3GTK K;  1XPP A;  4FZB A;  5FLM C;  3S1Q K;  2E2H K;  1O2B A;  4G0V A;  3DXJ A;  2GSO A;  2ZFZ A;  4C3I K;  2R7Z K;  4LK0 A;  2PMZ D;  4BXX C;  3H3V L;  2XCR B;  3LAJ A;  3HOV C;  2VUM K;  1WCM C;  2W7V A;  4A3M K;  4C3H K;  2RGR A;  3S15 C;  3RZO C;  1X31 C;  4BXX K;  1C0A A;  2R93 K;  3EQL A;  2Y0S L;  3HOX C;  1TWC K;  3OEP A;  3T00 A;  3HOW K;  1Y1V K;  2V6S A;  4P5B A;  5M5Y K;  1XZP A;  4A3F C;  4A3K C;  3GEE A;  1PJ7 A;  3AD7 C;  1IQ0 A;  3BP3 A;  4JK1 A;  3QX3 A;  2XCQ A;  4MEY A;  2XCO A;  4A3G K;  3FKI A;  1INN A;  1TWF K;  3S2D K;  5C4X C;  2JA7 C;  4Y52 C;  1YCL A;  1PJ6 A;  2JA7 A;  1DCO A;  1J6V A;  1TWH K;  2Y3P A;  3S16 K;  1I3Q A;  4KAR A;  2JH3 A;  3IPJ A;  3S14 K;  1ZQ1 C;  5IP7 C;  5IYC K;  3CQZ C;  1AB4 A;  2YU9 A;  4LR2 A;  2CFA A;  1HI9 A;  1VH2 A;  1EQR A;  4YFN A;  1WSV A;  4QIW L;  5M3F K;  2JA8 K;  1HQM A;  2RH6 A;  4C3J K;  1GE9 A;  4DDQ A;  2PA8 D;  1Y1V C;  3AD8 C;  4A3F K;  1TWA A;  1USO A;  3I4N K;  4OIR A;  3GTO C;  4GT9 A;  4X6A K;  1J98 A;  4KAT A;  2B63 A;  2A69 A;  3AH5 A;  1KQ4 A;  1VLO A;  3GTM A;  4GFQ A;  5TMC A;  3PO3 K;  3GTK C;  1SMY A;  4G7Z A;  3M4O K;  4GZY A;  1F7V A;  3GTP K;  5M5X K;  1DCP A;  3AQO A;  1I50 K;  5IYB K;  4GTA A;  1YNN A;  4GTD A;  3BUE A;  1F9N A;  3S1N K;  1O25 A;  2PA8 L;  1TWH C;  1VGX A;  4A3I K;  1EH1 A;  5C3E C;  1EFW A;  5EGH A;  4PAA A;  4A3B K;  3GIR A;  4KM8 A;  3GTO A;  2NVY C;  3L4J A;  3S1Q C;  1TWA C;  2E2I K;  1JVI A;  3N0C A;  2PMZ L;  3H3V D;  4A93 C;  2ZUF A;  3S1R C;  4KN7 A;  2NVX K;  4ILD A;  3FKI K;  2Y0S D;  2GAG C;  1EK8 A;  3GTO K;  3S2H K;  3TFJ A;  4GTE A;  3GEI A;  5L46 A;  4Y7N C;  3GDZ A;  5IOR A;  1WOO A;  1ZVU A;  2E2H C;  4MEX A;  2JA7 K;  2P8T A;  4AH6 A;  4C3I C;  3I4M K;  3JST A;  2V6T A;  2CW0 A;  1IBA A;  2WB1 L;  1VRQ C;  3A8J A;  2JA5 C;  2B63 C;  4OIO A;  1O26 A;  4A3E K;  1IW7 A;  2JA6 A;  4QJV A;  3ERE D;  4A3I C;  3GTG C;  4ZH4 A;  1TWG K;  3AD9 C;  3AQP A;  4A3D C;  5C44 K;  4BY1 C;  3N0B A;  3GTG A;  4A3B C;  3N3Y A;  2O5I A;  1I6V A;  1TWA K;  2E2I C;  3K7A C;  4GTF A;  2A6H A;  2NVT K;  4Q5S A;  4AYB L;  4A3J C;  4BBR C;  2BE5 A;  2WB1 D;  3K7A K;  1XZP B;  4LLG A;  1YX2 A;  2NVX C;  4A3K K;  5IP9 C;  2R92 K;  1USM A;  3GTL A;  1J6W A;  5IOT A;  4FM9 A;  3L4K A;  3GTP A;  4BBS C;  1WOS A;  2E2J K;  5IP9 K;  2R92 C;  3S1M C;  3VA7 A;  4C2M K;  3GSI A;  4G7O A;  1K83 K;  3CQZ K;  4KM9 A;  4AYB D;  2A6E A;  3SZY A;  3GTQ C;  3HOZ C;  4Y52 K;  2YU9 C;  3S1M K;  1XZQ A;  3GTQ A;  1K83 C;  3H0G K;  2WAQ D;  5IYB C;  1I50 C;  2GAH C;  2EBB A;  4BY1 K;  5IP7 K;  1R9T C;  4KB2 A;  3GTJ C;  3FHZ A;  3H0G C;  2R93 C;  1DCH A;  5FLM K;  2NVX A;  1WCM A;  4LQY A;  4XSX A;  4XSZ A;  4KN4 A;  4WIL A;  3HOY C;  2NVY K;  3S0X A;  1ISE A;  5M5W K;  2PPB A;  3SZZ A;  3S17 K;  4C3J C;  1L0W A;  3GTL C;  3RZD K;  3MML B;  4M1X A;  1BJT A;  1WOP A;  1TWF A;  4GTL A;  1O29 A;  3TTG A;  1TWG A;  4QJV B;  4A3C C;  2PHC B;  4P9S A;  1R9T A;  3S2H C;  2JA6 K;  3PO2 K;  2B63 K;  2NVY A;  1J6X A;  1I50 A;  4KMD A;  2D6F C;  1ZBS A;  4OIP A;  5TJ3 A;  4C3H C;  3WOD A;  1JOE A;  2NVQ K;  5IYD C;  1TWH A;  1VJE A;  1WIH A;  1IS1 A;  5IYC C;  5C4X K;  3S2D C;  3GTK A;  5FJ8 K;  1IE0 A;  4MQ9 A;  4O2D A;  2FQO A;  1G51 A;  4XLP A;  1R9T K;  4A3E C;  2VUM C;  4PAB A;  3HOU K;  2VUM A;  1TWG C;  5JFE A;  1B4A A;  4NOI A;  4LJZ A;  3M3Y K;  2A68 A;  4A93 K;  4A3L K;  1BS2 A;  3HOY K;  3BP8 C;  3HOU C;  3S1R K;  3ADA C;  4J3N A;  3FOE A;  2E2J C;  4WJ4 A;  5E68 A;  1Y1V A;  3FKI C;  4BBR K;  4XCH A;  5C4J K;  1K83 A;  1BGW A;  3GEH A;  4KAW X;  2KWA A;  5CJ9 A;  4A3G C;  3PO2 C;  2GSU A;  4KMU A;  4BBS K;  2ZUE A;  4GTC A;  4KMH A;  1I3Q C;  1F93 A;  5D4D A;  2E2H A;  3M4O C;  1WOR A;  1O27 A;  1Y1W C;  3S16 C;  4LOW A;  4A3D K;  3S15 K;  3HOZ K;  3S14 C;  4C45 A;  2O5J A;  5JVO A;  1PJ5 A;  2WAQ L;  5IOQ A;  1TWC C;  1O28 A;  3V4G A;  3S17 C;  3HOW C;  2V6U A;  1I6H C;  4KDD A;  3RZD C;  3GTM C;  4G0U A;  2NVT C;  3A8K A;  2P5M A;  4A3L C;  4A3M C;  1XZQ B;  1JQW A;  3CAG A;  1I6H K;  4A3C K;  1BDF A;  1V5V A;  3GTJ A;  1F7U A;  1UV7 A;  1XXB A;  5C3E K;  2JA5 K;  1WQH A;  1WCM K;  4WJ3 M;  3OPF A;  3NUH A;  4KAS A;  1SFO K;  2YU9 K;  4BLA A;  1TWF C;  3G4A A;  1SFO C;  4LK1 A;  5EGE A;  5CHP A;  3H0G A;  3TFI A;  2FQT A;  5C44 C;  3FOF A;  4P5A A;  3LPX A;  4Y7N K;  3T01 A;  1RU0 A;  3ORE A;  1DD5 A;  2R93 A;  1WSR A;  5TMF A;  3I4M C;  3LAP A;  3M3Y C;  4OIQ A;  5IYD K;  3CQZ A;  2GSN A;  3GTP C;  4G7H A;  3GTG K;  1O2A A;  4X6A C;  3S1N C;  4YG2 A;  3G4C A;  4BLB A;  1XXA A;  1YNJ A;  3A8I A;  4KC6 A;  3HKZ D;  4XLN A;  5IOS A;  4RMF A;  1ZXO A;  4YFK A;  3PO3 C;  3HOV K;  1IL2 A;  4QIW D;  2JA8 C;  4Q4Z A;  2R7Z A;  4BY7 K;  4GTB A;  4OIN A;  3RZO K;  1I3Q K;  3GTM K;  4YFX A;  2E2I A;  1WQF A;  3HOX K;  3I4N C;  1O24 A;  4BY7 C;  1Y1W A;  3HXA A;  3GTJ K;  4BKW A;  1EI6 A;  3T02 A;  4A3J K;  1O2F B;  1ZYR A;  3HKZ L;  2CFA B;  2JA5 A;  1WQG A;  3GTQ K;  1B4B A;  2JA6 C;  5HL8 A;  5C4J C;  2R92 A;  4KMA A;  3GTL K;  1SFO A;  1XXC A;  3TFH A;  1Y1W K;  5M3M K;  4G0W A;  4KB4 A; 
#chains in the Genus database with same CATH homology
 1IQ0 A;  3GDZ A;  1F7U A;  1BS2 A;  2ZUF A;  2ZUE A;  1F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...