3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginyl-tRNA synthetase
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Ligase
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
2ZUEA 1F7VA 1F7UA 3GDZA 2ZUFA 1BS2A 1IQ0A
chains in the Genus database with same CATH superfamily
2NVXA 5EGEA 2PHCB 3GTJC 4BBSC 3RZOC 3HOUK 3GTQA 3S1QK 2PPBA 4KB2A 2PA8D 4XLPA 4A93C 4M1XA 2D6FC 4Q5SA 2XCQA 3HOXC 1DD5A 3H0GK 3GTOC 1WSRA 3AD7C 1I50K 2ZFZA 5C3EK 1V5VA 3GEIA 4A3MC 1Y1WA 1TWAC 4YFNA 3SZZA 3N0CA 3M3YC 1TWGK 1J6WA 5IOTA 4A3IK 2JA6A 4OIPA 4KDDA 4OIOA 1WQHA 4QIWD 3GTMK 2KWAA 4GTDA 3M4OK 1C0AA 2VUMK 1O24A 3PO2K 2JA7K 5C4JC 3V4GA 1TWFC 4LR2A 4FZBA 4BY1C 3CAGA 1JQWA 2A69A 1IL2A 1EI6A 5TMCA 3GTJA 3HOXK 4WJ4A 4GT9A 4QJVB 3VA7A 4WILA 4Y7NC 5JFEA 4BLBA 2R93A 3BUEA 3HOWC 3OREA 1Y1VC 4G0WA 1B4AA 2NVYK 1I6HC 5IOQA 5IYBC 3FOFA 3WODA 1SFOC 3GEEA 4QJVA 1TWAA 4KMUA 4C3HK 1O27A 2P5MA 2B63A 4XCHA 4BBRK 1UV7A 2E2IA 3GDZA 3TFHA 3G4CA 4BY1K 3GTGA 1O29A 2R92K 1KQ4A 1L0WA 4A3KK 4A3FC 2R7ZK 3S2HK 2PMZD 3AQPA 2A6HA 4BY7K 3I4MC 4O2DA 1IS1A 2EBBA 4PABA 4BXXK 1WORA 3T01A 3H3VD 1TWHC 5CJ9A 5IYDK 1BGWA 3S1NK 2ZUFA 2PMZL 1YNJA 1GE9A 1Y1VA 1XXAA 2YU9A 3HOUC 1TWCK 3HOYK 3S1QC 2XCRB 4C45A 1I3QK 3SZYA 4Y52K 5TMFA 4A3FK 3H3VL 2NVTK 1I50C 5C3EC 3HOVK 2CW0A 5L46A 3S16K 1ZVUA 1XZPB 1TWGC 3GTLA 4LQYA 4A3IC 3JSTA 5C44K 4KATA 4NOIA 3GTMC 4XSZA 4G0VA 4KN7A 3M4OC 3OEPA 3G4AA 2VUMC 1K83K 4MEXA 3PO2C 2JA7C 3HXAA 4G7HA 1YX2A 1XZQB 4GTCA 4JK1A 2NVXK 4LK0A 3K7AK 1XZPA 4KARA 4FM9A 3A8KA 4AYBD 4P5BA 2W7VA 1PJ6A 3T00A 4G7OA 4GTAA 1RU0A 1WCMK 1XZQA 2GAHC 4GZYA 4A3JK 2NVYC 3FKIA 1BS2A 3H0GA 2PA8L 5D4DA 4AYBL 4MQ9A 3AH5A 1HI9A 4C3HC 5JVOA 5C4XK 4A3GC 4BBRC 3GIRA 1TWGA 4C3JC 1B4BA 4KAWX 3AD8C 2E2HK 2V6TA 1ISEA 4BKWA 2R92C 1O28A 3GTMA 4A3KC 2GSNA 1YNNA 2R7ZC 2VUMA 1WIHA 2WB1D 3S2HC 1X31C 2JA7A 4QIWL 1J6XA 4BY7C 1VH2A 1ZBSA 1J98A 5EGHA 2V6SA 4GTEA 2RGRA 4BXXC 4KN4A 3TTGA 4X6AK 2R93K 3N3YA 3GTOA 5FJ8K 1BJTA 1DCOA 5IYDC 3S1NC 3S2DK 2WB1L 3RZDK 3GTKK 4A3GK 1TWCC 3HOYC 4C3JK 2NVYA 4A3LC 4PAAA 3IPJA 1I3QC 4Y52C 2B63K 3S1MK 3GTPK 1ZQ1C 2NVTC 1HQMA 1PJ7A 4YFXA 3GTGK 4G0UA 3HOVC 3Q3QA 4MEYA 1EFWA 3LPXA 3S14K 3S16C 1TWFA 1R9TK 3HKZD 5IOSA 2JH3A 2R92A 2NVQK 5FLMK 4KMAA 5C44C 4A3EK 2O5JA 3HOZK 2R7ZA 1VRQC 3CQZK 1JVIA 5IYCK 3A8IA 1K83C 4A3DK 1J6VA 2NVXC 3K7AC 4A3LK 3HKZL 4RMFA 1DCHA 1SFOA 2YU9K 2BE5A 5M3FK 3GTQC 4YFKA 2GSUA 3L4JA 4OINA 1TWCA 3OPFA 5IP7K 2JA5K 1WCMC 5M3MK 1I3QA 4A3CK 1ZYRA 4A3JC 1O2BA 3BP3A 1EK8A 1IBAA 1EQRA 4KM8A 2CFAB 3GTLK 3DXJA 3GSIA 5C4XC 3I4NC 3QX3A 4KMDA 4DDQA 4LOWA 2E2HC 5M5WK 1USOA 1TWHA 4C2MK 1XXBA 2E2JK 4LK1A 3S1RC 3GTQK 2XCOA 1K83A 4KM9A 2CFAA 2JA8K 5HL8A 3AD9C 3S15C 5IP9K 4X6AC 3NUHA 4J3NA 2R93C 3EQLA 4OIQA 1Y1WK 1F9NA 4WJ3M 4YG2A 1I50A 4A3BK 4GTFA 2GAGC 1DCPA 3S2DC 1WCMA 3FKIK 3RZDC 3GTKC 2JA6K 3FHZA 3I4NK 2WAQD 4ZH4A 1ZXOA 3PO3C 1F7UA 4AH6A 4KC6A 2FQTA 2B63C 3S1MC 3GTPC 3TFIA 3ADAC 3S1RK 2E2IC 4KB4A 2ZUEA 4C3IK 2GSOA 3S0XA 3GTGC 4ILDA 3S17K 1I6VA 3AQOA 5CHPA 1VGXA 3S14C 1R9TC 2E2HA 1O26A 3GTJK 1XPPA 2FQOA 2RH6A 4Q4ZA 4BBSK 2WAQL 2NVQC 3S15K 3RZOK 5FLMC 4A3EC 3HOZC 3CQZC 2O5IA 3FOEA 1IQ0A 5IYCC 4A93K 3L4KA 4A3DC 4GTBA 1VJEA 3GTOK 4P9SA 1O2FB 3N0BA 4KASA 1IE0A 3PO3K 5M5YK 3A8JA 5IORA 4A3MK 1TWAK 4BLAA 2YU9C 3M3YK 1O2AA 4XSXA 1F93A 2E2IK 5TJ3A 2A6EA 4OIRA 3GTKA 1O25A 2Y3PA 1WQFA 5IP7C 2JA5C 1VLOA 1WOSA 1BDFA 4A3CC 1XXCA 3BP8C 3LAPA 3GTPA 5C4JK 1PJ5A 5E68A 1TWFK 1WOOA 1INNA 1JOEA 1R9TA 3GTLC 2Y0SD 1G51A 4GTLA 4Y7NK 1WOPA 1YCLA 3HOWK 4C2MC 1SMYA 2E2JC 1WSVA 1Y1VK 3CQZA 4G7ZA 4GFQA 1I6HK 1WQGA 1AB4A 4LJZA 3MMLB 1EH1A 5IYBK 3LAJA 1SFOK 2Y0SL 2JA8C 1USMA 2A68A 5IP9C 4P5AA 3T02A 1Y1WC 4A3BC 3TFJA 1IW7A 5M5XK 2JA5A 1F7VA 3FKIC 2P8TA 3H0GC 4XLNA 2JA6C 3ERED 4KMHA 3I4MK 2V6UA 4LLGA 3GEHA 4C3IC 3S17C 1TWHK
chains in the Genus database with same CATH topology
2ZUEA 1F7VA 1F7UA 3GDZA 2ZUFA 1BS2A 1IQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUE A;  1F7V A;  1F7U A;  3GDZ A;  2ZUF A;  1BS2 A;  1IQ0 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  5EGE A;  2PHC B;  3GTJ C;  4BBS C;  3RZO C;  3HOU K;  3GTQ A;  3S1Q K;  2PPB A;  4KB2 A;  2PA8 D;  4XLP A;  4A93 C;  4M1X A;  2D6F C;  4Q5S A;  2XCQ A;  3HOX C;  1DD5 A;  3H0G K;  3GTO C;  1WSR A;  3AD7 C;  1I50 K;  2ZFZ A;  5C3E K;  1V5V A;  3GEI A;  4A3M C;  1Y1W A;  1TWA C;  4YFN A;  3SZZ A;  3N0C A;  3M3Y C;  1TWG K;  1J6W A;  5IOT A;  4A3I K;  2JA6 A;  4OIP A;  4KDD A;  4OIO A;  1WQH A;  4QIW D;  3GTM K;  2KWA A;  4GTD A;  3M4O K;  1C0A A;  2VUM K;  1O24 A;  3PO2 K;  2JA7 K;  5C4J C;  3V4G A;  1TWF C;  4LR2 A;  4FZB A;  4BY1 C;  3CAG A;  1JQW A;  2A69 A;  1IL2 A;  1EI6 A;  5TMC A;  3GTJ A;  3HOX K;  4WJ4 A;  4GT9 A;  4QJV B;  3VA7 A;  4WIL A;  4Y7N C;  5JFE A;  4BLB A;  2R93 A;  3BUE A;  3HOW C;  3ORE A;  1Y1V C;  4G0W A;  1B4A A;  2NVY K;  1I6H C;  5IOQ A;  5IYB C;  3FOF A;  3WOD A;  1SFO C;  3GEE A;  4QJV A;  1TWA A;  4KMU A;  4C3H K;  1O27 A;  2P5M A;  2B63 A;  4XCH A;  4BBR K;  1UV7 A;  2E2I A;  3GDZ A;  3TFH A;  3G4C A;  4BY1 K;  3GTG A;  1O29 A;  2R92 K;  1KQ4 A;  1L0W A;  4A3K K;  4A3F C;  2R7Z K;  3S2H K;  2PMZ D;  3AQP A;  2A6H A;  4BY7 K;  3I4M C;  4O2D A;  1IS1 A;  2EBB A;  4PAB A;  4BXX K;  1WOR A;  3T01 A;  3H3V D;  1TWH C;  5CJ9 A;  5IYD K;  1BGW A;  3S1N K;  2ZUF A;  2PMZ L;  1YNJ A;  1GE9 A;  1Y1V A;  1XXA A;  2YU9 A;  3HOU C;  1TWC K;  3HOY K;  3S1Q C;  2XCR B;  4C45 A;  1I3Q K;  3SZY A;  4Y52 K;  5TMF A;  4A3F K;  3H3V L;  2NVT K;  1I50 C;  5C3E C;  3HOV K;  2CW0 A;  5L46 A;  3S16 K;  1ZVU A;  1XZP B;  1TWG C;  3GTL A;  4LQY A;  4A3I C;  3JST A;  5C44 K;  4KAT A;  4NOI A;  3GTM C;  4XSZ A;  4G0V A;  4KN7 A;  3M4O C;  3OEP A;  3G4A A;  2VUM C;  1K83 K;  4MEX A;  3PO2 C;  2JA7 C;  3HXA A;  4G7H A;  1YX2 A;  1XZQ B;  4GTC A;  4JK1 A;  2NVX K;  4LK0 A;  3K7A K;  1XZP A;  4KAR A;  4FM9 A;  3A8K A;  4AYB D;  4P5B A;  2W7V A;  1PJ6 A;  3T00 A;  4G7O A;  4GTA A;  1RU0 A;  1WCM K;  1XZQ A;  2GAH C;  4GZY A;  4A3J K;  2NVY C;  3FKI A;  1BS2 A;  3H0G A;  2PA8 L;  5D4D A;  4AYB L;  4MQ9 A;  3AH5 A;  1HI9 A;  4C3H C;  5JVO A;  5C4X K;  4A3G C;  4BBR C;  3GIR A;  1TWG A;  4C3J C;  1B4B A;  4KAW X;  3AD8 C;  2E2H K;  2V6T A;  1ISE A;  4BKW A;  2R92 C;  1O28 A;  3GTM A;  4A3K C;  2GSN A;  1YNN A;  2R7Z C;  2VUM A;  1WIH A;  2WB1 D;  3S2H C;  1X31 C;  2JA7 A;  4QIW L;  1J6X A;  4BY7 C;  1VH2 A;  1ZBS A;  1J98 A;  5EGH A;  2V6S A;  4GTE A;  2RGR A;  4BXX C;  4KN4 A;  3TTG A;  4X6A K;  2R93 K;  3N3Y A;  3GTO A;  5FJ8 K;  1BJT A;  1DCO A;  5IYD C;  3S1N C;  3S2D K;  2WB1 L;  3RZD K;  3GTK K;  4A3G K;  1TWC C;  3HOY C;  4C3J K;  2NVY A;  4A3L C;  4PAA A;  3IPJ A;  1I3Q C;  4Y52 C;  2B63 K;  3S1M K;  3GTP K;  1ZQ1 C;  2NVT C;  1HQM A;  1PJ7 A;  4YFX A;  3GTG K;  4G0U A;  3HOV C;  3Q3Q A;  4MEY A;  1EFW A;  3LPX A;  3S14 K;  3S16 C;  1TWF A;  1R9T K;  3HKZ D;  5IOS A;  2JH3 A;  2R92 A;  2NVQ K;  5FLM K;  4KMA A;  5C44 C;  4A3E K;  2O5J A;  3HOZ K;  2R7Z A;  1VRQ C;  3CQZ K;  1JVI A;  5IYC K;  3A8I A;  1K83 C;  4A3D K;  1J6V A;  2NVX C;  3K7A C;  4A3L K;  3HKZ L;  4RMF A;  1DCH A;  1SFO A;  2YU9 K;  2BE5 A;  5M3F K;  3GTQ C;  4YFK A;  2GSU A;  3L4J A;  4OIN A;  1TWC A;  3OPF A;  5IP7 K;  2JA5 K;  1WCM C;  5M3M K;  1I3Q A;  4A3C K;  1ZYR A;  4A3J C;  1O2B A;  3BP3 A;  1EK8 A;  1IBA A;  1EQR A;  4KM8 A;  2CFA B;  3GTL K;  3DXJ A;  3GSI A;  5C4X C;  3I4N C;  3QX3 A;  4KMD A;  4DDQ A;  4LOW A;  2E2H C;  5M5W K;  1USO A;  1TWH A;  4C2M K;  1XXB A;  2E2J K;  4LK1 A;  3S1R C;  3GTQ K;  2XCO A;  1K83 A;  4KM9 A;  2CFA A;  2JA8 K;  5HL8 A;  3AD9 C;  3S15 C;  5IP9 K;  4X6A C;  3NUH A;  4J3N A;  2R93 C;  3EQL A;  4OIQ A;  1Y1W K;  1F9N A;  4WJ3 M;  4YG2 A;  1I50 A;  4A3B K;  4GTF A;  2GAG C;  1DCP A;  3S2D C;  1WCM A;  3FKI K;  3RZD C;  3GTK C;  2JA6 K;  3FHZ A;  3I4N K;  2WAQ D;  4ZH4 A;  1ZXO A;  3PO3 C;  1F7U A;  4AH6 A;  4KC6 A;  2FQT A;  2B63 C;  3S1M C;  3GTP C;  3TFI A;  3ADA C;  3S1R K;  2E2I C;  4KB4 A;  2ZUE A;  4C3I K;  2GSO A;  3S0X A;  3GTG C;  4ILD A;  3S17 K;  1I6V A;  3AQO A;  5CHP A;  1VGX A;  3S14 C;  1R9T C;  2E2H A;  1O26 A;  3GTJ K;  1XPP A;  2FQO A;  2RH6 A;  4Q4Z A;  4BBS K;  2WAQ L;  2NVQ C;  3S15 K;  3RZO K;  5FLM C;  4A3E C;  3HOZ C;  3CQZ C;  2O5I A;  3FOE A;  1IQ0 A;  5IYC C;  4A93 K;  3L4K A;  4A3D C;  4GTB A;  1VJE A;  3GTO K;  4P9S A;  1O2F B;  3N0B A;  4KAS A;  1IE0 A;  3PO3 K;  5M5Y K;  3A8J A;  5IOR A;  4A3M K;  1TWA K;  4BLA A;  2YU9 C;  3M3Y K;  1O2A A;  4XSX A;  1F93 A;  2E2I K;  5TJ3 A;  2A6E A;  4OIR A;  3GTK A;  1O25 A;  2Y3P A;  1WQF A;  5IP7 C;  2JA5 C;  1VLO A;  1WOS A;  1BDF A;  4A3C C;  1XXC A;  3BP8 C;  3LAP A;  3GTP A;  5C4J K;  1PJ5 A;  5E68 A;  1TWF K;  1WOO A;  1INN A;  1JOE A;  1R9T A;  3GTL C;  2Y0S D;  1G51 A;  4GTL A;  4Y7N K;  1WOP A;  1YCL A;  3HOW K;  4C2M C;  1SMY A;  2E2J C;  1WSV A;  1Y1V K;  3CQZ A;  4G7Z A;  4GFQ A;  1I6H K;  1WQG A;  1AB4 A;  4LJZ A;  3MML B;  1EH1 A;  5IYB K;  3LAJ A;  1SFO K;  2Y0S L;  2JA8 C;  1USM A;  2A68 A;  5IP9 C;  4P5A A;  3T02 A;  1Y1W C;  4A3B C;  3TFJ A;  1IW7 A;  5M5X K;  2JA5 A;  1F7V A;  3FKI C;  2P8T A;  3H0G C;  4XLN A;  2JA6 C;  3ERE D;  4KMH A;  3I4M K;  2V6U A;  4LLG A;  3GEH A;  4C3I C;  3S17 C;  1TWH K; 
#chains in the Genus database with same CATH homology
 2ZUE A;  1F7V A;  1F7U A;  3GDZ A;  2ZUF A;  1BS2 A;  1IQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...