3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginyl-tRNA synthetase
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Ligase
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
1F7UA 3GDZA 2ZUFA 1IQ0A 1F7VA 2ZUEA 1BS2A
chains in the Genus database with same CATH superfamily
3M3YC 2BE5A 4G0WA 2NVYK 3PO3C 3S2DK 3GTKA 1O2BA 3BP8C 1EH1A 4XLPA 5C3EK 5TMCA 4BBRC 3HXAA 1WCMK 3AD9C 2CW0A 1WIHA 3AQOA 4GT9A 4P9SA 2A6EA 2R92A 4WJ4A 3K7AK 1BJTA 3CAGA 1F93A 4GTAA 2Y3PA 2W7VA 3M3YK 1EK8A 2R92C 3PO3K 3GTMK 5EGHA 2XCQA 3QX3A 3RZOC 3N0BA 4BBRK 1O24A 3FOFA 1F9NA 1YNNA 4WJ3M 5TJ3A 3VA7A 4A3JC 4A3KC 1YX2A 1B4BA 1L0WA 4YG2A 1BS2A 3WODA 1JQWA 3FOEA 5IP9C 1R9TA 4C3IC 1TWAA 1DD5A 4FM9A 5IYDK 5EGEA 1DCOA 1DCHA 1TWCA 4P5BA 4KMAA 4A3LC 3OEPA 5FLMC 1EFWA 2XCRB 2GAGC 4A3MC 1TWCC 1ZVUA 2NVQC 3TFIA 3AD7C 4KASA 4A3JK 4A3KK 4BBSK 3LPXA 4A3CC 4P5AA 4A3IC 4KDDA 4C45A 5M5XK 1I3QC 4KAWX 2E2JC 2VUMK 3GTLA 4C3IK 1USMA 1I50A 3V4GA 2KWAA 3HOWC 4LOWA 4A3LK 4LK1A 3GTOA 4X6AC 1I50C 1IBAA 5IOTA 1EI6A 1ZYRA 2FQTA 4A3MK 5M3MK 2NVXK 4BKWA 2R93C 2E2IA 2D6FC 1KQ4A 4A3EC 3GTGC 2GSUA 3AQPA 1IW7A 3FHZA 1WOSA 4A3IK 2E2IC 2E2JK 1I3QK 2RH6A 2XCOA 4KMDA 1O26A 3HKZD 1Y1WA 1HI9A 4OIQA 3HKZL 1GE9A 3HOWK 4Y52C 4Q4ZA 3T01A 2YU9C 1Y1WC 3HOVK 3S14C 5TMFA 2R93K 4KC6A 2JA6A 1AB4A 2EBBA 2P5MA 4M1XA 2O5IA 3GTGK 4J3NA 1WQFA 4OIOA 3LAJA 4JK1A 4GTBA 3GTKC 1XZQB 2B63A 2E2HK 1TWHK 1JOEA 3A8KA 1BGWA 1VRQC 5FJ8K 3ERED 4AH6A 1JVIA 4BLBA 2A6HA 3ADAC 2PMZD 2YU9K 4KN7A 1Y1WK 2PMZL 3S14K 1TWGA 3HOXC 4RMFA 4A3FC 2JH3A 4A3GC 3PO2C 1SFOA 1WSRA 2GAHC 2R7ZA 1IS1A 3SZZA 4A3BC 1J98A 3GTQA 3GEHA 1ZQ1C 3GTKK 1SFOC 1UV7A 3JSTA 5M3FK 1I6HC 3GTQC 4FZBA 3SZYA 3H3VD 4DDQA 1XZPA 5IP7C 3H3VL 3S0XA 3HOXK 2JA7A 3BP3A 3DXJA 4WILA 4A3FK 2V6SA 4QIWD 2R92K 3HOYC 4A3GK 1WQHA 4QIWL 3S1NC 4KB2A 2O5JA 1O27A 3FKIA 4KMUA 4YFXA 3RZOK 1R9TC 3I4NC 1Y1VA 3CQZA 4MEYA 5JVOA 1WOOA 1TWAC 1K83A 4QJVA 1YCLA 4BLAA 3M4OC 2V6UA 4PABA 4GTDA 3A8JA 5L46A 1SFOK 3CQZC 1PJ7A 1K83C 4GTCA 3G4AA 1XZPB 4A93C 3GEIA 2A68A 3S2HC 5IP7K 5IP9K 4G7OA 4G0UA 4BY7C 3AD8C 3S1NK 2Y0SD 2RGRA 2Y0SL 1O28A 5CHPA 1TWFA 5JFEA 1R9TK 3I4NK 5FLMK 4AYBL 3GTLC 1TWAK 4XSZA 3S16C 3HOUC 2JA5A 1TWCK 1VH2A 2NVQK 1TWFC 2ZUFA 3LAPA 4BY1C 3GTOC 2CFAB 4XSXA 3H0GA 4A93K 3GTJA 4MEXA 3NUHA 4A3CK 1XXAA 3HOZC 3S2HK 1B4AA 5C4XC 2GSNA 3S17C 4BY7K 3H0GC 2NVYA 2A69A 3GTJC 3RZDC 3S1MC 2PA8L 3I4MC 1C0AA 2CFAA 4GTEA 3GTLK 1WSVA 4X6AK 1IL2A 1I50K 2PPBA 4LJZA 3S2DC 3S16K 3L4KA 4C3HC 4BY1K 3GTOK 4C3JC 4OIPA 1X31C 4A3EK 4Y7NC 1O25A 2V6TA 3TTGA 1XXBA 2WAQD 3GDZA 4GTFA 2JA6C 2WAQL 4GFQA 5C4XK 1YNJA 2E2IK 2FQOA 3S17K 1J6VA 4G0VA 4G7HA 3GTMA 3RZDK 3S1MK 3I4MK 1WORA 4GZYA 4KM9A 1F7UA 4Y52K 4A3DC 2B63C 3IPJA 3GTMC 3S1QC 3AH5A 1INNA 1EQRA 4YFNA 3GSIA 5IYCC 4C3HK 4C3JK 4Y7NK 1TWGC 2P8TA 5M5YK 2JA8C 2JA6K 4C2MC 5CJ9A 4OIRA 1V5VA 3TFJA 4OINA 3OREA 3GTPA 1WOPA 4PAAA 2R7ZC 1G51A 4LK0A 3GEEA 4NOIA 4A3DK 4GTLA 1O29A 2B63K 5IYDC 3S1QK 3S1RC 3BUEA 3T00A 3GTPC 3N0CA 4KN4A 3N3YA 5IYCK 3PO2K 3L4JA 5C44C 1TWGK 3MMLB 2JA7C 4KATA 2JA8K 4C2MK 1IE0A 5IOSA 4A3BK 2VUMA 1I6VA 1ISEA 3FKIC 4LLGA 4BBSC 1Y1VC 5IYBC 2R7ZK 5IORA 2VUMC 1I6HK 3GTQK 1WQGA 2WB1D 5M5WK 3S1RK 1VLOA 2WB1L 4BXXC 1ZXOA 3GTPK 4O2DA 2NVXA 5E68A 3HOYK 5IOQA 1F7VA 5HL8A 5C44K 1J6XA 1RU0A 5D4DA 1PJ6A 2JA7K 4QJVB 4AYBD 4YFKA 2NVXC 1USOA 4XLNA 1I3QA 3M4OK 4KM8A 3FKIK 3Q3QA 3A8IA 3S15C 1J6WA 1Y1VK 2GSOA 3CQZK 1VJEA 4MQ9A 1XXCA 5IYBK 1K83K 4ILDA 1IQ0A 3OPFA 2PHCB 2NVTC 3EQLA 2JA5C 4BXXK 1BDFA 4KMHA 2R93A 1HQMA 2PA8D 5C4JC 4LQYA 1SMYA 4ZH4A 3GTGA 3HOVC 3G4CA 4Q5SA 1DCPA 3T02A 3TFHA 1WCMA 2NVYC 3HOUK 1XPPA 2E2HA 3S15K 1TWFK 1PJ5A 1TWHA 5C3EC 1O2FB 1WCMC 1O2AA 2NVTK 2JA5K 3GIRA 2E2HC 3HOZK 2YU9A 1TWHC 2ZUEA 1XZQA 1ZBSA 4XCHA 3K7AC 2ZFZA 1VGXA 3H0GK 4KB4A 3GTJK 4G7ZA 4LR2A 5C4JK 4KARA
chains in the Genus database with same CATH topology
1F7UA 3GDZA 2ZUFA 1IQ0A 1F7VA 2ZUEA 1BS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7U A;  3GDZ A;  2ZUF A;  1IQ0 A;  1F7V A;  2ZUE A;  1BS2 A; 
#chains in the Genus database with same CATH topology
 3M3Y C;  2BE5 A;  4G0W A;  2NVY K;  3PO3 C;  3S2D K;  3GTK A;  1O2B A;  3BP8 C;  1EH1 A;  4XLP A;  5C3E K;  5TMC A;  4BBR C;  3HXA A;  1WCM K;  3AD9 C;  2CW0 A;  1WIH A;  3AQO A;  4GT9 A;  4P9S A;  2A6E A;  2R92 A;  4WJ4 A;  3K7A K;  1BJT A;  3CAG A;  1F93 A;  4GTA A;  2Y3P A;  2W7V A;  3M3Y K;  1EK8 A;  2R92 C;  3PO3 K;  3GTM K;  5EGH A;  2XCQ A;  3QX3 A;  3RZO C;  3N0B A;  4BBR K;  1O24 A;  3FOF A;  1F9N A;  1YNN A;  4WJ3 M;  5TJ3 A;  3VA7 A;  4A3J C;  4A3K C;  1YX2 A;  1B4B A;  1L0W A;  4YG2 A;  1BS2 A;  3WOD A;  1JQW A;  3FOE A;  5IP9 C;  1R9T A;  4C3I C;  1TWA A;  1DD5 A;  4FM9 A;  5IYD K;  5EGE A;  1DCO A;  1DCH A;  1TWC A;  4P5B A;  4KMA A;  4A3L C;  3OEP A;  5FLM C;  1EFW A;  2XCR B;  2GAG C;  4A3M C;  1TWC C;  1ZVU A;  2NVQ C;  3TFI A;  3AD7 C;  4KAS A;  4A3J K;  4A3K K;  4BBS K;  3LPX A;  4A3C C;  4P5A A;  4A3I C;  4KDD A;  4C45 A;  5M5X K;  1I3Q C;  4KAW X;  2E2J C;  2VUM K;  3GTL A;  4C3I K;  1USM A;  1I50 A;  3V4G A;  2KWA A;  3HOW C;  4LOW A;  4A3L K;  4LK1 A;  3GTO A;  4X6A C;  1I50 C;  1IBA A;  5IOT A;  1EI6 A;  1ZYR A;  2FQT A;  4A3M K;  5M3M K;  2NVX K;  4BKW A;  2R93 C;  2E2I A;  2D6F C;  1KQ4 A;  4A3E C;  3GTG C;  2GSU A;  3AQP A;  1IW7 A;  3FHZ A;  1WOS A;  4A3I K;  2E2I C;  2E2J K;  1I3Q K;  2RH6 A;  2XCO A;  4KMD A;  1O26 A;  3HKZ D;  1Y1W A;  1HI9 A;  4OIQ A;  3HKZ L;  1GE9 A;  3HOW K;  4Y52 C;  4Q4Z A;  3T01 A;  2YU9 C;  1Y1W C;  3HOV K;  3S14 C;  5TMF A;  2R93 K;  4KC6 A;  2JA6 A;  1AB4 A;  2EBB A;  2P5M A;  4M1X A;  2O5I A;  3GTG K;  4J3N A;  1WQF A;  4OIO A;  3LAJ A;  4JK1 A;  4GTB A;  3GTK C;  1XZQ B;  2B63 A;  2E2H K;  1TWH K;  1JOE A;  3A8K A;  1BGW A;  1VRQ C;  5FJ8 K;  3ERE D;  4AH6 A;  1JVI A;  4BLB A;  2A6H A;  3ADA C;  2PMZ D;  2YU9 K;  4KN7 A;  1Y1W K;  2PMZ L;  3S14 K;  1TWG A;  3HOX C;  4RMF A;  4A3F C;  2JH3 A;  4A3G C;  3PO2 C;  1SFO A;  1WSR A;  2GAH C;  2R7Z A;  1IS1 A;  3SZZ A;  4A3B C;  1J98 A;  3GTQ A;  3GEH A;  1ZQ1 C;  3GTK K;  1SFO C;  1UV7 A;  3JST A;  5M3F K;  1I6H C;  3GTQ C;  4FZB A;  3SZY A;  3H3V D;  4DDQ A;  1XZP A;  5IP7 C;  3H3V L;  3S0X A;  3HOX K;  2JA7 A;  3BP3 A;  3DXJ A;  4WIL A;  4A3F K;  2V6S A;  4QIW D;  2R92 K;  3HOY C;  4A3G K;  1WQH A;  4QIW L;  3S1N C;  4KB2 A;  2O5J A;  1O27 A;  3FKI A;  4KMU A;  4YFX A;  3RZO K;  1R9T C;  3I4N C;  1Y1V A;  3CQZ A;  4MEY A;  5JVO A;  1WOO A;  1TWA C;  1K83 A;  4QJV A;  1YCL A;  4BLA A;  3M4O C;  2V6U A;  4PAB A;  4GTD A;  3A8J A;  5L46 A;  1SFO K;  3CQZ C;  1PJ7 A;  1K83 C;  4GTC A;  3G4A A;  1XZP B;  4A93 C;  3GEI A;  2A68 A;  3S2H C;  5IP7 K;  5IP9 K;  4G7O A;  4G0U A;  4BY7 C;  3AD8 C;  3S1N K;  2Y0S D;  2RGR A;  2Y0S L;  1O28 A;  5CHP A;  1TWF A;  5JFE A;  1R9T K;  3I4N K;  5FLM K;  4AYB L;  3GTL C;  1TWA K;  4XSZ A;  3S16 C;  3HOU C;  2JA5 A;  1TWC K;  1VH2 A;  2NVQ K;  1TWF C;  2ZUF A;  3LAP A;  4BY1 C;  3GTO C;  2CFA B;  4XSX A;  3H0G A;  4A93 K;  3GTJ A;  4MEX A;  3NUH A;  4A3C K;  1XXA A;  3HOZ C;  3S2H K;  1B4A A;  5C4X C;  2GSN A;  3S17 C;  4BY7 K;  3H0G C;  2NVY A;  2A69 A;  3GTJ C;  3RZD C;  3S1M C;  2PA8 L;  3I4M C;  1C0A A;  2CFA A;  4GTE A;  3GTL K;  1WSV A;  4X6A K;  1IL2 A;  1I50 K;  2PPB A;  4LJZ A;  3S2D C;  3S16 K;  3L4K A;  4C3H C;  4BY1 K;  3GTO K;  4C3J C;  4OIP A;  1X31 C;  4A3E K;  4Y7N C;  1O25 A;  2V6T A;  3TTG A;  1XXB A;  2WAQ D;  3GDZ A;  4GTF A;  2JA6 C;  2WAQ L;  4GFQ A;  5C4X K;  1YNJ A;  2E2I K;  2FQO A;  3S17 K;  1J6V A;  4G0V A;  4G7H A;  3GTM A;  3RZD K;  3S1M K;  3I4M K;  1WOR A;  4GZY A;  4KM9 A;  1F7U A;  4Y52 K;  4A3D C;  2B63 C;  3IPJ A;  3GTM C;  3S1Q C;  3AH5 A;  1INN A;  1EQR A;  4YFN A;  3GSI A;  5IYC C;  4C3H K;  4C3J K;  4Y7N K;  1TWG C;  2P8T A;  5M5Y K;  2JA8 C;  2JA6 K;  4C2M C;  5CJ9 A;  4OIR A;  1V5V A;  3TFJ A;  4OIN A;  3ORE A;  3GTP A;  1WOP A;  4PAA A;  2R7Z C;  1G51 A;  4LK0 A;  3GEE A;  4NOI A;  4A3D K;  4GTL A;  1O29 A;  2B63 K;  5IYD C;  3S1Q K;  3S1R C;  3BUE A;  3T00 A;  3GTP C;  3N0C A;  4KN4 A;  3N3Y A;  5IYC K;  3PO2 K;  3L4J A;  5C44 C;  1TWG K;  3MML B;  2JA7 C;  4KAT A;  2JA8 K;  4C2M K;  1IE0 A;  5IOS A;  4A3B K;  2VUM A;  1I6V A;  1ISE A;  3FKI C;  4LLG A;  4BBS C;  1Y1V C;  5IYB C;  2R7Z K;  5IOR A;  2VUM C;  1I6H K;  3GTQ K;  1WQG A;  2WB1 D;  5M5W K;  3S1R K;  1VLO A;  2WB1 L;  4BXX C;  1ZXO A;  3GTP K;  4O2D A;  2NVX A;  5E68 A;  3HOY K;  5IOQ A;  1F7V A;  5HL8 A;  5C44 K;  1J6X A;  1RU0 A;  5D4D A;  1PJ6 A;  2JA7 K;  4QJV B;  4AYB D;  4YFK A;  2NVX C;  1USO A;  4XLN A;  1I3Q A;  3M4O K;  4KM8 A;  3FKI K;  3Q3Q A;  3A8I A;  3S15 C;  1J6W A;  1Y1V K;  2GSO A;  3CQZ K;  1VJE A;  4MQ9 A;  1XXC A;  5IYB K;  1K83 K;  4ILD A;  1IQ0 A;  3OPF A;  2PHC B;  2NVT C;  3EQL A;  2JA5 C;  4BXX K;  1BDF A;  4KMH A;  2R93 A;  1HQM A;  2PA8 D;  5C4J C;  4LQY A;  1SMY A;  4ZH4 A;  3GTG A;  3HOV C;  3G4C A;  4Q5S A;  1DCP A;  3T02 A;  3TFH A;  1WCM A;  2NVY C;  3HOU K;  1XPP A;  2E2H A;  3S15 K;  1TWF K;  1PJ5 A;  1TWH A;  5C3E C;  1O2F B;  1WCM C;  1O2A A;  2NVT K;  2JA5 K;  3GIR A;  2E2H C;  3HOZ K;  2YU9 A;  1TWH C;  2ZUE A;  1XZQ A;  1ZBS A;  4XCH A;  3K7A C;  2ZFZ A;  1VGX A;  3H0G K;  4KB4 A;  3GTJ K;  4G7Z A;  4LR2 A;  5C4J K;  4KAR A; 
#chains in the Genus database with same CATH homology
 1F7U A;  3GDZ A;  2ZUF A;  1IQ0 A;  1F7V A;  2ZUE A;  1BS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...