3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Arginyl-tRNA synthetase
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
1F7UA 1BS2A 2ZUFA 1IQ0A 1F7VA 3GDZA 2ZUEA
chains in the Genus database with same CATH superfamily
2P5MA 1O24A 2NVYC 1PJ7A 3S14C 2RGRA 3K7AK 3GTPA 3S15K 1K83K 1J6VA 2E2IC 3HXAA 4G0UA 2FQTA 5FLMK 3K7AC 3S15C 1K83C 3NUHA 2ZFZA 3A8IA 4LK0A 4BKWA 1XXBA 5FLMC 1VH2A 4GTCA 1VRQC 4LR2A 4WJ4A 1J98A 3MMLB 1WORA 2V6TA 4A3JK 2E2HK 1X31C 3AD9C 4A3JC 2E2HC 3GTGA 1WQGA 1TWAA 1EK8A 3AD7C 5TMCA 4A93K 4QIWL 2WAQL 3S2HK 4GTEA 5C4XK 1XXCA 1I6VA 4GTFA 1EI6A 2PMZD 4A3BK 3S2HC 3TFHA 3S2DK 5C4XC 3GDZA 1JQWA 4XLNA 1IW7A 2JA5K 2WB1L 3OREA 2FQOA 2NVQK 4A3BC 4C2MC 4Y52K 3M4OC 2JA5C 3GIRA 2R7ZK 5IYCC 2NVQC 4Y52C 2GSUA 3HKZL 3ERED 1XXAA 3AQPA 2R7ZC 2JA6A 4P9SA 1R9TA 2B63K 4KM8A 5M5YK 4G7HA 5M5WK 4A3FK 3JSTA 2B63C 1TWGK 5CHPA 3L4KA 1IL2A 2VUMK 2GSOA 2Y0SL 4A3FC 2R93A 1TWGC 3FOFA 3S0XA 3AD8C 3I4MK 2VUMC 5EGHA 1IE0A 4GTLA 1B4BA 3GTKA 1WSVA 1IS1A 1F93A 3GTLA 1WOOA 3I4MC 1WOSA 4OIRA 1TWCK 4KM9A 5C44C 2A69A 4KATA 4FM9A 1TWCC 4A3MK 1O27A 1O2BA 1VLOA 3H3VL 3S1MK 2WB1D 4C45A 1O2AA 4A3MC 3S1QK 4LK1A 4KDDA 3S1MC 1XZQA 3CQZK 2V6SA 3HKZD 3WODA 3S1QC 2JA7A 3CQZC 5E68A 1I3QA 4J3NA 4KASA 5IOQA 3GTQK 5FJ8K 3LAJA 1XZPA 3GTOA 2JH3A 3BUEA 3GTQC 4A3DK 1VGXA 1ZYRA 3SZZA 3S14K 1YNJA 4A3DC 3ADAC 4WJ3M 2E2IK 2PMZL 3S1RK 1Y1WK 1WCMK 4KMAA 4BY7C 4NOIA 3AQOA 2YU9K 3H3VD 2BE5A 3S1RC 1Y1WC 1WCMC 5C4JK 3FKIC 1JOEA 4BXXK 1TWHK 4C3JK 2YU9C 5C4JC 3DXJA 4BXXC 1TWHC 2R92K 3GTJA 4C3JC 3GEIA 4ZH4A 1F7VA 1UV7A 1XZQB 2R92C 3GTMK 1AB4A 5IP7K 1ZQ1C 3GTMC 5IP7C 4Q5SA 2KWAA 1L0WA 1TWFA 5EGEA 1XZPB 4OIQA 4G0WA 4DDQA 3TFIA 4OINA 3H0GK 1SFOK 3HOXC 1YX2A 4C2MK 1O29A 4LJZA 3M4OK 3H0GC 4KC6A 1SFOC 5IYCK 1BGWA 5HL8A 1I50C 4RMFA 4KMDA 3RZOK 1Y1VK 4GTBA 4GZYA 3OEPA 2O5IA 3RZOC 1Y1VC 5IYDC 4LQYA 2EBBA 3PO3K 2CFAA 1JVIA 4O2DA 4XLPA 4Y7NK 3GTPK 1C0AA 1O26A 2NVXA 3PO3C 4WILA 4Y7NC 3GTPC 2NVTK 2W7VA 2NVYA 5C44K 5CJ9A 2XCRB 2NVTC 4G7OA 5IOSA 1GE9A 4AH6A 4MEXA 2E2IA 2RH6A 1EFWA 4GTDA 1K83A 4A3IK 4Q4ZA 4BBSK 1YNNA 4A3IC 1B4AA 3GTGK 2CW0A 2PA8D 3G4CA 1TWAK 3HOVK 1ZBSA 1DCHA 4BBSC 3GTGC 3PO2K 4MEYA 3HOVC 1O2FB 1TWAC 5JVOA 3M3YC 4G0VA 3PO2C 2E2HA 3S17K 5D4DA 3QX3A 4PABA 1O25A 3S17C 2GAHC 5M5XK 4YFXA 1BJTA 4PAAA 2CFAB 3HOWK 1G51A 1I6HK 4P5AA 4A3KK 3S1NK 1WSRA 4XSZA 3VA7A 5M3MK 5TJ3A 3FHZA 1EH1A 2A6HA 3HOWC 1IQ0A 4BY7K 2JA6K 1R9TK 1I6HC 2P8TA 4A3KC 3S1NC 3BP8C 3FKIK 2Y3PA 2JA5A 2JA6C 1R9TC 3SZYA 1F9NA 4KN7A 1VJEA 4YG2A 2GSNA 2R7ZA 5IP9K 2R93K 2ZUFA 1DD5A 3HOYK 4XSXA 1HI9A 3AH5A 2JA8K 3GTKK 4KB4A 5IP9C 5M3FK 2R93C 2B63A 4KN4A 3GTLK 2PHCB 3HOYC 1J6WA 4YFNA 1PJ5A 2JA8C 3GTKC 4BLBA 1TWGA 3GTLC 2VUMA 3A8KA 4GTAA 4P5BA 4JK1A 4KB2A 2XCQA 4KARA 1HQMA 5IOTA 3G4AA 3FOEA 1J6XA 3IPJA 4X6AK 4C3IK 4AYBD 4C3HK 1WQFA 1TWCA 3HOXK 3S16K 2JA7K 4A3EK 4X6AC 2D6FC 4C3IC 1I3QK 4C3HC 3HOUK 3S16C 2JA7C 4A3EC 3T00A 1I50K 3RZDK 1I3QC 3OPFA 3HOUC 3GTOK 4G7ZA 5TMFA 1KQ4A 2PA8L 3CQZA 3RZDC 4KMHA 3N0CA 3GTOC 3LAPA 4YFKA 4A93C 5IYDK 2PPBA 3GTQA 3EQLA 1WOPA 5IYBK 1BDFA 1RU0A 4A3LK 1WQHA 3S2DC 5IYBC 4A3LC 3LPXA 3HOZK 4QJVA 1DCOA 4MQ9A 2O5JA 3GTJK 3HOZC 3GSIA 1Y1WA 1WCMA 3GEHA 3FKIA 1USOA 2A6EA 4GT9A 3GTJC 4ILDA 4KMUA 2YU9A 3A8JA 3BP3A 3TTGA 1YCLA 1TWHA 2V6UA 5JFEA 3V4GA 1TWFK 3M3YK 2R92A 3L4JA 4QIWD 2WAQD 1EQRA 4KAWX 5C3EK 1BS2A 1TWFC 3GTMA 1IBAA 1PJ6A 4A3GK 2E2JK 1F7UA 5C3EC 4FZBA 4A3GC 2E2JC 3T02A 4GFQA 1O28A 1ZVUA 3GEEA 4OIPA 4BLAA 1ZXOA 4BY1K 1V5VA 3Q3QA 5IORA 4OIOA 4LLGA 2GAGC 4AYBL 4BY1C 1DCPA 3H0GA 3T01A 1SFOA 1INNA 4LOWA 4QJVB 1ISEA 1I50A 2XCOA 3I4NK 3N3YA 4BBRK 5L46A 1WIHA 4A3CK 2Y0SD 3CAGA 2NVXK 4M1XA 3TFJA 3I4NC 4XCHA 4BBRC 1Y1VA 2A68A 1XPPA 4A3CC 2NVYK 2NVXC 1USMA 3N0BA 1SMYA 2ZUEA
chains in the Genus database with same CATH topology
1F7UA 1BS2A 2ZUFA 1IQ0A 1F7VA 3GDZA 2ZUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7U A;  1BS2 A;  2ZUF A;  1IQ0 A;  1F7V A;  3GDZ A;  2ZUE A; 
#chains in the Genus database with same CATH topology
 2P5M A;  1O24 A;  2NVY C;  1PJ7 A;  3S14 C;  2RGR A;  3K7A K;  3GTP A;  3S15 K;  1K83 K;  1J6V A;  2E2I C;  3HXA A;  4G0U A;  2FQT A;  5FLM K;  3K7A C;  3S15 C;  1K83 C;  3NUH A;  2ZFZ A;  3A8I A;  4LK0 A;  4BKW A;  1XXB A;  5FLM C;  1VH2 A;  4GTC A;  1VRQ C;  4LR2 A;  4WJ4 A;  1J98 A;  3MML B;  1WOR A;  2V6T A;  4A3J K;  2E2H K;  1X31 C;  3AD9 C;  4A3J C;  2E2H C;  3GTG A;  1WQG A;  1TWA A;  1EK8 A;  3AD7 C;  5TMC A;  4A93 K;  4QIW L;  2WAQ L;  3S2H K;  4GTE A;  5C4X K;  1XXC A;  1I6V A;  4GTF A;  1EI6 A;  2PMZ D;  4A3B K;  3S2H C;  3TFH A;  3S2D K;  5C4X C;  3GDZ A;  1JQW A;  4XLN A;  1IW7 A;  2JA5 K;  2WB1 L;  3ORE A;  2FQO A;  2NVQ K;  4A3B C;  4C2M C;  4Y52 K;  3M4O C;  2JA5 C;  3GIR A;  2R7Z K;  5IYC C;  2NVQ C;  4Y52 C;  2GSU A;  3HKZ L;  3ERE D;  1XXA A;  3AQP A;  2R7Z C;  2JA6 A;  4P9S A;  1R9T A;  2B63 K;  4KM8 A;  5M5Y K;  4G7H A;  5M5W K;  4A3F K;  3JST A;  2B63 C;  1TWG K;  5CHP A;  3L4K A;  1IL2 A;  2VUM K;  2GSO A;  2Y0S L;  4A3F C;  2R93 A;  1TWG C;  3FOF A;  3S0X A;  3AD8 C;  3I4M K;  2VUM C;  5EGH A;  1IE0 A;  4GTL A;  1B4B A;  3GTK A;  1WSV A;  1IS1 A;  1F93 A;  3GTL A;  1WOO A;  3I4M C;  1WOS A;  4OIR A;  1TWC K;  4KM9 A;  5C44 C;  2A69 A;  4KAT A;  4FM9 A;  1TWC C;  4A3M K;  1O27 A;  1O2B A;  1VLO A;  3H3V L;  3S1M K;  2WB1 D;  4C45 A;  1O2A A;  4A3M C;  3S1Q K;  4LK1 A;  4KDD A;  3S1M C;  1XZQ A;  3CQZ K;  2V6S A;  3HKZ D;  3WOD A;  3S1Q C;  2JA7 A;  3CQZ C;  5E68 A;  1I3Q A;  4J3N A;  4KAS A;  5IOQ A;  3GTQ K;  5FJ8 K;  3LAJ A;  1XZP A;  3GTO A;  2JH3 A;  3BUE A;  3GTQ C;  4A3D K;  1VGX A;  1ZYR A;  3SZZ A;  3S14 K;  1YNJ A;  4A3D C;  3ADA C;  4WJ3 M;  2E2I K;  2PMZ L;  3S1R K;  1Y1W K;  1WCM K;  4KMA A;  4BY7 C;  4NOI A;  3AQO A;  2YU9 K;  3H3V D;  2BE5 A;  3S1R C;  1Y1W C;  1WCM C;  5C4J K;  3FKI C;  1JOE A;  4BXX K;  1TWH K;  4C3J K;  2YU9 C;  5C4J C;  3DXJ A;  4BXX C;  1TWH C;  2R92 K;  3GTJ A;  4C3J C;  3GEI A;  4ZH4 A;  1F7V A;  1UV7 A;  1XZQ B;  2R92 C;  3GTM K;  1AB4 A;  5IP7 K;  1ZQ1 C;  3GTM C;  5IP7 C;  4Q5S A;  2KWA A;  1L0W A;  1TWF A;  5EGE A;  1XZP B;  4OIQ A;  4G0W A;  4DDQ A;  3TFI A;  4OIN A;  3H0G K;  1SFO K;  3HOX C;  1YX2 A;  4C2M K;  1O29 A;  4LJZ A;  3M4O K;  3H0G C;  4KC6 A;  1SFO C;  5IYC K;  1BGW A;  5HL8 A;  1I50 C;  4RMF A;  4KMD A;  3RZO K;  1Y1V K;  4GTB A;  4GZY A;  3OEP A;  2O5I A;  3RZO C;  1Y1V C;  5IYD C;  4LQY A;  2EBB A;  3PO3 K;  2CFA A;  1JVI A;  4O2D A;  4XLP A;  4Y7N K;  3GTP K;  1C0A A;  1O26 A;  2NVX A;  3PO3 C;  4WIL A;  4Y7N C;  3GTP C;  2NVT K;  2W7V A;  2NVY A;  5C44 K;  5CJ9 A;  2XCR B;  2NVT C;  4G7O A;  5IOS A;  1GE9 A;  4AH6 A;  4MEX A;  2E2I A;  2RH6 A;  1EFW A;  4GTD A;  1K83 A;  4A3I K;  4Q4Z A;  4BBS K;  1YNN A;  4A3I C;  1B4A A;  3GTG K;  2CW0 A;  2PA8 D;  3G4C A;  1TWA K;  3HOV K;  1ZBS A;  1DCH A;  4BBS C;  3GTG C;  3PO2 K;  4MEY A;  3HOV C;  1O2F B;  1TWA C;  5JVO A;  3M3Y C;  4G0V A;  3PO2 C;  2E2H A;  3S17 K;  5D4D A;  3QX3 A;  4PAB A;  1O25 A;  3S17 C;  2GAH C;  5M5X K;  4YFX A;  1BJT A;  4PAA A;  2CFA B;  3HOW K;  1G51 A;  1I6H K;  4P5A A;  4A3K K;  3S1N K;  1WSR A;  4XSZ A;  3VA7 A;  5M3M K;  5TJ3 A;  3FHZ A;  1EH1 A;  2A6H A;  3HOW C;  1IQ0 A;  4BY7 K;  2JA6 K;  1R9T K;  1I6H C;  2P8T A;  4A3K C;  3S1N C;  3BP8 C;  3FKI K;  2Y3P A;  2JA5 A;  2JA6 C;  1R9T C;  3SZY A;  1F9N A;  4KN7 A;  1VJE A;  4YG2 A;  2GSN A;  2R7Z A;  5IP9 K;  2R93 K;  2ZUF A;  1DD5 A;  3HOY K;  4XSX A;  1HI9 A;  3AH5 A;  2JA8 K;  3GTK K;  4KB4 A;  5IP9 C;  5M3F K;  2R93 C;  2B63 A;  4KN4 A;  3GTL K;  2PHC B;  3HOY C;  1J6W A;  4YFN A;  1PJ5 A;  2JA8 C;  3GTK C;  4BLB A;  1TWG A;  3GTL C;  2VUM A;  3A8K A;  4GTA A;  4P5B A;  4JK1 A;  4KB2 A;  2XCQ A;  4KAR A;  1HQM A;  5IOT A;  3G4A A;  3FOE A;  1J6X A;  3IPJ A;  4X6A K;  4C3I K;  4AYB D;  4C3H K;  1WQF A;  1TWC A;  3HOX K;  3S16 K;  2JA7 K;  4A3E K;  4X6A C;  2D6F C;  4C3I C;  1I3Q K;  4C3H C;  3HOU K;  3S16 C;  2JA7 C;  4A3E C;  3T00 A;  1I50 K;  3RZD K;  1I3Q C;  3OPF A;  3HOU C;  3GTO K;  4G7Z A;  5TMF A;  1KQ4 A;  2PA8 L;  3CQZ A;  3RZD C;  4KMH A;  3N0C A;  3GTO C;  3LAP A;  4YFK A;  4A93 C;  5IYD K;  2PPB A;  3GTQ A;  3EQL A;  1WOP A;  5IYB K;  1BDF A;  1RU0 A;  4A3L K;  1WQH A;  3S2D C;  5IYB C;  4A3L C;  3LPX A;  3HOZ K;  4QJV A;  1DCO A;  4MQ9 A;  2O5J A;  3GTJ K;  3HOZ C;  3GSI A;  1Y1W A;  1WCM A;  3GEH A;  3FKI A;  1USO A;  2A6E A;  4GT9 A;  3GTJ C;  4ILD A;  4KMU A;  2YU9 A;  3A8J A;  3BP3 A;  3TTG A;  1YCL A;  1TWH A;  2V6U A;  5JFE A;  3V4G A;  1TWF K;  3M3Y K;  2R92 A;  3L4J A;  4QIW D;  2WAQ D;  1EQR A;  4KAW X;  5C3E K;  1BS2 A;  1TWF C;  3GTM A;  1IBA A;  1PJ6 A;  4A3G K;  2E2J K;  1F7U A;  5C3E C;  4FZB A;  4A3G C;  2E2J C;  3T02 A;  4GFQ A;  1O28 A;  1ZVU A;  3GEE A;  4OIP A;  4BLA A;  1ZXO A;  4BY1 K;  1V5V A;  3Q3Q A;  5IOR A;  4OIO A;  4LLG A;  2GAG C;  4AYB L;  4BY1 C;  1DCP A;  3H0G A;  3T01 A;  1SFO A;  1INN A;  4LOW A;  4QJV B;  1ISE A;  1I50 A;  2XCO A;  3I4N K;  3N3Y A;  4BBR K;  5L46 A;  1WIH A;  4A3C K;  2Y0S D;  3CAG A;  2NVX K;  4M1X A;  3TFJ A;  3I4N C;  4XCH A;  4BBR C;  1Y1V A;  2A68 A;  1XPP A;  4A3C C;  2NVY K;  2NVX C;  1USM A;  3N0B A;  1SMY A;  2ZUE A; 
#chains in the Genus database with same CATH homology
 1F7U A;  1BS2 A;  2ZUF A;  1IQ0 A;  1F7V A;  3GDZ A;  2ZUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...