3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Ligase
molecule keywords Arginyl-tRNA synthetase
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
2ZUEA 2ZUFA 1IQ0A 3GDZA 1F7VA 1F7UA 1BS2A
chains in the Genus database with same CATH superfamily
3M4OC 4GFQA 4A3MK 3S15K 4KDDA 3GTOK 4A3KC 4A93C 1EI6A 1J6XA 3GTKC 4BBRC 1TWHK 4DDQA 3HOXK 4WILA 1BJTA 1XZQA 1PJ6A 4KASA 4QIWD 4A3LC 3DXJA 1DCPA 3GTQK 3HOVK 2E2IA 1WCMC 4BBSC 2R93C 1YNJA 1SFOA 1K83A 2YU9A 4BBSK 1EK8A 2RH6A 4KC6A 1DD5A 3Q3QA 1Y1WC 1I3QA 4GTCA 1WOSA 1Y1WK 3GEEA 2YU9K 3LPXA 5M3MK 5IYBK 4A3MC 1I50A 4BXXK 5TMCA 1IE0A 3I4NC 3CQZK 4WJ3M 2Y0SL 5IP9C 1RU0A 4G0VA 1O26A 1TWHA 3I4MK 4X6AK 5IYDK 3GTPA 2PHCB 2R93K 2JA7C 3GTGC 5IOQA 3S14C 5IYBC 2BE5A 2NVQK 5FJ8K 1IW7A 1TWAA 3FKIC 5IORA 5IYCC 3SZZA 2WB1D 3HOZK 3N0BA 3ADAC 4A3BC 3T01A 1PJ5A 2NVTC 3H0GC 3V4GA 4A3IK 2E2HC 3S1QK 1WQGA 3GTGA 1ZQ1C 2XCOA 2A6EA 1VH2A 4KAWX 4A3CC 2A6HA 2FQOA 1I50K 5M5YK 1F93A 1JOEA 3PO3K 1G51A 5M5WK 3BP8C 4PABA 5IYDC 1DCHA 2B63A 4A3IC 2JA8K 3S1QC 2ZUFA 3JSTA 5IOTA 2O5JA 3OEPA 1SMYA 3CAGA 4Q5SA 4LK0A 4BY7C 5TMFA 4WJ4A 2CFAB 2GAHC 2P5MA 3L4JA 3G4AA 1J6WA 3M3YC 4Y7NK 2JA5K 4KN4A 4FM9A 1BDFA 4GZYA 1V5VA 1WOOA 3K7AK 4GTDA 4AH6A 4Q4ZA 1IQ0A 2R7ZA 4KB4A 1I6VA 4OIQA 4BXXC 4QJVA 3S16C 3AD9C 2R93A 1YCLA 5EGHA 2JA8C 2W7VA 4GTEA 1VJEA 2XCRB 1ISEA 1B4BA 1R9TK 3S2DK 2ZUEA 3MMLB 4KB2A 4A3LK 4Y52C 3HOYC 4A3DC 1R9TA 1O24A 3HOYK 4JK1A 3H0GA 2E2HA 4GTLA 4G7OA 1BGWA 2NVYK 3S16K 3RZOK 5M5XK 1Y1VK 1EQRA 1K83C 4MEYA 3S1MK 4ZH4A 4G0WA 3FKIK 5C4JC 3GTPC 3GTKK 4C45A 5JVOA 1GE9A 4A3KK 2JH3A 3HKZD 1USMA 3LAPA 2PA8L 4C3HC 4C3JK 3GTKA 2VUMC 1R9TC 5IP9K 1YNNA 2V6TA 4LOWA 1VLOA 3A8IA 3OREA 1I6HK 5FLMK 3IPJA 1TWFC 2R7ZC 2YU9C 4OIRA 1J98A 1TWAC 3FKIA 3T02A 3T00A 4BKWA 5M3FK 5C44C 2EBBA 1WORA 3GTLA 1IBAA 2WAQD 3HOUK 2NVTK 2ZFZA 3S17K 1F7VA 1WQFA 4QIWL 1I50C 2E2IC 1TWCA 2R7ZK 3AQPA 3GEHA 4KMDA 1O2BA 1I6HC 1SFOC 2JA7K 3HKZL 2PA8D 5C4XK 5C4JK 5HL8A 2GSOA 4C3IK 3QX3A 3M4OK 4XSXA 1TWCK 3PO2C 1K83K 3FOEA 4C3IC 2JA5A 3HOUC 3GTJK 3EQLA 4P9SA 1SFOK 3PO3C 2FQTA 4NOIA 1HI9A 3TFIA 1WSRA 4GTFA 2E2IK 4MQ9A 1ZVUA 4XLNA 2WAQL 4OIPA 3GTOA 2CFAA 3H3VD 4AYBL 2NVYC 1O25A 1YX2A 1TWGA 2GSNA 1AB4A 3RZDC 3A8JA 2O5IA 1BS2A 4YFNA 1TWFK 2D6FC 3GTOC 3S14K 4AYBD 1DCOA 3GTMK 4BY7K 2E2JK 3I4MC 4OIOA 1WCMK 1O2AA 3N3YA 1XZPB 3I4NK 5C4XC 3GIRA 3CQZA 2B63C 4ILDA 3M3YK 4LR2A 3HOWC 1KQ4A 5IP7C 3S15C 4LJZA 1WOPA 4BY1C 1L0WA 1USOA 1Y1WA 4XSZA 4BBRK 3FHZA 4A93K 3H3VL 3RZDK 1XXAA 3GTLC 1Y1VC 1O2FB 3G4CA 2JA6C 1I3QK 1O27A 1IL2A 5IYCK 1ZXOA 3AD8C 4A3CK 1J6VA 1WCMA 5CJ9A 3AQOA 4A3GK 5E68A 1F7UA 3GTMA 3S1RK 3HOXC 3S2HC 4LK1A 3GTJA 3WODA 1IS1A 2R92K 2JA7A 3HXAA 4KN7A 1O29A 1WSVA 2GAGC 1C0AA 5C3EC 4FZBA 4GTAA 1TWCC 2KWAA 5C3EK 2NVQC 3S1NC 1XXBA 3GEIA 3OPFA 4BLAA 3BP3A 3TFHA 3S0XA 4A3EC 3GTGK 4P5BA 3SZYA 3TFJA 3S2HK 5IOSA 5TJ3A 4A3FC 1XZQB 3CQZC 3N0CA 2VUMK 2E2JC 1XXCA 2A69A 3LAJA 2RGRA 3GTMC 3S17C 4YG2A 4KATA 2NVYA 3GSIA 4KMHA 4A3BK 1XPPA 5CHPA 5C44K 3GTPK 3S1RC 1TWAK 1VGXA 3S2DC 2Y3PA 2PMZD 5IP7K 1Y1VA 2JA6A 2GSUA 4PAAA 1B4AA 1VRQC 1TWGC 2E2HK 4X6AC 3PO2K 3AD7C 3K7AC 4OINA 4O2DA 3GTQC 1INNA 4GT9A 4BLBA 4YFKA 4A3FK 3NUHA 2Y0SD 1TWGK 1EFWA 4C3HK 4C3JC 4G7HA 3RZOC 1XZPA 2PMZL 1WQHA 4KM9A 4BY1K 4A3DK 4Y7NC 2NVXA 1O28A 2R92A 4G0UA 3BUEA 4KM8A 3TTGA 4A3JC 3HOWK 4GTBA 3ERED 1PJ7A 5D4DA 4Y52K 4LLGA 3GTQA 5JFEA 2WB1L 1X31C 3FOFA 4C2MK 2NVXK 3A8KA 2R92C 1JQWA 4RMFA 5L46A 2P8TA 4LQYA 2PPBA 1ZYRA 4KARA 1JVIA 4A3GC 3S1NK 1EH1A 1HQMA 3AH5A 4P5AA 1I3QC 2JA6K 3GTJC 4A3EK 4C2MC 2NVXC 3GTLK 4QJVB 2XCQA 4KMUA 4M1XA 3HOZC 4XLPA 4XCHA 2V6UA 1ZBSA 4G7ZA 1UV7A 2V6SA 4KMAA 3HOVC 4J3NA 2VUMA 3VA7A 4A3JK 4MEXA 2JA5C 5FLMC 1TWHC 2A68A 3GDZA 4YFXA 2B63K 2CW0A 3H0GK 3L4KA 5EGEA 3S1MC 1TWFA 1F9NA 1WIHA
chains in the Genus database with same CATH topology
2ZUEA 2ZUFA 1IQ0A 3GDZA 1F7VA 1F7UA 1BS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUE A;  2ZUF A;  1IQ0 A;  3GDZ A;  1F7V A;  1F7U A;  1BS2 A; 
#chains in the Genus database with same CATH topology
 3M4O C;  4GFQ A;  4A3M K;  3S15 K;  4KDD A;  3GTO K;  4A3K C;  4A93 C;  1EI6 A;  1J6X A;  3GTK C;  4BBR C;  1TWH K;  4DDQ A;  3HOX K;  4WIL A;  1BJT A;  1XZQ A;  1PJ6 A;  4KAS A;  4QIW D;  4A3L C;  3DXJ A;  1DCP A;  3GTQ K;  3HOV K;  2E2I A;  1WCM C;  4BBS C;  2R93 C;  1YNJ A;  1SFO A;  1K83 A;  2YU9 A;  4BBS K;  1EK8 A;  2RH6 A;  4KC6 A;  1DD5 A;  3Q3Q A;  1Y1W C;  1I3Q A;  4GTC A;  1WOS A;  1Y1W K;  3GEE A;  2YU9 K;  3LPX A;  5M3M K;  5IYB K;  4A3M C;  1I50 A;  4BXX K;  5TMC A;  1IE0 A;  3I4N C;  3CQZ K;  4WJ3 M;  2Y0S L;  5IP9 C;  1RU0 A;  4G0V A;  1O26 A;  1TWH A;  3I4M K;  4X6A K;  5IYD K;  3GTP A;  2PHC B;  2R93 K;  2JA7 C;  3GTG C;  5IOQ A;  3S14 C;  5IYB C;  2BE5 A;  2NVQ K;  5FJ8 K;  1IW7 A;  1TWA A;  3FKI C;  5IOR A;  5IYC C;  3SZZ A;  2WB1 D;  3HOZ K;  3N0B A;  3ADA C;  4A3B C;  3T01 A;  1PJ5 A;  2NVT C;  3H0G C;  3V4G A;  4A3I K;  2E2H C;  3S1Q K;  1WQG A;  3GTG A;  1ZQ1 C;  2XCO A;  2A6E A;  1VH2 A;  4KAW X;  4A3C C;  2A6H A;  2FQO A;  1I50 K;  5M5Y K;  1F93 A;  1JOE A;  3PO3 K;  1G51 A;  5M5W K;  3BP8 C;  4PAB A;  5IYD C;  1DCH A;  2B63 A;  4A3I C;  2JA8 K;  3S1Q C;  2ZUF A;  3JST A;  5IOT A;  2O5J A;  3OEP A;  1SMY A;  3CAG A;  4Q5S A;  4LK0 A;  4BY7 C;  5TMF A;  4WJ4 A;  2CFA B;  2GAH C;  2P5M A;  3L4J A;  3G4A A;  1J6W A;  3M3Y C;  4Y7N K;  2JA5 K;  4KN4 A;  4FM9 A;  1BDF A;  4GZY A;  1V5V A;  1WOO A;  3K7A K;  4GTD A;  4AH6 A;  4Q4Z A;  1IQ0 A;  2R7Z A;  4KB4 A;  1I6V A;  4OIQ A;  4BXX C;  4QJV A;  3S16 C;  3AD9 C;  2R93 A;  1YCL A;  5EGH A;  2JA8 C;  2W7V A;  4GTE A;  1VJE A;  2XCR B;  1ISE A;  1B4B A;  1R9T K;  3S2D K;  2ZUE A;  3MML B;  4KB2 A;  4A3L K;  4Y52 C;  3HOY C;  4A3D C;  1R9T A;  1O24 A;  3HOY K;  4JK1 A;  3H0G A;  2E2H A;  4GTL A;  4G7O A;  1BGW A;  2NVY K;  3S16 K;  3RZO K;  5M5X K;  1Y1V K;  1EQR A;  1K83 C;  4MEY A;  3S1M K;  4ZH4 A;  4G0W A;  3FKI K;  5C4J C;  3GTP C;  3GTK K;  4C45 A;  5JVO A;  1GE9 A;  4A3K K;  2JH3 A;  3HKZ D;  1USM A;  3LAP A;  2PA8 L;  4C3H C;  4C3J K;  3GTK A;  2VUM C;  1R9T C;  5IP9 K;  1YNN A;  2V6T A;  4LOW A;  1VLO A;  3A8I A;  3ORE A;  1I6H K;  5FLM K;  3IPJ A;  1TWF C;  2R7Z C;  2YU9 C;  4OIR A;  1J98 A;  1TWA C;  3FKI A;  3T02 A;  3T00 A;  4BKW A;  5M3F K;  5C44 C;  2EBB A;  1WOR A;  3GTL A;  1IBA A;  2WAQ D;  3HOU K;  2NVT K;  2ZFZ A;  3S17 K;  1F7V A;  1WQF A;  4QIW L;  1I50 C;  2E2I C;  1TWC A;  2R7Z K;  3AQP A;  3GEH A;  4KMD A;  1O2B A;  1I6H C;  1SFO C;  2JA7 K;  3HKZ L;  2PA8 D;  5C4X K;  5C4J K;  5HL8 A;  2GSO A;  4C3I K;  3QX3 A;  3M4O K;  4XSX A;  1TWC K;  3PO2 C;  1K83 K;  3FOE A;  4C3I C;  2JA5 A;  3HOU C;  3GTJ K;  3EQL A;  4P9S A;  1SFO K;  3PO3 C;  2FQT A;  4NOI A;  1HI9 A;  3TFI A;  1WSR A;  4GTF A;  2E2I K;  4MQ9 A;  1ZVU A;  4XLN A;  2WAQ L;  4OIP A;  3GTO A;  2CFA A;  3H3V D;  4AYB L;  2NVY C;  1O25 A;  1YX2 A;  1TWG A;  2GSN A;  1AB4 A;  3RZD C;  3A8J A;  2O5I A;  1BS2 A;  4YFN A;  1TWF K;  2D6F C;  3GTO C;  3S14 K;  4AYB D;  1DCO A;  3GTM K;  4BY7 K;  2E2J K;  3I4M C;  4OIO A;  1WCM K;  1O2A A;  3N3Y A;  1XZP B;  3I4N K;  5C4X C;  3GIR A;  3CQZ A;  2B63 C;  4ILD A;  3M3Y K;  4LR2 A;  3HOW C;  1KQ4 A;  5IP7 C;  3S15 C;  4LJZ A;  1WOP A;  4BY1 C;  1L0W A;  1USO A;  1Y1W A;  4XSZ A;  4BBR K;  3FHZ A;  4A93 K;  3H3V L;  3RZD K;  1XXA A;  3GTL C;  1Y1V C;  1O2F B;  3G4C A;  2JA6 C;  1I3Q K;  1O27 A;  1IL2 A;  5IYC K;  1ZXO A;  3AD8 C;  4A3C K;  1J6V A;  1WCM A;  5CJ9 A;  3AQO A;  4A3G K;  5E68 A;  1F7U A;  3GTM A;  3S1R K;  3HOX C;  3S2H C;  4LK1 A;  3GTJ A;  3WOD A;  1IS1 A;  2R92 K;  2JA7 A;  3HXA A;  4KN7 A;  1O29 A;  1WSV A;  2GAG C;  1C0A A;  5C3E C;  4FZB A;  4GTA A;  1TWC C;  2KWA A;  5C3E K;  2NVQ C;  3S1N C;  1XXB A;  3GEI A;  3OPF A;  4BLA A;  3BP3 A;  3TFH A;  3S0X A;  4A3E C;  3GTG K;  4P5B A;  3SZY A;  3TFJ A;  3S2H K;  5IOS A;  5TJ3 A;  4A3F C;  1XZQ B;  3CQZ C;  3N0C A;  2VUM K;  2E2J C;  1XXC A;  2A69 A;  3LAJ A;  2RGR A;  3GTM C;  3S17 C;  4YG2 A;  4KAT A;  2NVY A;  3GSI A;  4KMH A;  4A3B K;  1XPP A;  5CHP A;  5C44 K;  3GTP K;  3S1R C;  1TWA K;  1VGX A;  3S2D C;  2Y3P A;  2PMZ D;  5IP7 K;  1Y1V A;  2JA6 A;  2GSU A;  4PAA A;  1B4A A;  1VRQ C;  1TWG C;  2E2H K;  4X6A C;  3PO2 K;  3AD7 C;  3K7A C;  4OIN A;  4O2D A;  3GTQ C;  1INN A;  4GT9 A;  4BLB A;  4YFK A;  4A3F K;  3NUH A;  2Y0S D;  1TWG K;  1EFW A;  4C3H K;  4C3J C;  4G7H A;  3RZO C;  1XZP A;  2PMZ L;  1WQH A;  4KM9 A;  4BY1 K;  4A3D K;  4Y7N C;  2NVX A;  1O28 A;  2R92 A;  4G0U A;  3BUE A;  4KM8 A;  3TTG A;  4A3J C;  3HOW K;  4GTB A;  3ERE D;  1PJ7 A;  5D4D A;  4Y52 K;  4LLG A;  3GTQ A;  5JFE A;  2WB1 L;  1X31 C;  3FOF A;  4C2M K;  2NVX K;  3A8K A;  2R92 C;  1JQW A;  4RMF A;  5L46 A;  2P8T A;  4LQY A;  2PPB A;  1ZYR A;  4KAR A;  1JVI A;  4A3G C;  3S1N K;  1EH1 A;  1HQM A;  3AH5 A;  4P5A A;  1I3Q C;  2JA6 K;  3GTJ C;  4A3E K;  4C2M C;  2NVX C;  3GTL K;  4QJV B;  2XCQ A;  4KMU A;  4M1X A;  3HOZ C;  4XLP A;  4XCH A;  2V6U A;  1ZBS A;  4G7Z A;  1UV7 A;  2V6S A;  4KMA A;  3HOV C;  4J3N A;  2VUM A;  3VA7 A;  4A3J K;  4MEX A;  2JA5 C;  5FLM C;  1TWH C;  2A68 A;  3GDZ A;  4YFX A;  2B63 K;  2CW0 A;  3H0G K;  3L4K A;  5EGE A;  3S1M C;  1TWF A;  1F9N A;  1WIH A; 
#chains in the Genus database with same CATH homology
 2ZUE A;  2ZUF A;  1IQ0 A;  3GDZ A;  1F7V A;  1F7U A;  1BS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...