3GDZA

Crystal structure of arginyl-trna synthetase from klebsiella pneumoniae subsp. pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
SNAMNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAEQVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginyl-tRNA synthetase
publication title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Ligase
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.19: Arginine--tRNA ligase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.70 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Arginyl tRNA synthetase N-terminal domain 3gdzA00
1F7VA 1IQ0A 1BS2A 2ZUFA 2ZUEA 1F7UA 3GDZA
chains in the Genus database with same CATH superfamily
2JA6C 4A3CK 2R7ZA 3GEHA 4GTBA 3WODA 2V6SA 1F7UA 2NVYA 2P8TA 2NVTK 3GTLA 5IP9C 3H3VL 4KN4A 1UV7A 2WAQL 2E2IC 3S17C 2W7VA 1O24A 4G7HA 4KMAA 3AQOA 3OEPA 5IP7K 4A3BK 1VRQC 3PO3C 1I3QK 2JA5K 2NVYC 3FKIK 4QJVB 3GTLC 4BBRK 3OREA 3H0GA 4BY7C 1Y1VA 1WSRA 2R93C 3BP8C 3L4JA 2Y0SL 3RZDC 3M4OC 4A3GK 2FQTA 1PJ5A 1K83K 4Y52K 3AQPA 1ZYRA 1I3QA 1Y1VC 4ILDA 4OINA 5IYDK 3HOXC 1XPPA 1XXAA 1YNJA 3CAGA 4BBSC 2R92A 4A3JK 5CJ9A 4OIOA 1BGWA 5C4JC 1RU0A 3LPXA 4P9SA 2Y3PA 1XXBA 4BLAA 3S2DK 1XXCA 4PAAA 3S14K 1KQ4A 2VUMK 1TWFA 2A69A 3S1RC 3S1MK 2GAHC 4XLNA 5EGEA 4G7ZA 3V4GA 4BXXC 2ZUEA 4WJ4A 1F93A 4YFXA 1VJEA 1Y1WK 1I6HC 3GTKA 1C0AA 3GTMC 3S1QK 2Y0SD 4MQ9A 3G4CA 4YFNA 5JFEA 3FHZA 3GTGK 4A3FK 2KWAA 3PO2C 3GTPK 4C3HC 1VGXA 4KASA 2JA6K 3GTOA 4BLBA 5IYBC 3HOYC 3GTKC 3ADAC 4OIQA 1PJ7A 4LLGA 5IP9K 2E2IK 3S17K 3TFIA 1ZBSA 4A3EC 1GE9A 1XZPA 1R9TA 3LAPA 1WQGA 2PPBA 2R7ZK 3GTOC 4Q5SA 1VLOA 4KMUA 4A3KC 3PO3K 1O29A 4A3LC 2CFAA 2NVYK 2O5IA 1YX2A 3GTLK 4BY7K 3G4AA 4OIPA 4GTCA 1WOSA 4LR2A 2R93K 5IYCC 4A93C 2P5MA 1R9TC 3M4OK 2E2IA 1DCPA 1TWAA 1O2BA 4GTEA 1O2AA 1USOA 3H0GK 1I6VA 5EGHA 1Y1VK 1I50A 1ZQ1C 2GSOA 3HOXK 5TJ3A 2CW0A 1J6WA 3S16K 4BBSK 2XCRB 1YCLA 1TWAC 4Y7NK 2R93A 2PMZD 1EFWA 1ZXOA 2E2HA 4Q4ZA 4KMDA 4AYBL 1I50C 3MMLB 3HOUK 3BP3A 1XZPB 3S1NC 3S1RK 1SFOC 2R92K 4KB2A 4KMHA 2RH6A 4BXXK 3N0CA 5TMCA 2E2HC 1TWCC 2JA8K 3GIRA 4KM8A 3TFJA 3FOFA 1F7VA 2NVXA 4KC6A 1I6HK 4FM9A 1EH1A 1TWFK 1YNNA 3N0BA 4OIRA 2WB1L 5D4DA 1WCMC 4GTDA 4YFKA 3PO2K 4C3HK 3HKZL 3NUHA 2NVXC 3ERED 3SZYA 2ZUFA 1TWHA 3T02A 1IL2A 1B4BA 3GTKK 2E2JC 1X31C 3I4MC 5M3MK 1SMYA 2A6EA 4A3MC 3H3VD 2WAQD 3AD9C 1V5VA 4A3EK 4FZBA 3GTMA 1G51A 3VA7A 3GTOK 5FJ8K 4G7OA 4A3KK 2PA8L 3GEEA 1TWHC 1WSVA 2V6TA 3QX3A 4AYBD 4A3LK 1INNA 4LK1A 5L46A 3K7AK 5IP7C 1IQ0A 5HL8A 5IYCK 2GAGC 4A93K 1R9TK 1DD5A 4MEXA 2ZFZA 3S0XA 3RZOC 5FLMC 3GTJC 4XSXA 1WORA 3DXJA 2A68A 5M5YK 4C2MC 3JSTA 2B63C 4JK1A 4P5AA 1F9NA 1K83C 3GTQA 4LJZA 1JQWA 4KB4A 3I4NC 3Q3QA 4G0VA 1VH2A 2YU9A 3HKZD 1TWAK 1J6VA 5IYDC 4PABA 2EBBA 1IS1A 4M1XA 1I50K 3GTQC 4RMFA 1WOPA 3S1NK 1SFOK 2YU9C 1WQFA 3M3YC 3GEIA 5C3EC 1J98A 1XZQA 5C44C 4XCHA 3RZDK 2E2HK 1TWCK 3TFHA 4YG2A 5M5WK 1TWGA 4GTFA 4A3DC 5M3FK 3GDZA 4GT9A 4X6AC 4G0UA 1J6XA 1AB4A 1Y1WC 1SFOA 1BDFA 5C4JK 4AH6A 1TWGC 2NVXK 4G0WA 1HI9A 1TWCA 3I4MK 3S15C 4WJ3M 3CQZC 3N3YA 4A3MK 5M5XK 3S2HC 2NVQC 4DDQA 4MEYA 3T01A 1IE0A 1O2FB 1WCMA 4KM9A 3HOZC 1WOOA 1TWHK 2JA7A 2CFAB 1B4AA 4P5BA 4LOWA 2R7ZC 4KARA 4WILA 3HOWC 2BE5A 3A8JA 4A3IC 4C3JC 1XZQB 2D6FC 3GTMK 2FQOA 4XLPA 3SZZA 5C4XC 4C3IC 3OPFA 1EQRA 3L4KA 3RZOK 1O28A 5FLMK 3LAJA 3GTJK 2JA7C 4BY1C 3HOYK 5IYBK 4C2MK 2B63K 1L0WA 2XCQA 3AD7C 3HOVC 5E68A 1EI6A 4A3CC 1O27A 3H0GC 4QIWL 3GSIA 3I4NK 4LQYA 5IOTA 1IW7A 2JA5A 3FKIA 5JVOA 2NVTC 2GSNA 3S16C 4LK0A 3T00A 4KATA 3GTJA 4Y7NC 3GTQK 4GFQA 4A3BC 3HXAA 4GTAA 1WIHA 3IPJA 2PHCB 5TMFA 2B63A 1BJTA 2YU9K 3M3YK 1I3QC 1K83A 4O2DA 5C3EK 2JA5C 3HOUC 4KDDA 3FKIC 5C44K 4BBRC 3A8KA 2R92C 3BUEA 1BS2A 4C45A 4A3DK 3TTGA 2JA8C 1HQMA 5CHPA 4X6AK 4A3GC 2RGRA 5IORA 1JVIA 2WB1D 4Y52C 1DCHA 1IBAA 1ISEA 1TWFC 3FOEA 4GZYA 1TWGK 2VUMA 2V6UA 4A3JC 3S15K 3AH5A 3EQLA 1PJ6A 2PMZL 3CQZK 4QIWD 3S2HK 2NVQK 3S2DC 4J3NA 2XCOA 4KN7A 1ZVUA 5IOSA 3S14C 3HOZK 1USMA 1Y1WA 2VUMC 4QJVA 1WQHA 2PA8D 3S1MC 3GTGA 3HOWK 3GTPA 4A3IK 4ZH4A 2O5JA 4C3JK 2JA6A 4BKWA 3CQZA 1JOEA 1EK8A 1DCOA 1WCMK 3K7AC 5C4XK 4C3IK 4KAWX 4NOIA 2A6HA 2JA7K 3AD8C 3A8IA 4BY1K 3S1QC 2GSUA 3GTGC 4A3FC 3GTPC 5IOQA 2E2JK 1O25A 4XSZA 1O26A 3HOVK 2JH3A 4GTLA
chains in the Genus database with same CATH topology
1F7VA 1IQ0A 1BS2A 2ZUFA 2ZUEA 1F7UA 3GDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7V A;  1IQ0 A;  1BS2 A;  2ZUF A;  2ZUE A;  1F7U A;  3GDZ A; 
#chains in the Genus database with same CATH topology
 2JA6 C;  4A3C K;  2R7Z A;  3GEH A;  4GTB A;  3WOD A;  2V6S A;  1F7U A;  2NVY A;  2P8T A;  2NVT K;  3GTL A;  5IP9 C;  3H3V L;  4KN4 A;  1UV7 A;  2WAQ L;  2E2I C;  3S17 C;  2W7V A;  1O24 A;  4G7H A;  4KMA A;  3AQO A;  3OEP A;  5IP7 K;  4A3B K;  1VRQ C;  3PO3 C;  1I3Q K;  2JA5 K;  2NVY C;  3FKI K;  4QJV B;  3GTL C;  4BBR K;  3ORE A;  3H0G A;  4BY7 C;  1Y1V A;  1WSR A;  2R93 C;  3BP8 C;  3L4J A;  2Y0S L;  3RZD C;  3M4O C;  4A3G K;  2FQT A;  1PJ5 A;  1K83 K;  4Y52 K;  3AQP A;  1ZYR A;  1I3Q A;  1Y1V C;  4ILD A;  4OIN A;  5IYD K;  3HOX C;  1XPP A;  1XXA A;  1YNJ A;  3CAG A;  4BBS C;  2R92 A;  4A3J K;  5CJ9 A;  4OIO A;  1BGW A;  5C4J C;  1RU0 A;  3LPX A;  4P9S A;  2Y3P A;  1XXB A;  4BLA A;  3S2D K;  1XXC A;  4PAA A;  3S14 K;  1KQ4 A;  2VUM K;  1TWF A;  2A69 A;  3S1R C;  3S1M K;  2GAH C;  4XLN A;  5EGE A;  4G7Z A;  3V4G A;  4BXX C;  2ZUE A;  4WJ4 A;  1F93 A;  4YFX A;  1VJE A;  1Y1W K;  1I6H C;  3GTK A;  1C0A A;  3GTM C;  3S1Q K;  2Y0S D;  4MQ9 A;  3G4C A;  4YFN A;  5JFE A;  3FHZ A;  3GTG K;  4A3F K;  2KWA A;  3PO2 C;  3GTP K;  4C3H C;  1VGX A;  4KAS A;  2JA6 K;  3GTO A;  4BLB A;  5IYB C;  3HOY C;  3GTK C;  3ADA C;  4OIQ A;  1PJ7 A;  4LLG A;  5IP9 K;  2E2I K;  3S17 K;  3TFI A;  1ZBS A;  4A3E C;  1GE9 A;  1XZP A;  1R9T A;  3LAP A;  1WQG A;  2PPB A;  2R7Z K;  3GTO C;  4Q5S A;  1VLO A;  4KMU A;  4A3K C;  3PO3 K;  1O29 A;  4A3L C;  2CFA A;  2NVY K;  2O5I A;  1YX2 A;  3GTL K;  4BY7 K;  3G4A A;  4OIP A;  4GTC A;  1WOS A;  4LR2 A;  2R93 K;  5IYC C;  4A93 C;  2P5M A;  1R9T C;  3M4O K;  2E2I A;  1DCP A;  1TWA A;  1O2B A;  4GTE A;  1O2A A;  1USO A;  3H0G K;  1I6V A;  5EGH A;  1Y1V K;  1I50 A;  1ZQ1 C;  2GSO A;  3HOX K;  5TJ3 A;  2CW0 A;  1J6W A;  3S16 K;  4BBS K;  2XCR B;  1YCL A;  1TWA C;  4Y7N K;  2R93 A;  2PMZ D;  1EFW A;  1ZXO A;  2E2H A;  4Q4Z A;  4KMD A;  4AYB L;  1I50 C;  3MML B;  3HOU K;  3BP3 A;  1XZP B;  3S1N C;  3S1R K;  1SFO C;  2R92 K;  4KB2 A;  4KMH A;  2RH6 A;  4BXX K;  3N0C A;  5TMC A;  2E2H C;  1TWC C;  2JA8 K;  3GIR A;  4KM8 A;  3TFJ A;  3FOF A;  1F7V A;  2NVX A;  4KC6 A;  1I6H K;  4FM9 A;  1EH1 A;  1TWF K;  1YNN A;  3N0B A;  4OIR A;  2WB1 L;  5D4D A;  1WCM C;  4GTD A;  4YFK A;  3PO2 K;  4C3H K;  3HKZ L;  3NUH A;  2NVX C;  3ERE D;  3SZY A;  2ZUF A;  1TWH A;  3T02 A;  1IL2 A;  1B4B A;  3GTK K;  2E2J C;  1X31 C;  3I4M C;  5M3M K;  1SMY A;  2A6E A;  4A3M C;  3H3V D;  2WAQ D;  3AD9 C;  1V5V A;  4A3E K;  4FZB A;  3GTM A;  1G51 A;  3VA7 A;  3GTO K;  5FJ8 K;  4G7O A;  4A3K K;  2PA8 L;  3GEE A;  1TWH C;  1WSV A;  2V6T A;  3QX3 A;  4AYB D;  4A3L K;  1INN A;  4LK1 A;  5L46 A;  3K7A K;  5IP7 C;  1IQ0 A;  5HL8 A;  5IYC K;  2GAG C;  4A93 K;  1R9T K;  1DD5 A;  4MEX A;  2ZFZ A;  3S0X A;  3RZO C;  5FLM C;  3GTJ C;  4XSX A;  1WOR A;  3DXJ A;  2A68 A;  5M5Y K;  4C2M C;  3JST A;  2B63 C;  4JK1 A;  4P5A A;  1F9N A;  1K83 C;  3GTQ A;  4LJZ A;  1JQW A;  4KB4 A;  3I4N C;  3Q3Q A;  4G0V A;  1VH2 A;  2YU9 A;  3HKZ D;  1TWA K;  1J6V A;  5IYD C;  4PAB A;  2EBB A;  1IS1 A;  4M1X A;  1I50 K;  3GTQ C;  4RMF A;  1WOP A;  3S1N K;  1SFO K;  2YU9 C;  1WQF A;  3M3Y C;  3GEI A;  5C3E C;  1J98 A;  1XZQ A;  5C44 C;  4XCH A;  3RZD K;  2E2H K;  1TWC K;  3TFH A;  4YG2 A;  5M5W K;  1TWG A;  4GTF A;  4A3D C;  5M3F K;  3GDZ A;  4GT9 A;  4X6A C;  4G0U A;  1J6X A;  1AB4 A;  1Y1W C;  1SFO A;  1BDF A;  5C4J K;  4AH6 A;  1TWG C;  2NVX K;  4G0W A;  1HI9 A;  1TWC A;  3I4M K;  3S15 C;  4WJ3 M;  3CQZ C;  3N3Y A;  4A3M K;  5M5X K;  3S2H C;  2NVQ C;  4DDQ A;  4MEY A;  3T01 A;  1IE0 A;  1O2F B;  1WCM A;  4KM9 A;  3HOZ C;  1WOO A;  1TWH K;  2JA7 A;  2CFA B;  1B4A A;  4P5B A;  4LOW A;  2R7Z C;  4KAR A;  4WIL A;  3HOW C;  2BE5 A;  3A8J A;  4A3I C;  4C3J C;  1XZQ B;  2D6F C;  3GTM K;  2FQO A;  4XLP A;  3SZZ A;  5C4X C;  4C3I C;  3OPF A;  1EQR A;  3L4K A;  3RZO K;  1O28 A;  5FLM K;  3LAJ A;  3GTJ K;  2JA7 C;  4BY1 C;  3HOY K;  5IYB K;  4C2M K;  2B63 K;  1L0W A;  2XCQ A;  3AD7 C;  3HOV C;  5E68 A;  1EI6 A;  4A3C C;  1O27 A;  3H0G C;  4QIW L;  3GSI A;  3I4N K;  4LQY A;  5IOT A;  1IW7 A;  2JA5 A;  3FKI A;  5JVO A;  2NVT C;  2GSN A;  3S16 C;  4LK0 A;  3T00 A;  4KAT A;  3GTJ A;  4Y7N C;  3GTQ K;  4GFQ A;  4A3B C;  3HXA A;  4GTA A;  1WIH A;  3IPJ A;  2PHC B;  5TMF A;  2B63 A;  1BJT A;  2YU9 K;  3M3Y K;  1I3Q C;  1K83 A;  4O2D A;  5C3E K;  2JA5 C;  3HOU C;  4KDD A;  3FKI C;  5C44 K;  4BBR C;  3A8K A;  2R92 C;  3BUE A;  1BS2 A;  4C45 A;  4A3D K;  3TTG A;  2JA8 C;  1HQM A;  5CHP A;  4X6A K;  4A3G C;  2RGR A;  5IOR A;  1JVI A;  2WB1 D;  4Y52 C;  1DCH A;  1IBA A;  1ISE A;  1TWF C;  3FOE A;  4GZY A;  1TWG K;  2VUM A;  2V6U A;  4A3J C;  3S15 K;  3AH5 A;  3EQL A;  1PJ6 A;  2PMZ L;  3CQZ K;  4QIW D;  3S2H K;  2NVQ K;  3S2D C;  4J3N A;  2XCO A;  4KN7 A;  1ZVU A;  5IOS A;  3S14 C;  3HOZ K;  1USM A;  1Y1W A;  2VUM C;  4QJV A;  1WQH A;  2PA8 D;  3S1M C;  3GTG A;  3HOW K;  3GTP A;  4A3I K;  4ZH4 A;  2O5J A;  4C3J K;  2JA6 A;  4BKW A;  3CQZ A;  1JOE A;  1EK8 A;  1DCO A;  1WCM K;  3K7A C;  5C4X K;  4C3I K;  4KAW X;  4NOI A;  2A6H A;  2JA7 K;  3AD8 C;  3A8I A;  4BY1 K;  3S1Q C;  2GSU A;  3GTG C;  4A3F C;  3GTP C;  5IOQ A;  2E2J K;  1O25 A;  4XSZ A;  1O26 A;  3HOV K;  2JH3 A;  4GTL A; 
#chains in the Genus database with same CATH homology
 1F7V A;  1IQ0 A;  1BS2 A;  2ZUF A;  2ZUE A;  1F7U A;  3GDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...