3GTLK

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtlK00
3S2DK 3M4OC 2WB1D 4YFNA 4A3JK 3S1QC 5C44K 4A3CK 2PA8D 4G7ZA 2YU9K 5M5YK 2NVXC 4C2MK 4Y52C 2R7ZK 3RZOK 4BXXK 1ZYRA 3HOXC 2WAQD 3FKIC 2NVTK 3GTMC 5M3MK 5FLMK 4A3LC 3HOWK 1YNJA 1I3QC 5M5XK 4BBSC 3HOUK 3S1NC 4QJVB 2R93C 5C4XC 4JK1A 3RZDK 4OINA 3H0GC 4YG2A 3GTOK 3HOVC 4G7OA 4QJVA 4A93C 3K7AK 1HQMA 2O5IA 3PO2K 4C3IK 5IYCK 3S17K 3PO3K 4QIWL 4NOIA 4YFKA 1WCMC 5C4JK 5C3EC 3S1MK 4XLNA 3S2HK 2Y0SL 1SFOK 4A3DC 2E2IC 2PA8L 4MEXA 3GTLC 1Y1WC 2R92C 3M3YK 4LK0A 4A3BK 2CW0A 3HKZD 3GTKC 4AYBD 3S15C 1BDFA 3DXJA 3CQZK 5TMFA 2JA5C 2JA7K 3HOYC 5M3FK 5C44C 2BE5A 4A3CC 5IYDK 4Y7NC 1I6VA 1TWGK 1R9TK 2YU9C 2VUMK 3RZOC 3GTGK 3HOZK 5IYBK 4LJZA 2R7ZC 3I4MK 4BXXC 4OIQA 2NVTC 2JA8C 5FLMC 1SMYA 4XLPA 3GTJC 3HOWC 3S1RK 1TWFC 4BBRK 4LK1A 3HOUC 3S14K 4BY7K 4X6AK 1I50K 1TWHK 2PMZL 4KN4A 4A3IC 4C3HK 3GTOC 3K7AC 2A69A 4G7HA 4A3MK 5IYCC 2WB1L 3EQLA 4A3FC 4BY1K 3PO3C 5C4JC 2NVQC 3S1MC 2JA6C 2NVXK 1SFOC 4A3EK 5IP9C 3S16K 3I4NK 3M3YC 4A3BC 2WAQL 1Y1VC 4A3LK 2E2JK 3GTPK 5D4DA 3S2DC 4GZYA 4MQ9A 4A3JC 4ZH4A 5FJ8K 4BBSK 3CQZC 2R93K 2JA7C 2NVYK 2A6EA 5C4XK 4XSXA 1I6HK 1K83K 3HOVK 5IP7K 3GTQK 5IYDC 1R9TC 2E2HK 1TWGC 2PPBA 4A93K 3GTGC 3HOZC 5IYBC 3I4MC 3H3VD 4A3KK 5C3EK 4KMUA 4KN7A 3S1RC 4YFXA 1TWAK 4BBRC 4A3GK 1YNNA 1TWCK 3RZDC 2B63K 3S14C 4X6AC 1I50C 2O5JA 1TWHC 3M4OK 1IW7A 3PO2C 4QIWD 3HKZL 3S1QK 4AYBL 3S17C 2JA5K 3HOYK 2Y0SD 2A6HA 3S2HC 4A3MC 4Y52K 4BY1C 4Y7NK 3HOXK 3FKIK 4OIOA 3GTMK 5TMCA 2A68A 4A3EC 4OIRA 2JA8K 3S16C 1I3QK 3GTJK 3I4NC 4Q5SA 3S1NK 2E2JC 1TWFK 3GTPC 3H3VL 4OIPA 4C3JK 3H0GK 2NVYC 4XSZA 1I6HC 4A3IK 1K83C 2VUMC 5IP7C 3GTQC 2E2HC 5M5WK 3WODA 4LLGA 1WCMK 4A3FK 4A3KC 2NVQK 4MEYA 2JA6K 4A3DK 2E2IK 3GTLK 1XPPA 4BY7C 2PMZD 1TWAC 1Y1WK 2R92K 4Q4ZA 4A3GC 1TWCC 3GTKK 5IP9K 2B63C 3S15K 1Y1VK
chains in the Genus database with same CATH superfamily
1JVIA 3SZZA 1J98A 3N0BA 1B4BA 5M5YK 4BXXK 2R7ZK 5JFEA 2WAQD 1VLOA 2D6FC 3FKIA 3HOWK 1IE0A 4C45A 3AD7C 4QJVB 2V6TA 1O24A 4YG2A 4QJVA 3H0GA 1WIHA 4BLAA 1XXAA 5C4JK 1G51A 2Y0SL 1XZQB 1WCMA 1SFOK 4A3BK 1PJ7A 1XZQA 1ZXOA 2CW0A 3GEIA 3HKZD 4AYBD 3GEEA 4AH6A 3GTKC 3S15C 1BDFA 3CQZK 2JA5C 2P5MA 2BE5A 2VUMK 3GTGK 4BXXC 2R7ZC 4LJZA 1JOEA 3HOWC 3S1RK 1TWFC 3GTJA 3S14K 1IQ0A 3L4KA 5JVOA 3GTOA 4KASA 4A3MK 2PHCB 2WB1L 4A3FC 5C4JC 5CHPA 1AB4A 2JA6A 1SFOC 1IBAA 4A3LK 4A3BC 3GTPK 1Y1VA 3CQZC 3AQPA 5C4XK 2A6EA 3ADAC 4GTAA 1C0AA 5IP7K 4A93K 2E2HK 3GTGC 3H3VD 4KMUA 3S1RC 1YNNA 4M1XA 3S14C 5EGHA 2O5JA 1IW7A 3T01A 3S1QK 3HOYK 3S2HC 4A3MC 3GSIA 3HOXK 3FKIK 1F7UA 3GTPC 3H0GK 1BS2A 3A8KA 3N0CA 2ZUFA 5IP7C 2E2HC 1K83A 2VUMA 5L46A 1WCMK 2GSOA 4XCHA 1XZPB 1J6XA 2B63A 4YFNA 4A3JK 1XZPA 3HXAA 3S1QC 5C44K 1F93A 4A3CK 2PA8D 1B4AA 3HOXC 3FKIC 4LR2A 1O28A 3TFIA 3GTMA 5HL8A 3FHZA 1VJEA 3RZDK 2GSNA 2XCRB 3H0GC 3GTOK 3HOVC 3K7AK 3ERED 2O5IA 4KM9A 1ZVUA 4QIWL 1WCMC 3S1MK 4FM9A 2GSUA 2Y3PA 4ILDA 2E2IA 3GTLA 4WJ4A 3DXJA 3BP8C 5E68A 5C44C 4A3CC 1WOPA 4Y7NC 3BUEA 3I4MK 2JA8C 3LAPA 1JQWA 4KM8A 3GTJC 4FZBA 4LK1A 3S0XA 2PMZL 3GDZA 4KN4A 1KQ4A 4C3HK 4A3IC 3GTOC 3K7AC 3JSTA 4BY1K 3S1MC 1O2BA 2JA6C 2NVXK 1L0WA 1XXBA 5IP9C 3S16K 3I4NK 1Y1VC 1ZBSA 5D4DA 3AD9C 4GZYA 4BBSK 2R93K 1BJTA 1K83K 5IOSA 5CJ9A 2PPBA 1R9TA 4O2DA 1TWGA 3I4MC 4GFQA 5C3EK 4KN7A 2FQOA 1X31C 2B63K 3M4OK 3SZYA 4KB2A 4KARA 1TWHA 1VH2A 2Y0SD 4KAWX 4BY1C 3GTMK 5TMCA 3S16C 3I4NC 1F7VA 3H3VL 4OIPA 4BKWA 1DD5A 3A8JA 1BGWA 4GTDA 2GAGC 1DCPA 1K83C 2NVYA 1WSVA 2VUMC 3GTQA 2XCOA 1O25A 2NVQK 4A3DK 2E2IK 3GTLK 4P9SA 2B63C 3S2DK 3M4OC 2WB1D 3G4AA 4KMHA 1O26A 1VGXA 5TJ3A 3LAJA 1VRQC 3RZOK 4C2MK 2W7VA 3TTGA 1ZYRA 4P5AA 4P5BA 2NVXA 3GTMC 5M3MK 5FLMK 3GEHA 4A3LC 3MMLB 1EFWA 3HOUK 4DDQA 1I3QA 5C4XC 3OEPA 1YX2A 4JK1A 4OINA 2R93A 4A93C 1DCOA 1HQMA 3PO2K 4C3IK 3S17K 1J6WA 3PO3K 4YFKA 4XLNA 4A3DC 2E2IC 2PA8L 4MEXA 3GTLC 3M3YK 1YCLA 1Y1WA 2R92A 1WQHA 1EI6A 3LPXA 5TMFA 3HOYC 5IYDK 1R9TK 1I6VA 1TWGK 3RZOC 4C2MC 3HOZK 2JH3A 5IYBK 2YU9A 4OIQA 5FLMC 4XLPA 3HOUC 4BY7K 1O29A 1TWHK 5IORA 4G0UA 2A69A 4G7HA 1XXCA 4C3IC 3G4CA 3PO3C 3M3YC 2WAQL 1ZQ1C 1USMA 4KMDA 2ZFZA 4MQ9A 1PJ6A 4A3JC 5FJ8K 3OREA 2NVYK 4XSXA 2RGRA 1I6HK 2JA7A 3AD8C 3GTQK 5IYDC 1R9TC 1TWGC 3HOZC 5IYBC 3VA7A 5EGEA 1WOSA 1V5VA 4YFXA 3RZDC 3L4JA 4GTFA 1TWHC 2V6SA 1I50A 4QIWD 3HKZL 4AYBL 1HI9A 2JA5K 4KDDA 2XCQA 1F9NA 4WJ3M 4GT9A 4Y52K 1DCHA 4OIOA 2A68A 3T02A 3Q3QA 4KATA 2GAHC 1I3QK 4Q5SA 3S1NK 1TWFK 5IOTA 4C3JK 2NVYC 4XSZA 1I6HC 1WORA 3GTQC 1WOOA 4LLGA 3FOFA 4A3FK 3QX3A 3AQOA 4MEYA 2CFAB 3GIRA 2PMZD 1Y1WK 4Q4ZA 2R92K 1GE9A 1TWAA 1TWCA 4C3HC 2CFAA 1O2FB 3AH5A 2RH6A 4G7ZA 4GTCA 3FOEA 2YU9K 2NVXC 4KMAA 4Y52C 2NVTK 2EBBA 4BLBA 4KB4A 3CAGA 1YNJA 1I3QC 5M5XK 4BBSC 4RMFA 3S1NC 2R93C 4C3JC 4G7OA 4GTEA 4GTLA 5IYCK 4NOIA 3S2HK 5C3EC 1EK8A 1IL2A 1Y1WC 2R92C 4LK0A 3GTKA 1J6VA 2JA7K 5M3FK 2JA5A 5IOQA 1UV7A 1USOA 1EH1A 2YU9C 3NUHA 2NVTC 2R7ZA 1SMYA 3N3YA 4BBRK 1WSRA 3T00A 1TWFA 4X6AK 3A8IA 1I50K 1ISEA 3OPFA 4LQYA 5IYCC 3EQLA 2NVQC 4A3EK 1SFOA 4WILA 2E2JK 4KC6A 3S2DC 2ZUEA 4ZH4A 4LOWA 2JA7C 3IPJA 3CQZA 4G0VA 1PJ5A 3HOVK 1IS1A 1O2AA 1RU0A 3GTGA 4A3KK 4GTBA 1TWAK 4PABA 3V4GA 4BBRC 4A3GK 1TWCK 4X6AC 2FQTA 1I50C 3PO2C 1WQFA 3S17C 2A6HA 2KWAA 4Y7NK 2P8TA 4A3EC 4OIRA 2JA8K 3GTJK 4G0WA 1O27A 2V6UA 3TFJA 2E2JC 1INNA 3BP3A 3GTPA 4J3NA 3TFHA 4A3IK 1WQGA 1EQRA 5M5WK 3WODA 4PAAA 2E2HA 4A3KC 2JA6K 1XPPA 4BY7C 1TWAC 4A3GC 1TWCC 3GTKK 5IP9K 3S15K 1Y1VK
chains in the Genus database with same CATH topology
3S2DK 3M4OC 2WB1D 4YFNA 4A3JK 3S1QC 5C44K 4A3CK 2PA8D 4G7ZA 2YU9K 5M5YK 2NVXC 4C2MK 4Y52C 2R7ZK 3RZOK 4BXXK 1ZYRA 3HOXC 2WAQD 3FKIC 2NVTK 3GTMC 5M3MK 5FLMK 4A3LC 3HOWK 1YNJA 1I3QC 5M5XK 4BBSC 3HOUK 3S1NC 4QJVB 2R93C 5C4XC 4JK1A 3RZDK 4OINA 3H0GC 4YG2A 3GTOK 3HOVC 4G7OA 4QJVA 4A93C 3K7AK 1HQMA 2O5IA 3PO2K 4C3IK 5IYCK 3S17K 3PO3K 4QIWL 4NOIA 4YFKA 1WCMC 5C4JK 5C3EC 3S1MK 4XLNA 3S2HK 2Y0SL 1SFOK 4A3DC 2E2IC 2PA8L 4MEXA 3GTLC 1Y1WC 2R92C 3M3YK 4LK0A 4A3BK 2CW0A 3HKZD 3GTKC 4AYBD 3S15C 1BDFA 3DXJA 3CQZK 5TMFA 2JA5C 2JA7K 3HOYC 5M3FK 5C44C 2BE5A 4A3CC 5IYDK 4Y7NC 1I6VA 1TWGK 1R9TK 2YU9C 2VUMK 3RZOC 3GTGK 3HOZK 5IYBK 4LJZA 2R7ZC 3I4MK 4BXXC 4OIQA 2NVTC 2JA8C 5FLMC 1SMYA 4XLPA 3GTJC 3HOWC 3S1RK 1TWFC 4BBRK 4LK1A 3HOUC 3S14K 4BY7K 4X6AK 1I50K 1TWHK 2PMZL 4KN4A 4A3IC 4C3HK 3GTOC 3K7AC 2A69A 4G7HA 4A3MK 5IYCC 2WB1L 3EQLA 4A3FC 4BY1K 3PO3C 5C4JC 2NVQC 3S1MC 2JA6C 2NVXK 1SFOC 4A3EK 5IP9C 3S16K 3I4NK 3M3YC 4A3BC 2WAQL 1Y1VC 4A3LK 2E2JK 3GTPK 5D4DA 3S2DC 4GZYA 4MQ9A 4A3JC 4ZH4A 5FJ8K 4BBSK 3CQZC 2R93K 2JA7C 2NVYK 2A6EA 5C4XK 4XSXA 1I6HK 1K83K 3HOVK 5IP7K 3GTQK 5IYDC 1R9TC 2E2HK 1TWGC 2PPBA 4A93K 3GTGC 3HOZC 5IYBC 3I4MC 3H3VD 4A3KK 5C3EK 4KMUA 4KN7A 3S1RC 4YFXA 1TWAK 4BBRC 4A3GK 1YNNA 1TWCK 3RZDC 2B63K 3S14C 4X6AC 1I50C 2O5JA 1TWHC 3M4OK 1IW7A 3PO2C 4QIWD 3HKZL 3S1QK 4AYBL 3S17C 2JA5K 3HOYK 2Y0SD 2A6HA 3S2HC 4A3MC 4Y52K 4BY1C 4Y7NK 3HOXK 3FKIK 4OIOA 3GTMK 5TMCA 2A68A 4A3EC 4OIRA 2JA8K 3S16C 1I3QK 3GTJK 3I4NC 4Q5SA 3S1NK 2E2JC 1TWFK 3GTPC 3H3VL 4OIPA 4C3JK 3H0GK 2NVYC 4XSZA 1I6HC 4A3IK 1K83C 2VUMC 5IP7C 3GTQC 2E2HC 5M5WK 3WODA 4LLGA 1WCMK 4A3FK 4A3KC 2NVQK 4MEYA 2JA6K 4A3DK 2E2IK 3GTLK 1XPPA 4BY7C 2PMZD 1TWAC 1Y1WK 2R92K 4Q4ZA 4A3GC 1TWCC 3GTKK 5IP9K 2B63C 3S15K 1Y1VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D K;  3M4O C;  2WB1 D;  4YFN A;  4A3J K;  3S1Q C;  5C44 K;  4A3C K;  2PA8 D;  4G7Z A;  2YU9 K;  5M5Y K;  2NVX C;  4C2M K;  4Y52 C;  2R7Z K;  3RZO K;  4BXX K;  1ZYR A;  3HOX C;  2WAQ D;  3FKI C;  2NVT K;  3GTM C;  5M3M K;  5FLM K;  4A3L C;  3HOW K;  1YNJ A;  1I3Q C;  5M5X K;  4BBS C;  3HOU K;  3S1N C;  4QJV B;  2R93 C;  5C4X C;  4JK1 A;  3RZD K;  4OIN A;  3H0G C;  4YG2 A;  3GTO K;  3HOV C;  4G7O A;  4QJV A;  4A93 C;  3K7A K;  1HQM A;  2O5I A;  3PO2 K;  4C3I K;  5IYC K;  3S17 K;  3PO3 K;  4QIW L;  4NOI A;  4YFK A;  1WCM C;  5C4J K;  5C3E C;  3S1M K;  4XLN A;  3S2H K;  2Y0S L;  1SFO K;  4A3D C;  2E2I C;  2PA8 L;  4MEX A;  3GTL C;  1Y1W C;  2R92 C;  3M3Y K;  4LK0 A;  4A3B K;  2CW0 A;  3HKZ D;  3GTK C;  4AYB D;  3S15 C;  1BDF A;  3DXJ A;  3CQZ K;  5TMF A;  2JA5 C;  2JA7 K;  3HOY C;  5M3F K;  5C44 C;  2BE5 A;  4A3C C;  5IYD K;  4Y7N C;  1I6V A;  1TWG K;  1R9T K;  2YU9 C;  2VUM K;  3RZO C;  3GTG K;  3HOZ K;  5IYB K;  4LJZ A;  2R7Z C;  3I4M K;  4BXX C;  4OIQ A;  2NVT C;  2JA8 C;  5FLM C;  1SMY A;  4XLP A;  3GTJ C;  3HOW C;  3S1R K;  1TWF C;  4BBR K;  4LK1 A;  3HOU C;  3S14 K;  4BY7 K;  4X6A K;  1I50 K;  1TWH K;  2PMZ L;  4KN4 A;  4A3I C;  4C3H K;  3GTO C;  3K7A C;  2A69 A;  4G7H A;  4A3M K;  5IYC C;  2WB1 L;  3EQL A;  4A3F C;  4BY1 K;  3PO3 C;  5C4J C;  2NVQ C;  3S1M C;  2JA6 C;  2NVX K;  1SFO C;  4A3E K;  5IP9 C;  3S16 K;  3I4N K;  3M3Y C;  4A3B C;  2WAQ L;  1Y1V C;  4A3L K;  2E2J K;  3GTP K;  5D4D A;  3S2D C;  4GZY A;  4MQ9 A;  4A3J C;  4ZH4 A;  5FJ8 K;  4BBS K;  3CQZ C;  2R93 K;  2JA7 C;  2NVY K;  2A6E A;  5C4X K;  4XSX A;  1I6H K;  1K83 K;  3HOV K;  5IP7 K;  3GTQ K;  5IYD C;  1R9T C;  2E2H K;  1TWG C;  2PPB A;  4A93 K;  3GTG C;  3HOZ C;  5IYB C;  3I4M C;  3H3V D;  4A3K K;  5C3E K;  4KMU A;  4KN7 A;  3S1R C;  4YFX A;  1TWA K;  4BBR C;  4A3G K;  1YNN A;  1TWC K;  3RZD C;  2B63 K;  3S14 C;  4X6A C;  1I50 C;  2O5J A;  1TWH C;  3M4O K;  1IW7 A;  3PO2 C;  4QIW D;  3HKZ L;  3S1Q K;  4AYB L;  3S17 C;  2JA5 K;  3HOY K;  2Y0S D;  2A6H A;  3S2H C;  4A3M C;  4Y52 K;  4BY1 C;  4Y7N K;  3HOX K;  3FKI K;  4OIO A;  3GTM K;  5TMC A;  2A68 A;  4A3E C;  4OIR A;  2JA8 K;  3S16 C;  1I3Q K;  3GTJ K;  3I4N C;  4Q5S A;  3S1N K;  2E2J C;  1TWF K;  3GTP C;  3H3V L;  4OIP A;  4C3J K;  3H0G K;  2NVY C;  4XSZ A;  1I6H C;  4A3I K;  1K83 C;  2VUM C;  5IP7 C;  3GTQ C;  2E2H C;  5M5W K;  3WOD A;  4LLG A;  1WCM K;  4A3F K;  4A3K C;  2NVQ K;  4MEY A;  2JA6 K;  4A3D K;  2E2I K;  3GTL K;  1XPP A;  4BY7 C;  2PMZ D;  1TWA C;  1Y1W K;  2R92 K;  4Q4Z A;  4A3G C;  1TWC C;  3GTK K;  5IP9 K;  2B63 C;  3S15 K;  1Y1V K; 
#chains in the Genus database with same CATH topology
 1JVI A;  3SZZ A;  1J98 A;  3N0B A;  1B4B A;  5M5Y K;  4BXX K;  2R7Z K;  5JFE A;  2WAQ D;  1VLO A;  2D6F C;  3FKI A;  3HOW K;  1IE0 A;  4C45 A;  3AD7 C;  4QJV B;  2V6T A;  1O24 A;  4YG2 A;  4QJV A;  3H0G A;  1WIH A;  4BLA A;  1XXA A;  5C4J K;  1G51 A;  2Y0S L;  1XZQ B;  1WCM A;  1SFO K;  4A3B K;  1PJ7 A;  1XZQ A;  1ZXO A;  2CW0 A;  3GEI A;  3HKZ D;  4AYB D;  3GEE A;  4AH6 A;  3GTK C;  3S15 C;  1BDF A;  3CQZ K;  2JA5 C;  2P5M A;  2BE5 A;  2VUM K;  3GTG K;  4BXX C;  2R7Z C;  4LJZ A;  1JOE A;  3HOW C;  3S1R K;  1TWF C;  3GTJ A;  3S14 K;  1IQ0 A;  3L4K A;  5JVO A;  3GTO A;  4KAS A;  4A3M K;  2PHC B;  2WB1 L;  4A3F C;  5C4J C;  5CHP A;  1AB4 A;  2JA6 A;  1SFO C;  1IBA A;  4A3L K;  4A3B C;  3GTP K;  1Y1V A;  3CQZ C;  3AQP A;  5C4X K;  2A6E A;  3ADA C;  4GTA A;  1C0A A;  5IP7 K;  4A93 K;  2E2H K;  3GTG C;  3H3V D;  4KMU A;  3S1R C;  1YNN A;  4M1X A;  3S14 C;  5EGH A;  2O5J A;  1IW7 A;  3T01 A;  3S1Q K;  3HOY K;  3S2H C;  4A3M C;  3GSI A;  3HOX K;  3FKI K;  1F7U A;  3GTP C;  3H0G K;  1BS2 A;  3A8K A;  3N0C A;  2ZUF A;  5IP7 C;  2E2H C;  1K83 A;  2VUM A;  5L46 A;  1WCM K;  2GSO A;  4XCH A;  1XZP B;  1J6X A;  2B63 A;  4YFN A;  4A3J K;  1XZP A;  3HXA A;  3S1Q C;  5C44 K;  1F93 A;  4A3C K;  2PA8 D;  1B4A A;  3HOX C;  3FKI C;  4LR2 A;  1O28 A;  3TFI A;  3GTM A;  5HL8 A;  3FHZ A;  1VJE A;  3RZD K;  2GSN A;  2XCR B;  3H0G C;  3GTO K;  3HOV C;  3K7A K;  3ERE D;  2O5I A;  4KM9 A;  1ZVU A;  4QIW L;  1WCM C;  3S1M K;  4FM9 A;  2GSU A;  2Y3P A;  4ILD A;  2E2I A;  3GTL A;  4WJ4 A;  3DXJ A;  3BP8 C;  5E68 A;  5C44 C;  4A3C C;  1WOP A;  4Y7N C;  3BUE A;  3I4M K;  2JA8 C;  3LAP A;  1JQW A;  4KM8 A;  3GTJ C;  4FZB A;  4LK1 A;  3S0X A;  2PMZ L;  3GDZ A;  4KN4 A;  1KQ4 A;  4C3H K;  4A3I C;  3GTO C;  3K7A C;  3JST A;  4BY1 K;  3S1M C;  1O2B A;  2JA6 C;  2NVX K;  1L0W A;  1XXB A;  5IP9 C;  3S16 K;  3I4N K;  1Y1V C;  1ZBS A;  5D4D A;  3AD9 C;  4GZY A;  4BBS K;  2R93 K;  1BJT A;  1K83 K;  5IOS A;  5CJ9 A;  2PPB A;  1R9T A;  4O2D A;  1TWG A;  3I4M C;  4GFQ A;  5C3E K;  4KN7 A;  2FQO A;  1X31 C;  2B63 K;  3M4O K;  3SZY A;  4KB2 A;  4KAR A;  1TWH A;  1VH2 A;  2Y0S D;  4KAW X;  4BY1 C;  3GTM K;  5TMC A;  3S16 C;  3I4N C;  1F7V A;  3H3V L;  4OIP A;  4BKW A;  1DD5 A;  3A8J A;  1BGW A;  4GTD A;  2GAG C;  1DCP A;  1K83 C;  2NVY A;  1WSV A;  2VUM C;  3GTQ A;  2XCO A;  1O25 A;  2NVQ K;  4A3D K;  2E2I K;  3GTL K;  4P9S A;  2B63 C;  3S2D K;  3M4O C;  2WB1 D;  3G4A A;  4KMH A;  1O26 A;  1VGX A;  5TJ3 A;  3LAJ A;  1VRQ C;  3RZO K;  4C2M K;  2W7V A;  3TTG A;  1ZYR A;  4P5A A;  4P5B A;  2NVX A;  3GTM C;  5M3M K;  5FLM K;  3GEH A;  4A3L C;  3MML B;  1EFW A;  3HOU K;  4DDQ A;  1I3Q A;  5C4X C;  3OEP A;  1YX2 A;  4JK1 A;  4OIN A;  2R93 A;  4A93 C;  1DCO A;  1HQM A;  3PO2 K;  4C3I K;  3S17 K;  1J6W A;  3PO3 K;  4YFK A;  4XLN A;  4A3D C;  2E2I C;  2PA8 L;  4MEX A;  3GTL C;  3M3Y K;  1YCL A;  1Y1W A;  2R92 A;  1WQH A;  1EI6 A;  3LPX A;  5TMF A;  3HOY C;  5IYD K;  1R9T K;  1I6V A;  1TWG K;  3RZO C;  4C2M C;  3HOZ K;  2JH3 A;  5IYB K;  2YU9 A;  4OIQ A;  5FLM C;  4XLP A;  3HOU C;  4BY7 K;  1O29 A;  1TWH K;  5IOR A;  4G0U A;  2A69 A;  4G7H A;  1XXC A;  4C3I C;  3G4C A;  3PO3 C;  3M3Y C;  2WAQ L;  1ZQ1 C;  1USM A;  4KMD A;  2ZFZ A;  4MQ9 A;  1PJ6 A;  4A3J C;  5FJ8 K;  3ORE A;  2NVY K;  4XSX A;  2RGR A;  1I6H K;  2JA7 A;  3AD8 C;  3GTQ K;  5IYD C;  1R9T C;  1TWG C;  3HOZ C;  5IYB C;  3VA7 A;  5EGE A;  1WOS A;  1V5V A;  4YFX A;  3RZD C;  3L4J A;  4GTF A;  1TWH C;  2V6S A;  1I50 A;  4QIW D;  3HKZ L;  4AYB L;  1HI9 A;  2JA5 K;  4KDD A;  2XCQ A;  1F9N A;  4WJ3 M;  4GT9 A;  4Y52 K;  1DCH A;  4OIO A;  2A68 A;  3T02 A;  3Q3Q A;  4KAT A;  2GAH C;  1I3Q K;  4Q5S A;  3S1N K;  1TWF K;  5IOT A;  4C3J K;  2NVY C;  4XSZ A;  1I6H C;  1WOR A;  3GTQ C;  1WOO A;  4LLG A;  3FOF A;  4A3F K;  3QX3 A;  3AQO A;  4MEY A;  2CFA B;  3GIR A;  2PMZ D;  1Y1W K;  4Q4Z A;  2R92 K;  1GE9 A;  1TWA A;  1TWC A;  4C3H C;  2CFA A;  1O2F B;  3AH5 A;  2RH6 A;  4G7Z A;  4GTC A;  3FOE A;  2YU9 K;  2NVX C;  4KMA A;  4Y52 C;  2NVT K;  2EBB A;  4BLB A;  4KB4 A;  3CAG A;  1YNJ A;  1I3Q C;  5M5X K;  4BBS C;  4RMF A;  3S1N C;  2R93 C;  4C3J C;  4G7O A;  4GTE A;  4GTL A;  5IYC K;  4NOI A;  3S2H K;  5C3E C;  1EK8 A;  1IL2 A;  1Y1W C;  2R92 C;  4LK0 A;  3GTK A;  1J6V A;  2JA7 K;  5M3F K;  2JA5 A;  5IOQ A;  1UV7 A;  1USO A;  1EH1 A;  2YU9 C;  3NUH A;  2NVT C;  2R7Z A;  1SMY A;  3N3Y A;  4BBR K;  1WSR A;  3T00 A;  1TWF A;  4X6A K;  3A8I A;  1I50 K;  1ISE A;  3OPF A;  4LQY A;  5IYC C;  3EQL A;  2NVQ C;  4A3E K;  1SFO A;  4WIL A;  2E2J K;  4KC6 A;  3S2D C;  2ZUE A;  4ZH4 A;  4LOW A;  2JA7 C;  3IPJ A;  3CQZ A;  4G0V A;  1PJ5 A;  3HOV K;  1IS1 A;  1O2A A;  1RU0 A;  3GTG A;  4A3K K;  4GTB A;  1TWA K;  4PAB A;  3V4G A;  4BBR C;  4A3G K;  1TWC K;  4X6A C;  2FQT A;  1I50 C;  3PO2 C;  1WQF A;  3S17 C;  2A6H A;  2KWA A;  4Y7N K;  2P8T A;  4A3E C;  4OIR A;  2JA8 K;  3GTJ K;  4G0W A;  1O27 A;  2V6U A;  3TFJ A;  2E2J C;  1INN A;  3BP3 A;  3GTP A;  4J3N A;  3TFH A;  4A3I K;  1WQG A;  1EQR A;  5M5W K;  3WOD A;  4PAA A;  2E2H A;  4A3K C;  2JA6 K;  1XPP A;  4BY7 C;  1TWA C;  4A3G C;  1TWC C;  3GTK K;  5IP9 K;  3S15 K;  1Y1V K; 
#chains in the Genus database with same CATH homology
 3S2D K;  3M4O C;  2WB1 D;  4YFN A;  4A3J K;  3S1Q C;  5C44 K;  4A3C K;  2PA8 D;  4G7Z A;  2YU9 K;  5M5Y K;  2NVX C;  4C2M K;  4Y52 C;  2R7Z K;  3RZO K;  4BXX K;  1ZYR A;  3HOX C;  2WAQ D;  3FKI C;  2NVT K;  3GTM C;  5M3M K;  5FLM K;  4A3L C;  3HOW K;  1YNJ A;  1I3Q C;  5M5X K;  4BBS C;  3HOU K;  3S1N C;  4QJV B;  2R93 C;  5C4X C;  4JK1 A;  3RZD K;  4OIN A;  3H0G C;  4YG2 A;  3GTO K;  3HOV C;  4G7O A;  4QJV A;  4A93 C;  3K7A K;  1HQM A;  2O5I A;  3PO2 K;  4C3I K;  5IYC K;  3S17 K;  3PO3 K;  4QIW L;  4NOI A;  4YFK A;  1WCM C;  5C4J K;  5C3E C;  3S1M K;  4XLN A;  3S2H K;  2Y0S L;  1SFO K;  4A3D C;  2E2I C;  2PA8 L;  4MEX A;  3GTL C;  1Y1W C;  2R92 C;  3M3Y K;  4LK0 A;  4A3B K;  2CW0 A;  3HKZ D;  3GTK C;  4AYB D;  3S15 C;  1BDF A;  3DXJ A;  3CQZ K;  5TMF A;  2JA5 C;  2JA7 K;  3HOY C;  5M3F K;  5C44 C;  2BE5 A;  4A3C C;  5IYD K;  4Y7N C;  1I6V A;  1TWG K;  1R9T K;  2YU9 C;  2VUM K;  3RZO C;  3GTG K;  3HOZ K;  5IYB K;  4LJZ A;  2R7Z C;  3I4M K;  4BXX C;  4OIQ A;  2NVT C;  2JA8 C;  5FLM C;  1SMY A;  4XLP A;  3GTJ C;  3HOW C;  3S1R K;  1TWF C;  4BBR K;  4LK1 A;  3HOU C;  3S14 K;  4BY7 K;  4X6A K;  1I50 K;  1TWH K;  2PMZ L;  4KN4 A;  4A3I C;  4C3H K;  3GTO C;  3K7A C;  2A69 A;  4G7H A;  4A3M K;  5IYC C;  2WB1 L;  3EQL A;  4A3F C;  4BY1 K;  3PO3 C;  5C4J C;  2NVQ C;  3S1M C;  2JA6 C;  2NVX K;  1SFO C;  4A3E K;  5IP9 C;  3S16 K;  3I4N K;  3M3Y C;  4A3B C;  2WAQ L;  1Y1V C;  4A3L K;  2E2J K;  3GTP K;  5D4D A;  3S2D C;  4GZY A;  4MQ9 A;  4A3J C;  4ZH4 A;  5FJ8 K;  4BBS K;  3CQZ C;  2R93 K;  2JA7 C;  2NVY K;  2A6E A;  5C4X K;  4XSX A;  1I6H K;  1K83 K;  3HOV K;  5IP7 K;  3GTQ K;  5IYD C;  1R9T C;  2E2H K;  1TWG C;  2PPB A;  4A93 K;  3GTG C;  3HOZ C;  5IYB C;  3I4M C;  3H3V D;  4A3K K;  5C3E K;  4KMU A;  4KN7 A;  3S1R C;  4YFX A;  1TWA K;  4BBR C;  4A3G K;  1YNN A;  1TWC K;  3RZD C;  2B63 K;  3S14 C;  4X6A C;  1I50 C;  2O5J A;  1TWH C;  3M4O K;  1IW7 A;  3PO2 C;  4QIW D;  3HKZ L;  3S1Q K;  4AYB L;  3S17 C;  2JA5 K;  3HOY K;  2Y0S D;  2A6H A;  3S2H C;  4A3M C;  4Y52 K;  4BY1 C;  4Y7N K;  3HOX K;  3FKI K;  4OIO A;  3GTM K;  5TMC A;  2A68 A;  4A3E C;  4OIR A;  2JA8 K;  3S16 C;  1I3Q K;  3GTJ K;  3I4N C;  4Q5S A;  3S1N K;  2E2J C;  1TWF K;  3GTP C;  3H3V L;  4OIP A;  4C3J K;  3H0G K;  2NVY C;  4XSZ A;  1I6H C;  4A3I K;  1K83 C;  2VUM C;  5IP7 C;  3GTQ C;  2E2H C;  5M5W K;  3WOD A;  4LLG A;  1WCM K;  4A3F K;  4A3K C;  2NVQ K;  4MEY A;  2JA6 K;  4A3D K;  2E2I K;  3GTL K;  1XPP A;  4BY7 C;  2PMZ D;  1TWA C;  1Y1W K;  2R92 K;  4Q4Z A;  4A3G C;  1TWC C;  3GTK K;  5IP9 K;  2B63 C;  3S15 K;  1Y1V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...