3GTLK

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtlK00
4QJVA 2R93K 3HOVC 4AYBL 4YFNA 3S1MK 2WB1D 5IP9K 2A69A 2NVYK 4OIPA 3M3YC 3S1QC 4KMUA 3RZDC 1BDFA 2NVTC 3K7AK 4C3IK 5IYBK 5FJ8K 2B63K 5IYCC 3GTMK 5C44K 5C4XC 4Q5SA 3HOYC 4A3KK 1TWGK 3S17C 1YNNA 3H3VL 1YNJA 1WCMC 3I4NC 3HOXK 1SMYA 3HOZC 5M5XK 4C2MK 1I6HK 4BBSC 1TWHK 2O5IA 5FLMC 2E2HK 3GTQK 5IYDC 2CW0A 2Y0SD 2PA8L 5C3EC 4A3MK 2E2IK 2R93C 3HOWK 3S1MC 1SFOK 4OIQA 1R9TK 4KN7A 5IP9C 2NVYC 1TWAK 2JA8K 4YFKA 3S2DC 1IW7A 3S1NK 3GTJK 3S15K 3HKZD 3K7AC 3S16K 5IYBC 4GZYA 2B63C 3GTMC 4BY7K 5C44C 4QIWD 3S2DK 2VUMK 4XLNA 2A68A 3DXJA 4A3KC 1TWGC 3CQZK 2WB1L 2PMZD 2JA6K 4BY1K 4JK1A 3HOXC 1TWFK 4NOIA 4A3GC 2PPBA 3I4MK 1I6HC 2WAQD 4A93K 5TMCA 1K83K 2JA5K 1TWHC 4A3IK 2E2HC 3GTQC 4AYBD 3S2HC 4A3GK 4A3MC 2E2IC 1HQMA 2E2JK 3HOWC 1SFOC 1R9TC 2NVXK 1TWAC 2JA8C 3H0GK 3GTOK 4ZH4A 5C4JK 4A3JK 3S1NC 4A3LK 4Y7NK 4XSXA 4LLGA 3GTJC 3S16C 3S15C 3GTGK 3S1RK 4C3JK 4BXXK 4BY7C 2VUMC 1I50K 3PO2K 2YU9K 4A3FK 4A3DK 3CQZC 2JA6C 1ZYRA 1Y1VK 4BY1C 4QJVB 1TWFC 4LK0A 4A3EK 1Y1WK 4X6AK 3I4MC 4XLPA 4A93C 2JA5C 1K83C 4A3BK 3HKZL 3S14K 1TWCK 4A3IC 3FKIK 4QIWL 4MEXA 2E2JC 3RZOK 3GTPK 4KN4A 4LJZA 4YG2A 5IP7C 4BBRK 3M4OK 2PMZL 2NVXC 4OINA 3H0GC 3GTOC 4Y52K 5C4JC 4A3JC 2BE5A 4A3LC 4Y7NC 5M3MK 3EQLA 4MEYA 2JA7K 2WAQL 2NVQK 3GTLK 3GTGC 3S1RC 3PO3K 4BXXC 1I3QK 2R92K 3HOUK 1I50C 3PO2C 2YU9C 4A3CK 4MQ9A 4A3FC 3WODA 4A3DC 3GTKK 2R7ZK 5M5YK 5M5WK 5IP7K 2R7ZC 1Y1VC 3HOVK 2A6EA 2Y0SL 4C3HK 4G7HA 4A3EC 1Y1WC 4X6AC 1I6VA 3H3VD 3M3YK 4A3BC 3S14C 3S2HK 3S1QK 1TWCC 3FKIC 4G7ZA 3RZDK 5TMFA 2NVTK 4YFXA 3RZOC 1XPPA 3GTPC 5IYCK 4BBRC 2PA8D 5C4XK 4Y52C 5D4DA 3HOYK 3M4OC 4LK1A 4Q4ZA 4XSZA 4G7OA 3S17K 3GTLC 2JA7C 2NVQC 4OIOA 3PO3C 1WCMK 3I4NK 1I3QC 5M3FK 2R92C 3HOZK 3HOUC 4A3CC 2A6HA 2O5JA 4OIRA 4BBSK 3GTKC 5FLMK 5IYDK 5C3EK
chains in the Genus database with same CATH superfamily
4AYBL 4J3NA 5CJ9A 1XXCA 3OEPA 4OIPA 3S1QC 1B4BA 1JVIA 4C3IK 5FJ8K 2NVYA 5IYCC 4A3KK 1TWGK 3AQOA 2B63A 1YNNA 4KB4A 3H3VL 4GT9A 1DCOA 3HOXK 3AH5A 1SMYA 5M5XK 4C2MK 1J6WA 5FLMC 4GTLA 2PA8L 4A3MK 3HOWK 4KN7A 5IP9C 2JA8K 1WOSA 3TFIA 2GSOA 3GTMC 5C44C 4XLNA 3CQZK 2WB1L 1VRQC 2FQTA 2VUMA 1ZXOA 1I6HC 1IS1A 4A93K 2JA5K 1TWHC 2E2HC 3GTQC 2ZFZA 2E2JK 1TWAC 3GTOK 3GDZA 1KQ4A 1XZQB 4KMAA 4KMDA 4A3LK 4XSXA 5IORA 1EFWA 1HI9A 3H0GA 1L0WA 2R92A 1XXBA 4GTFA 4XCHA 4A3DK 1DCPA 1Y1VK 4QJVB 1TWFC 4A3EK 1Y1WK 4X6AK 3I4MC 3HKZL 3S14K 4WJ3M 4A3IC 1XZQA 1TWCA 4BBRK 2PMZL 4Y52K 4OINA 1F93A 3EQLA 2P5MA 3GTGC 3S1RC 4BXXC 1I3QK 3HOUK 1I50C 1ZBSA 2YU9C 3PO2C 1INNA 5IP7K 3H3VD 3GTKA 4A3BC 1IQ0A 3FKIC 1XZPB 1WQHA 3BP8C 4YFXA 2PA8D 4Q4ZA 1V5VA 3GSIA 3S17K 2NVQC 1O2AA 4OIOA 3PO3C 4KATA 3LAPA 2R92C 3HOZK 4ILDA 3NUHA 1WIHA 1XZPA 2R93K 4C3HC 3S1MK 2WB1D 2V6TA 3ADAC 3QX3A 4WILA 1VLOA 4WJ4A 3K7AK 3TFJA 5C4XC 4Q5SA 3HOYC 1ZQ1C 3GTMA 3Q3QA 1WCMC 3I4NC 3AQPA 1B4AA 3V4GA 2Y0SD 4GTBA 5C3EC 2E2IK 1SFOK 1TWHA 3GTQA 2E2HA 4C45A 1IL2A 3GTJK 3S15K 3HKZD 4C3IC 3S16K 2D6FC 1TWAA 3HXAA 2A68A 3CAGA 1TWGC 4A3KC 2PMZD 2JA6K 1C0AA 3HOXC 3GIRA 4C2MC 3A8KA 1K83K 5TMCA 1TWFA 4A3MC 3G4CA 1EK8A 1F7VA 4G0UA 3HOWC 1O24A 4PABA 2JA8C 4ZH4A 3N0BA 4A3JK 3ERED 4LLGA 4P9SA 1VGXA 4C3JK 1O25A 4A3FK 3GTGA 5JFEA 3CQZC 1I50A 2YU9A 4LK0A 3GEHA 4A93C 2JA5C 4KB2A 3LAJA 2XCOA 4QIWL 4MEXA 2E2JC 3GTPK 4KN4A 4LJZA 1BS2A 3FKIA 3M4OK 3GTOC 3GEEA 4A3LC 1F7UA 2CFAB 2JA7K 3GTLK 2WAQL 2XCQA 1EQRA 4MQ9A 5CHPA 4A3DC 2R7ZK 1Y1VC 3HOVK 2A6EA 2Y0SL 4BLAA 4A3EC 1BJTA 1Y1WC 4X6AC 3T00A 3AD8C 3M3YK 3S14C 3SZYA 3L4KA 3RZDK 2NVTK 1XPPA 4BBRC 5D4DA 4Y52C 1IE0A 4G7OA 1AB4A 3G4AA 5HL8A 1I3QC 1JQWA 3HOUC 3TTGA 2O5JA 4BBSK 1WCMA 5IYDK 5IP7C 4QJVA 2A69A 2NVYK 3BUEA 4KMUA 1EH1A 4LQYA 1BDFA 5IYBK 3LPXA 1X31C 2B63K 3OPFA 5IOQA 3N0CA 3S17C 4DDQA 1XXAA 4FM9A 2JA6A 1YNJA 1TWGA 4RMFA 3HOZC 5IOSA 2O5IA 3S2HK 1WOPA 2R93C 3S1MC 1R9TK 4AH6A 4GFQA 3S2DC 1IW7A 1VH2A 3S1NK 2RH6A 1PJ5A 1VJEA 3K7AC 3A8IA 4BY7K 4QIWD 3S2DK 2VUMK 1UV7A 3DXJA 2JH3A 4BLBA 4G0VA 4BY1K 4JK1A 3FHZA 4A3GC 2WAQD 3CQZA 4A3GK 2E2IC 1WQGA 1HQMA 5TJ3A 2JA5A 1SFOC 3OREA 2NVXK 1JOEA 3H0GK 5C4JK 4Y7NK 3GTLA 3GTJC 4LOWA 3S15C 3S16C 3GTOA 2GSNA 1BGWA 2W7VA 2JA6C 1ZYRA 1O29A 5IOTA 4KAWX 1K83C 1TWCK 1Y1VA 4GTDA 2RGRA 1Y1WA 3RZOK 2GAHC 4KASA 5E68A 5JVOA 4A3JC 2FQOA 4GTEA 4MEYA 1WSRA 4C3JC 2Y3PA 4P5BA 4A3CK 1G51A 4A3FC 3SZZA 3GTKK 4M1XA 1USOA 3BP3A 1I3QA 5M5WK 4G7HA 1I6VA 3S1QK 1PJ7A 4G7ZA 5TMFA 3GTPC 5IYCK 1YX2A 3M4OC 2V6UA 4XSZA 1O2FB 3GTLC 2JA7C 3TFHA 5M3FK 2A6HA 4KM8A 1O26A 3GEIA 5FLMK 2R7ZC 3HOVC 2PHCB 4YFNA 1R9TA 4KC6A 5IP9K 1WQFA 4KM9A 3M3YC 1USMA 5EGEA 2R93A 5L46A 3RZDC 2NVTC 1J98A 3GTMK 4KMHA 5C44K 4O2DA 1WSVA 2CFAA 2GSUA 1WORA 3AD7C 2EBBA 1I6HK 1IBAA 4BBSC 1TWHK 2E2HK 3GTQK 5IYDC 2CW0A 4OIQA 2NVXA 2NVYC 1TWAK 4YFKA 3JSTA 1RU0A 2E2IA 1DCHA 1YCLA 1SFOA 1GE9A 3FOEA 4GZYA 5IYBC 4KDDA 2B63C 2ZUFA 3T01A 2P8TA 3GTJA 4FZBA 1DD5A 1TWFK 4NOIA 2PPBA 3I4MK 4A3IK 3S2HC 4AYBD 1ISEA 4BKWA 1K83A 1R9TC 1F9NA 3N3YA 3AD9C 3L4JA 3S1NC 3GTGK 3S1RK 4BXXK 4BY7C 2VUMC 1I50K 3PO2K 2YU9K 1O2BA 4BY1C 4XLPA 4A3BK 1PJ6A 2V6SA 3FKIK 4GTAA 4YG2A 1ZVUA 4P5AA 2NVXC 3H0GC 5C4JC 2BE5A 4Y7NC 1J6XA 5M3MK 3GTPA 2NVQK 3PO3K 4GTCA 2R92K 2JA7A 3WODA 5M5YK 4LR2A 3VA7A 4C3HK 4KARA 5EGHA 2ZUEA 2R7ZA 1TWCC 1J6VA 2KWAA 3A8JA 3RZOC 1O27A 3IPJA 4G0WA 5C4XK 4PAAA 3T02A 3HOYK 3FOFA 4LK1A 1O28A 1WOOA 1EI6A 3MMLB 1WCMK 2XCRB 3I4NK 4A3CC 2GAGC 3S0XA 4OIRA 3GTKC 5C3EK
chains in the Genus database with same CATH topology
4QJVA 2R93K 3HOVC 4AYBL 4YFNA 3S1MK 2WB1D 5IP9K 2A69A 2NVYK 4OIPA 3M3YC 3S1QC 4KMUA 3RZDC 1BDFA 2NVTC 3K7AK 4C3IK 5IYBK 5FJ8K 2B63K 5IYCC 3GTMK 5C44K 5C4XC 4Q5SA 3HOYC 4A3KK 1TWGK 3S17C 1YNNA 3H3VL 1YNJA 1WCMC 3I4NC 3HOXK 1SMYA 3HOZC 5M5XK 4C2MK 1I6HK 4BBSC 1TWHK 2O5IA 5FLMC 2E2HK 3GTQK 5IYDC 2CW0A 2Y0SD 2PA8L 5C3EC 4A3MK 2E2IK 2R93C 3HOWK 3S1MC 1SFOK 4OIQA 1R9TK 4KN7A 5IP9C 2NVYC 1TWAK 2JA8K 4YFKA 3S2DC 1IW7A 3S1NK 3GTJK 3S15K 3HKZD 3K7AC 3S16K 5IYBC 4GZYA 2B63C 3GTMC 4BY7K 5C44C 4QIWD 3S2DK 2VUMK 4XLNA 2A68A 3DXJA 4A3KC 1TWGC 3CQZK 2WB1L 2PMZD 2JA6K 4BY1K 4JK1A 3HOXC 1TWFK 4NOIA 4A3GC 2PPBA 3I4MK 1I6HC 2WAQD 4A93K 5TMCA 1K83K 2JA5K 1TWHC 4A3IK 2E2HC 3GTQC 4AYBD 3S2HC 4A3GK 4A3MC 2E2IC 1HQMA 2E2JK 3HOWC 1SFOC 1R9TC 2NVXK 1TWAC 2JA8C 3H0GK 3GTOK 4ZH4A 5C4JK 4A3JK 3S1NC 4A3LK 4Y7NK 4XSXA 4LLGA 3GTJC 3S16C 3S15C 3GTGK 3S1RK 4C3JK 4BXXK 4BY7C 2VUMC 1I50K 3PO2K 2YU9K 4A3FK 4A3DK 3CQZC 2JA6C 1ZYRA 1Y1VK 4BY1C 4QJVB 1TWFC 4LK0A 4A3EK 1Y1WK 4X6AK 3I4MC 4XLPA 4A93C 2JA5C 1K83C 4A3BK 3HKZL 3S14K 1TWCK 4A3IC 3FKIK 4QIWL 4MEXA 2E2JC 3RZOK 3GTPK 4KN4A 4LJZA 4YG2A 5IP7C 4BBRK 3M4OK 2PMZL 2NVXC 4OINA 3H0GC 3GTOC 4Y52K 5C4JC 4A3JC 2BE5A 4A3LC 4Y7NC 5M3MK 3EQLA 4MEYA 2JA7K 2WAQL 2NVQK 3GTLK 3GTGC 3S1RC 3PO3K 4BXXC 1I3QK 2R92K 3HOUK 1I50C 3PO2C 2YU9C 4A3CK 4MQ9A 4A3FC 3WODA 4A3DC 3GTKK 2R7ZK 5M5YK 5M5WK 5IP7K 2R7ZC 1Y1VC 3HOVK 2A6EA 2Y0SL 4C3HK 4G7HA 4A3EC 1Y1WC 4X6AC 1I6VA 3H3VD 3M3YK 4A3BC 3S14C 3S2HK 3S1QK 1TWCC 3FKIC 4G7ZA 3RZDK 5TMFA 2NVTK 4YFXA 3RZOC 1XPPA 3GTPC 5IYCK 4BBRC 2PA8D 5C4XK 4Y52C 5D4DA 3HOYK 3M4OC 4LK1A 4Q4ZA 4XSZA 4G7OA 3S17K 3GTLC 2JA7C 2NVQC 4OIOA 3PO3C 1WCMK 3I4NK 1I3QC 5M3FK 2R92C 3HOZK 3HOUC 4A3CC 2A6HA 2O5JA 4OIRA 4BBSK 3GTKC 5FLMK 5IYDK 5C3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJV A;  2R93 K;  3HOV C;  4AYB L;  4YFN A;  3S1M K;  2WB1 D;  5IP9 K;  2A69 A;  2NVY K;  4OIP A;  3M3Y C;  3S1Q C;  4KMU A;  3RZD C;  1BDF A;  2NVT C;  3K7A K;  4C3I K;  5IYB K;  5FJ8 K;  2B63 K;  5IYC C;  3GTM K;  5C44 K;  5C4X C;  4Q5S A;  3HOY C;  4A3K K;  1TWG K;  3S17 C;  1YNN A;  3H3V L;  1YNJ A;  1WCM C;  3I4N C;  3HOX K;  1SMY A;  3HOZ C;  5M5X K;  4C2M K;  1I6H K;  4BBS C;  1TWH K;  2O5I A;  5FLM C;  2E2H K;  3GTQ K;  5IYD C;  2CW0 A;  2Y0S D;  2PA8 L;  5C3E C;  4A3M K;  2E2I K;  2R93 C;  3HOW K;  3S1M C;  1SFO K;  4OIQ A;  1R9T K;  4KN7 A;  5IP9 C;  2NVY C;  1TWA K;  2JA8 K;  4YFK A;  3S2D C;  1IW7 A;  3S1N K;  3GTJ K;  3S15 K;  3HKZ D;  3K7A C;  3S16 K;  5IYB C;  4GZY A;  2B63 C;  3GTM C;  4BY7 K;  5C44 C;  4QIW D;  3S2D K;  2VUM K;  4XLN A;  2A68 A;  3DXJ A;  4A3K C;  1TWG C;  3CQZ K;  2WB1 L;  2PMZ D;  2JA6 K;  4BY1 K;  4JK1 A;  3HOX C;  1TWF K;  4NOI A;  4A3G C;  2PPB A;  3I4M K;  1I6H C;  2WAQ D;  4A93 K;  5TMC A;  1K83 K;  2JA5 K;  1TWH C;  4A3I K;  2E2H C;  3GTQ C;  4AYB D;  3S2H C;  4A3G K;  4A3M C;  2E2I C;  1HQM A;  2E2J K;  3HOW C;  1SFO C;  1R9T C;  2NVX K;  1TWA C;  2JA8 C;  3H0G K;  3GTO K;  4ZH4 A;  5C4J K;  4A3J K;  3S1N C;  4A3L K;  4Y7N K;  4XSX A;  4LLG A;  3GTJ C;  3S16 C;  3S15 C;  3GTG K;  3S1R K;  4C3J K;  4BXX K;  4BY7 C;  2VUM C;  1I50 K;  3PO2 K;  2YU9 K;  4A3F K;  4A3D K;  3CQZ C;  2JA6 C;  1ZYR A;  1Y1V K;  4BY1 C;  4QJV B;  1TWF C;  4LK0 A;  4A3E K;  1Y1W K;  4X6A K;  3I4M C;  4XLP A;  4A93 C;  2JA5 C;  1K83 C;  4A3B K;  3HKZ L;  3S14 K;  1TWC K;  4A3I C;  3FKI K;  4QIW L;  4MEX A;  2E2J C;  3RZO K;  3GTP K;  4KN4 A;  4LJZ A;  4YG2 A;  5IP7 C;  4BBR K;  3M4O K;  2PMZ L;  2NVX C;  4OIN A;  3H0G C;  3GTO C;  4Y52 K;  5C4J C;  4A3J C;  2BE5 A;  4A3L C;  4Y7N C;  5M3M K;  3EQL A;  4MEY A;  2JA7 K;  2WAQ L;  2NVQ K;  3GTL K;  3GTG C;  3S1R C;  3PO3 K;  4BXX C;  1I3Q K;  2R92 K;  3HOU K;  1I50 C;  3PO2 C;  2YU9 C;  4A3C K;  4MQ9 A;  4A3F C;  3WOD A;  4A3D C;  3GTK K;  2R7Z K;  5M5Y K;  5M5W K;  5IP7 K;  2R7Z C;  1Y1V C;  3HOV K;  2A6E A;  2Y0S L;  4C3H K;  4G7H A;  4A3E C;  1Y1W C;  4X6A C;  1I6V A;  3H3V D;  3M3Y K;  4A3B C;  3S14 C;  3S2H K;  3S1Q K;  1TWC C;  3FKI C;  4G7Z A;  3RZD K;  5TMF A;  2NVT K;  4YFX A;  3RZO C;  1XPP A;  3GTP C;  5IYC K;  4BBR C;  2PA8 D;  5C4X K;  4Y52 C;  5D4D A;  3HOY K;  3M4O C;  4LK1 A;  4Q4Z A;  4XSZ A;  4G7O A;  3S17 K;  3GTL C;  2JA7 C;  2NVQ C;  4OIO A;  3PO3 C;  1WCM K;  3I4N K;  1I3Q C;  5M3F K;  2R92 C;  3HOZ K;  3HOU C;  4A3C C;  2A6H A;  2O5J A;  4OIR A;  4BBS K;  3GTK C;  5FLM K;  5IYD K;  5C3E K; 
#chains in the Genus database with same CATH topology
 4AYB L;  4J3N A;  5CJ9 A;  1XXC A;  3OEP A;  4OIP A;  3S1Q C;  1B4B A;  1JVI A;  4C3I K;  5FJ8 K;  2NVY A;  5IYC C;  4A3K K;  1TWG K;  3AQO A;  2B63 A;  1YNN A;  4KB4 A;  3H3V L;  4GT9 A;  1DCO A;  3HOX K;  3AH5 A;  1SMY A;  5M5X K;  4C2M K;  1J6W A;  5FLM C;  4GTL A;  2PA8 L;  4A3M K;  3HOW K;  4KN7 A;  5IP9 C;  2JA8 K;  1WOS A;  3TFI A;  2GSO A;  3GTM C;  5C44 C;  4XLN A;  3CQZ K;  2WB1 L;  1VRQ C;  2FQT A;  2VUM A;  1ZXO A;  1I6H C;  1IS1 A;  4A93 K;  2JA5 K;  1TWH C;  2E2H C;  3GTQ C;  2ZFZ A;  2E2J K;  1TWA C;  3GTO K;  3GDZ A;  1KQ4 A;  1XZQ B;  4KMA A;  4KMD A;  4A3L K;  4XSX A;  5IOR A;  1EFW A;  1HI9 A;  3H0G A;  1L0W A;  2R92 A;  1XXB A;  4GTF A;  4XCH A;  4A3D K;  1DCP A;  1Y1V K;  4QJV B;  1TWF C;  4A3E K;  1Y1W K;  4X6A K;  3I4M C;  3HKZ L;  3S14 K;  4WJ3 M;  4A3I C;  1XZQ A;  1TWC A;  4BBR K;  2PMZ L;  4Y52 K;  4OIN A;  1F93 A;  3EQL A;  2P5M A;  3GTG C;  3S1R C;  4BXX C;  1I3Q K;  3HOU K;  1I50 C;  1ZBS A;  2YU9 C;  3PO2 C;  1INN A;  5IP7 K;  3H3V D;  3GTK A;  4A3B C;  1IQ0 A;  3FKI C;  1XZP B;  1WQH A;  3BP8 C;  4YFX A;  2PA8 D;  4Q4Z A;  1V5V A;  3GSI A;  3S17 K;  2NVQ C;  1O2A A;  4OIO A;  3PO3 C;  4KAT A;  3LAP A;  2R92 C;  3HOZ K;  4ILD A;  3NUH A;  1WIH A;  1XZP A;  2R93 K;  4C3H C;  3S1M K;  2WB1 D;  2V6T A;  3ADA C;  3QX3 A;  4WIL A;  1VLO A;  4WJ4 A;  3K7A K;  3TFJ A;  5C4X C;  4Q5S A;  3HOY C;  1ZQ1 C;  3GTM A;  3Q3Q A;  1WCM C;  3I4N C;  3AQP A;  1B4A A;  3V4G A;  2Y0S D;  4GTB A;  5C3E C;  2E2I K;  1SFO K;  1TWH A;  3GTQ A;  2E2H A;  4C45 A;  1IL2 A;  3GTJ K;  3S15 K;  3HKZ D;  4C3I C;  3S16 K;  2D6F C;  1TWA A;  3HXA A;  2A68 A;  3CAG A;  1TWG C;  4A3K C;  2PMZ D;  2JA6 K;  1C0A A;  3HOX C;  3GIR A;  4C2M C;  3A8K A;  1K83 K;  5TMC A;  1TWF A;  4A3M C;  3G4C A;  1EK8 A;  1F7V A;  4G0U A;  3HOW C;  1O24 A;  4PAB A;  2JA8 C;  4ZH4 A;  3N0B A;  4A3J K;  3ERE D;  4LLG A;  4P9S A;  1VGX A;  4C3J K;  1O25 A;  4A3F K;  3GTG A;  5JFE A;  3CQZ C;  1I50 A;  2YU9 A;  4LK0 A;  3GEH A;  4A93 C;  2JA5 C;  4KB2 A;  3LAJ A;  2XCO A;  4QIW L;  4MEX A;  2E2J C;  3GTP K;  4KN4 A;  4LJZ A;  1BS2 A;  3FKI A;  3M4O K;  3GTO C;  3GEE A;  4A3L C;  1F7U A;  2CFA B;  2JA7 K;  3GTL K;  2WAQ L;  2XCQ A;  1EQR A;  4MQ9 A;  5CHP A;  4A3D C;  2R7Z K;  1Y1V C;  3HOV K;  2A6E A;  2Y0S L;  4BLA A;  4A3E C;  1BJT A;  1Y1W C;  4X6A C;  3T00 A;  3AD8 C;  3M3Y K;  3S14 C;  3SZY A;  3L4K A;  3RZD K;  2NVT K;  1XPP A;  4BBR C;  5D4D A;  4Y52 C;  1IE0 A;  4G7O A;  1AB4 A;  3G4A A;  5HL8 A;  1I3Q C;  1JQW A;  3HOU C;  3TTG A;  2O5J A;  4BBS K;  1WCM A;  5IYD K;  5IP7 C;  4QJV A;  2A69 A;  2NVY K;  3BUE A;  4KMU A;  1EH1 A;  4LQY A;  1BDF A;  5IYB K;  3LPX A;  1X31 C;  2B63 K;  3OPF A;  5IOQ A;  3N0C A;  3S17 C;  4DDQ A;  1XXA A;  4FM9 A;  2JA6 A;  1YNJ A;  1TWG A;  4RMF A;  3HOZ C;  5IOS A;  2O5I A;  3S2H K;  1WOP A;  2R93 C;  3S1M C;  1R9T K;  4AH6 A;  4GFQ A;  3S2D C;  1IW7 A;  1VH2 A;  3S1N K;  2RH6 A;  1PJ5 A;  1VJE A;  3K7A C;  3A8I A;  4BY7 K;  4QIW D;  3S2D K;  2VUM K;  1UV7 A;  3DXJ A;  2JH3 A;  4BLB A;  4G0V A;  4BY1 K;  4JK1 A;  3FHZ A;  4A3G C;  2WAQ D;  3CQZ A;  4A3G K;  2E2I C;  1WQG A;  1HQM A;  5TJ3 A;  2JA5 A;  1SFO C;  3ORE A;  2NVX K;  1JOE A;  3H0G K;  5C4J K;  4Y7N K;  3GTL A;  3GTJ C;  4LOW A;  3S15 C;  3S16 C;  3GTO A;  2GSN A;  1BGW A;  2W7V A;  2JA6 C;  1ZYR A;  1O29 A;  5IOT A;  4KAW X;  1K83 C;  1TWC K;  1Y1V A;  4GTD A;  2RGR A;  1Y1W A;  3RZO K;  2GAH C;  4KAS A;  5E68 A;  5JVO A;  4A3J C;  2FQO A;  4GTE A;  4MEY A;  1WSR A;  4C3J C;  2Y3P A;  4P5B A;  4A3C K;  1G51 A;  4A3F C;  3SZZ A;  3GTK K;  4M1X A;  1USO A;  3BP3 A;  1I3Q A;  5M5W K;  4G7H A;  1I6V A;  3S1Q K;  1PJ7 A;  4G7Z A;  5TMF A;  3GTP C;  5IYC K;  1YX2 A;  3M4O C;  2V6U A;  4XSZ A;  1O2F B;  3GTL C;  2JA7 C;  3TFH A;  5M3F K;  2A6H A;  4KM8 A;  1O26 A;  3GEI A;  5FLM K;  2R7Z C;  3HOV C;  2PHC B;  4YFN A;  1R9T A;  4KC6 A;  5IP9 K;  1WQF A;  4KM9 A;  3M3Y C;  1USM A;  5EGE A;  2R93 A;  5L46 A;  3RZD C;  2NVT C;  1J98 A;  3GTM K;  4KMH A;  5C44 K;  4O2D A;  1WSV A;  2CFA A;  2GSU A;  1WOR A;  3AD7 C;  2EBB A;  1I6H K;  1IBA A;  4BBS C;  1TWH K;  2E2H K;  3GTQ K;  5IYD C;  2CW0 A;  4OIQ A;  2NVX A;  2NVY C;  1TWA K;  4YFK A;  3JST A;  1RU0 A;  2E2I A;  1DCH A;  1YCL A;  1SFO A;  1GE9 A;  3FOE A;  4GZY A;  5IYB C;  4KDD A;  2B63 C;  2ZUF A;  3T01 A;  2P8T A;  3GTJ A;  4FZB A;  1DD5 A;  1TWF K;  4NOI A;  2PPB A;  3I4M K;  4A3I K;  3S2H C;  4AYB D;  1ISE A;  4BKW A;  1K83 A;  1R9T C;  1F9N A;  3N3Y A;  3AD9 C;  3L4J A;  3S1N C;  3GTG K;  3S1R K;  4BXX K;  4BY7 C;  2VUM C;  1I50 K;  3PO2 K;  2YU9 K;  1O2B A;  4BY1 C;  4XLP A;  4A3B K;  1PJ6 A;  2V6S A;  3FKI K;  4GTA A;  4YG2 A;  1ZVU A;  4P5A A;  2NVX C;  3H0G C;  5C4J C;  2BE5 A;  4Y7N C;  1J6X A;  5M3M K;  3GTP A;  2NVQ K;  3PO3 K;  4GTC A;  2R92 K;  2JA7 A;  3WOD A;  5M5Y K;  4LR2 A;  3VA7 A;  4C3H K;  4KAR A;  5EGH A;  2ZUE A;  2R7Z A;  1TWC C;  1J6V A;  2KWA A;  3A8J A;  3RZO C;  1O27 A;  3IPJ A;  4G0W A;  5C4X K;  4PAA A;  3T02 A;  3HOY K;  3FOF A;  4LK1 A;  1O28 A;  1WOO A;  1EI6 A;  3MML B;  1WCM K;  2XCR B;  3I4N K;  4A3C C;  2GAG C;  3S0X A;  4OIR A;  3GTK C;  5C3E K; 
#chains in the Genus database with same CATH homology
 4QJV A;  2R93 K;  3HOV C;  4AYB L;  4YFN A;  3S1M K;  2WB1 D;  5IP9 K;  2A69 A;  2NVY K;  4OIP A;  3M3Y C;  3S1Q C;  4KMU A;  3RZD C;  1BDF A;  2NVT C;  3K7A K;  4C3I K;  5IYB K;  5FJ8 K;  2B63 K;  5IYC C;  3GTM K;  5C44 K;  5C4X C;  4Q5S A;  3HOY C;  4A3K K;  1TWG K;  3S17 C;  1YNN A;  3H3V L;  1YNJ A;  1WCM C;  3I4N C;  3HOX K;  1SMY A;  3HOZ C;  5M5X K;  4C2M K;  1I6H K;  4BBS C;  1TWH K;  2O5I A;  5FLM C;  2E2H K;  3GTQ K;  5IYD C;  2CW0 A;  2Y0S D;  2PA8 L;  5C3E C;  4A3M K;  2E2I K;  2R93 C;  3HOW K;  3S1M C;  1SFO K;  4OIQ A;  1R9T K;  4KN7 A;  5IP9 C;  2NVY C;  1TWA K;  2JA8 K;  4YFK A;  3S2D C;  1IW7 A;  3S1N K;  3GTJ K;  3S15 K;  3HKZ D;  3K7A C;  3S16 K;  5IYB C;  4GZY A;  2B63 C;  3GTM C;  4BY7 K;  5C44 C;  4QIW D;  3S2D K;  2VUM K;  4XLN A;  2A68 A;  3DXJ A;  4A3K C;  1TWG C;  3CQZ K;  2WB1 L;  2PMZ D;  2JA6 K;  4BY1 K;  4JK1 A;  3HOX C;  1TWF K;  4NOI A;  4A3G C;  2PPB A;  3I4M K;  1I6H C;  2WAQ D;  4A93 K;  5TMC A;  1K83 K;  2JA5 K;  1TWH C;  4A3I K;  2E2H C;  3GTQ C;  4AYB D;  3S2H C;  4A3G K;  4A3M C;  2E2I C;  1HQM A;  2E2J K;  3HOW C;  1SFO C;  1R9T C;  2NVX K;  1TWA C;  2JA8 C;  3H0G K;  3GTO K;  4ZH4 A;  5C4J K;  4A3J K;  3S1N C;  4A3L K;  4Y7N K;  4XSX A;  4LLG A;  3GTJ C;  3S16 C;  3S15 C;  3GTG K;  3S1R K;  4C3J K;  4BXX K;  4BY7 C;  2VUM C;  1I50 K;  3PO2 K;  2YU9 K;  4A3F K;  4A3D K;  3CQZ C;  2JA6 C;  1ZYR A;  1Y1V K;  4BY1 C;  4QJV B;  1TWF C;  4LK0 A;  4A3E K;  1Y1W K;  4X6A K;  3I4M C;  4XLP A;  4A93 C;  2JA5 C;  1K83 C;  4A3B K;  3HKZ L;  3S14 K;  1TWC K;  4A3I C;  3FKI K;  4QIW L;  4MEX A;  2E2J C;  3RZO K;  3GTP K;  4KN4 A;  4LJZ A;  4YG2 A;  5IP7 C;  4BBR K;  3M4O K;  2PMZ L;  2NVX C;  4OIN A;  3H0G C;  3GTO C;  4Y52 K;  5C4J C;  4A3J C;  2BE5 A;  4A3L C;  4Y7N C;  5M3M K;  3EQL A;  4MEY A;  2JA7 K;  2WAQ L;  2NVQ K;  3GTL K;  3GTG C;  3S1R C;  3PO3 K;  4BXX C;  1I3Q K;  2R92 K;  3HOU K;  1I50 C;  3PO2 C;  2YU9 C;  4A3C K;  4MQ9 A;  4A3F C;  3WOD A;  4A3D C;  3GTK K;  2R7Z K;  5M5Y K;  5M5W K;  5IP7 K;  2R7Z C;  1Y1V C;  3HOV K;  2A6E A;  2Y0S L;  4C3H K;  4G7H A;  4A3E C;  1Y1W C;  4X6A C;  1I6V A;  3H3V D;  3M3Y K;  4A3B C;  3S14 C;  3S2H K;  3S1Q K;  1TWC C;  3FKI C;  4G7Z A;  3RZD K;  5TMF A;  2NVT K;  4YFX A;  3RZO C;  1XPP A;  3GTP C;  5IYC K;  4BBR C;  2PA8 D;  5C4X K;  4Y52 C;  5D4D A;  3HOY K;  3M4O C;  4LK1 A;  4Q4Z A;  4XSZ A;  4G7O A;  3S17 K;  3GTL C;  2JA7 C;  2NVQ C;  4OIO A;  3PO3 C;  1WCM K;  3I4N K;  1I3Q C;  5M3F K;  2R92 C;  3HOZ K;  3HOU C;  4A3C C;  2A6H A;  2O5J A;  4OIR A;  4BBS K;  3GTK C;  5FLM K;  5IYD K;  5C3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...