3GTLK

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtlK00
2E2IK 2O5JA 3S1RK 2NVTC 4A3IK 1YNJA 5M3FK 1YNNA 4A3EC 4A3KC 1SFOK 3GTKK 3GTMK 5IYDK 3RZOK 3GTPC 3HOWC 1Y1WK 5C4JC 2O5IA 4BY1C 3GTJC 1R9TC 3HOZK 3S17C 3I4NC 3HOVK 2R93C 3S1MC 1K83C 4A3GC 1I3QK 5M3MK 4XLNA 4A3JC 3GTLK 3H0GK 2PMZL 3FKIC 3WODA 1ZYRA 3K7AK 4JK1A 4Y52C 4A3FC 4BXXC 5FJ8K 2JA8C 1TWHK 5IYCC 5IP9C 5C3EC 3GTQC 3HOYK 3S2DK 3S1NK 3PO2K 1TWCK 3I4MK 2R92K 3CQZK 4KN4A 1Y1VK 1I50C 4AYBL 4A93C 2WAQD 5IYBK 2JA7C 2NVXC 4A3BK 5TMCA 2B63K 1TWGK 3HOUK 5C44K 3GTOC 3S14C 4A3DK 2BE5A 4C3IK 4Q5SA 2A69A 4A3LK 2YU9K 4X6AK 4OIPA 4BBRK 5IP7C 4LLGA 4ZH4A 4C2MK 1WCMC 3GTGC 3S2HK 2VUMK 2NVYC 2A68A 4BY7C 3S1QC 4A3KK 4A3IC 4C3JK 4A3EK 2PPBA 2WAQL 1I6HC 3GTMC 3RZOC 4QJVB 3S16K 3HOXK 1TWAC 4C3HK 4GZYA 5C4XC 5C4JK 2E2JC 3GTJK 2NVQK 1TWFC 3EQLA 1XPPA 3S1MK 5FLMK 3PO3K 4OIOA 4OIRA 3H3VD 3GTKC 5IYDC 4A3MC 3K7AC 3S15C 4BXXK 1I6VA 4G7OA 2R7ZK 2JA8K 4QIWD 5M5WK 3M3YC 4G7HA 3RZDC 3M4OC 2JA6C 2JA5K 3HOVC 2E2HC 4NOIA 2R93K 2E2IC 3PO2C 4A3GK 1SFOC 3H0GC 4Y7NK 2WB1D 3HKZD 1Y1VC 2CW0A 4A3CC 1IW7A 4BBSK 1I50K 4A93K 4LJZA 3GTPK 3HOWK 4BY1K 3HOZC 4XSXA 3I4NK 3S17K 4MQ9A 4G7ZA 3S2DC 3S1NC 1K83K 3S1RC 2NVTK 1I3QC 4A3JK 3GTLC 1HQMA 3CQZC 2PA8L 3DXJA 4Y52K 4X6AC 5IYBC 4KN7A 1Y1WC 1TWHC 3GTGK 5IYCK 1R9TK 3S2HC 1TWGC 5C3EK 3GTQK 2A6HA 4XSZA 5C44C 3HOYC 3S14K 4XLPA 5TMFA 3FKIK 2PMZD 4A3FK 2YU9C 4OIQA 4LK0A 2NVXK 4BBRC 5IP7K 5M5YK 4A3BC 2Y0SL 1SMYA 5M5XK 2NVYK 5IP9K 4YFXA 2PA8D 4OINA 3S1QK 4BY7K 5D4DA 4KMUA 1TWCC 3GTOK 3I4MC 4MEYA 2R92C 3S16C 1TWAK 5C4XK 3H3VL 2R7ZC 3M3YK 4AYBD 2E2JK 3RZDK 2JA7K 4MEXA 2JA5C 2NVQC 3M4OK 1WCMK 2VUMC 2B63C 2Y0SD 4YFKA 5FLMC 4QIWL 4QJVA 3HOUC 4YG2A 3PO3C 2WB1L 3HKZL 4Y7NC 1I6HK 4A3CK 4A3DC 4BBSC 4A3MK 3S15K 3HOXC 2A6EA 4LK1A 4Q4ZA 4A3LC 4YFNA 1BDFA 2JA6K 1TWFK 2E2HK
chains in the Genus database with same CATH superfamily
3T00A 2E2IK 2NVYA 2NVTC 5EGEA 3V4GA 1O24A 1O28A 1JQWA 2ZFZA 1F9NA 3HOWC 2XCOA 1R9TC 1XZPB 1BGWA 4J3NA 1K83C 4FM9A 1I50A 2RH6A 4XLNA 1XXCA 3TFHA 3GTLK 2PMZL 3FKIC 3N0CA 1ZYRA 2YU9A 5IP9C 3HOYK 1G51A 4GTLA 3G4CA 3CQZK 4KN4A 1Y1VK 1JOEA 3AQOA 1WORA 1ZVUA 4A3BK 1EI6A 3JSTA 5TMCA 4WILA 5CJ9A 2R93A 1DD5A 3L4JA 2BE5A 4GTBA 4BKWA 4KAWX 4BBRK 5IP7C 1JVIA 4C2MK 2RGRA 2VUMK 5JFEA 1IBAA 2GSOA 1J6XA 4A3EK 4WJ4A 3BP3A 3HOXK 2E2JC 2NVQK 1TWFC 1GE9A 4DDQA 5FLMK 3PO3K 1WOPA 1K83A 3GSIA 4KMHA 4BXXK 1I6VA 3M3YC 2JA8K 4LQYA 2JA6C 3VA7A 3PO2C 3A8KA 1WIHA 3GIRA 2WB1D 4BBSK 1F7VA 3CAGA 3S17K 1O29A 3GEHA 3CQZC 4C3IC 4Y52K 5IYCK 1EQRA 5C3EK 2A6HA 1IS1A 1O2AA 4OIQA 4BBRC 1PJ5A 5IP7K 2PA8D 5D4DA 1TWCC 2PHCB 4MEYA 2R92C 3QX3A 1O25A 1Y1WA 4AYBD 2E2JK 2JA7K 3MMLB 2NVQC 2JA5C 1ZQ1C 4G0VA 2Y0SD 4YFKA 5FLMC 3HOUC 4QJVA 3PO3C 1IL2A 2WB1L 1EK8A 4A3CK 2JA6A 1XZPA 4LK1A 3AD7C 3SZZA 4A3LC 5CHPA 2JA6K 1F7UA 1TWCA 4A3IK 1YNJA 1TWFA 1B4AA 3GTMK 3RZOK 3ADAC 4GTCA 3TFIA 1O2FB 3OREA 2GAHC 3IPJA 4GTDA 1Y1WK 4KATA 3GTJC 4KM9A 3S17C 2VUMA 3GEIA 1VLOA 4A3GC 3HXAA 3H0GK 4Y52C 4A3FC 3BUEA 4GTEA 1DCHA 1Y1VA 5IYCC 5C3EC 1O26A 3I4MK 4AYBL 3Q3QA 5IYBK 1ZBSA 2B63K 1J6WA 3N0BA 4KMDA 4AH6A 3T02A 4LLGA 3GTGC 4P9SA 4QJVB 3S16K 3GTPA 1VH2A 4FZBA 5E68A 4KC6A 1BS2A 4OIOA 4OIRA 2JA5A 2R7ZA 3BP8C 2R92A 1X31C 3S15C 4KDDA 4G7OA 3NUHA 1EH1A 3RZDC 3M4OC 5IOSA 1USMA 4A3GK 2B63A 1USOA 3H0GC 4Y7NK 1Y1VC 2CW0A 4LJZA 3GTPK 3GDZA 4KMAA 4XSXA 4MQ9A 3S1RC 1TWHA 4A3JK 5IYBC 4G0WA 1TWHC 1J6VA 4C2MC 3GTQK 4XSZA 2ZUFA 1DCOA 2NVXK 5M5XK 4KM8A 2NVXA 3S16C 3M3YK 4MEXA 1V5VA 1WCMK 1DCPA 1I6HK 2E2IA 5HL8A 2JH3A 4A3DC 4BBSC 3S15K 3GTMA 1BDFA 4WJ3M 1IE0A 4M1XA 4A3KC 5M3FK 3GTKK 3GTPC 3AD9C 5C4JC 2O5IA 3HOVK 2R93C 3S1MC 5M3MK 2V6SA 4A3JC 3A8IA 1WQFA 1WQGA 3K7AK 4JK1A 4O2DA 1TWHK 3GTQC 1SFOA 3S1NK 1TWCK 2R92K 1I50C 4A93C 2WAQD 2JA7C 2NVXC 1TWGK 3HOUK 3S14C 3LPXA 4Q5SA 4X6AK 4A3LK 2YU9K 4OIPA 1WCMC 3S2HK 2NVYC 2A68A 3S1QC 4A3IC 4GT9A 4C3JK 1C0AA 2PPBA 1I6HC 1VRQC 3GTMC 4KB4A 3RZOC 4PABA 3GTJK 1XPPA 2Y3PA 3LAJA 1BJTA 3GTKC 2KWAA 4A3MC 1PJ6A 1WSRA 2R7ZK 5M5WK 2CFAA 4LR2A 3FHZA 3HOVC 2E2HC 2R93K 2W7VA 3AQPA 3A8JA 1SFOC 4ILDA 2FQOA 3HKZD 3GEEA 1I3QA 4BY1K 3HOZC 4P5AA 3I4NK 2JA7A 2EBBA 4G7ZA 3S1NC 4C45A 2NVTK 1I3QC 2CFAB 1HQMA 1L0WA 4KN7A 2E2HA 3GTGK 1R9TK 3N3YA 1TWGC 2P5MA 3S14K 4KB2A 2FQTA 2P8TA 1WOSA 3FKIK 2GSNA 4GTAA 2YU9C 4LK0A 3CQZA 5M5YK 3OPFA 2Y0SL 1SMYA 2NVYK 5IP9K 4OINA 4LOWA 3S1QK 4C3JC 4KMUA 3GTOK 1F93A 1AB4A 3RZDK 3M4OK 4KARA 1R9TA 3HKZL 4Y7NC 1WSVA 5IOQA 4A3MK 1PJ7A 4Q4ZA 5IORA 2V6UA 3SZYA 4YFNA 4PAAA 1B4BA 2E2HK 2O5JA 3S1RK 1SFOK 1YNNA 4A3EC 1XXAA 5IYDK 1O2BA 1RU0A 4XCHA 4BY1C 3HOZK 3I4NC 3GTLA 3ERED 1I3QK 3FOEA 1XZQB 4GTFA 4BLBA 2V6TA 3WODA 4BXXC 5FJ8K 2JA8C 1EFWA 3S2DK 1VJEA 3PO2K 5IOTA 5JVOA 1XZQA 3GTGA 3T01A 3GTJA 5C44K 3OEPA 3GTOC 3LAPA 4A3DK 4P5BA 4C3IK 2A69A 3S0XA 4ZH4A 4BY7C 4A3KK 3H0GA 2WAQL 5EGHA 1TWAC 4C3HK 4GZYA 5C4XC 5C4JK 1O27A 3EQLA 1HI9A 3S1MK 4BLAA 3H3VD 1J98A 1WCMA 5IYDC 3K7AC 4QIWD 4G7HA 4G0UA 2JA5K 4NOIA 2E2IC 3FOFA 4GFQA 4A3CC 4RMFA 1IW7A 1I50K 4A93K 3HOWK 1YX2A 4KASA 3S2DC 3AH5A 1K83K 1ZXOA 2D6FC 3GTLC 2ZUEA 3GTOA 2PA8L 3AD8C 3DXJA 4X6AC 1Y1WC 2XCQA 3S2HC 3FKIA 3HOYC 5C44C 4XLPA 1KQ4A 5TMFA 2PMZD 4A3FK 3GTQA 4A3BC 3L4KA 2GAGC 4BY7K 4YFXA 1ISEA 1VGXA 1TWAA 3G4AA 3I4MC 1TWGA 1XXBA 2XCRB 3GTKA 1UV7A 1TWAK 4C3HC 5C4XK 3TFJA 2R7ZC 3H3VL 1WQHA 1IQ0A 5L46A 2VUMC 2B63C 3TTGA 4QIWL 4YG2A 1INNA 2GSUA 1YCLA 5TJ3A 3HOXC 2A6EA 1TWFK 1WOOA
chains in the Genus database with same CATH topology
2E2IK 2O5JA 3S1RK 2NVTC 4A3IK 1YNJA 5M3FK 1YNNA 4A3EC 4A3KC 1SFOK 3GTKK 3GTMK 5IYDK 3RZOK 3GTPC 3HOWC 1Y1WK 5C4JC 2O5IA 4BY1C 3GTJC 1R9TC 3HOZK 3S17C 3I4NC 3HOVK 2R93C 3S1MC 1K83C 4A3GC 1I3QK 5M3MK 4XLNA 4A3JC 3GTLK 3H0GK 2PMZL 3FKIC 3WODA 1ZYRA 3K7AK 4JK1A 4Y52C 4A3FC 4BXXC 5FJ8K 2JA8C 1TWHK 5IYCC 5IP9C 5C3EC 3GTQC 3HOYK 3S2DK 3S1NK 3PO2K 1TWCK 3I4MK 2R92K 3CQZK 4KN4A 1Y1VK 1I50C 4AYBL 4A93C 2WAQD 5IYBK 2JA7C 2NVXC 4A3BK 5TMCA 2B63K 1TWGK 3HOUK 5C44K 3GTOC 3S14C 4A3DK 2BE5A 4C3IK 4Q5SA 2A69A 4A3LK 2YU9K 4X6AK 4OIPA 4BBRK 5IP7C 4LLGA 4ZH4A 4C2MK 1WCMC 3GTGC 3S2HK 2VUMK 2NVYC 2A68A 4BY7C 3S1QC 4A3KK 4A3IC 4C3JK 4A3EK 2PPBA 2WAQL 1I6HC 3GTMC 3RZOC 4QJVB 3S16K 3HOXK 1TWAC 4C3HK 4GZYA 5C4XC 5C4JK 2E2JC 3GTJK 2NVQK 1TWFC 3EQLA 1XPPA 3S1MK 5FLMK 3PO3K 4OIOA 4OIRA 3H3VD 3GTKC 5IYDC 4A3MC 3K7AC 3S15C 4BXXK 1I6VA 4G7OA 2R7ZK 2JA8K 4QIWD 5M5WK 3M3YC 4G7HA 3RZDC 3M4OC 2JA6C 2JA5K 3HOVC 2E2HC 4NOIA 2R93K 2E2IC 3PO2C 4A3GK 1SFOC 3H0GC 4Y7NK 2WB1D 3HKZD 1Y1VC 2CW0A 4A3CC 1IW7A 4BBSK 1I50K 4A93K 4LJZA 3GTPK 3HOWK 4BY1K 3HOZC 4XSXA 3I4NK 3S17K 4MQ9A 4G7ZA 3S2DC 3S1NC 1K83K 3S1RC 2NVTK 1I3QC 4A3JK 3GTLC 1HQMA 3CQZC 2PA8L 3DXJA 4Y52K 4X6AC 5IYBC 4KN7A 1Y1WC 1TWHC 3GTGK 5IYCK 1R9TK 3S2HC 1TWGC 5C3EK 3GTQK 2A6HA 4XSZA 5C44C 3HOYC 3S14K 4XLPA 5TMFA 3FKIK 2PMZD 4A3FK 2YU9C 4OIQA 4LK0A 2NVXK 4BBRC 5IP7K 5M5YK 4A3BC 2Y0SL 1SMYA 5M5XK 2NVYK 5IP9K 4YFXA 2PA8D 4OINA 3S1QK 4BY7K 5D4DA 4KMUA 1TWCC 3GTOK 3I4MC 4MEYA 2R92C 3S16C 1TWAK 5C4XK 3H3VL 2R7ZC 3M3YK 4AYBD 2E2JK 3RZDK 2JA7K 4MEXA 2JA5C 2NVQC 3M4OK 1WCMK 2VUMC 2B63C 2Y0SD 4YFKA 5FLMC 4QIWL 4QJVA 3HOUC 4YG2A 3PO3C 2WB1L 3HKZL 4Y7NC 1I6HK 4A3CK 4A3DC 4BBSC 4A3MK 3S15K 3HOXC 2A6EA 4LK1A 4Q4ZA 4A3LC 4YFNA 1BDFA 2JA6K 1TWFK 2E2HK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I K;  2O5J A;  3S1R K;  2NVT C;  4A3I K;  1YNJ A;  5M3F K;  1YNN A;  4A3E C;  4A3K C;  1SFO K;  3GTK K;  3GTM K;  5IYD K;  3RZO K;  3GTP C;  3HOW C;  1Y1W K;  5C4J C;  2O5I A;  4BY1 C;  3GTJ C;  1R9T C;  3HOZ K;  3S17 C;  3I4N C;  3HOV K;  2R93 C;  3S1M C;  1K83 C;  4A3G C;  1I3Q K;  5M3M K;  4XLN A;  4A3J C;  3GTL K;  3H0G K;  2PMZ L;  3FKI C;  3WOD A;  1ZYR A;  3K7A K;  4JK1 A;  4Y52 C;  4A3F C;  4BXX C;  5FJ8 K;  2JA8 C;  1TWH K;  5IYC C;  5IP9 C;  5C3E C;  3GTQ C;  3HOY K;  3S2D K;  3S1N K;  3PO2 K;  1TWC K;  3I4M K;  2R92 K;  3CQZ K;  4KN4 A;  1Y1V K;  1I50 C;  4AYB L;  4A93 C;  2WAQ D;  5IYB K;  2JA7 C;  2NVX C;  4A3B K;  5TMC A;  2B63 K;  1TWG K;  3HOU K;  5C44 K;  3GTO C;  3S14 C;  4A3D K;  2BE5 A;  4C3I K;  4Q5S A;  2A69 A;  4A3L K;  2YU9 K;  4X6A K;  4OIP A;  4BBR K;  5IP7 C;  4LLG A;  4ZH4 A;  4C2M K;  1WCM C;  3GTG C;  3S2H K;  2VUM K;  2NVY C;  2A68 A;  4BY7 C;  3S1Q C;  4A3K K;  4A3I C;  4C3J K;  4A3E K;  2PPB A;  2WAQ L;  1I6H C;  3GTM C;  3RZO C;  4QJV B;  3S16 K;  3HOX K;  1TWA C;  4C3H K;  4GZY A;  5C4X C;  5C4J K;  2E2J C;  3GTJ K;  2NVQ K;  1TWF C;  3EQL A;  1XPP A;  3S1M K;  5FLM K;  3PO3 K;  4OIO A;  4OIR A;  3H3V D;  3GTK C;  5IYD C;  4A3M C;  3K7A C;  3S15 C;  4BXX K;  1I6V A;  4G7O A;  2R7Z K;  2JA8 K;  4QIW D;  5M5W K;  3M3Y C;  4G7H A;  3RZD C;  3M4O C;  2JA6 C;  2JA5 K;  3HOV C;  2E2H C;  4NOI A;  2R93 K;  2E2I C;  3PO2 C;  4A3G K;  1SFO C;  3H0G C;  4Y7N K;  2WB1 D;  3HKZ D;  1Y1V C;  2CW0 A;  4A3C C;  1IW7 A;  4BBS K;  1I50 K;  4A93 K;  4LJZ A;  3GTP K;  3HOW K;  4BY1 K;  3HOZ C;  4XSX A;  3I4N K;  3S17 K;  4MQ9 A;  4G7Z A;  3S2D C;  3S1N C;  1K83 K;  3S1R C;  2NVT K;  1I3Q C;  4A3J K;  3GTL C;  1HQM A;  3CQZ C;  2PA8 L;  3DXJ A;  4Y52 K;  4X6A C;  5IYB C;  4KN7 A;  1Y1W C;  1TWH C;  3GTG K;  5IYC K;  1R9T K;  3S2H C;  1TWG C;  5C3E K;  3GTQ K;  2A6H A;  4XSZ A;  5C44 C;  3HOY C;  3S14 K;  4XLP A;  5TMF A;  3FKI K;  2PMZ D;  4A3F K;  2YU9 C;  4OIQ A;  4LK0 A;  2NVX K;  4BBR C;  5IP7 K;  5M5Y K;  4A3B C;  2Y0S L;  1SMY A;  5M5X K;  2NVY K;  5IP9 K;  4YFX A;  2PA8 D;  4OIN A;  3S1Q K;  4BY7 K;  5D4D A;  4KMU A;  1TWC C;  3GTO K;  3I4M C;  4MEY A;  2R92 C;  3S16 C;  1TWA K;  5C4X K;  3H3V L;  2R7Z C;  3M3Y K;  4AYB D;  2E2J K;  3RZD K;  2JA7 K;  4MEX A;  2JA5 C;  2NVQ C;  3M4O K;  1WCM K;  2VUM C;  2B63 C;  2Y0S D;  4YFK A;  5FLM C;  4QIW L;  4QJV A;  3HOU C;  4YG2 A;  3PO3 C;  2WB1 L;  3HKZ L;  4Y7N C;  1I6H K;  4A3C K;  4A3D C;  4BBS C;  4A3M K;  3S15 K;  3HOX C;  2A6E A;  4LK1 A;  4Q4Z A;  4A3L C;  4YFN A;  1BDF A;  2JA6 K;  1TWF K;  2E2H K; 
#chains in the Genus database with same CATH topology
 3T00 A;  2E2I K;  2NVY A;  2NVT C;  5EGE A;  3V4G A;  1O24 A;  1O28 A;  1JQW A;  2ZFZ A;  1F9N A;  3HOW C;  2XCO A;  1R9T C;  1XZP B;  1BGW A;  4J3N A;  1K83 C;  4FM9 A;  1I50 A;  2RH6 A;  4XLN A;  1XXC A;  3TFH A;  3GTL K;  2PMZ L;  3FKI C;  3N0C A;  1ZYR A;  2YU9 A;  5IP9 C;  3HOY K;  1G51 A;  4GTL A;  3G4C A;  3CQZ K;  4KN4 A;  1Y1V K;  1JOE A;  3AQO A;  1WOR A;  1ZVU A;  4A3B K;  1EI6 A;  3JST A;  5TMC A;  4WIL A;  5CJ9 A;  2R93 A;  1DD5 A;  3L4J A;  2BE5 A;  4GTB A;  4BKW A;  4KAW X;  4BBR K;  5IP7 C;  1JVI A;  4C2M K;  2RGR A;  2VUM K;  5JFE A;  1IBA A;  2GSO A;  1J6X A;  4A3E K;  4WJ4 A;  3BP3 A;  3HOX K;  2E2J C;  2NVQ K;  1TWF C;  1GE9 A;  4DDQ A;  5FLM K;  3PO3 K;  1WOP A;  1K83 A;  3GSI A;  4KMH A;  4BXX K;  1I6V A;  3M3Y C;  2JA8 K;  4LQY A;  2JA6 C;  3VA7 A;  3PO2 C;  3A8K A;  1WIH A;  3GIR A;  2WB1 D;  4BBS K;  1F7V A;  3CAG A;  3S17 K;  1O29 A;  3GEH A;  3CQZ C;  4C3I C;  4Y52 K;  5IYC K;  1EQR A;  5C3E K;  2A6H A;  1IS1 A;  1O2A A;  4OIQ A;  4BBR C;  1PJ5 A;  5IP7 K;  2PA8 D;  5D4D A;  1TWC C;  2PHC B;  4MEY A;  2R92 C;  3QX3 A;  1O25 A;  1Y1W A;  4AYB D;  2E2J K;  2JA7 K;  3MML B;  2NVQ C;  2JA5 C;  1ZQ1 C;  4G0V A;  2Y0S D;  4YFK A;  5FLM C;  3HOU C;  4QJV A;  3PO3 C;  1IL2 A;  2WB1 L;  1EK8 A;  4A3C K;  2JA6 A;  1XZP A;  4LK1 A;  3AD7 C;  3SZZ A;  4A3L C;  5CHP A;  2JA6 K;  1F7U A;  1TWC A;  4A3I K;  1YNJ A;  1TWF A;  1B4A A;  3GTM K;  3RZO K;  3ADA C;  4GTC A;  3TFI A;  1O2F B;  3ORE A;  2GAH C;  3IPJ A;  4GTD A;  1Y1W K;  4KAT A;  3GTJ C;  4KM9 A;  3S17 C;  2VUM A;  3GEI A;  1VLO A;  4A3G C;  3HXA A;  3H0G K;  4Y52 C;  4A3F C;  3BUE A;  4GTE A;  1DCH A;  1Y1V A;  5IYC C;  5C3E C;  1O26 A;  3I4M K;  4AYB L;  3Q3Q A;  5IYB K;  1ZBS A;  2B63 K;  1J6W A;  3N0B A;  4KMD A;  4AH6 A;  3T02 A;  4LLG A;  3GTG C;  4P9S A;  4QJV B;  3S16 K;  3GTP A;  1VH2 A;  4FZB A;  5E68 A;  4KC6 A;  1BS2 A;  4OIO A;  4OIR A;  2JA5 A;  2R7Z A;  3BP8 C;  2R92 A;  1X31 C;  3S15 C;  4KDD A;  4G7O A;  3NUH A;  1EH1 A;  3RZD C;  3M4O C;  5IOS A;  1USM A;  4A3G K;  2B63 A;  1USO A;  3H0G C;  4Y7N K;  1Y1V C;  2CW0 A;  4LJZ A;  3GTP K;  3GDZ A;  4KMA A;  4XSX A;  4MQ9 A;  3S1R C;  1TWH A;  4A3J K;  5IYB C;  4G0W A;  1TWH C;  1J6V A;  4C2M C;  3GTQ K;  4XSZ A;  2ZUF A;  1DCO A;  2NVX K;  5M5X K;  4KM8 A;  2NVX A;  3S16 C;  3M3Y K;  4MEX A;  1V5V A;  1WCM K;  1DCP A;  1I6H K;  2E2I A;  5HL8 A;  2JH3 A;  4A3D C;  4BBS C;  3S15 K;  3GTM A;  1BDF A;  4WJ3 M;  1IE0 A;  4M1X A;  4A3K C;  5M3F K;  3GTK K;  3GTP C;  3AD9 C;  5C4J C;  2O5I A;  3HOV K;  2R93 C;  3S1M C;  5M3M K;  2V6S A;  4A3J C;  3A8I A;  1WQF A;  1WQG A;  3K7A K;  4JK1 A;  4O2D A;  1TWH K;  3GTQ C;  1SFO A;  3S1N K;  1TWC K;  2R92 K;  1I50 C;  4A93 C;  2WAQ D;  2JA7 C;  2NVX C;  1TWG K;  3HOU K;  3S14 C;  3LPX A;  4Q5S A;  4X6A K;  4A3L K;  2YU9 K;  4OIP A;  1WCM C;  3S2H K;  2NVY C;  2A68 A;  3S1Q C;  4A3I C;  4GT9 A;  4C3J K;  1C0A A;  2PPB A;  1I6H C;  1VRQ C;  3GTM C;  4KB4 A;  3RZO C;  4PAB A;  3GTJ K;  1XPP A;  2Y3P A;  3LAJ A;  1BJT A;  3GTK C;  2KWA A;  4A3M C;  1PJ6 A;  1WSR A;  2R7Z K;  5M5W K;  2CFA A;  4LR2 A;  3FHZ A;  3HOV C;  2E2H C;  2R93 K;  2W7V A;  3AQP A;  3A8J A;  1SFO C;  4ILD A;  2FQO A;  3HKZ D;  3GEE A;  1I3Q A;  4BY1 K;  3HOZ C;  4P5A A;  3I4N K;  2JA7 A;  2EBB A;  4G7Z A;  3S1N C;  4C45 A;  2NVT K;  1I3Q C;  2CFA B;  1HQM A;  1L0W A;  4KN7 A;  2E2H A;  3GTG K;  1R9T K;  3N3Y A;  1TWG C;  2P5M A;  3S14 K;  4KB2 A;  2FQT A;  2P8T A;  1WOS A;  3FKI K;  2GSN A;  4GTA A;  2YU9 C;  4LK0 A;  3CQZ A;  5M5Y K;  3OPF A;  2Y0S L;  1SMY A;  2NVY K;  5IP9 K;  4OIN A;  4LOW A;  3S1Q K;  4C3J C;  4KMU A;  3GTO K;  1F93 A;  1AB4 A;  3RZD K;  3M4O K;  4KAR A;  1R9T A;  3HKZ L;  4Y7N C;  1WSV A;  5IOQ A;  4A3M K;  1PJ7 A;  4Q4Z A;  5IOR A;  2V6U A;  3SZY A;  4YFN A;  4PAA A;  1B4B A;  2E2H K;  2O5J A;  3S1R K;  1SFO K;  1YNN A;  4A3E C;  1XXA A;  5IYD K;  1O2B A;  1RU0 A;  4XCH A;  4BY1 C;  3HOZ K;  3I4N C;  3GTL A;  3ERE D;  1I3Q K;  3FOE A;  1XZQ B;  4GTF A;  4BLB A;  2V6T A;  3WOD A;  4BXX C;  5FJ8 K;  2JA8 C;  1EFW A;  3S2D K;  1VJE A;  3PO2 K;  5IOT A;  5JVO A;  1XZQ A;  3GTG A;  3T01 A;  3GTJ A;  5C44 K;  3OEP A;  3GTO C;  3LAP A;  4A3D K;  4P5B A;  4C3I K;  2A69 A;  3S0X A;  4ZH4 A;  4BY7 C;  4A3K K;  3H0G A;  2WAQ L;  5EGH A;  1TWA C;  4C3H K;  4GZY A;  5C4X C;  5C4J K;  1O27 A;  3EQL A;  1HI9 A;  3S1M K;  4BLA A;  3H3V D;  1J98 A;  1WCM A;  5IYD C;  3K7A C;  4QIW D;  4G7H A;  4G0U A;  2JA5 K;  4NOI A;  2E2I C;  3FOF A;  4GFQ A;  4A3C C;  4RMF A;  1IW7 A;  1I50 K;  4A93 K;  3HOW K;  1YX2 A;  4KAS A;  3S2D C;  3AH5 A;  1K83 K;  1ZXO A;  2D6F C;  3GTL C;  2ZUE A;  3GTO A;  2PA8 L;  3AD8 C;  3DXJ A;  4X6A C;  1Y1W C;  2XCQ A;  3S2H C;  3FKI A;  3HOY C;  5C44 C;  4XLP A;  1KQ4 A;  5TMF A;  2PMZ D;  4A3F K;  3GTQ A;  4A3B C;  3L4K A;  2GAG C;  4BY7 K;  4YFX A;  1ISE A;  1VGX A;  1TWA A;  3G4A A;  3I4M C;  1TWG A;  1XXB A;  2XCR B;  3GTK A;  1UV7 A;  1TWA K;  4C3H C;  5C4X K;  3TFJ A;  2R7Z C;  3H3V L;  1WQH A;  1IQ0 A;  5L46 A;  2VUM C;  2B63 C;  3TTG A;  4QIW L;  4YG2 A;  1INN A;  2GSU A;  1YCL A;  5TJ3 A;  3HOX C;  2A6E A;  1TWF K;  1WOO A; 
#chains in the Genus database with same CATH homology
 2E2I K;  2O5J A;  3S1R K;  2NVT C;  4A3I K;  1YNJ A;  5M3F K;  1YNN A;  4A3E C;  4A3K C;  1SFO K;  3GTK K;  3GTM K;  5IYD K;  3RZO K;  3GTP C;  3HOW C;  1Y1W K;  5C4J C;  2O5I A;  4BY1 C;  3GTJ C;  1R9T C;  3HOZ K;  3S17 C;  3I4N C;  3HOV K;  2R93 C;  3S1M C;  1K83 C;  4A3G C;  1I3Q K;  5M3M K;  4XLN A;  4A3J C;  3GTL K;  3H0G K;  2PMZ L;  3FKI C;  3WOD A;  1ZYR A;  3K7A K;  4JK1 A;  4Y52 C;  4A3F C;  4BXX C;  5FJ8 K;  2JA8 C;  1TWH K;  5IYC C;  5IP9 C;  5C3E C;  3GTQ C;  3HOY K;  3S2D K;  3S1N K;  3PO2 K;  1TWC K;  3I4M K;  2R92 K;  3CQZ K;  4KN4 A;  1Y1V K;  1I50 C;  4AYB L;  4A93 C;  2WAQ D;  5IYB K;  2JA7 C;  2NVX C;  4A3B K;  5TMC A;  2B63 K;  1TWG K;  3HOU K;  5C44 K;  3GTO C;  3S14 C;  4A3D K;  2BE5 A;  4C3I K;  4Q5S A;  2A69 A;  4A3L K;  2YU9 K;  4X6A K;  4OIP A;  4BBR K;  5IP7 C;  4LLG A;  4ZH4 A;  4C2M K;  1WCM C;  3GTG C;  3S2H K;  2VUM K;  2NVY C;  2A68 A;  4BY7 C;  3S1Q C;  4A3K K;  4A3I C;  4C3J K;  4A3E K;  2PPB A;  2WAQ L;  1I6H C;  3GTM C;  3RZO C;  4QJV B;  3S16 K;  3HOX K;  1TWA C;  4C3H K;  4GZY A;  5C4X C;  5C4J K;  2E2J C;  3GTJ K;  2NVQ K;  1TWF C;  3EQL A;  1XPP A;  3S1M K;  5FLM K;  3PO3 K;  4OIO A;  4OIR A;  3H3V D;  3GTK C;  5IYD C;  4A3M C;  3K7A C;  3S15 C;  4BXX K;  1I6V A;  4G7O A;  2R7Z K;  2JA8 K;  4QIW D;  5M5W K;  3M3Y C;  4G7H A;  3RZD C;  3M4O C;  2JA6 C;  2JA5 K;  3HOV C;  2E2H C;  4NOI A;  2R93 K;  2E2I C;  3PO2 C;  4A3G K;  1SFO C;  3H0G C;  4Y7N K;  2WB1 D;  3HKZ D;  1Y1V C;  2CW0 A;  4A3C C;  1IW7 A;  4BBS K;  1I50 K;  4A93 K;  4LJZ A;  3GTP K;  3HOW K;  4BY1 K;  3HOZ C;  4XSX A;  3I4N K;  3S17 K;  4MQ9 A;  4G7Z A;  3S2D C;  3S1N C;  1K83 K;  3S1R C;  2NVT K;  1I3Q C;  4A3J K;  3GTL C;  1HQM A;  3CQZ C;  2PA8 L;  3DXJ A;  4Y52 K;  4X6A C;  5IYB C;  4KN7 A;  1Y1W C;  1TWH C;  3GTG K;  5IYC K;  1R9T K;  3S2H C;  1TWG C;  5C3E K;  3GTQ K;  2A6H A;  4XSZ A;  5C44 C;  3HOY C;  3S14 K;  4XLP A;  5TMF A;  3FKI K;  2PMZ D;  4A3F K;  2YU9 C;  4OIQ A;  4LK0 A;  2NVX K;  4BBR C;  5IP7 K;  5M5Y K;  4A3B C;  2Y0S L;  1SMY A;  5M5X K;  2NVY K;  5IP9 K;  4YFX A;  2PA8 D;  4OIN A;  3S1Q K;  4BY7 K;  5D4D A;  4KMU A;  1TWC C;  3GTO K;  3I4M C;  4MEY A;  2R92 C;  3S16 C;  1TWA K;  5C4X K;  3H3V L;  2R7Z C;  3M3Y K;  4AYB D;  2E2J K;  3RZD K;  2JA7 K;  4MEX A;  2JA5 C;  2NVQ C;  3M4O K;  1WCM K;  2VUM C;  2B63 C;  2Y0S D;  4YFK A;  5FLM C;  4QIW L;  4QJV A;  3HOU C;  4YG2 A;  3PO3 C;  2WB1 L;  3HKZ L;  4Y7N C;  1I6H K;  4A3C K;  4A3D C;  4BBS C;  4A3M K;  3S15 K;  3HOX C;  2A6E A;  4LK1 A;  4Q4Z A;  4A3L C;  4YFN A;  1BDF A;  2JA6 K;  1TWF K;  2E2H K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...