3GTLK

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtlK00
5FJ8K 1TWFC 1HQMA 3I4NC 2JA6C 4XLNA 3CQZC 3GTLK 3HOVC 3RZDK 4YFNA 4A3JC 4XSXA 5C44C 4QIWL 4A3MC 3I4MC 4A3CK 4A3GC 2A6HA 3M3YC 2JA5K 5IYDC 2R92K 1ZYRA 2BE5A 4A3IK 3K7AC 4QJVA 4YG2A 4MEXA 4OIPA 4MQ9A 1Y1WC 1I6HC 1SFOC 3PO2C 1K83C 3GTGK 3GTJC 3CQZK 1BDFA 4YFXA 4A3FK 3HOVK 4C3JK 5C44K 5FLMC 2PA8L 3GTKC 3S17K 1TWHK 3S15K 4G7OA 4Q5SA 3H0GC 3M3YK 5TMFA 5IYDK 3GTQK 2PMZL 4G7ZA 4A93K 2E2IC 2JA7C 3H3VL 3HOYK 4Y52C 3HOWC 3S2HK 1I6HK 3EQLA 3RZOC 5C4JC 1SFOK 4G7HA 3PO2K 4BBRK 1R9TC 2WAQD 3GTJK 3HOUK 4X6AC 3HOXK 3S1QK 1YNNA 3GTKK 4Y7NK 3S2DC 5IYBK 4BBSK 4A3BC 4KN7A 4C3IK 3S14C 1I3QK 3HOZC 4OIOA 3S16K 2E2JC 3WODA 1TWAK 2R7ZC 2VUMK 3S1NC 3HOWK 4A3KK 2WB1L 3M4OC 1R9TK 2R93K 4QIWD 5M3FK 2YU9K 2A68A 1I50C 2JA8C 1TWFK 3I4NK 2JA6K 5TMCA 3PO3C 4A3JK 1YNJA 4A3MK 3I4MK 4Q4ZA 4A3GK 3S1MC 3S1NK 4BY1C 4QJVB 3GTPC 3K7AK 4LK0A 4OIQA 4NOIA 5C3EC 2PA8D 4XSZA 5C4XC 1Y1WK 4C3HK 1WCMC 4AYBL 1K83K 2O5JA 2PMZD 1TWGC 3PO3K 5IP9C 3H3VD 1TWCC 4BXXC 2NVYC 1IW7A 5FLMK 3H0GK 3GTMC 4BY7C 2PPBA 2E2IK 4OIRA 2NVTC 2JA7K 4Y52K 1Y1VC 5IP7C 5IYCC 3RZOK 5C4JK 4A3LC 3S1RC 2Y0SL 2NVQC 4X6AK 5M3MK 3GTLC 4A3EC 1SMYA 4A3CC 2O5IA 3S2DK 3HKZL 4JK1A 4A3BK 4A3DC 3S14K 4LJZA 3HOZK 2JA5C 2R92C 4A3IC 2E2JK 2NVTK 2R7ZK 4C2MK 5M5YK 5IYCK 3M4OK 3GTOC 4MEYA 2B63C 2NVQK 1I50K 3GTGC 2E2HC 4A3FC 4A3EK 2JA8K 2NVXC 4ZH4A 4A3DK 2CW0A 1TWHC 4OINA 3S17C 3S15C 5D4DA 4XLPA 4KMUA 3GTQC 3S1MK 4A93C 4AYBD 4YFKA 4BY1K 3HOYC 3GTPK 3GTOK 4GZYA 3S2HC 2A69A 4KN4A 2A6EA 5C3EK 4BBRC 5C4XK 2B63K 3FKIC 2E2HK 3HOUC 1WCMK 5M5XK 3HOXC 2NVXK 3S1QC 1TWGK 3DXJA 4Y7NC 5IYBC 5IP9K 4BBSC 1TWCK 4BXXK 2NVYK 3RZDC 1I3QC 2WB1D 1XPPA 2WAQL 3GTMK 4LLGA 1I6VA 3S16C 4A3LK 4BY7K 1TWAC 2Y0SD 2VUMC 4A3KC 5M5WK 1Y1VK 2R93C 5IP7K 3HKZD 3FKIK 2YU9C 4LK1A 3S1RK
chains in the Genus database with same CATH superfamily
5FJ8K 4GTAA 2JA6C 4GT9A 4A3JC 4A3CK 4XSXA 1ZYRA 3JSTA 1F7VA 4YG2A 4MQ9A 1WSVA 3BP3A 1WOOA 3PO2C 3GTQA 3GTJC 1BDFA 3HOVK 4C3JK 3GTKC 1PJ7A 4G7OA 1JOEA 1TWHK 1GE9A 3M3YK 5IORA 2PMZL 2V6UA 4G7ZA 4GFQA 1USMA 2JA7C 4Y52C 1I6HK 5C4JC 4G7HA 2V6SA 2Y3PA 1O2AA 3S2DC 4A3BC 1XZPA 4C3IK 3HOZC 4OIOA 3L4JA 3QX3A 1TWAK 5TJ3A 2R7ZC 3HOWK 2YU9K 2A68A 1I50C 3Q3QA 2ZUEA 2GSNA 1O24A 3PO3C 1ISEA 4ILDA 3I4MK 1WQFA 4KMDA 4A3GK 1K83A 2RH6A 1JQWA 4QJVB 5JVOA 2P8TA 4OIQA 4NOIA 5C3EC 2PA8D 4O2DA 3T00A 4C3HK 1EQRA 2JH3A 1TWGC 1IW7A 3LAJA 3FHZA 2E2IK 4OIRA 1F93A 1O28A 4LR2A 5IOSA 3RZOK 4A3LC 2Y0SL 1J6WA 4A3CC 2O5IA 1IL2A 3HKZL 4JK1A 3S14K 4LJZA 4KB2A 4J3NA 1ZBSA 3M4OK 3GTOC 1BS2A 4KAWX 2E2HC 2JA8K 3GTPA 2P5MA 3AQPA 1TWHC 5D4DA 1WCMA 2NVXA 4YFKA 1TWCA 2NVYA 4KN4A 2B63K 1O29A 5M5XK 4C3IC 4G0UA 4G0VA 1TWAC 1J98A 1Y1VK 4LOWA 5IP7K 3AH5A 2YU9C 2JA5A 2R92A 3S0XA 1HQMA 1EI6A 1EH1A 3CQZC 3N0CA 1VJEA 3A8KA 5CJ9A 3RZDK 3I4MC 3AD8C 4PAAA 4A3GC 3GTGA 5IYDC 3HXAA 1WQGA 4MEXA 4OIPA 4C3HC 1SFOC 5C44K 2PA8L 3S17K 4Q5SA 2XCOA 3GTJA 2PHCB 3GTQK 3TFJA 2E2IC 3GTKA 5L46A 3S2HK 3RZOC 4BBRK 1R9TC 1WIHA 2VUMA 3HOXK 1YNNA 4BBSK 4KN7A 3S14C 2FQOA 3S16K 1TWFA 3WODA 1BJTA 2WB1L 3M4OC 1IS1A 2XCQA 4QIWD 1ZQ1C 3AQOA 3L4KA 4WJ3M 2JA8C 5TMCA 4RMFA 4XCHA 1Y1WA 1O2BA 3AD7C 3S1NK 1XZQA 4AH6A 3K7AK 1IE0A 3H0GA 4FM9A 1K83K 2O5JA 5FLMK 1X31C 5CHPA 1TWGA 4C45A 2PPBA 1Y1VC 5IP7C 4KASA 4X6AK 3G4AA 1XZPB 3GDZA 4A3DC 4WILA 2NVTK 4C2MK 5IYCK 4KC6A 2NVQK 3ERED 4A3EK 3GTOA 3T01A 4GTFA 3S17C 4OINA 1AB4A 2ZUFA 2E2HA 3GTQC 3S1MK 4AYBD 4BY1K 1B4AA 1JVIA 3GTPK 4GZYA 3S2HC 4BBRC 5C4XK 3GTMA 3FKIC 1WCMK 2GAHC 3HOXC 2NVXK 3DXJA 1WOSA 4BBSC 1TWCK 3CAGA 2NVYK 2WB1D 4LLGA 3S16C 3GTLA 1DCHA 1VRQC 1G51A 1ZVUA 4KMAA 3GEHA 3S1RK 1O2FB 3GSIA 3HOVC 4YFNA 4C3JC 4QIWL 3M3YC 3CQZA 2JA5K 2R92K 4A3IK 3K7AC 1DD5A 1I6HC 4KDDA 4P9SA 1K83C 3GTGK 1V5VA 4KM9A 5FLMC 1SFOA 3S15K 1XXAA 5E68A 1RU0A 3HOYK 3HOWC 1XXBA 1I3QA 4GTBA 3PO2K 1VGXA 3GTJK 1PJ6A 3HOUK 1WOPA 4X6AC 1VLOA 3S1QK 3GTKK 4Y7NK 3ADAC 5IYBK 1R9TA 2R93A 3FOEA 1HI9A 2VUMK 2JA6A 3A8JA 4A3KK 5JFEA 5EGEA 5M3FK 1TWFK 3I4NK 4KARA 5EGHA 4A3MK 1YX2A 2W7VA 4Q4ZA 3S1MC 1O26A 1INNA 4BY1C 2D6FC 3GTPC 4LK0A 1B4BA 4XSZA 5C4XC 4LQYA 1Y1WK 1WCMC 4AYBL 2JA7A 3PO3K 3H3VD 1TWCC 2NVYC 1EK8A 3H0GK 4KATA 4BKWA 3S1RC 4KMHA 2V6TA 1WSRA 2R7ZA 1YCLA 5M3MK 1WORA 1SMYA 1KQ4A 4GTDA 3GIRA 3LPXA 3MMLB 1I50A 2JA5C 2R92C 4A3IC 2E2JK 5M5YK 3VA7A 1WQHA 2B63C 3GTGC 4ZH4A 2CW0A 3S15C 4XLPA 4KMUA 1J6VA 1XZQB 1O25A 3HOYC 3GTOK 4M1XA 3HOUC 1BGWA 2E2HK 3S1QC 4GTLA 2GAGC 4Y7NC 5IYBC 5IP9K 4BXXK 2KWAA 4GTCA 3FKIA 3RZDC 1IBAA 3NUHA 1XPPA 4P5AA 5HL8A 3N3YA 1I6VA 3GTMK 4A3LK 4BY7K 2VUMC 1UV7A 4A3KC 5M5WK 4G0WA 1TWFC 3I4NC 4XLNA 3GTLK 1ZXOA 5C44C 4A3MC 2A6HA 3GEEA 2GSUA 2BE5A 4QJVA 1F9NA 1TWHA 3BUEA 1Y1WC 5IOQA 4P5BA 1EFWA 3CQZK 4A3FK 4YFXA 2RGRA 3TTGA 3TFHA 4BLAA 3H0GC 5TMFA 1DCPA 5IYDK 4DDQA 4A93K 3H3VL 2FQTA 3EQLA 1SFOK 2WAQD 1TWAA 1C0AA 2GSOA 1I3QK 2ZFZA 2YU9A 2E2JC 3G4CA 3S1NC 1R9TK 2R93K 4GTEA 1O27A 2JA6K 3OPFA 4FZBA 4A3JK 1YNJA 1XXCA 1USOA 3T02A 1IQ0A 4WJ4A 2PMZD 2E2IA 5IP9C 4BXXC 3A8IA 3V4GA 3GTMC 4BY7C 4KB4A 3OEPA 2NVTC 2JA7K 1PJ5A 4C2MC 4Y52K 5IYCC 5C4JK 2NVQC 3GTLC 4A3EC 1L0WA 3S2DK 4KM8A 4BLBA 4A3BK 3HOZK 3TFIA 2R7ZK 4MEYA 1I50K 4PABA 4A3FC 3LAPA 2NVXC 2EBBA 4A3DK 2B63A 1DCOA 5IOTA 3IPJA 3N0BA 4A93C 1F7UA 2CFAA 3BP8C 1VH2A 2A69A 2A6EA 3AD9C 1J6XA 5C3EK 3OREA 3GEIA 1TWGK 3FOFA 1Y1VA 3SZZA 1I3QC 2XCRB 2WAQL 2CFAB 2Y0SD 3SZYA 2R93C 3HKZD 3FKIK 4LK1A
chains in the Genus database with same CATH topology
5FJ8K 1TWFC 1HQMA 3I4NC 2JA6C 4XLNA 3CQZC 3GTLK 3HOVC 3RZDK 4YFNA 4A3JC 4XSXA 5C44C 4QIWL 4A3MC 3I4MC 4A3CK 4A3GC 2A6HA 3M3YC 2JA5K 5IYDC 2R92K 1ZYRA 2BE5A 4A3IK 3K7AC 4QJVA 4YG2A 4MEXA 4OIPA 4MQ9A 1Y1WC 1I6HC 1SFOC 3PO2C 1K83C 3GTGK 3GTJC 3CQZK 1BDFA 4YFXA 4A3FK 3HOVK 4C3JK 5C44K 5FLMC 2PA8L 3GTKC 3S17K 1TWHK 3S15K 4G7OA 4Q5SA 3H0GC 3M3YK 5TMFA 5IYDK 3GTQK 2PMZL 4G7ZA 4A93K 2E2IC 2JA7C 3H3VL 3HOYK 4Y52C 3HOWC 3S2HK 1I6HK 3EQLA 3RZOC 5C4JC 1SFOK 4G7HA 3PO2K 4BBRK 1R9TC 2WAQD 3GTJK 3HOUK 4X6AC 3HOXK 3S1QK 1YNNA 3GTKK 4Y7NK 3S2DC 5IYBK 4BBSK 4A3BC 4KN7A 4C3IK 3S14C 1I3QK 3HOZC 4OIOA 3S16K 2E2JC 3WODA 1TWAK 2R7ZC 2VUMK 3S1NC 3HOWK 4A3KK 2WB1L 3M4OC 1R9TK 2R93K 4QIWD 5M3FK 2YU9K 2A68A 1I50C 2JA8C 1TWFK 3I4NK 2JA6K 5TMCA 3PO3C 4A3JK 1YNJA 4A3MK 3I4MK 4Q4ZA 4A3GK 3S1MC 3S1NK 4BY1C 4QJVB 3GTPC 3K7AK 4LK0A 4OIQA 4NOIA 5C3EC 2PA8D 4XSZA 5C4XC 1Y1WK 4C3HK 1WCMC 4AYBL 1K83K 2O5JA 2PMZD 1TWGC 3PO3K 5IP9C 3H3VD 1TWCC 4BXXC 2NVYC 1IW7A 5FLMK 3H0GK 3GTMC 4BY7C 2PPBA 2E2IK 4OIRA 2NVTC 2JA7K 4Y52K 1Y1VC 5IP7C 5IYCC 3RZOK 5C4JK 4A3LC 3S1RC 2Y0SL 2NVQC 4X6AK 5M3MK 3GTLC 4A3EC 1SMYA 4A3CC 2O5IA 3S2DK 3HKZL 4JK1A 4A3BK 4A3DC 3S14K 4LJZA 3HOZK 2JA5C 2R92C 4A3IC 2E2JK 2NVTK 2R7ZK 4C2MK 5M5YK 5IYCK 3M4OK 3GTOC 4MEYA 2B63C 2NVQK 1I50K 3GTGC 2E2HC 4A3FC 4A3EK 2JA8K 2NVXC 4ZH4A 4A3DK 2CW0A 1TWHC 4OINA 3S17C 3S15C 5D4DA 4XLPA 4KMUA 3GTQC 3S1MK 4A93C 4AYBD 4YFKA 4BY1K 3HOYC 3GTPK 3GTOK 4GZYA 3S2HC 2A69A 4KN4A 2A6EA 5C3EK 4BBRC 5C4XK 2B63K 3FKIC 2E2HK 3HOUC 1WCMK 5M5XK 3HOXC 2NVXK 3S1QC 1TWGK 3DXJA 4Y7NC 5IYBC 5IP9K 4BBSC 1TWCK 4BXXK 2NVYK 3RZDC 1I3QC 2WB1D 1XPPA 2WAQL 3GTMK 4LLGA 1I6VA 3S16C 4A3LK 4BY7K 1TWAC 2Y0SD 2VUMC 4A3KC 5M5WK 1Y1VK 2R93C 5IP7K 3HKZD 3FKIK 2YU9C 4LK1A 3S1RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 K;  1TWF C;  1HQM A;  3I4N C;  2JA6 C;  4XLN A;  3CQZ C;  3GTL K;  3HOV C;  3RZD K;  4YFN A;  4A3J C;  4XSX A;  5C44 C;  4QIW L;  4A3M C;  3I4M C;  4A3C K;  4A3G C;  2A6H A;  3M3Y C;  2JA5 K;  5IYD C;  2R92 K;  1ZYR A;  2BE5 A;  4A3I K;  3K7A C;  4QJV A;  4YG2 A;  4MEX A;  4OIP A;  4MQ9 A;  1Y1W C;  1I6H C;  1SFO C;  3PO2 C;  1K83 C;  3GTG K;  3GTJ C;  3CQZ K;  1BDF A;  4YFX A;  4A3F K;  3HOV K;  4C3J K;  5C44 K;  5FLM C;  2PA8 L;  3GTK C;  3S17 K;  1TWH K;  3S15 K;  4G7O A;  4Q5S A;  3H0G C;  3M3Y K;  5TMF A;  5IYD K;  3GTQ K;  2PMZ L;  4G7Z A;  4A93 K;  2E2I C;  2JA7 C;  3H3V L;  3HOY K;  4Y52 C;  3HOW C;  3S2H K;  1I6H K;  3EQL A;  3RZO C;  5C4J C;  1SFO K;  4G7H A;  3PO2 K;  4BBR K;  1R9T C;  2WAQ D;  3GTJ K;  3HOU K;  4X6A C;  3HOX K;  3S1Q K;  1YNN A;  3GTK K;  4Y7N K;  3S2D C;  5IYB K;  4BBS K;  4A3B C;  4KN7 A;  4C3I K;  3S14 C;  1I3Q K;  3HOZ C;  4OIO A;  3S16 K;  2E2J C;  3WOD A;  1TWA K;  2R7Z C;  2VUM K;  3S1N C;  3HOW K;  4A3K K;  2WB1 L;  3M4O C;  1R9T K;  2R93 K;  4QIW D;  5M3F K;  2YU9 K;  2A68 A;  1I50 C;  2JA8 C;  1TWF K;  3I4N K;  2JA6 K;  5TMC A;  3PO3 C;  4A3J K;  1YNJ A;  4A3M K;  3I4M K;  4Q4Z A;  4A3G K;  3S1M C;  3S1N K;  4BY1 C;  4QJV B;  3GTP C;  3K7A K;  4LK0 A;  4OIQ A;  4NOI A;  5C3E C;  2PA8 D;  4XSZ A;  5C4X C;  1Y1W K;  4C3H K;  1WCM C;  4AYB L;  1K83 K;  2O5J A;  2PMZ D;  1TWG C;  3PO3 K;  5IP9 C;  3H3V D;  1TWC C;  4BXX C;  2NVY C;  1IW7 A;  5FLM K;  3H0G K;  3GTM C;  4BY7 C;  2PPB A;  2E2I K;  4OIR A;  2NVT C;  2JA7 K;  4Y52 K;  1Y1V C;  5IP7 C;  5IYC C;  3RZO K;  5C4J K;  4A3L C;  3S1R C;  2Y0S L;  2NVQ C;  4X6A K;  5M3M K;  3GTL C;  4A3E C;  1SMY A;  4A3C C;  2O5I A;  3S2D K;  3HKZ L;  4JK1 A;  4A3B K;  4A3D C;  3S14 K;  4LJZ A;  3HOZ K;  2JA5 C;  2R92 C;  4A3I C;  2E2J K;  2NVT K;  2R7Z K;  4C2M K;  5M5Y K;  5IYC K;  3M4O K;  3GTO C;  4MEY A;  2B63 C;  2NVQ K;  1I50 K;  3GTG C;  2E2H C;  4A3F C;  4A3E K;  2JA8 K;  2NVX C;  4ZH4 A;  4A3D K;  2CW0 A;  1TWH C;  4OIN A;  3S17 C;  3S15 C;  5D4D A;  4XLP A;  4KMU A;  3GTQ C;  3S1M K;  4A93 C;  4AYB D;  4YFK A;  4BY1 K;  3HOY C;  3GTP K;  3GTO K;  4GZY A;  3S2H C;  2A69 A;  4KN4 A;  2A6E A;  5C3E K;  4BBR C;  5C4X K;  2B63 K;  3FKI C;  2E2H K;  3HOU C;  1WCM K;  5M5X K;  3HOX C;  2NVX K;  3S1Q C;  1TWG K;  3DXJ A;  4Y7N C;  5IYB C;  5IP9 K;  4BBS C;  1TWC K;  4BXX K;  2NVY K;  3RZD C;  1I3Q C;  2WB1 D;  1XPP A;  2WAQ L;  3GTM K;  4LLG A;  1I6V A;  3S16 C;  4A3L K;  4BY7 K;  1TWA C;  2Y0S D;  2VUM C;  4A3K C;  5M5W K;  1Y1V K;  2R93 C;  5IP7 K;  3HKZ D;  3FKI K;  2YU9 C;  4LK1 A;  3S1R K; 
#chains in the Genus database with same CATH topology
 5FJ8 K;  4GTA A;  2JA6 C;  4GT9 A;  4A3J C;  4A3C K;  4XSX A;  1ZYR A;  3JST A;  1F7V A;  4YG2 A;  4MQ9 A;  1WSV A;  3BP3 A;  1WOO A;  3PO2 C;  3GTQ A;  3GTJ C;  1BDF A;  3HOV K;  4C3J K;  3GTK C;  1PJ7 A;  4G7O A;  1JOE A;  1TWH K;  1GE9 A;  3M3Y K;  5IOR A;  2PMZ L;  2V6U A;  4G7Z A;  4GFQ A;  1USM A;  2JA7 C;  4Y52 C;  1I6H K;  5C4J C;  4G7H A;  2V6S A;  2Y3P A;  1O2A A;  3S2D C;  4A3B C;  1XZP A;  4C3I K;  3HOZ C;  4OIO A;  3L4J A;  3QX3 A;  1TWA K;  5TJ3 A;  2R7Z C;  3HOW K;  2YU9 K;  2A68 A;  1I50 C;  3Q3Q A;  2ZUE A;  2GSN A;  1O24 A;  3PO3 C;  1ISE A;  4ILD A;  3I4M K;  1WQF A;  4KMD A;  4A3G K;  1K83 A;  2RH6 A;  1JQW A;  4QJV B;  5JVO A;  2P8T A;  4OIQ A;  4NOI A;  5C3E C;  2PA8 D;  4O2D A;  3T00 A;  4C3H K;  1EQR A;  2JH3 A;  1TWG C;  1IW7 A;  3LAJ A;  3FHZ A;  2E2I K;  4OIR A;  1F93 A;  1O28 A;  4LR2 A;  5IOS A;  3RZO K;  4A3L C;  2Y0S L;  1J6W A;  4A3C C;  2O5I A;  1IL2 A;  3HKZ L;  4JK1 A;  3S14 K;  4LJZ A;  4KB2 A;  4J3N A;  1ZBS A;  3M4O K;  3GTO C;  1BS2 A;  4KAW X;  2E2H C;  2JA8 K;  3GTP A;  2P5M A;  3AQP A;  1TWH C;  5D4D A;  1WCM A;  2NVX A;  4YFK A;  1TWC A;  2NVY A;  4KN4 A;  2B63 K;  1O29 A;  5M5X K;  4C3I C;  4G0U A;  4G0V A;  1TWA C;  1J98 A;  1Y1V K;  4LOW A;  5IP7 K;  3AH5 A;  2YU9 C;  2JA5 A;  2R92 A;  3S0X A;  1HQM A;  1EI6 A;  1EH1 A;  3CQZ C;  3N0C A;  1VJE A;  3A8K A;  5CJ9 A;  3RZD K;  3I4M C;  3AD8 C;  4PAA A;  4A3G C;  3GTG A;  5IYD C;  3HXA A;  1WQG A;  4MEX A;  4OIP A;  4C3H C;  1SFO C;  5C44 K;  2PA8 L;  3S17 K;  4Q5S A;  2XCO A;  3GTJ A;  2PHC B;  3GTQ K;  3TFJ A;  2E2I C;  3GTK A;  5L46 A;  3S2H K;  3RZO C;  4BBR K;  1R9T C;  1WIH A;  2VUM A;  3HOX K;  1YNN A;  4BBS K;  4KN7 A;  3S14 C;  2FQO A;  3S16 K;  1TWF A;  3WOD A;  1BJT A;  2WB1 L;  3M4O C;  1IS1 A;  2XCQ A;  4QIW D;  1ZQ1 C;  3AQO A;  3L4K A;  4WJ3 M;  2JA8 C;  5TMC A;  4RMF A;  4XCH A;  1Y1W A;  1O2B A;  3AD7 C;  3S1N K;  1XZQ A;  4AH6 A;  3K7A K;  1IE0 A;  3H0G A;  4FM9 A;  1K83 K;  2O5J A;  5FLM K;  1X31 C;  5CHP A;  1TWG A;  4C45 A;  2PPB A;  1Y1V C;  5IP7 C;  4KAS A;  4X6A K;  3G4A A;  1XZP B;  3GDZ A;  4A3D C;  4WIL A;  2NVT K;  4C2M K;  5IYC K;  4KC6 A;  2NVQ K;  3ERE D;  4A3E K;  3GTO A;  3T01 A;  4GTF A;  3S17 C;  4OIN A;  1AB4 A;  2ZUF A;  2E2H A;  3GTQ C;  3S1M K;  4AYB D;  4BY1 K;  1B4A A;  1JVI A;  3GTP K;  4GZY A;  3S2H C;  4BBR C;  5C4X K;  3GTM A;  3FKI C;  1WCM K;  2GAH C;  3HOX C;  2NVX K;  3DXJ A;  1WOS A;  4BBS C;  1TWC K;  3CAG A;  2NVY K;  2WB1 D;  4LLG A;  3S16 C;  3GTL A;  1DCH A;  1VRQ C;  1G51 A;  1ZVU A;  4KMA A;  3GEH A;  3S1R K;  1O2F B;  3GSI A;  3HOV C;  4YFN A;  4C3J C;  4QIW L;  3M3Y C;  3CQZ A;  2JA5 K;  2R92 K;  4A3I K;  3K7A C;  1DD5 A;  1I6H C;  4KDD A;  4P9S A;  1K83 C;  3GTG K;  1V5V A;  4KM9 A;  5FLM C;  1SFO A;  3S15 K;  1XXA A;  5E68 A;  1RU0 A;  3HOY K;  3HOW C;  1XXB A;  1I3Q A;  4GTB A;  3PO2 K;  1VGX A;  3GTJ K;  1PJ6 A;  3HOU K;  1WOP A;  4X6A C;  1VLO A;  3S1Q K;  3GTK K;  4Y7N K;  3ADA C;  5IYB K;  1R9T A;  2R93 A;  3FOE A;  1HI9 A;  2VUM K;  2JA6 A;  3A8J A;  4A3K K;  5JFE A;  5EGE A;  5M3F K;  1TWF K;  3I4N K;  4KAR A;  5EGH A;  4A3M K;  1YX2 A;  2W7V A;  4Q4Z A;  3S1M C;  1O26 A;  1INN A;  4BY1 C;  2D6F C;  3GTP C;  4LK0 A;  1B4B A;  4XSZ A;  5C4X C;  4LQY A;  1Y1W K;  1WCM C;  4AYB L;  2JA7 A;  3PO3 K;  3H3V D;  1TWC C;  2NVY C;  1EK8 A;  3H0G K;  4KAT A;  4BKW A;  3S1R C;  4KMH A;  2V6T A;  1WSR A;  2R7Z A;  1YCL A;  5M3M K;  1WOR A;  1SMY A;  1KQ4 A;  4GTD A;  3GIR A;  3LPX A;  3MML B;  1I50 A;  2JA5 C;  2R92 C;  4A3I C;  2E2J K;  5M5Y K;  3VA7 A;  1WQH A;  2B63 C;  3GTG C;  4ZH4 A;  2CW0 A;  3S15 C;  4XLP A;  4KMU A;  1J6V A;  1XZQ B;  1O25 A;  3HOY C;  3GTO K;  4M1X A;  3HOU C;  1BGW A;  2E2H K;  3S1Q C;  4GTL A;  2GAG C;  4Y7N C;  5IYB C;  5IP9 K;  4BXX K;  2KWA A;  4GTC A;  3FKI A;  3RZD C;  1IBA A;  3NUH A;  1XPP A;  4P5A A;  5HL8 A;  3N3Y A;  1I6V A;  3GTM K;  4A3L K;  4BY7 K;  2VUM C;  1UV7 A;  4A3K C;  5M5W K;  4G0W A;  1TWF C;  3I4N C;  4XLN A;  3GTL K;  1ZXO A;  5C44 C;  4A3M C;  2A6H A;  3GEE A;  2GSU A;  2BE5 A;  4QJV A;  1F9N A;  1TWH A;  3BUE A;  1Y1W C;  5IOQ A;  4P5B A;  1EFW A;  3CQZ K;  4A3F K;  4YFX A;  2RGR A;  3TTG A;  3TFH A;  4BLA A;  3H0G C;  5TMF A;  1DCP A;  5IYD K;  4DDQ A;  4A93 K;  3H3V L;  2FQT A;  3EQL A;  1SFO K;  2WAQ D;  1TWA A;  1C0A A;  2GSO A;  1I3Q K;  2ZFZ A;  2YU9 A;  2E2J C;  3G4C A;  3S1N C;  1R9T K;  2R93 K;  4GTE A;  1O27 A;  2JA6 K;  3OPF A;  4FZB A;  4A3J K;  1YNJ A;  1XXC A;  1USO A;  3T02 A;  1IQ0 A;  4WJ4 A;  2PMZ D;  2E2I A;  5IP9 C;  4BXX C;  3A8I A;  3V4G A;  3GTM C;  4BY7 C;  4KB4 A;  3OEP A;  2NVT C;  2JA7 K;  1PJ5 A;  4C2M C;  4Y52 K;  5IYC C;  5C4J K;  2NVQ C;  3GTL C;  4A3E C;  1L0W A;  3S2D K;  4KM8 A;  4BLB A;  4A3B K;  3HOZ K;  3TFI A;  2R7Z K;  4MEY A;  1I50 K;  4PAB A;  4A3F C;  3LAP A;  2NVX C;  2EBB A;  4A3D K;  2B63 A;  1DCO A;  5IOT A;  3IPJ A;  3N0B A;  4A93 C;  1F7U A;  2CFA A;  3BP8 C;  1VH2 A;  2A69 A;  2A6E A;  3AD9 C;  1J6X A;  5C3E K;  3ORE A;  3GEI A;  1TWG K;  3FOF A;  1Y1V A;  3SZZ A;  1I3Q C;  2XCR B;  2WAQ L;  2CFA B;  2Y0S D;  3SZY A;  2R93 C;  3HKZ D;  3FKI K;  4LK1 A; 
#chains in the Genus database with same CATH homology
 5FJ8 K;  1TWF C;  1HQM A;  3I4N C;  2JA6 C;  4XLN A;  3CQZ C;  3GTL K;  3HOV C;  3RZD K;  4YFN A;  4A3J C;  4XSX A;  5C44 C;  4QIW L;  4A3M C;  3I4M C;  4A3C K;  4A3G C;  2A6H A;  3M3Y C;  2JA5 K;  5IYD C;  2R92 K;  1ZYR A;  2BE5 A;  4A3I K;  3K7A C;  4QJV A;  4YG2 A;  4MEX A;  4OIP A;  4MQ9 A;  1Y1W C;  1I6H C;  1SFO C;  3PO2 C;  1K83 C;  3GTG K;  3GTJ C;  3CQZ K;  1BDF A;  4YFX A;  4A3F K;  3HOV K;  4C3J K;  5C44 K;  5FLM C;  2PA8 L;  3GTK C;  3S17 K;  1TWH K;  3S15 K;  4G7O A;  4Q5S A;  3H0G C;  3M3Y K;  5TMF A;  5IYD K;  3GTQ K;  2PMZ L;  4G7Z A;  4A93 K;  2E2I C;  2JA7 C;  3H3V L;  3HOY K;  4Y52 C;  3HOW C;  3S2H K;  1I6H K;  3EQL A;  3RZO C;  5C4J C;  1SFO K;  4G7H A;  3PO2 K;  4BBR K;  1R9T C;  2WAQ D;  3GTJ K;  3HOU K;  4X6A C;  3HOX K;  3S1Q K;  1YNN A;  3GTK K;  4Y7N K;  3S2D C;  5IYB K;  4BBS K;  4A3B C;  4KN7 A;  4C3I K;  3S14 C;  1I3Q K;  3HOZ C;  4OIO A;  3S16 K;  2E2J C;  3WOD A;  1TWA K;  2R7Z C;  2VUM K;  3S1N C;  3HOW K;  4A3K K;  2WB1 L;  3M4O C;  1R9T K;  2R93 K;  4QIW D;  5M3F K;  2YU9 K;  2A68 A;  1I50 C;  2JA8 C;  1TWF K;  3I4N K;  2JA6 K;  5TMC A;  3PO3 C;  4A3J K;  1YNJ A;  4A3M K;  3I4M K;  4Q4Z A;  4A3G K;  3S1M C;  3S1N K;  4BY1 C;  4QJV B;  3GTP C;  3K7A K;  4LK0 A;  4OIQ A;  4NOI A;  5C3E C;  2PA8 D;  4XSZ A;  5C4X C;  1Y1W K;  4C3H K;  1WCM C;  4AYB L;  1K83 K;  2O5J A;  2PMZ D;  1TWG C;  3PO3 K;  5IP9 C;  3H3V D;  1TWC C;  4BXX C;  2NVY C;  1IW7 A;  5FLM K;  3H0G K;  3GTM C;  4BY7 C;  2PPB A;  2E2I K;  4OIR A;  2NVT C;  2JA7 K;  4Y52 K;  1Y1V C;  5IP7 C;  5IYC C;  3RZO K;  5C4J K;  4A3L C;  3S1R C;  2Y0S L;  2NVQ C;  4X6A K;  5M3M K;  3GTL C;  4A3E C;  1SMY A;  4A3C C;  2O5I A;  3S2D K;  3HKZ L;  4JK1 A;  4A3B K;  4A3D C;  3S14 K;  4LJZ A;  3HOZ K;  2JA5 C;  2R92 C;  4A3I C;  2E2J K;  2NVT K;  2R7Z K;  4C2M K;  5M5Y K;  5IYC K;  3M4O K;  3GTO C;  4MEY A;  2B63 C;  2NVQ K;  1I50 K;  3GTG C;  2E2H C;  4A3F C;  4A3E K;  2JA8 K;  2NVX C;  4ZH4 A;  4A3D K;  2CW0 A;  1TWH C;  4OIN A;  3S17 C;  3S15 C;  5D4D A;  4XLP A;  4KMU A;  3GTQ C;  3S1M K;  4A93 C;  4AYB D;  4YFK A;  4BY1 K;  3HOY C;  3GTP K;  3GTO K;  4GZY A;  3S2H C;  2A69 A;  4KN4 A;  2A6E A;  5C3E K;  4BBR C;  5C4X K;  2B63 K;  3FKI C;  2E2H K;  3HOU C;  1WCM K;  5M5X K;  3HOX C;  2NVX K;  3S1Q C;  1TWG K;  3DXJ A;  4Y7N C;  5IYB C;  5IP9 K;  4BBS C;  1TWC K;  4BXX K;  2NVY K;  3RZD C;  1I3Q C;  2WB1 D;  1XPP A;  2WAQ L;  3GTM K;  4LLG A;  1I6V A;  3S16 C;  4A3L K;  4BY7 K;  1TWA C;  2Y0S D;  2VUM C;  4A3K C;  5M5W K;  1Y1V K;  2R93 C;  5IP7 K;  3HKZ D;  3FKI K;  2YU9 C;  4LK1 A;  3S1R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...