1I50K

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i50K00
3H0GK 4YG2A 2O5IA 3GTMC 2O5JA 3CQZK 2E2IC 4BXXK 4KN4A 4A3IC 3S2DC 5IP9C 3GTLK 3S1MK 4A3EC 3GTPC 2PMZD 3S14C 4A3KK 1I3QC 1YNNA 2PA8L 4YFXA 1I6HC 4A3MK 3S1QK 3PO2K 4KMUA 1BDFA 5IYCC 2JA7K 3HOZK 5FLMK 1XPPA 4C2MK 2NVYC 4YFNA 4G7HA 5IP7K 2PPBA 2VUMC 2JA5K 1Y1WC 2NVXK 3M4OC 3K7AC 3H0GC 4OIPA 1SFOC 2E2HC 3HOVK 3GTKK 4ZH4A 4A3BK 3GTLC 5C4JK 2R93K 3GTPK 3PO3C 1TWCC 4XLPA 2B63K 4OINA 4JK1A 2NVQK 2WAQD 5M3FK 4LJZA 1I6VA 4OIQA 3PO2C 5D4DA 2Y0SD 2BE5A 2WB1D 5M3MK 4OIRA 2A6EA 2JA8K 3H3VD 3I4MC 3S2HK 3S2DK 2JA5C 3M4OK 2NVXC 4MEYA 3GTOC 4Y52K 2CW0A 1TWFC 3S14K 1Y1VC 4KN7A 1I6HK 1TWHC 4BBSC 3RZDC 2A69A 4QJVB 5M5XK 5C4JC 2WAQL 2NVTK 2JA7C 3HOZC 4C3HK 3S16K 3S17K 2VUMK 2NVYK 4A3LK 4A3FC 4GZYA 4Q5SA 4QIWL 4BY1C 1SFOK 2E2HK 5TMCA 4NOIA 1I50K 3GTKC 2JA8C 1ZYRA 5TMFA 3S2HC 3RZOK 2A68A 1YNJA 2E2JC 4Y52C 3I4NC 1TWFK 4A93C 4LK1A 3S1NK 2R93C 1K83K 2B63C 5C3EK 2JA6C 2NVQC 1TWHK 4BBSK 3RZDK 3HOWK 4C3JK 3HOYK 4MQ9A 4QJVA 3S17C 3I4MK 2Y0SL 2YU9K 3H3VL 4XSZA 3HOXC 3GTOK 4BY1K 1IW7A 1Y1VK 3S15C 3WODA 4A3GC 3RZOC 2NVTC 3S16C 4AYBD 3I4NK 4BBRC 3S1NC 1K83C 4A3JC 2WB1L 4BY7K 4G7ZA 2R92C 5C4XC 1TWGC 3DXJA 3M3YC 3HOWC 3HOYC 1I50C 4LK0A 5IYBC 4XSXA 3GTGK 2E2JK 4A93K 5C44C 2R7ZC 2PA8D 3FKIC 5C3EC 4A3DC 5IYDK 3GTJK 2JA6K 1WCMK 4A3GK 1R9TC 1TWAC 2PMZL 4Y7NC 4AYBL 4A3FK 4A3JK 4G7OA 4XLNA 4BY7C 2YU9C 5C4XK 3HOXK 3CQZC 2E2IK 4BXXC 5M5WK 5IP9K 3S15K 3HOUC 3S1MC 4OIOA 4A3EK 4A3CK 3GTGC 4A3LC 5C44K 3GTQC 1I3QK 4BBRK 3S1RC 4X6AK 2A6HA 4QIWD 5M5YK 3GTJC 5FJ8K 2R92K 1TWGK 5IYCK 3M3YK 3GTMK 4Y7NK 1HQMA 4C3IK 5IYBK 4A3IK 1SMYA 3K7AK 3HKZL 4YFKA 3HOVC 4A3KC 4MEXA 2R7ZK 3FKIK 5IYDC 4A3BC 4A3MC 4X6AC 1WCMC 4Q4ZA 3HOUK 3S1QC 1R9TK 1TWAK 3HKZD 4A3CC 3PO3K 1TWCK 4LLGA 5FLMC 3GTQK 4A3DK 3S1RK 5IP7C 3EQLA 1Y1WK
chains in the Genus database with same CATH superfamily
1O29A 3A8IA 3IPJA 2O5JA 1DD5A 1R9TA 4C3IC 4A3IC 3GTLK 4KM9A 4A3EC 2PMZD 2GSUA 1I3QC 3VA7A 4KAWX 1BDFA 4KMUA 3T01A 3HOZK 5E68A 2VUMC 2NVYC 1AB4A 5IOTA 2JA5K 1O25A 1SFOC 1J6WA 3A8KA 4A3BK 3N0BA 4RMFA 3GTLC 4FZBA 4P5BA 2NVQK 5M3FK 1XZQB 1RU0A 4C45A 3S2HK 2JA5C 3GTOC 3S14K 2RH6A 3FHZA 2A69A 2CFAB 4C2MC 1XXAA 2E2HK 1ZYRA 3S2HC 1O26A 2E2JC 1YNJA 2R93C 1K83K 1G51A 3SZYA 3HOWK 4MQ9A 4QJVA 2R7ZA 5HL8A 4FM9A 1IW7A 2FQOA 3BUEA 1Y1VK 2XCRB 3H0GA 2KWAA 4BBRC 1K83C 4A3JC 2ZUEA 1HI9A 4BY7K 4G7ZA 1Y1VA 1TWGC 3HOWC 1WOPA 5JFEA 4A93K 5C44C 4KASA 2GSOA 3FKIC 5C3EC 5IYDK 3MMLB 1R9TC 2PMZL 4KARA 1KQ4A 2JH3A 4A3JK 1I3QA 4BY7C 1J6XA 4KMHA 3OPFA 4AH6A 4A3EK 5C44K 1I3QK 4X6AK 2A6HA 2GAHC 3GTMK 2XCOA 2PHCB 1BJTA 1SMYA 4YFKA 4GTDA 4GTBA 4A3BC 1USMA 2NVYA 4A3MC 3GTMA 3S1QC 3CAGA 1B4AA 4X6AC 1YCLA 2FQTA 1Y1WK 4YG2A 5EGHA 3GTMC 1IBAA 3CQZK 4BXXK 4GT9A 4KN4A 5IP9C 4GTAA 3S14C 1JQWA 1YNNA 1YX2A 4A3MK 3S1QK 3PO2K 3CQZA 5IYCC 4C2MK 4P9SA 4YFNA 2P8TA 2PPBA 1Y1WC 3GSIA 3K7AC 3GTQA 1IL2A 4OIPA 2E2HC 1L0WA 4ZH4A 5IOQA 1EH1A 2V6UA 1F7UA 2R93K 1JOEA 4C3HC 4OINA 1IQ0A 2W7VA 1I6VA 3PO2C 4WJ4A 5M3MK 4OIRA 1VJEA 3S2DK 1K83A 4MEYA 4Y52K 1WQGA 1F9NA 1Y1VC 3LAJA 1TWHC 4BBSC 1USOA 4C3HK 4KDDA 4A3LK 3G4AA 3GTPA 3GTKC 3RZOK 2A68A 4A93C 4Y52C 3I4NC 5C3EK 4G0WA 1TWHK 4BBSK 1WOSA 3HOYK 3I4MK 3H3VL 3GIRA 3OEPA 3OREA 4BLAA 3RZOC 2NVTC 3GEEA 3I4NK 5C4XC 3N3YA 2ZFZA 3HOYC 3TFIA 4XSXA 4KB2A 3GTGK 4KATA 4ILDA 2JA6K 1BS2A 4C3JC 1EQRA 2YU9C 5C4XK 3HOXK 3AH5A 3CQZC 3AQPA 4BXXC 5IP9K 2GAGC 3GTGC 1Y1WA 3GTQC 3TFHA 1V5VA 3SZZA 1O2FB 3T02A 1TWFA 5IYCK 3M3YK 1WCMA 1IS1A 1O2AA 5IYBK 3K7AK 5CJ9A 3V4GA 1O27A 1WCMC 1X31C 5FLMC 3GTQK 5IP7C 1ZXOA 3EQLA 5L46A 4A3FC 2O5IA 1PJ6A 3S2DC 3GTPC 2PA8L 4YFXA 1UV7A 3ADAC 5FLMK 4A3LC 5IP7K 2NVXK 1TWHA 3AQOA 3GTKK 2CFAA 1O2BA 3GTPK 1J6VA 4XLPA 2NVXA 4JK1A 2WAQD 3LPXA 5D4DA 2Y0SD 1XZQA 1WORA 1WSRA 3I4MC 4LOWA 2JA7A 4XCHA 1INNA 3LAPA 2NVXC 2CW0A 4KN7A 3N0CA 1WQFA 1I6HK 3T00A 3RZDC 4QJVB 5M5XK 2NVTK 2WAQL 3TFJA 2JA7C 4WJ3M 3S0XA 4G0VA 4KB4A 3S17K 3Q3QA 4DDQA 1ZBSA 4Q5SA 4QIWL 2B63A 1TWCA 4KC6A 4BLBA 2YU9A 3S1NK 2B63C 2JA6C 1XXCA 1WOOA 3RZDK 4C3JK 3S17C 4KMAA 2Y0SL 2YU9K 4XSZA 3HOXC 3WODA 3QX3A 3S16C 4AYBD 4GTCA 3S1NC 3M3YC 5IOSA 1I50C 5IYBC 3ERED 4O2DA 2PA8D 3G4CA 2GSNA 1WSVA 1WCMK 1SFOA 2V6TA 1DCPA 3BP3A 4A3FK 1F7VA 4G7OA 3BP8C 4XLNA 1DCOA 3GEIA 3S15K 5TJ3A 3S1RC 3GTKA 5M5YK 5FJ8K 2R92K 3GTOA 1JVIA 3TTGA 1XZPB 3L4KA 4A3KC 4KMDA 3HXAA 4MEXA 2R7ZK 2V6SA 5JVOA 3AD9C 2E2IA 1TWAK 1J98A 4LLGA 4A3DK 1VH2A 3S1RK 3H0GK 1F93A 2P5MA 2EBBA 2E2IC 1EI6A 3GTJA 3S1MK 1IE0A 1ISEA 5EGEA 1O28A 4A3KK 1I6HC 2JA7K 1C0AA 4A3DC 1XPPA 1VRQC 4G7HA 1ZQ1C 3M4OC 3H0GC 4WILA 3A8JA 3HOVK 4BKWA 4GFQA 5C4JK 1GE9A 3PO3C 1TWCC 4PAAA 2B63K 4KM8A 4LJZA 4OIQA 3GTGA 3H3VD 2BE5A 2WB1D 3FKIA 2A6EA 2JA8K 1DCHA 3M4OK 2JA6A 1PJ7A 1TWFC 5IORA 3AD7C 1I50A 4J3NA 1BGWA 5C4JC 3S16K 3HOZC 4GTLA 3GDZA 4LQYA 1EFWA 2VUMK 5CHPA 2NVYK 3GEHA 3GTLA 4GZYA 1PJ5A 3L4JA 4BY1C 1SFOK 5TMCA 4NOIA 1I50K 2JA8C 5TMFA 2VUMA 1TWFK 1WIHA 4LK1A 2JA5A 2NVQC 2Y3PA 3AD8C 3FOEA 2XCQA 3GTOK 4BY1K 3S15C 4A3GC 1EK8A 4GTFA 2WB1L 2R92C 2R93A 3DXJA 4LR2A 1ZVUA 4LK0A 2ZUFA 3NUHA 2E2JK 4M1XA 4G0UA 2R92A 2R7ZC 3GTJK 4A3GK 1TWAC 4Y7NC 2E2HA 3JSTA 4AYBL 1B4BA 2E2IK 1TWAA 1XXBA 5M5WK 1VGXA 3S1MC 3HOUC 4OIOA 1VLOA 4A3CK 4BBRK 3FOFA 4PABA 4QIWD 3GTJC 1TWGK 2RGRA 4Y7NK 1HQMA 2D6FC 4C3IK 4A3IK 1O24A 3HKZL 3HOVC 4P5AA 3FKIK 5IYDC 1TWGA 4GTEA 4Q4ZA 3HOUK 1R9TK 1XZPA 3HKZD 4A3CC 3PO3K 1WQHA 1TWCK
chains in the Genus database with same CATH topology
3H0GK 4YG2A 2O5IA 3GTMC 2O5JA 3CQZK 2E2IC 4BXXK 4KN4A 4A3IC 3S2DC 5IP9C 3GTLK 3S1MK 4A3EC 3GTPC 2PMZD 3S14C 4A3KK 1I3QC 1YNNA 2PA8L 4YFXA 1I6HC 4A3MK 3S1QK 3PO2K 4KMUA 1BDFA 5IYCC 2JA7K 3HOZK 5FLMK 1XPPA 4C2MK 2NVYC 4YFNA 4G7HA 5IP7K 2PPBA 2VUMC 2JA5K 1Y1WC 2NVXK 3M4OC 3K7AC 3H0GC 4OIPA 1SFOC 2E2HC 3HOVK 3GTKK 4ZH4A 4A3BK 3GTLC 5C4JK 2R93K 3GTPK 3PO3C 1TWCC 4XLPA 2B63K 4OINA 4JK1A 2NVQK 2WAQD 5M3FK 4LJZA 1I6VA 4OIQA 3PO2C 5D4DA 2Y0SD 2BE5A 2WB1D 5M3MK 4OIRA 2A6EA 2JA8K 3H3VD 3I4MC 3S2HK 3S2DK 2JA5C 3M4OK 2NVXC 4MEYA 3GTOC 4Y52K 2CW0A 1TWFC 3S14K 1Y1VC 4KN7A 1I6HK 1TWHC 4BBSC 3RZDC 2A69A 4QJVB 5M5XK 5C4JC 2WAQL 2NVTK 2JA7C 3HOZC 4C3HK 3S16K 3S17K 2VUMK 2NVYK 4A3LK 4A3FC 4GZYA 4Q5SA 4QIWL 4BY1C 1SFOK 2E2HK 5TMCA 4NOIA 1I50K 3GTKC 2JA8C 1ZYRA 5TMFA 3S2HC 3RZOK 2A68A 1YNJA 2E2JC 4Y52C 3I4NC 1TWFK 4A93C 4LK1A 3S1NK 2R93C 1K83K 2B63C 5C3EK 2JA6C 2NVQC 1TWHK 4BBSK 3RZDK 3HOWK 4C3JK 3HOYK 4MQ9A 4QJVA 3S17C 3I4MK 2Y0SL 2YU9K 3H3VL 4XSZA 3HOXC 3GTOK 4BY1K 1IW7A 1Y1VK 3S15C 3WODA 4A3GC 3RZOC 2NVTC 3S16C 4AYBD 3I4NK 4BBRC 3S1NC 1K83C 4A3JC 2WB1L 4BY7K 4G7ZA 2R92C 5C4XC 1TWGC 3DXJA 3M3YC 3HOWC 3HOYC 1I50C 4LK0A 5IYBC 4XSXA 3GTGK 2E2JK 4A93K 5C44C 2R7ZC 2PA8D 3FKIC 5C3EC 4A3DC 5IYDK 3GTJK 2JA6K 1WCMK 4A3GK 1R9TC 1TWAC 2PMZL 4Y7NC 4AYBL 4A3FK 4A3JK 4G7OA 4XLNA 4BY7C 2YU9C 5C4XK 3HOXK 3CQZC 2E2IK 4BXXC 5M5WK 5IP9K 3S15K 3HOUC 3S1MC 4OIOA 4A3EK 4A3CK 3GTGC 4A3LC 5C44K 3GTQC 1I3QK 4BBRK 3S1RC 4X6AK 2A6HA 4QIWD 5M5YK 3GTJC 5FJ8K 2R92K 1TWGK 5IYCK 3M3YK 3GTMK 4Y7NK 1HQMA 4C3IK 5IYBK 4A3IK 1SMYA 3K7AK 3HKZL 4YFKA 3HOVC 4A3KC 4MEXA 2R7ZK 3FKIK 5IYDC 4A3BC 4A3MC 4X6AC 1WCMC 4Q4ZA 3HOUK 3S1QC 1R9TK 1TWAK 3HKZD 4A3CC 3PO3K 1TWCK 4LLGA 5FLMC 3GTQK 4A3DK 3S1RK 5IP7C 3EQLA 1Y1WK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G K;  4YG2 A;  2O5I A;  3GTM C;  2O5J A;  3CQZ K;  2E2I C;  4BXX K;  4KN4 A;  4A3I C;  3S2D C;  5IP9 C;  3GTL K;  3S1M K;  4A3E C;  3GTP C;  2PMZ D;  3S14 C;  4A3K K;  1I3Q C;  1YNN A;  2PA8 L;  4YFX A;  1I6H C;  4A3M K;  3S1Q K;  3PO2 K;  4KMU A;  1BDF A;  5IYC C;  2JA7 K;  3HOZ K;  5FLM K;  1XPP A;  4C2M K;  2NVY C;  4YFN A;  4G7H A;  5IP7 K;  2PPB A;  2VUM C;  2JA5 K;  1Y1W C;  2NVX K;  3M4O C;  3K7A C;  3H0G C;  4OIP A;  1SFO C;  2E2H C;  3HOV K;  3GTK K;  4ZH4 A;  4A3B K;  3GTL C;  5C4J K;  2R93 K;  3GTP K;  3PO3 C;  1TWC C;  4XLP A;  2B63 K;  4OIN A;  4JK1 A;  2NVQ K;  2WAQ D;  5M3F K;  4LJZ A;  1I6V A;  4OIQ A;  3PO2 C;  5D4D A;  2Y0S D;  2BE5 A;  2WB1 D;  5M3M K;  4OIR A;  2A6E A;  2JA8 K;  3H3V D;  3I4M C;  3S2H K;  3S2D K;  2JA5 C;  3M4O K;  2NVX C;  4MEY A;  3GTO C;  4Y52 K;  2CW0 A;  1TWF C;  3S14 K;  1Y1V C;  4KN7 A;  1I6H K;  1TWH C;  4BBS C;  3RZD C;  2A69 A;  4QJV B;  5M5X K;  5C4J C;  2WAQ L;  2NVT K;  2JA7 C;  3HOZ C;  4C3H K;  3S16 K;  3S17 K;  2VUM K;  2NVY K;  4A3L K;  4A3F C;  4GZY A;  4Q5S A;  4QIW L;  4BY1 C;  1SFO K;  2E2H K;  5TMC A;  4NOI A;  1I50 K;  3GTK C;  2JA8 C;  1ZYR A;  5TMF A;  3S2H C;  3RZO K;  2A68 A;  1YNJ A;  2E2J C;  4Y52 C;  3I4N C;  1TWF K;  4A93 C;  4LK1 A;  3S1N K;  2R93 C;  1K83 K;  2B63 C;  5C3E K;  2JA6 C;  2NVQ C;  1TWH K;  4BBS K;  3RZD K;  3HOW K;  4C3J K;  3HOY K;  4MQ9 A;  4QJV A;  3S17 C;  3I4M K;  2Y0S L;  2YU9 K;  3H3V L;  4XSZ A;  3HOX C;  3GTO K;  4BY1 K;  1IW7 A;  1Y1V K;  3S15 C;  3WOD A;  4A3G C;  3RZO C;  2NVT C;  3S16 C;  4AYB D;  3I4N K;  4BBR C;  3S1N C;  1K83 C;  4A3J C;  2WB1 L;  4BY7 K;  4G7Z A;  2R92 C;  5C4X C;  1TWG C;  3DXJ A;  3M3Y C;  3HOW C;  3HOY C;  1I50 C;  4LK0 A;  5IYB C;  4XSX A;  3GTG K;  2E2J K;  4A93 K;  5C44 C;  2R7Z C;  2PA8 D;  3FKI C;  5C3E C;  4A3D C;  5IYD K;  3GTJ K;  2JA6 K;  1WCM K;  4A3G K;  1R9T C;  1TWA C;  2PMZ L;  4Y7N C;  4AYB L;  4A3F K;  4A3J K;  4G7O A;  4XLN A;  4BY7 C;  2YU9 C;  5C4X K;  3HOX K;  3CQZ C;  2E2I K;  4BXX C;  5M5W K;  5IP9 K;  3S15 K;  3HOU C;  3S1M C;  4OIO A;  4A3E K;  4A3C K;  3GTG C;  4A3L C;  5C44 K;  3GTQ C;  1I3Q K;  4BBR K;  3S1R C;  4X6A K;  2A6H A;  4QIW D;  5M5Y K;  3GTJ C;  5FJ8 K;  2R92 K;  1TWG K;  5IYC K;  3M3Y K;  3GTM K;  4Y7N K;  1HQM A;  4C3I K;  5IYB K;  4A3I K;  1SMY A;  3K7A K;  3HKZ L;  4YFK A;  3HOV C;  4A3K C;  4MEX A;  2R7Z K;  3FKI K;  5IYD C;  4A3B C;  4A3M C;  4X6A C;  1WCM C;  4Q4Z A;  3HOU K;  3S1Q C;  1R9T K;  1TWA K;  3HKZ D;  4A3C C;  3PO3 K;  1TWC K;  4LLG A;  5FLM C;  3GTQ K;  4A3D K;  3S1R K;  5IP7 C;  3EQL A;  1Y1W K; 
#chains in the Genus database with same CATH topology
 1O29 A;  3A8I A;  3IPJ A;  2O5J A;  1DD5 A;  1R9T A;  4C3I C;  4A3I C;  3GTL K;  4KM9 A;  4A3E C;  2PMZ D;  2GSU A;  1I3Q C;  3VA7 A;  4KAW X;  1BDF A;  4KMU A;  3T01 A;  3HOZ K;  5E68 A;  2VUM C;  2NVY C;  1AB4 A;  5IOT A;  2JA5 K;  1O25 A;  1SFO C;  1J6W A;  3A8K A;  4A3B K;  3N0B A;  4RMF A;  3GTL C;  4FZB A;  4P5B A;  2NVQ K;  5M3F K;  1XZQ B;  1RU0 A;  4C45 A;  3S2H K;  2JA5 C;  3GTO C;  3S14 K;  2RH6 A;  3FHZ A;  2A69 A;  2CFA B;  4C2M C;  1XXA A;  2E2H K;  1ZYR A;  3S2H C;  1O26 A;  2E2J C;  1YNJ A;  2R93 C;  1K83 K;  1G51 A;  3SZY A;  3HOW K;  4MQ9 A;  4QJV A;  2R7Z A;  5HL8 A;  4FM9 A;  1IW7 A;  2FQO A;  3BUE A;  1Y1V K;  2XCR B;  3H0G A;  2KWA A;  4BBR C;  1K83 C;  4A3J C;  2ZUE A;  1HI9 A;  4BY7 K;  4G7Z A;  1Y1V A;  1TWG C;  3HOW C;  1WOP A;  5JFE A;  4A93 K;  5C44 C;  4KAS A;  2GSO A;  3FKI C;  5C3E C;  5IYD K;  3MML B;  1R9T C;  2PMZ L;  4KAR A;  1KQ4 A;  2JH3 A;  4A3J K;  1I3Q A;  4BY7 C;  1J6X A;  4KMH A;  3OPF A;  4AH6 A;  4A3E K;  5C44 K;  1I3Q K;  4X6A K;  2A6H A;  2GAH C;  3GTM K;  2XCO A;  2PHC B;  1BJT A;  1SMY A;  4YFK A;  4GTD A;  4GTB A;  4A3B C;  1USM A;  2NVY A;  4A3M C;  3GTM A;  3S1Q C;  3CAG A;  1B4A A;  4X6A C;  1YCL A;  2FQT A;  1Y1W K;  4YG2 A;  5EGH A;  3GTM C;  1IBA A;  3CQZ K;  4BXX K;  4GT9 A;  4KN4 A;  5IP9 C;  4GTA A;  3S14 C;  1JQW A;  1YNN A;  1YX2 A;  4A3M K;  3S1Q K;  3PO2 K;  3CQZ A;  5IYC C;  4C2M K;  4P9S A;  4YFN A;  2P8T A;  2PPB A;  1Y1W C;  3GSI A;  3K7A C;  3GTQ A;  1IL2 A;  4OIP A;  2E2H C;  1L0W A;  4ZH4 A;  5IOQ A;  1EH1 A;  2V6U A;  1F7U A;  2R93 K;  1JOE A;  4C3H C;  4OIN A;  1IQ0 A;  2W7V A;  1I6V A;  3PO2 C;  4WJ4 A;  5M3M K;  4OIR A;  1VJE A;  3S2D K;  1K83 A;  4MEY A;  4Y52 K;  1WQG A;  1F9N A;  1Y1V C;  3LAJ A;  1TWH C;  4BBS C;  1USO A;  4C3H K;  4KDD A;  4A3L K;  3G4A A;  3GTP A;  3GTK C;  3RZO K;  2A68 A;  4A93 C;  4Y52 C;  3I4N C;  5C3E K;  4G0W A;  1TWH K;  4BBS K;  1WOS A;  3HOY K;  3I4M K;  3H3V L;  3GIR A;  3OEP A;  3ORE A;  4BLA A;  3RZO C;  2NVT C;  3GEE A;  3I4N K;  5C4X C;  3N3Y A;  2ZFZ A;  3HOY C;  3TFI A;  4XSX A;  4KB2 A;  3GTG K;  4KAT A;  4ILD A;  2JA6 K;  1BS2 A;  4C3J C;  1EQR A;  2YU9 C;  5C4X K;  3HOX K;  3AH5 A;  3CQZ C;  3AQP A;  4BXX C;  5IP9 K;  2GAG C;  3GTG C;  1Y1W A;  3GTQ C;  3TFH A;  1V5V A;  3SZZ A;  1O2F B;  3T02 A;  1TWF A;  5IYC K;  3M3Y K;  1WCM A;  1IS1 A;  1O2A A;  5IYB K;  3K7A K;  5CJ9 A;  3V4G A;  1O27 A;  1WCM C;  1X31 C;  5FLM C;  3GTQ K;  5IP7 C;  1ZXO A;  3EQL A;  5L46 A;  4A3F C;  2O5I A;  1PJ6 A;  3S2D C;  3GTP C;  2PA8 L;  4YFX A;  1UV7 A;  3ADA C;  5FLM K;  4A3L C;  5IP7 K;  2NVX K;  1TWH A;  3AQO A;  3GTK K;  2CFA A;  1O2B A;  3GTP K;  1J6V A;  4XLP A;  2NVX A;  4JK1 A;  2WAQ D;  3LPX A;  5D4D A;  2Y0S D;  1XZQ A;  1WOR A;  1WSR A;  3I4M C;  4LOW A;  2JA7 A;  4XCH A;  1INN A;  3LAP A;  2NVX C;  2CW0 A;  4KN7 A;  3N0C A;  1WQF A;  1I6H K;  3T00 A;  3RZD C;  4QJV B;  5M5X K;  2NVT K;  2WAQ L;  3TFJ A;  2JA7 C;  4WJ3 M;  3S0X A;  4G0V A;  4KB4 A;  3S17 K;  3Q3Q A;  4DDQ A;  1ZBS A;  4Q5S A;  4QIW L;  2B63 A;  1TWC A;  4KC6 A;  4BLB A;  2YU9 A;  3S1N K;  2B63 C;  2JA6 C;  1XXC A;  1WOO A;  3RZD K;  4C3J K;  3S17 C;  4KMA A;  2Y0S L;  2YU9 K;  4XSZ A;  3HOX C;  3WOD A;  3QX3 A;  3S16 C;  4AYB D;  4GTC A;  3S1N C;  3M3Y C;  5IOS A;  1I50 C;  5IYB C;  3ERE D;  4O2D A;  2PA8 D;  3G4C A;  2GSN A;  1WSV A;  1WCM K;  1SFO A;  2V6T A;  1DCP A;  3BP3 A;  4A3F K;  1F7V A;  4G7O A;  3BP8 C;  4XLN A;  1DCO A;  3GEI A;  3S15 K;  5TJ3 A;  3S1R C;  3GTK A;  5M5Y K;  5FJ8 K;  2R92 K;  3GTO A;  1JVI A;  3TTG A;  1XZP B;  3L4K A;  4A3K C;  4KMD A;  3HXA A;  4MEX A;  2R7Z K;  2V6S A;  5JVO A;  3AD9 C;  2E2I A;  1TWA K;  1J98 A;  4LLG A;  4A3D K;  1VH2 A;  3S1R K;  3H0G K;  1F93 A;  2P5M A;  2EBB A;  2E2I C;  1EI6 A;  3GTJ A;  3S1M K;  1IE0 A;  1ISE A;  5EGE A;  1O28 A;  4A3K K;  1I6H C;  2JA7 K;  1C0A A;  4A3D C;  1XPP A;  1VRQ C;  4G7H A;  1ZQ1 C;  3M4O C;  3H0G C;  4WIL A;  3A8J A;  3HOV K;  4BKW A;  4GFQ A;  5C4J K;  1GE9 A;  3PO3 C;  1TWC C;  4PAA A;  2B63 K;  4KM8 A;  4LJZ A;  4OIQ A;  3GTG A;  3H3V D;  2BE5 A;  2WB1 D;  3FKI A;  2A6E A;  2JA8 K;  1DCH A;  3M4O K;  2JA6 A;  1PJ7 A;  1TWF C;  5IOR A;  3AD7 C;  1I50 A;  4J3N A;  1BGW A;  5C4J C;  3S16 K;  3HOZ C;  4GTL A;  3GDZ A;  4LQY A;  1EFW A;  2VUM K;  5CHP A;  2NVY K;  3GEH A;  3GTL A;  4GZY A;  1PJ5 A;  3L4J A;  4BY1 C;  1SFO K;  5TMC A;  4NOI A;  1I50 K;  2JA8 C;  5TMF A;  2VUM A;  1TWF K;  1WIH A;  4LK1 A;  2JA5 A;  2NVQ C;  2Y3P A;  3AD8 C;  3FOE A;  2XCQ A;  3GTO K;  4BY1 K;  3S15 C;  4A3G C;  1EK8 A;  4GTF A;  2WB1 L;  2R92 C;  2R93 A;  3DXJ A;  4LR2 A;  1ZVU A;  4LK0 A;  2ZUF A;  3NUH A;  2E2J K;  4M1X A;  4G0U A;  2R92 A;  2R7Z C;  3GTJ K;  4A3G K;  1TWA C;  4Y7N C;  2E2H A;  3JST A;  4AYB L;  1B4B A;  2E2I K;  1TWA A;  1XXB A;  5M5W K;  1VGX A;  3S1M C;  3HOU C;  4OIO A;  1VLO A;  4A3C K;  4BBR K;  3FOF A;  4PAB A;  4QIW D;  3GTJ C;  1TWG K;  2RGR A;  4Y7N K;  1HQM A;  2D6F C;  4C3I K;  4A3I K;  1O24 A;  3HKZ L;  3HOV C;  4P5A A;  3FKI K;  5IYD C;  1TWG A;  4GTE A;  4Q4Z A;  3HOU K;  1R9T K;  1XZP A;  3HKZ D;  4A3C C;  3PO3 K;  1WQH A;  1TWC K; 
#chains in the Genus database with same CATH homology
 3H0G K;  4YG2 A;  2O5I A;  3GTM C;  2O5J A;  3CQZ K;  2E2I C;  4BXX K;  4KN4 A;  4A3I C;  3S2D C;  5IP9 C;  3GTL K;  3S1M K;  4A3E C;  3GTP C;  2PMZ D;  3S14 C;  4A3K K;  1I3Q C;  1YNN A;  2PA8 L;  4YFX A;  1I6H C;  4A3M K;  3S1Q K;  3PO2 K;  4KMU A;  1BDF A;  5IYC C;  2JA7 K;  3HOZ K;  5FLM K;  1XPP A;  4C2M K;  2NVY C;  4YFN A;  4G7H A;  5IP7 K;  2PPB A;  2VUM C;  2JA5 K;  1Y1W C;  2NVX K;  3M4O C;  3K7A C;  3H0G C;  4OIP A;  1SFO C;  2E2H C;  3HOV K;  3GTK K;  4ZH4 A;  4A3B K;  3GTL C;  5C4J K;  2R93 K;  3GTP K;  3PO3 C;  1TWC C;  4XLP A;  2B63 K;  4OIN A;  4JK1 A;  2NVQ K;  2WAQ D;  5M3F K;  4LJZ A;  1I6V A;  4OIQ A;  3PO2 C;  5D4D A;  2Y0S D;  2BE5 A;  2WB1 D;  5M3M K;  4OIR A;  2A6E A;  2JA8 K;  3H3V D;  3I4M C;  3S2H K;  3S2D K;  2JA5 C;  3M4O K;  2NVX C;  4MEY A;  3GTO C;  4Y52 K;  2CW0 A;  1TWF C;  3S14 K;  1Y1V C;  4KN7 A;  1I6H K;  1TWH C;  4BBS C;  3RZD C;  2A69 A;  4QJV B;  5M5X K;  5C4J C;  2WAQ L;  2NVT K;  2JA7 C;  3HOZ C;  4C3H K;  3S16 K;  3S17 K;  2VUM K;  2NVY K;  4A3L K;  4A3F C;  4GZY A;  4Q5S A;  4QIW L;  4BY1 C;  1SFO K;  2E2H K;  5TMC A;  4NOI A;  1I50 K;  3GTK C;  2JA8 C;  1ZYR A;  5TMF A;  3S2H C;  3RZO K;  2A68 A;  1YNJ A;  2E2J C;  4Y52 C;  3I4N C;  1TWF K;  4A93 C;  4LK1 A;  3S1N K;  2R93 C;  1K83 K;  2B63 C;  5C3E K;  2JA6 C;  2NVQ C;  1TWH K;  4BBS K;  3RZD K;  3HOW K;  4C3J K;  3HOY K;  4MQ9 A;  4QJV A;  3S17 C;  3I4M K;  2Y0S L;  2YU9 K;  3H3V L;  4XSZ A;  3HOX C;  3GTO K;  4BY1 K;  1IW7 A;  1Y1V K;  3S15 C;  3WOD A;  4A3G C;  3RZO C;  2NVT C;  3S16 C;  4AYB D;  3I4N K;  4BBR C;  3S1N C;  1K83 C;  4A3J C;  2WB1 L;  4BY7 K;  4G7Z A;  2R92 C;  5C4X C;  1TWG C;  3DXJ A;  3M3Y C;  3HOW C;  3HOY C;  1I50 C;  4LK0 A;  5IYB C;  4XSX A;  3GTG K;  2E2J K;  4A93 K;  5C44 C;  2R7Z C;  2PA8 D;  3FKI C;  5C3E C;  4A3D C;  5IYD K;  3GTJ K;  2JA6 K;  1WCM K;  4A3G K;  1R9T C;  1TWA C;  2PMZ L;  4Y7N C;  4AYB L;  4A3F K;  4A3J K;  4G7O A;  4XLN A;  4BY7 C;  2YU9 C;  5C4X K;  3HOX K;  3CQZ C;  2E2I K;  4BXX C;  5M5W K;  5IP9 K;  3S15 K;  3HOU C;  3S1M C;  4OIO A;  4A3E K;  4A3C K;  3GTG C;  4A3L C;  5C44 K;  3GTQ C;  1I3Q K;  4BBR K;  3S1R C;  4X6A K;  2A6H A;  4QIW D;  5M5Y K;  3GTJ C;  5FJ8 K;  2R92 K;  1TWG K;  5IYC K;  3M3Y K;  3GTM K;  4Y7N K;  1HQM A;  4C3I K;  5IYB K;  4A3I K;  1SMY A;  3K7A K;  3HKZ L;  4YFK A;  3HOV C;  4A3K C;  4MEX A;  2R7Z K;  3FKI K;  5IYD C;  4A3B C;  4A3M C;  4X6A C;  1WCM C;  4Q4Z A;  3HOU K;  3S1Q C;  1R9T K;  1TWA K;  3HKZ D;  4A3C C;  3PO3 K;  1TWC K;  4LLG A;  5FLM C;  3GTQ K;  4A3D K;  3S1R K;  5IP7 C;  3EQL A;  1Y1W K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...