1I50K

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i50K00
3GTOC 3S1MC 4Y7NC 3S1MK 3GTMC 4KN7A 5M3FK 3HOYK 3HOXC 4Y52K 4BBSC 3HOYC 3RZOC 2JA8C 3WODA 3S1QC 1I3QK 1I6HK 2NVXC 3S1QK 3GTJK 4YFXA 3GTJC 2E2HK 2JA7K 5C44K 1TWGK 5IYBC 3PO3K 4LK1A 4A3FK 3RZDC 2E2HC 4BY7C 5C4XC 1BDFA 5C4XK 5FLMC 1YNNA 2WAQL 2R92C 4BBRC 1R9TK 4A3DC 4A3IC 2NVQC 3S1RC 2NVTK 3PO3C 2PMZL 3S2DC 4A3IK 4A93K 2R7ZC 5IYDC 1TWAK 5IP9C 4Y7NK 2JA5C 4A3BC 5IYDK 2PPBA 1TWCK 2A69A 3HOWC 5C4JK 2O5JA 3H3VD 3HOWK 4YFNA 3M4OC 3M4OK 5M5YK 2E2JC 2NVYK 4A3MK 4OIPA 4Y52C 5M5WK 3HOXK 3H3VL 2NVYC 4JK1A 3EQLA 5IP7K 3S2HC 1WCMK 2A6EA 1I3QC 5FJ8K 5IYBK 5C44C 1WCMC 2A68A 3S15K 1I50K 3H0GK 5C3EC 2JA7C 3I4NK 4AYBL 3S17K 3S16C 1HQMA 3S17C 2WB1D 4MEYA 2NVTC 4ZH4A 3S1NC 4XLPA 2Y0SL 4NOIA 4A3EC 1SMYA 1TWHC 1ZYRA 2R92K 3HOUK 2NVQK 3S2DK 4A93C 4G7OA 4BBSK 3GTOK 4MEXA 3M3YK 3GTPK 5C4JC 3M3YC 4X6AC 4A3LK 2E2IK 4GZYA 3RZOK 5M5XK 1I6HC 4A3MC 2E2IC 3S15C 4MQ9A 2NVXK 3H0GC 4QJVB 3CQZC 4C3HK 4BY1C 3GTQK 4A3CC 1I50C 3CQZK 4BY1K 4A3JC 3RZDK 2YU9C 4A3CK 3FKIK 5C3EK 3I4NC 2CW0A 2WB1L 3HKZL 4OINA 2JA6K 4XSZA 1TWFK 1K83C 4AYBD 4BBRK 4YFKA 1R9TC 5IYCK 3PO2C 4A3DK 3DXJA 4A3EK 3HOUC 2R7ZK 2PA8L 4QIWL 5TMFA 1SFOK 3GTLK 3GTPC 2O5IA 2JA5K 4G7ZA 1SFOC 3GTLC 1TWCC 2B63K 4G7HA 2BE5A 3HOZK 4BXXC 4BXXK 4KN4A 4X6AK 1I6VA 2R93C 2R93K 3GTGK 3HOVK 2JA8K 4C3IK 5IP7C 3S2HK 4Q5SA 4XSXA 2YU9K 2PMZD 3GTQC 1YNJA 3HKZD 4LLGA 2JA6C 2WAQD 1IW7A 3GTKK 4BY7K 4OIOA 4LJZA 3FKIC 2Y0SD 5IYCC 5TMCA 2VUMK 3S1RK 4A3KK 3K7AK 2A6HA 4KMUA 2VUMC 2B63C 3PO2K 4A3GC 3K7AC 3S14C 1Y1WC 3S14K 4XLNA 4C3JK 5M3MK 3GTGC 2E2JK 4A3LC 1XPPA 3GTMK 3HOVC 5D4DA 2PA8D 4LK0A 4OIQA 3HOZC 1Y1VK 4QIWD 4Q4ZA 4A3JK 3I4MK 5FLMK 1Y1VC 3I4MC 3S16K 1TWGC 3GTKC 4A3FC 4A3KC 4C2MK 3S1NK 1K83K 1TWFC 1Y1WK 4YG2A 1TWHK 1TWAC 5IP9K 4A3BK 4A3GK 4QJVA 4OIRA
chains in the Genus database with same CATH superfamily
2NVYA 3S1MC 4Y7NC 3L4JA 4Y52K 4BBSC 3WODA 1YCLA 1I50A 2Y3PA 3BUEA 4YFXA 2E2HK 4KAWX 4BY7C 2WAQL 3NUHA 4BBRC 1R9TK 2FQTA 4A3IK 4WJ3M 5CJ9A 2JA5C 5IYDK 2PPBA 1TWHA 4WJ4A 1WORA 4GTAA 3TTGA 1ZXOA 1WQHA 2E2JC 4OIPA 2NVYC 1IQ0A 5FJ8K 5IYBK 5C44C 2W7VA 2E2IA 3JSTA 1EFWA 3S17C 2R7ZA 5E68A 2Y0SL 4G7OA 1L0WA 3GTOK 1DCOA 4MEXA 1EH1A 3M3YC 2EBBA 1I6HC 5M5XK 1B4BA 1HI9A 4QJVB 4DDQA 3GTQK 3GTGA 4A3CK 3I4NC 4OINA 1EK8A 4XSZA 4BBRK 1R9TC 4KARA 3DXJA 4P9SA 3HOUC 4QIWL 5JVOA 4KASA 3GTLC 4C3JC 4BXXK 4X6AK 3HOVK 5HL8A 4C3IK 1WQFA 3OREA 2GAGC 1SFOA 1IW7A 3GTKK 1Y1WA 5IYCC 1WSRA 5TMCA 3BP8C 1VLOA 1VJEA 4C45A 1USOA 1XZPB 3K7AC 2B63C 3S14C 1UV7A 4O2DA 4XLNA 3SZYA 2JA5A 1X31C 3BP3A 1WOPA 1WSVA 2PHCB 3HOVC 4C3IC 3HXAA 1F9NA 5D4DA 4LK0A 1INNA 1BS2A 5JFEA 4OIQA 1Y1VK 4QIWD 3GTKC 3S1NK 1IBAA 1XZQB 1VRQC 1PJ6A 4QJVA 4OIRA 3GSIA 2VUMA 4KN7A 1DCHA 3HOYK 3GDZA 1B4AA 2JA7K 5C44K 1TWGK 5IYBC 4LK1A 3LAPA 5C4XK 2R92C 3A8JA 3TFHA 4A3DC 1BJTA 3ADAC 1XXBA 4A3IC 2NVQC 4KDDA 3GTPA 5IYDC 5IP9C 3SZZA 1TWCK 3HOWC 1JQWA 1XXAA 3GTJA 3M4OC 2XCOA 5M5YK 2GSUA 2NVYK 3AD9C 3H3VL 4JK1A 5EGEA 5IP7K 3S2HC 1I3QC 3CQZA 1F93A 3FKIA 1I3QA 5CHPA 3L4KA 3H0GK 1KQ4A 5C3EC 2JA7C 1GE9A 1TWFA 3S17K 4KMDA 4MEYA 3S1NC 2R92K 2CFAB 3A8KA 2V6UA 3QX3A 2R93A 3GEHA 3T02A 2NVXK 3CQZC 4BY1C 3AH5A 3TFIA 4C3HC 3FOFA 2YU9C 5C3EK 2CW0A 1K83C 1PJ5A 5IYCK 1XXCA 2R7ZK 2PA8L 3GTLK 3GTPC 2O5IA 3AD8C 4G7HA 4KN4A 4BKWA 3CAGA 5IP7C 3S2HK 4GTLA 4LLGA 2WAQD 4LJZA 4G0VA 3K7AK 1EI6A 2A6HA 4KMUA 2VUMC 1JOEA 3GIRA 4KB2A 3MMLB 2E2JK 4A3LC 1XPPA 1YX2A 3FHZA 2PA8D 2RH6A 5FLMK 1AB4A 1Y1VC 2FQOA 1TWGC 4FM9A 4A3KC 1ZBSA 4M1XA 2E2HA 1O2AA 1RU0A 1Y1WK 1TWHK 4YG2A 1TWAC 2KWAA 4A3BK 3N0BA 4A3GK 3T01A 4XCHA 3GTMA 3GTOC 4GFQA 2V6TA 1R9TA 1O29A 5M3FK 1WCMA 1VGXA 3HOYC 1I6HK 2JA8C 3S1QC 1XZQA 1J6XA 3GTJK 4AH6A 1V5VA 3RZDC 5C4XC 1DD5A 1BDFA 5FLMC 4KM9A 2XCRB 4A93C 3S2DC 1J6VA 1TWAK 4A3BC 3FOEA 2A69A 5C4JK 3H3VD 3HOWK 3AQPA 3M4OK 2GSOA 3AQOA 3OEPA 5M5WK 4Y52C 4A3MK 4BBSK 3GTOA 1JVIA 2A6EA 1F7UA 2D6FC 1XZPA 1WCMC 2A68A 3S15K 1I50K 2JA6A 3I4NK 4AYBL 1HQMA 1TWGA 2NVTC 4XLPA 3HOUK 4NOIA 3GTQA 1TWHC 2GSNA 3S2DK 1WOOA 3GTPK 3V4GA 5C4JC 4FZBA 4GTBA 4LOWA 4PABA 4A3MC 2E2IC 1IL2A 4MQ9A 3H0GC 3LPXA 1O27A 2CFAA 2ZFZA 4C3HK 1I50C 3CQZK 4BY1K 3GEEA 3RZDK 3S0XA 2WB1L 3H0GA 1TWFK 4YFKA 3PO2C 2ZUFA 1F7VA 1SFOK 3GTKA 2JA5K 3HOZK 2BE5A 1I6VA 4KB4A 4LQYA 2R93K 5IOTA 3GTGK 1O24A 1USMA 1J6WA 1VH2A 4Q5SA 2YU9K 2PMZD 2V6SA 3GTQC 2JA6C 3HKZD 1K83A 4OIOA 2Y0SD 2B63A 4BLBA 1EQRA 4KC6A 1WOSA 4LR2A 3S1RK 4A3KK 2VUMK 3PO2K 1Y1WC 4C3JK 1WIHA 5IOSA 4P5BA 5IOQA 3LAJA 3I4MK 3S16K 3OPFA 1J98A 1TWFC 2JA7A 2XCQA 1TWCA 5IP9K 1O2FB 4G0WA 4PAAA 1G51A 3S1MK 3GTMC 3ERED 4ILDA 3HOXC 1TWAA 3RZOC 1I3QK 2NVXC 3S1QK 1O25A 3TFJA 3VA7A 3GTJC 2E2HC 4A3FK 4BLAA 2R92A 1YNNA 1C0AA 1Y1VA 3S1RC 2NVTK 3PO3C 1PJ7A 2PMZL 4A93K 2R7ZC 4Y7NK 2O5JA 4YFNA 3N3YA 3Q3QA 3HOXK 4GTEA 3EQLA 4WILA 1WCMK 3N0CA 2GAHC 1WQGA 2RGRA 4GT9A 3S16C 2P8TA 2WB1D 2P5MA 4ZH4A 4A3EC 1DCPA 1SMYA 1ZYRA 2NVQK 4GTDA 3A8IA 3M3YK 3G4CA 2JH3A 4J3NA 4X6AC 4A3LK 2E2IK 5L46A 4KATA 3RZOK 4GZYA 3S15C 4G0UA 4A3CC 4P5AA 4A3JC 3FKIK 2ZUEA 3HKZL 3GEIA 2JA6K 2YU9A 4AYBD 4A3DK 4A3EK 5EGHA 3HOZC 5TMFA 4GTFA 4G7ZA 1SFOC 4BXXC 1TWCC 2B63K 3AD7C 3IPJA 2R93C 1ZQ1C 2JA8K 1IS1A 4XSXA 2NVXA 1BGWA 3T00A 1O26A 4GTCA 1YNJA 4RMFA 4BY7K 3GTLA 1ZVUA 3FKIC 4C2MC 3G4AA 5TJ3A 4A3GC 1O2BA 4KMHA 3S14K 5M3MK 3GTGC 1ISEA 5IORA 1O28A 4KMAA 3GTMK 1IE0A 4Q4ZA 4A3JK 3I4MC 4A3FC 4C2MK 1K83K 4KM8A 3PO3K
chains in the Genus database with same CATH topology
3GTOC 3S1MC 4Y7NC 3S1MK 3GTMC 4KN7A 5M3FK 3HOYK 3HOXC 4Y52K 4BBSC 3HOYC 3RZOC 2JA8C 3WODA 3S1QC 1I3QK 1I6HK 2NVXC 3S1QK 3GTJK 4YFXA 3GTJC 2E2HK 2JA7K 5C44K 1TWGK 5IYBC 3PO3K 4LK1A 4A3FK 3RZDC 2E2HC 4BY7C 5C4XC 1BDFA 5C4XK 5FLMC 1YNNA 2WAQL 2R92C 4BBRC 1R9TK 4A3DC 4A3IC 2NVQC 3S1RC 2NVTK 3PO3C 2PMZL 3S2DC 4A3IK 4A93K 2R7ZC 5IYDC 1TWAK 5IP9C 4Y7NK 2JA5C 4A3BC 5IYDK 2PPBA 1TWCK 2A69A 3HOWC 5C4JK 2O5JA 3H3VD 3HOWK 4YFNA 3M4OC 3M4OK 5M5YK 2E2JC 2NVYK 4A3MK 4OIPA 4Y52C 5M5WK 3HOXK 3H3VL 2NVYC 4JK1A 3EQLA 5IP7K 3S2HC 1WCMK 2A6EA 1I3QC 5FJ8K 5IYBK 5C44C 1WCMC 2A68A 3S15K 1I50K 3H0GK 5C3EC 2JA7C 3I4NK 4AYBL 3S17K 3S16C 1HQMA 3S17C 2WB1D 4MEYA 2NVTC 4ZH4A 3S1NC 4XLPA 2Y0SL 4NOIA 4A3EC 1SMYA 1TWHC 1ZYRA 2R92K 3HOUK 2NVQK 3S2DK 4A93C 4G7OA 4BBSK 3GTOK 4MEXA 3M3YK 3GTPK 5C4JC 3M3YC 4X6AC 4A3LK 2E2IK 4GZYA 3RZOK 5M5XK 1I6HC 4A3MC 2E2IC 3S15C 4MQ9A 2NVXK 3H0GC 4QJVB 3CQZC 4C3HK 4BY1C 3GTQK 4A3CC 1I50C 3CQZK 4BY1K 4A3JC 3RZDK 2YU9C 4A3CK 3FKIK 5C3EK 3I4NC 2CW0A 2WB1L 3HKZL 4OINA 2JA6K 4XSZA 1TWFK 1K83C 4AYBD 4BBRK 4YFKA 1R9TC 5IYCK 3PO2C 4A3DK 3DXJA 4A3EK 3HOUC 2R7ZK 2PA8L 4QIWL 5TMFA 1SFOK 3GTLK 3GTPC 2O5IA 2JA5K 4G7ZA 1SFOC 3GTLC 1TWCC 2B63K 4G7HA 2BE5A 3HOZK 4BXXC 4BXXK 4KN4A 4X6AK 1I6VA 2R93C 2R93K 3GTGK 3HOVK 2JA8K 4C3IK 5IP7C 3S2HK 4Q5SA 4XSXA 2YU9K 2PMZD 3GTQC 1YNJA 3HKZD 4LLGA 2JA6C 2WAQD 1IW7A 3GTKK 4BY7K 4OIOA 4LJZA 3FKIC 2Y0SD 5IYCC 5TMCA 2VUMK 3S1RK 4A3KK 3K7AK 2A6HA 4KMUA 2VUMC 2B63C 3PO2K 4A3GC 3K7AC 3S14C 1Y1WC 3S14K 4XLNA 4C3JK 5M3MK 3GTGC 2E2JK 4A3LC 1XPPA 3GTMK 3HOVC 5D4DA 2PA8D 4LK0A 4OIQA 3HOZC 1Y1VK 4QIWD 4Q4ZA 4A3JK 3I4MK 5FLMK 1Y1VC 3I4MC 3S16K 1TWGC 3GTKC 4A3FC 4A3KC 4C2MK 3S1NK 1K83K 1TWFC 1Y1WK 4YG2A 1TWHK 1TWAC 5IP9K 4A3BK 4A3GK 4QJVA 4OIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO C;  3S1M C;  4Y7N C;  3S1M K;  3GTM C;  4KN7 A;  5M3F K;  3HOY K;  3HOX C;  4Y52 K;  4BBS C;  3HOY C;  3RZO C;  2JA8 C;  3WOD A;  3S1Q C;  1I3Q K;  1I6H K;  2NVX C;  3S1Q K;  3GTJ K;  4YFX A;  3GTJ C;  2E2H K;  2JA7 K;  5C44 K;  1TWG K;  5IYB C;  3PO3 K;  4LK1 A;  4A3F K;  3RZD C;  2E2H C;  4BY7 C;  5C4X C;  1BDF A;  5C4X K;  5FLM C;  1YNN A;  2WAQ L;  2R92 C;  4BBR C;  1R9T K;  4A3D C;  4A3I C;  2NVQ C;  3S1R C;  2NVT K;  3PO3 C;  2PMZ L;  3S2D C;  4A3I K;  4A93 K;  2R7Z C;  5IYD C;  1TWA K;  5IP9 C;  4Y7N K;  2JA5 C;  4A3B C;  5IYD K;  2PPB A;  1TWC K;  2A69 A;  3HOW C;  5C4J K;  2O5J A;  3H3V D;  3HOW K;  4YFN A;  3M4O C;  3M4O K;  5M5Y K;  2E2J C;  2NVY K;  4A3M K;  4OIP A;  4Y52 C;  5M5W K;  3HOX K;  3H3V L;  2NVY C;  4JK1 A;  3EQL A;  5IP7 K;  3S2H C;  1WCM K;  2A6E A;  1I3Q C;  5FJ8 K;  5IYB K;  5C44 C;  1WCM C;  2A68 A;  3S15 K;  1I50 K;  3H0G K;  5C3E C;  2JA7 C;  3I4N K;  4AYB L;  3S17 K;  3S16 C;  1HQM A;  3S17 C;  2WB1 D;  4MEY A;  2NVT C;  4ZH4 A;  3S1N C;  4XLP A;  2Y0S L;  4NOI A;  4A3E C;  1SMY A;  1TWH C;  1ZYR A;  2R92 K;  3HOU K;  2NVQ K;  3S2D K;  4A93 C;  4G7O A;  4BBS K;  3GTO K;  4MEX A;  3M3Y K;  3GTP K;  5C4J C;  3M3Y C;  4X6A C;  4A3L K;  2E2I K;  4GZY A;  3RZO K;  5M5X K;  1I6H C;  4A3M C;  2E2I C;  3S15 C;  4MQ9 A;  2NVX K;  3H0G C;  4QJV B;  3CQZ C;  4C3H K;  4BY1 C;  3GTQ K;  4A3C C;  1I50 C;  3CQZ K;  4BY1 K;  4A3J C;  3RZD K;  2YU9 C;  4A3C K;  3FKI K;  5C3E K;  3I4N C;  2CW0 A;  2WB1 L;  3HKZ L;  4OIN A;  2JA6 K;  4XSZ A;  1TWF K;  1K83 C;  4AYB D;  4BBR K;  4YFK A;  1R9T C;  5IYC K;  3PO2 C;  4A3D K;  3DXJ A;  4A3E K;  3HOU C;  2R7Z K;  2PA8 L;  4QIW L;  5TMF A;  1SFO K;  3GTL K;  3GTP C;  2O5I A;  2JA5 K;  4G7Z A;  1SFO C;  3GTL C;  1TWC C;  2B63 K;  4G7H A;  2BE5 A;  3HOZ K;  4BXX C;  4BXX K;  4KN4 A;  4X6A K;  1I6V A;  2R93 C;  2R93 K;  3GTG K;  3HOV K;  2JA8 K;  4C3I K;  5IP7 C;  3S2H K;  4Q5S A;  4XSX A;  2YU9 K;  2PMZ D;  3GTQ C;  1YNJ A;  3HKZ D;  4LLG A;  2JA6 C;  2WAQ D;  1IW7 A;  3GTK K;  4BY7 K;  4OIO A;  4LJZ A;  3FKI C;  2Y0S D;  5IYC C;  5TMC A;  2VUM K;  3S1R K;  4A3K K;  3K7A K;  2A6H A;  4KMU A;  2VUM C;  2B63 C;  3PO2 K;  4A3G C;  3K7A C;  3S14 C;  1Y1W C;  3S14 K;  4XLN A;  4C3J K;  5M3M K;  3GTG C;  2E2J K;  4A3L C;  1XPP A;  3GTM K;  3HOV C;  5D4D A;  2PA8 D;  4LK0 A;  4OIQ A;  3HOZ C;  1Y1V K;  4QIW D;  4Q4Z A;  4A3J K;  3I4M K;  5FLM K;  1Y1V C;  3I4M C;  3S16 K;  1TWG C;  3GTK C;  4A3F C;  4A3K C;  4C2M K;  3S1N K;  1K83 K;  1TWF C;  1Y1W K;  4YG2 A;  1TWH K;  1TWA C;  5IP9 K;  4A3B K;  4A3G K;  4QJV A;  4OIR A; 
#chains in the Genus database with same CATH topology
 2NVY A;  3S1M C;  4Y7N C;  3L4J A;  4Y52 K;  4BBS C;  3WOD A;  1YCL A;  1I50 A;  2Y3P A;  3BUE A;  4YFX A;  2E2H K;  4KAW X;  4BY7 C;  2WAQ L;  3NUH A;  4BBR C;  1R9T K;  2FQT A;  4A3I K;  4WJ3 M;  5CJ9 A;  2JA5 C;  5IYD K;  2PPB A;  1TWH A;  4WJ4 A;  1WOR A;  4GTA A;  3TTG A;  1ZXO A;  1WQH A;  2E2J C;  4OIP A;  2NVY C;  1IQ0 A;  5FJ8 K;  5IYB K;  5C44 C;  2W7V A;  2E2I A;  3JST A;  1EFW A;  3S17 C;  2R7Z A;  5E68 A;  2Y0S L;  4G7O A;  1L0W A;  3GTO K;  1DCO A;  4MEX A;  1EH1 A;  3M3Y C;  2EBB A;  1I6H C;  5M5X K;  1B4B A;  1HI9 A;  4QJV B;  4DDQ A;  3GTQ K;  3GTG A;  4A3C K;  3I4N C;  4OIN A;  1EK8 A;  4XSZ A;  4BBR K;  1R9T C;  4KAR A;  3DXJ A;  4P9S A;  3HOU C;  4QIW L;  5JVO A;  4KAS A;  3GTL C;  4C3J C;  4BXX K;  4X6A K;  3HOV K;  5HL8 A;  4C3I K;  1WQF A;  3ORE A;  2GAG C;  1SFO A;  1IW7 A;  3GTK K;  1Y1W A;  5IYC C;  1WSR A;  5TMC A;  3BP8 C;  1VLO A;  1VJE A;  4C45 A;  1USO A;  1XZP B;  3K7A C;  2B63 C;  3S14 C;  1UV7 A;  4O2D A;  4XLN A;  3SZY A;  2JA5 A;  1X31 C;  3BP3 A;  1WOP A;  1WSV A;  2PHC B;  3HOV C;  4C3I C;  3HXA A;  1F9N A;  5D4D A;  4LK0 A;  1INN A;  1BS2 A;  5JFE A;  4OIQ A;  1Y1V K;  4QIW D;  3GTK C;  3S1N K;  1IBA A;  1XZQ B;  1VRQ C;  1PJ6 A;  4QJV A;  4OIR A;  3GSI A;  2VUM A;  4KN7 A;  1DCH A;  3HOY K;  3GDZ A;  1B4A A;  2JA7 K;  5C44 K;  1TWG K;  5IYB C;  4LK1 A;  3LAP A;  5C4X K;  2R92 C;  3A8J A;  3TFH A;  4A3D C;  1BJT A;  3ADA C;  1XXB A;  4A3I C;  2NVQ C;  4KDD A;  3GTP A;  5IYD C;  5IP9 C;  3SZZ A;  1TWC K;  3HOW C;  1JQW A;  1XXA A;  3GTJ A;  3M4O C;  2XCO A;  5M5Y K;  2GSU A;  2NVY K;  3AD9 C;  3H3V L;  4JK1 A;  5EGE A;  5IP7 K;  3S2H C;  1I3Q C;  3CQZ A;  1F93 A;  3FKI A;  1I3Q A;  5CHP A;  3L4K A;  3H0G K;  1KQ4 A;  5C3E C;  2JA7 C;  1GE9 A;  1TWF A;  3S17 K;  4KMD A;  4MEY A;  3S1N C;  2R92 K;  2CFA B;  3A8K A;  2V6U A;  3QX3 A;  2R93 A;  3GEH A;  3T02 A;  2NVX K;  3CQZ C;  4BY1 C;  3AH5 A;  3TFI A;  4C3H C;  3FOF A;  2YU9 C;  5C3E K;  2CW0 A;  1K83 C;  1PJ5 A;  5IYC K;  1XXC A;  2R7Z K;  2PA8 L;  3GTL K;  3GTP C;  2O5I A;  3AD8 C;  4G7H A;  4KN4 A;  4BKW A;  3CAG A;  5IP7 C;  3S2H K;  4GTL A;  4LLG A;  2WAQ D;  4LJZ A;  4G0V A;  3K7A K;  1EI6 A;  2A6H A;  4KMU A;  2VUM C;  1JOE A;  3GIR A;  4KB2 A;  3MML B;  2E2J K;  4A3L C;  1XPP A;  1YX2 A;  3FHZ A;  2PA8 D;  2RH6 A;  5FLM K;  1AB4 A;  1Y1V C;  2FQO A;  1TWG C;  4FM9 A;  4A3K C;  1ZBS A;  4M1X A;  2E2H A;  1O2A A;  1RU0 A;  1Y1W K;  1TWH K;  4YG2 A;  1TWA C;  2KWA A;  4A3B K;  3N0B A;  4A3G K;  3T01 A;  4XCH A;  3GTM A;  3GTO C;  4GFQ A;  2V6T A;  1R9T A;  1O29 A;  5M3F K;  1WCM A;  1VGX A;  3HOY C;  1I6H K;  2JA8 C;  3S1Q C;  1XZQ A;  1J6X A;  3GTJ K;  4AH6 A;  1V5V A;  3RZD C;  5C4X C;  1DD5 A;  1BDF A;  5FLM C;  4KM9 A;  2XCR B;  4A93 C;  3S2D C;  1J6V A;  1TWA K;  4A3B C;  3FOE A;  2A69 A;  5C4J K;  3H3V D;  3HOW K;  3AQP A;  3M4O K;  2GSO A;  3AQO A;  3OEP A;  5M5W K;  4Y52 C;  4A3M K;  4BBS K;  3GTO A;  1JVI A;  2A6E A;  1F7U A;  2D6F C;  1XZP A;  1WCM C;  2A68 A;  3S15 K;  1I50 K;  2JA6 A;  3I4N K;  4AYB L;  1HQM A;  1TWG A;  2NVT C;  4XLP A;  3HOU K;  4NOI A;  3GTQ A;  1TWH C;  2GSN A;  3S2D K;  1WOO A;  3GTP K;  3V4G A;  5C4J C;  4FZB A;  4GTB A;  4LOW A;  4PAB A;  4A3M C;  2E2I C;  1IL2 A;  4MQ9 A;  3H0G C;  3LPX A;  1O27 A;  2CFA A;  2ZFZ A;  4C3H K;  1I50 C;  3CQZ K;  4BY1 K;  3GEE A;  3RZD K;  3S0X A;  2WB1 L;  3H0G A;  1TWF K;  4YFK A;  3PO2 C;  2ZUF A;  1F7V A;  1SFO K;  3GTK A;  2JA5 K;  3HOZ K;  2BE5 A;  1I6V A;  4KB4 A;  4LQY A;  2R93 K;  5IOT A;  3GTG K;  1O24 A;  1USM A;  1J6W A;  1VH2 A;  4Q5S A;  2YU9 K;  2PMZ D;  2V6S A;  3GTQ C;  2JA6 C;  3HKZ D;  1K83 A;  4OIO A;  2Y0S D;  2B63 A;  4BLB A;  1EQR A;  4KC6 A;  1WOS A;  4LR2 A;  3S1R K;  4A3K K;  2VUM K;  3PO2 K;  1Y1W C;  4C3J K;  1WIH A;  5IOS A;  4P5B A;  5IOQ A;  3LAJ A;  3I4M K;  3S16 K;  3OPF A;  1J98 A;  1TWF C;  2JA7 A;  2XCQ A;  1TWC A;  5IP9 K;  1O2F B;  4G0W A;  4PAA A;  1G51 A;  3S1M K;  3GTM C;  3ERE D;  4ILD A;  3HOX C;  1TWA A;  3RZO C;  1I3Q K;  2NVX C;  3S1Q K;  1O25 A;  3TFJ A;  3VA7 A;  3GTJ C;  2E2H C;  4A3F K;  4BLA A;  2R92 A;  1YNN A;  1C0A A;  1Y1V A;  3S1R C;  2NVT K;  3PO3 C;  1PJ7 A;  2PMZ L;  4A93 K;  2R7Z C;  4Y7N K;  2O5J A;  4YFN A;  3N3Y A;  3Q3Q A;  3HOX K;  4GTE A;  3EQL A;  4WIL A;  1WCM K;  3N0C A;  2GAH C;  1WQG A;  2RGR A;  4GT9 A;  3S16 C;  2P8T A;  2WB1 D;  2P5M A;  4ZH4 A;  4A3E C;  1DCP A;  1SMY A;  1ZYR A;  2NVQ K;  4GTD A;  3A8I A;  3M3Y K;  3G4C A;  2JH3 A;  4J3N A;  4X6A C;  4A3L K;  2E2I K;  5L46 A;  4KAT A;  3RZO K;  4GZY A;  3S15 C;  4G0U A;  4A3C C;  4P5A A;  4A3J C;  3FKI K;  2ZUE A;  3HKZ L;  3GEI A;  2JA6 K;  2YU9 A;  4AYB D;  4A3D K;  4A3E K;  5EGH A;  3HOZ C;  5TMF A;  4GTF A;  4G7Z A;  1SFO C;  4BXX C;  1TWC C;  2B63 K;  3AD7 C;  3IPJ A;  2R93 C;  1ZQ1 C;  2JA8 K;  1IS1 A;  4XSX A;  2NVX A;  1BGW A;  3T00 A;  1O26 A;  4GTC A;  1YNJ A;  4RMF A;  4BY7 K;  3GTL A;  1ZVU A;  3FKI C;  4C2M C;  3G4A A;  5TJ3 A;  4A3G C;  1O2B A;  4KMH A;  3S14 K;  5M3M K;  3GTG C;  1ISE A;  5IOR A;  1O28 A;  4KMA A;  3GTM K;  1IE0 A;  4Q4Z A;  4A3J K;  3I4M C;  4A3F C;  4C2M K;  1K83 K;  4KM8 A;  3PO3 K; 
#chains in the Genus database with same CATH homology
 3GTO C;  3S1M C;  4Y7N C;  3S1M K;  3GTM C;  4KN7 A;  5M3F K;  3HOY K;  3HOX C;  4Y52 K;  4BBS C;  3HOY C;  3RZO C;  2JA8 C;  3WOD A;  3S1Q C;  1I3Q K;  1I6H K;  2NVX C;  3S1Q K;  3GTJ K;  4YFX A;  3GTJ C;  2E2H K;  2JA7 K;  5C44 K;  1TWG K;  5IYB C;  3PO3 K;  4LK1 A;  4A3F K;  3RZD C;  2E2H C;  4BY7 C;  5C4X C;  1BDF A;  5C4X K;  5FLM C;  1YNN A;  2WAQ L;  2R92 C;  4BBR C;  1R9T K;  4A3D C;  4A3I C;  2NVQ C;  3S1R C;  2NVT K;  3PO3 C;  2PMZ L;  3S2D C;  4A3I K;  4A93 K;  2R7Z C;  5IYD C;  1TWA K;  5IP9 C;  4Y7N K;  2JA5 C;  4A3B C;  5IYD K;  2PPB A;  1TWC K;  2A69 A;  3HOW C;  5C4J K;  2O5J A;  3H3V D;  3HOW K;  4YFN A;  3M4O C;  3M4O K;  5M5Y K;  2E2J C;  2NVY K;  4A3M K;  4OIP A;  4Y52 C;  5M5W K;  3HOX K;  3H3V L;  2NVY C;  4JK1 A;  3EQL A;  5IP7 K;  3S2H C;  1WCM K;  2A6E A;  1I3Q C;  5FJ8 K;  5IYB K;  5C44 C;  1WCM C;  2A68 A;  3S15 K;  1I50 K;  3H0G K;  5C3E C;  2JA7 C;  3I4N K;  4AYB L;  3S17 K;  3S16 C;  1HQM A;  3S17 C;  2WB1 D;  4MEY A;  2NVT C;  4ZH4 A;  3S1N C;  4XLP A;  2Y0S L;  4NOI A;  4A3E C;  1SMY A;  1TWH C;  1ZYR A;  2R92 K;  3HOU K;  2NVQ K;  3S2D K;  4A93 C;  4G7O A;  4BBS K;  3GTO K;  4MEX A;  3M3Y K;  3GTP K;  5C4J C;  3M3Y C;  4X6A C;  4A3L K;  2E2I K;  4GZY A;  3RZO K;  5M5X K;  1I6H C;  4A3M C;  2E2I C;  3S15 C;  4MQ9 A;  2NVX K;  3H0G C;  4QJV B;  3CQZ C;  4C3H K;  4BY1 C;  3GTQ K;  4A3C C;  1I50 C;  3CQZ K;  4BY1 K;  4A3J C;  3RZD K;  2YU9 C;  4A3C K;  3FKI K;  5C3E K;  3I4N C;  2CW0 A;  2WB1 L;  3HKZ L;  4OIN A;  2JA6 K;  4XSZ A;  1TWF K;  1K83 C;  4AYB D;  4BBR K;  4YFK A;  1R9T C;  5IYC K;  3PO2 C;  4A3D K;  3DXJ A;  4A3E K;  3HOU C;  2R7Z K;  2PA8 L;  4QIW L;  5TMF A;  1SFO K;  3GTL K;  3GTP C;  2O5I A;  2JA5 K;  4G7Z A;  1SFO C;  3GTL C;  1TWC C;  2B63 K;  4G7H A;  2BE5 A;  3HOZ K;  4BXX C;  4BXX K;  4KN4 A;  4X6A K;  1I6V A;  2R93 C;  2R93 K;  3GTG K;  3HOV K;  2JA8 K;  4C3I K;  5IP7 C;  3S2H K;  4Q5S A;  4XSX A;  2YU9 K;  2PMZ D;  3GTQ C;  1YNJ A;  3HKZ D;  4LLG A;  2JA6 C;  2WAQ D;  1IW7 A;  3GTK K;  4BY7 K;  4OIO A;  4LJZ A;  3FKI C;  2Y0S D;  5IYC C;  5TMC A;  2VUM K;  3S1R K;  4A3K K;  3K7A K;  2A6H A;  4KMU A;  2VUM C;  2B63 C;  3PO2 K;  4A3G C;  3K7A C;  3S14 C;  1Y1W C;  3S14 K;  4XLN A;  4C3J K;  5M3M K;  3GTG C;  2E2J K;  4A3L C;  1XPP A;  3GTM K;  3HOV C;  5D4D A;  2PA8 D;  4LK0 A;  4OIQ A;  3HOZ C;  1Y1V K;  4QIW D;  4Q4Z A;  4A3J K;  3I4M K;  5FLM K;  1Y1V C;  3I4M C;  3S16 K;  1TWG C;  3GTK C;  4A3F C;  4A3K C;  4C2M K;  3S1N K;  1K83 K;  1TWF C;  1Y1W K;  4YG2 A;  1TWH K;  1TWA C;  5IP9 K;  4A3B K;  4A3G K;  4QJV A;  4OIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...