1I50K

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i50K00
3HKZD 2JA5K 4A3FK 4OIQA 4YG2A 4A3LC 4X6AC 4BBRK 4KN7A 5IYBC 2R7ZK 4GZYA 3S16K 3HOXC 3S1MK 4C3JK 4A93K 2A69A 3GTQC 1K83C 3HOWC 1TWHC 2PA8L 4XSXA 4LK1A 4BBSC 3H0GC 2JA8K 4Y7NK 5FLMC 3GTGK 3I4MK 5C44C 3HOVC 3S1QK 3FKIC 3HKZL 4QIWD 4Q4ZA 2NVTC 2O5IA 3K7AK 5C3EK 2B63K 2JA7C 3CQZK 3GTMC 5IP7K 1TWFK 4BY1C 3S14C 3S2DC 5M5XK 2E2HC 1WCMC 1TWGK 5TMCA 1SFOK 3GTPC 3I4NK 3M4OC 2R92C 3RZDK 2WAQL 2JA6K 1I50K 4A3KK 5M5YK 3M3YC 4QIWL 4BY7C 4BXXK 3S15K 4A3JC 1Y1WC 3RZOK 4A3BC 5FJ8K 5IYDK 1TWAK 4XSZA 2PPBA 3GTLK 2NVYK 2Y0SL 3S2HK 3WODA 1I3QK 2BE5A 5IYBK 3HOUK 5IP9K 4QJVB 3S1RC 4G7OA 4G7HA 3GTQK 4A3GC 3HOWK 3EQLA 3PO2K 2E2JC 4KN4A 4BBSK 1SMYA 3H0GK 3S17C 5FLMK 3HOYC 5C44K 5C4JC 2E2IC 2NVQK 3PO3C 5M5WK 2JA7K 2O5JA 3GTMK 4A3DK 4BY1K 3GTKC 2PMZD 4MEXA 3S2DK 1R9TC 2VUMK 2NVXC 4BBRC 3GTOC 2R7ZC 3GTJK 1WCMK 3GTPK 4A93C 3M4OK 2WB1D 2YU9K 4A3EK 2R92K 4A3CC 2CW0A 4LJZA 4JK1A 4AYBD 1YNJA 1Y1VC 5IYCC 3M3YK 4BY7K 4LK0A 4A3MC 4Y7NC 4A3JK 4C3HK 4MEYA 5TMFA 5C4XK 1Y1WK 3I4MC 4A3BK 2PMZL 3S1NC 4OIOA 4A3LK 1TWCC 3K7AC 2B63C 4X6AK 3CQZC 3HOZC 2R93C 1TWFC 3HOXK 4LLGA 1K83K 4A3IC 1TWHK 4G7ZA 3S1RK 4AYBL 4A3GK 1SFOC 4ZH4A 4Y52C 1I6HC 3RZDC 2JA6C 3HOVK 2A6EA 3S17K 3FKIK 2NVTK 2A6HA 3HOYK 3S14K 1YNNA 5C4JK 3PO3K 2JA5C 4A3FC 1BDFA 3S2HC 3GTKK 2E2HK 1R9TK 1I3QC 3S16C 3S1MC 5M3FK 2NVXK 3GTOK 3HOUC 5IP9C 4YFKA 4NOIA 4OIRA 4OIPA 4A3CK 2JA8C 3H3VD 3GTGC 3PO2C 5IYCK 1Y1VK 1ZYRA 5D4DA 4KMUA 4OINA 3S1QC 4XLPA 4A3MK 2WAQD 5C3EC 4MQ9A 4C2MK 2NVQC 3S1NK 5IP7C 1I6VA 2A68A 3DXJA 1TWCK 4YFNA 2WB1L 3HOZK 4XLNA 4A3DC 2R93K 4QJVA 4A3IK 1TWGC 2VUMC 3I4NC 2Y0SD 3H3VL 2E2JK 4YFXA 1HQMA 1IW7A 1I50C 3GTJC 4A3KC 4Y52K 1I6HK 4Q5SA 2YU9C 1XPPA 4A3EC 2PA8D 4BXXC 3S15C 2E2IK 3RZOC 5M3MK 5IYDC 1TWAC 3GTLC 5C4XC 4C3IK 2NVYC
chains in the Genus database with same CATH superfamily
1O29A 4A3FK 4X6AC 3SZZA 1BS2A 3HOWC 4LK1A 4Y7NK 3GTGK 3K7AK 3SZYA 1WSVA 5C3EK 1ZQ1C 4BY1C 4LR2A 4BKWA 1TWCA 3I4NK 1KQ4A 2WAQL 3T02A 4FM9A 3M3YC 4BY7C 1Y1WC 3RZOK 1O2FB 1TWAK 2NVYK 3AQOA 5IYBK 1XXBA 1ZVUA 4QJVB 5IP9K 3EQLA 1I3QA 2E2JC 3S17C 3N0BA 5C4JC 3GEEA 5M5WK 2GAGC 1IQ0A 1IS1A 1L0WA 3GTMK 2PMZD 1WOOA 3GTPK 3LAJA 4A3EK 2CW0A 3BUEA 1USOA 4C45A 1YNJA 3G4AA 4A3MC 3GTJA 3I4MC 3AD7C 5TMFA 5C4XK 4KMAA 3T00A 3S1NC 2YU9A 4OIOA 4A3LK 2XCOA 2B63C 1UV7A 3CQZC 3HOZC 1TWFC 3HOXK 1F7VA 1K83K 4A3IC 1X31C 5TJ3A 3GTLA 4A3GK 4LOWA 4Y52C 2XCQA 3RZDC 3HOVK 1YNNA 2RGRA 2JA5C 4J3NA 2E2HK 4GFQA 1USMA 1YCLA 4KAWX 3S1MC 1WOPA 3T01A 5E68A 3HOUC 4YFKA 4A3CK 2JA8C 2P5MA 5IYCK 1XXCA 4XLPA 1PJ5A 4P5AA 2A68A 3A8KA 1TWCK 1Y1WA 4A3DC 4XLNA 4PABA 4A3KC 1VJEA 2PA8D 3S15C 3GSIA 1XZQA 1JOEA 3QX3A 4OIQA 4YG2A 1BGWA 4KN7A 2R7ZK 1J6XA 3S16K 4A93K 4C3JK 2A69A 4M1XA 1TWHC 2GSOA 2V6UA 3IPJA 4XSXA 4BBSC 1IL2A 5C44C 1VLOA 3FKIC 2NVTC 2JA7C 3S14C 3S2DC 2KWAA 2FQOA 1BJTA 1WCMC 1SFOK 3M4OC 2B63A 2R92C 1TWFA 1JVIA 2JA6K 2ZUFA 3HXAA 4A3JC 4A3BC 5FJ8K 3S2HK 4XSZA 2PPBA 3GTLK 4C2MC 3WODA 2FQTA 4KMDA 2JA5A 3HOWK 3PO2K 1G51A 5IOSA 3HOYC 3OPFA 3S0XA 2E2IC 1XZQB 3A8JA 1EFWA 4BY1K 3GTKC 4MEXA 2VUMK 3TFJA 2NVXC 3GTOC 1O27A 1B4BA 4KC6A 4AYBD 4JK1A 1WQHA 1Y1VC 3M3YK 2P8TA 4BY7K 4KASA 3GEIA 3V4GA 3ADAC 4Y7NC 1Y1WK 1IBAA 2PMZL 3K7AC 1WOSA 4KM8A 3AH5A 3ERED 4FZBA 2A6EA 3S17K 1TWHA 3VA7A 1GE9A 5C4JK 4C3IC 3FKIA 2JA7A 5M3FK 5IP9C 4OIRA 3OEPA 3MMLB 1VH2A 1WCMA 1JQWA 4BLAA 1WSRA 4OINA 2R92A 3S1QC 4A3MK 2WAQD 4MQ9A 3S1NK 5IP7C 2WB1L 3HOZK 4WJ3M 4A3IK 1TWGC 4GTLA 1I50C 5JVOA 4DDQA 4Y52K 4A3EC 4BXXC 1XZPA 5M3MK 1O25A 2XCRB 5IYDC 4GTDA 1INNA 2ZUEA 5C4XC 1EI6A 3HKZD 2JA5K 4A3LC 2E2IA 4BBRK 3HOXC 3S1MK 3GTQC 1K83C 3GTKA 1EH1A 2PA8L 2NVXA 3H0GC 3GTOA 2JA8K 5FLMC 1RU0A 2JH3A 3HOVC 4QIWD 1PJ6A 2O5IA 1Y1VA 5M5XK 1VGXA 1WQGA 3TFHA 3JSTA 2E2HC 3AD9C 4KB4A 5TMCA 4GTBA 4A3KK 1VRQC 5M5YK 3NUHA 5HL8A 3S15K 4GTEA 4C3HC 3GEHA 1WIHA 5JFEA 2Y0SL 1DCPA 4BLBA 1I3QK 2BE5A 1J6VA 3S1RC 4G7HA 3FOEA 4KN4A 4BBSK 1F93A 1SMYA 1XZPB 3AD8C 3N0CA 5C44K 4KM9A 2NVQK 3PO3C 3TTGA 2JA7K 2O5JA 3S2DK 3FOFA 1R9TC 3CQZA 4GTFA 2R7ZC 3GTJK 1WCMK 4GTCA 4A93C 4C3JC 1O24A 3M4OK 1F9NA 2R92K 2YU9K 4LJZA 1TWGA 4P5BA 2GSNA 4A3JK 1I50A 1EK8A 4A3BK 2GAHC 3G4CA 3BP8C 4X6AK 2R93C 4KARA 4LLGA 4AH6A 2EBBA 4LQYA 4AYBL 1SFOC 5IOTA 1I6HC 2JA6C 3GTQA 1B4AA 3LAPA 1K83A 2A6HA 3HOYK 4KATA 3H0GA 4PAAA 1O26A 4A3FC 1BDFA 3LPXA 3GTKK 3S2HC 2NVXK 1WQFA 3GTOK 4P9SA 1IE0A 1C0AA 4NOIA 4OIPA 2E2HA 3H3VD 3GTGC 3PO2C 1Y1VK 5EGHA 4KB2A 5C3EC 2RH6A 2V6TA 4YFNA 2Y3PA 2VUMC 3I4NC 1ISEA 4KMHA 2E2JK 1HQMA 1DCHA 4Q5SA 3RZOC 1PJ7A 1TWAC 4C3IK 2NVYC 1HI9A 3OREA 5EGEA 5IYBC 4GZYA 2CFAA 5IORA 1V5VA 1R9TA 4KDDA 2R7ZA 3I4MK 5IOQA 2PHCB 3FHZA 1O2AA 3L4JA 3HKZL 4G0VA 4Q4ZA 1F7UA 3S1QK 2B63K 3CQZK 3GTMC 5IP7K 1TWFK 2ZFZA 3GIRA 4G0WA 1TWGK 3GTPC 5L46A 2R93A 3RZDK 1I50K 1J98A 4XCHA 3AQPA 4QIWL 4BXXK 1SFOA 2GSUA 5IYDK 4WJ4A 2JA6A 1XXAA 4ILDA 3HOUK 3Q3QA 4G7OA 2V6SA 3GTQK 4A3GC 3BP3A 3H0GK 5FLMK 1O2BA 3L4KA 2W7VA 1WORA 3GTGA 4A3DK 4BBRC 2CFAB 1J6WA 5CJ9A 2WB1D 4A3CC 2VUMA 5IYCC 4LK0A 4C3HK 4MEYA 1ZXOA 1TWCC 1EQRA 1TWAA 1TWHK 2NVYA 4G7ZA 3S1RK 3A8IA 1YX2A 4G0UA 4GT9A 4ZH4A 2D6FC 4O2DA 3FKIK 2NVTK 3S14K 3N3YA 4RMFA 3PO3K 3CAGA 1DCOA 1R9TK 1I3QC 3S16C 3GTMA 1ZBSA 3GTPA 1ZYRA 5D4DA 4KMUA 3TFIA 4C2MK 2NVQC 4WILA 1I6VA 3DXJA 3GDZA 2R93K 4QJVA 4GTAA 2Y0SD 3H3VL 4YFXA 1IW7A 3GTJC 1I6HK 2YU9C 1XPPA 2E2IK 1O28A 1DD5A 1AB4A 3GTLC 5CHPA
chains in the Genus database with same CATH topology
3HKZD 2JA5K 4A3FK 4OIQA 4YG2A 4A3LC 4X6AC 4BBRK 4KN7A 5IYBC 2R7ZK 4GZYA 3S16K 3HOXC 3S1MK 4C3JK 4A93K 2A69A 3GTQC 1K83C 3HOWC 1TWHC 2PA8L 4XSXA 4LK1A 4BBSC 3H0GC 2JA8K 4Y7NK 5FLMC 3GTGK 3I4MK 5C44C 3HOVC 3S1QK 3FKIC 3HKZL 4QIWD 4Q4ZA 2NVTC 2O5IA 3K7AK 5C3EK 2B63K 2JA7C 3CQZK 3GTMC 5IP7K 1TWFK 4BY1C 3S14C 3S2DC 5M5XK 2E2HC 1WCMC 1TWGK 5TMCA 1SFOK 3GTPC 3I4NK 3M4OC 2R92C 3RZDK 2WAQL 2JA6K 1I50K 4A3KK 5M5YK 3M3YC 4QIWL 4BY7C 4BXXK 3S15K 4A3JC 1Y1WC 3RZOK 4A3BC 5FJ8K 5IYDK 1TWAK 4XSZA 2PPBA 3GTLK 2NVYK 2Y0SL 3S2HK 3WODA 1I3QK 2BE5A 5IYBK 3HOUK 5IP9K 4QJVB 3S1RC 4G7OA 4G7HA 3GTQK 4A3GC 3HOWK 3EQLA 3PO2K 2E2JC 4KN4A 4BBSK 1SMYA 3H0GK 3S17C 5FLMK 3HOYC 5C44K 5C4JC 2E2IC 2NVQK 3PO3C 5M5WK 2JA7K 2O5JA 3GTMK 4A3DK 4BY1K 3GTKC 2PMZD 4MEXA 3S2DK 1R9TC 2VUMK 2NVXC 4BBRC 3GTOC 2R7ZC 3GTJK 1WCMK 3GTPK 4A93C 3M4OK 2WB1D 2YU9K 4A3EK 2R92K 4A3CC 2CW0A 4LJZA 4JK1A 4AYBD 1YNJA 1Y1VC 5IYCC 3M3YK 4BY7K 4LK0A 4A3MC 4Y7NC 4A3JK 4C3HK 4MEYA 5TMFA 5C4XK 1Y1WK 3I4MC 4A3BK 2PMZL 3S1NC 4OIOA 4A3LK 1TWCC 3K7AC 2B63C 4X6AK 3CQZC 3HOZC 2R93C 1TWFC 3HOXK 4LLGA 1K83K 4A3IC 1TWHK 4G7ZA 3S1RK 4AYBL 4A3GK 1SFOC 4ZH4A 4Y52C 1I6HC 3RZDC 2JA6C 3HOVK 2A6EA 3S17K 3FKIK 2NVTK 2A6HA 3HOYK 3S14K 1YNNA 5C4JK 3PO3K 2JA5C 4A3FC 1BDFA 3S2HC 3GTKK 2E2HK 1R9TK 1I3QC 3S16C 3S1MC 5M3FK 2NVXK 3GTOK 3HOUC 5IP9C 4YFKA 4NOIA 4OIRA 4OIPA 4A3CK 2JA8C 3H3VD 3GTGC 3PO2C 5IYCK 1Y1VK 1ZYRA 5D4DA 4KMUA 4OINA 3S1QC 4XLPA 4A3MK 2WAQD 5C3EC 4MQ9A 4C2MK 2NVQC 3S1NK 5IP7C 1I6VA 2A68A 3DXJA 1TWCK 4YFNA 2WB1L 3HOZK 4XLNA 4A3DC 2R93K 4QJVA 4A3IK 1TWGC 2VUMC 3I4NC 2Y0SD 3H3VL 2E2JK 4YFXA 1HQMA 1IW7A 1I50C 3GTJC 4A3KC 4Y52K 1I6HK 4Q5SA 2YU9C 1XPPA 4A3EC 2PA8D 4BXXC 3S15C 2E2IK 3RZOC 5M3MK 5IYDC 1TWAC 3GTLC 5C4XC 4C3IK 2NVYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ D;  2JA5 K;  4A3F K;  4OIQ A;  4YG2 A;  4A3L C;  4X6A C;  4BBR K;  4KN7 A;  5IYB C;  2R7Z K;  4GZY A;  3S16 K;  3HOX C;  3S1M K;  4C3J K;  4A93 K;  2A69 A;  3GTQ C;  1K83 C;  3HOW C;  1TWH C;  2PA8 L;  4XSX A;  4LK1 A;  4BBS C;  3H0G C;  2JA8 K;  4Y7N K;  5FLM C;  3GTG K;  3I4M K;  5C44 C;  3HOV C;  3S1Q K;  3FKI C;  3HKZ L;  4QIW D;  4Q4Z A;  2NVT C;  2O5I A;  3K7A K;  5C3E K;  2B63 K;  2JA7 C;  3CQZ K;  3GTM C;  5IP7 K;  1TWF K;  4BY1 C;  3S14 C;  3S2D C;  5M5X K;  2E2H C;  1WCM C;  1TWG K;  5TMC A;  1SFO K;  3GTP C;  3I4N K;  3M4O C;  2R92 C;  3RZD K;  2WAQ L;  2JA6 K;  1I50 K;  4A3K K;  5M5Y K;  3M3Y C;  4QIW L;  4BY7 C;  4BXX K;  3S15 K;  4A3J C;  1Y1W C;  3RZO K;  4A3B C;  5FJ8 K;  5IYD K;  1TWA K;  4XSZ A;  2PPB A;  3GTL K;  2NVY K;  2Y0S L;  3S2H K;  3WOD A;  1I3Q K;  2BE5 A;  5IYB K;  3HOU K;  5IP9 K;  4QJV B;  3S1R C;  4G7O A;  4G7H A;  3GTQ K;  4A3G C;  3HOW K;  3EQL A;  3PO2 K;  2E2J C;  4KN4 A;  4BBS K;  1SMY A;  3H0G K;  3S17 C;  5FLM K;  3HOY C;  5C44 K;  5C4J C;  2E2I C;  2NVQ K;  3PO3 C;  5M5W K;  2JA7 K;  2O5J A;  3GTM K;  4A3D K;  4BY1 K;  3GTK C;  2PMZ D;  4MEX A;  3S2D K;  1R9T C;  2VUM K;  2NVX C;  4BBR C;  3GTO C;  2R7Z C;  3GTJ K;  1WCM K;  3GTP K;  4A93 C;  3M4O K;  2WB1 D;  2YU9 K;  4A3E K;  2R92 K;  4A3C C;  2CW0 A;  4LJZ A;  4JK1 A;  4AYB D;  1YNJ A;  1Y1V C;  5IYC C;  3M3Y K;  4BY7 K;  4LK0 A;  4A3M C;  4Y7N C;  4A3J K;  4C3H K;  4MEY A;  5TMF A;  5C4X K;  1Y1W K;  3I4M C;  4A3B K;  2PMZ L;  3S1N C;  4OIO A;  4A3L K;  1TWC C;  3K7A C;  2B63 C;  4X6A K;  3CQZ C;  3HOZ C;  2R93 C;  1TWF C;  3HOX K;  4LLG A;  1K83 K;  4A3I C;  1TWH K;  4G7Z A;  3S1R K;  4AYB L;  4A3G K;  1SFO C;  4ZH4 A;  4Y52 C;  1I6H C;  3RZD C;  2JA6 C;  3HOV K;  2A6E A;  3S17 K;  3FKI K;  2NVT K;  2A6H A;  3HOY K;  3S14 K;  1YNN A;  5C4J K;  3PO3 K;  2JA5 C;  4A3F C;  1BDF A;  3S2H C;  3GTK K;  2E2H K;  1R9T K;  1I3Q C;  3S16 C;  3S1M C;  5M3F K;  2NVX K;  3GTO K;  3HOU C;  5IP9 C;  4YFK A;  4NOI A;  4OIR A;  4OIP A;  4A3C K;  2JA8 C;  3H3V D;  3GTG C;  3PO2 C;  5IYC K;  1Y1V K;  1ZYR A;  5D4D A;  4KMU A;  4OIN A;  3S1Q C;  4XLP A;  4A3M K;  2WAQ D;  5C3E C;  4MQ9 A;  4C2M K;  2NVQ C;  3S1N K;  5IP7 C;  1I6V A;  2A68 A;  3DXJ A;  1TWC K;  4YFN A;  2WB1 L;  3HOZ K;  4XLN A;  4A3D C;  2R93 K;  4QJV A;  4A3I K;  1TWG C;  2VUM C;  3I4N C;  2Y0S D;  3H3V L;  2E2J K;  4YFX A;  1HQM A;  1IW7 A;  1I50 C;  3GTJ C;  4A3K C;  4Y52 K;  1I6H K;  4Q5S A;  2YU9 C;  1XPP A;  4A3E C;  2PA8 D;  4BXX C;  3S15 C;  2E2I K;  3RZO C;  5M3M K;  5IYD C;  1TWA C;  3GTL C;  5C4X C;  4C3I K;  2NVY C; 
#chains in the Genus database with same CATH topology
 1O29 A;  4A3F K;  4X6A C;  3SZZ A;  1BS2 A;  3HOW C;  4LK1 A;  4Y7N K;  3GTG K;  3K7A K;  3SZY A;  1WSV A;  5C3E K;  1ZQ1 C;  4BY1 C;  4LR2 A;  4BKW A;  1TWC A;  3I4N K;  1KQ4 A;  2WAQ L;  3T02 A;  4FM9 A;  3M3Y C;  4BY7 C;  1Y1W C;  3RZO K;  1O2F B;  1TWA K;  2NVY K;  3AQO A;  5IYB K;  1XXB A;  1ZVU A;  4QJV B;  5IP9 K;  3EQL A;  1I3Q A;  2E2J C;  3S17 C;  3N0B A;  5C4J C;  3GEE A;  5M5W K;  2GAG C;  1IQ0 A;  1IS1 A;  1L0W A;  3GTM K;  2PMZ D;  1WOO A;  3GTP K;  3LAJ A;  4A3E K;  2CW0 A;  3BUE A;  1USO A;  4C45 A;  1YNJ A;  3G4A A;  4A3M C;  3GTJ A;  3I4M C;  3AD7 C;  5TMF A;  5C4X K;  4KMA A;  3T00 A;  3S1N C;  2YU9 A;  4OIO A;  4A3L K;  2XCO A;  2B63 C;  1UV7 A;  3CQZ C;  3HOZ C;  1TWF C;  3HOX K;  1F7V A;  1K83 K;  4A3I C;  1X31 C;  5TJ3 A;  3GTL A;  4A3G K;  4LOW A;  4Y52 C;  2XCQ A;  3RZD C;  3HOV K;  1YNN A;  2RGR A;  2JA5 C;  4J3N A;  2E2H K;  4GFQ A;  1USM A;  1YCL A;  4KAW X;  3S1M C;  1WOP A;  3T01 A;  5E68 A;  3HOU C;  4YFK A;  4A3C K;  2JA8 C;  2P5M A;  5IYC K;  1XXC A;  4XLP A;  1PJ5 A;  4P5A A;  2A68 A;  3A8K A;  1TWC K;  1Y1W A;  4A3D C;  4XLN A;  4PAB A;  4A3K C;  1VJE A;  2PA8 D;  3S15 C;  3GSI A;  1XZQ A;  1JOE A;  3QX3 A;  4OIQ A;  4YG2 A;  1BGW A;  4KN7 A;  2R7Z K;  1J6X A;  3S16 K;  4A93 K;  4C3J K;  2A69 A;  4M1X A;  1TWH C;  2GSO A;  2V6U A;  3IPJ A;  4XSX A;  4BBS C;  1IL2 A;  5C44 C;  1VLO A;  3FKI C;  2NVT C;  2JA7 C;  3S14 C;  3S2D C;  2KWA A;  2FQO A;  1BJT A;  1WCM C;  1SFO K;  3M4O C;  2B63 A;  2R92 C;  1TWF A;  1JVI A;  2JA6 K;  2ZUF A;  3HXA A;  4A3J C;  4A3B C;  5FJ8 K;  3S2H K;  4XSZ A;  2PPB A;  3GTL K;  4C2M C;  3WOD A;  2FQT A;  4KMD A;  2JA5 A;  3HOW K;  3PO2 K;  1G51 A;  5IOS A;  3HOY C;  3OPF A;  3S0X A;  2E2I C;  1XZQ B;  3A8J A;  1EFW A;  4BY1 K;  3GTK C;  4MEX A;  2VUM K;  3TFJ A;  2NVX C;  3GTO C;  1O27 A;  1B4B A;  4KC6 A;  4AYB D;  4JK1 A;  1WQH A;  1Y1V C;  3M3Y K;  2P8T A;  4BY7 K;  4KAS A;  3GEI A;  3V4G A;  3ADA C;  4Y7N C;  1Y1W K;  1IBA A;  2PMZ L;  3K7A C;  1WOS A;  4KM8 A;  3AH5 A;  3ERE D;  4FZB A;  2A6E A;  3S17 K;  1TWH A;  3VA7 A;  1GE9 A;  5C4J K;  4C3I C;  3FKI A;  2JA7 A;  5M3F K;  5IP9 C;  4OIR A;  3OEP A;  3MML B;  1VH2 A;  1WCM A;  1JQW A;  4BLA A;  1WSR A;  4OIN A;  2R92 A;  3S1Q C;  4A3M K;  2WAQ D;  4MQ9 A;  3S1N K;  5IP7 C;  2WB1 L;  3HOZ K;  4WJ3 M;  4A3I K;  1TWG C;  4GTL A;  1I50 C;  5JVO A;  4DDQ A;  4Y52 K;  4A3E C;  4BXX C;  1XZP A;  5M3M K;  1O25 A;  2XCR B;  5IYD C;  4GTD A;  1INN A;  2ZUE A;  5C4X C;  1EI6 A;  3HKZ D;  2JA5 K;  4A3L C;  2E2I A;  4BBR K;  3HOX C;  3S1M K;  3GTQ C;  1K83 C;  3GTK A;  1EH1 A;  2PA8 L;  2NVX A;  3H0G C;  3GTO A;  2JA8 K;  5FLM C;  1RU0 A;  2JH3 A;  3HOV C;  4QIW D;  1PJ6 A;  2O5I A;  1Y1V A;  5M5X K;  1VGX A;  1WQG A;  3TFH A;  3JST A;  2E2H C;  3AD9 C;  4KB4 A;  5TMC A;  4GTB A;  4A3K K;  1VRQ C;  5M5Y K;  3NUH A;  5HL8 A;  3S15 K;  4GTE A;  4C3H C;  3GEH A;  1WIH A;  5JFE A;  2Y0S L;  1DCP A;  4BLB A;  1I3Q K;  2BE5 A;  1J6V A;  3S1R C;  4G7H A;  3FOE A;  4KN4 A;  4BBS K;  1F93 A;  1SMY A;  1XZP B;  3AD8 C;  3N0C A;  5C44 K;  4KM9 A;  2NVQ K;  3PO3 C;  3TTG A;  2JA7 K;  2O5J A;  3S2D K;  3FOF A;  1R9T C;  3CQZ A;  4GTF A;  2R7Z C;  3GTJ K;  1WCM K;  4GTC A;  4A93 C;  4C3J C;  1O24 A;  3M4O K;  1F9N A;  2R92 K;  2YU9 K;  4LJZ A;  1TWG A;  4P5B A;  2GSN A;  4A3J K;  1I50 A;  1EK8 A;  4A3B K;  2GAH C;  3G4C A;  3BP8 C;  4X6A K;  2R93 C;  4KAR A;  4LLG A;  4AH6 A;  2EBB A;  4LQY A;  4AYB L;  1SFO C;  5IOT A;  1I6H C;  2JA6 C;  3GTQ A;  1B4A A;  3LAP A;  1K83 A;  2A6H A;  3HOY K;  4KAT A;  3H0G A;  4PAA A;  1O26 A;  4A3F C;  1BDF A;  3LPX A;  3GTK K;  3S2H C;  2NVX K;  1WQF A;  3GTO K;  4P9S A;  1IE0 A;  1C0A A;  4NOI A;  4OIP A;  2E2H A;  3H3V D;  3GTG C;  3PO2 C;  1Y1V K;  5EGH A;  4KB2 A;  5C3E C;  2RH6 A;  2V6T A;  4YFN A;  2Y3P A;  2VUM C;  3I4N C;  1ISE A;  4KMH A;  2E2J K;  1HQM A;  1DCH A;  4Q5S A;  3RZO C;  1PJ7 A;  1TWA C;  4C3I K;  2NVY C;  1HI9 A;  3ORE A;  5EGE A;  5IYB C;  4GZY A;  2CFA A;  5IOR A;  1V5V A;  1R9T A;  4KDD A;  2R7Z A;  3I4M K;  5IOQ A;  2PHC B;  3FHZ A;  1O2A A;  3L4J A;  3HKZ L;  4G0V A;  4Q4Z A;  1F7U A;  3S1Q K;  2B63 K;  3CQZ K;  3GTM C;  5IP7 K;  1TWF K;  2ZFZ A;  3GIR A;  4G0W A;  1TWG K;  3GTP C;  5L46 A;  2R93 A;  3RZD K;  1I50 K;  1J98 A;  4XCH A;  3AQP A;  4QIW L;  4BXX K;  1SFO A;  2GSU A;  5IYD K;  4WJ4 A;  2JA6 A;  1XXA A;  4ILD A;  3HOU K;  3Q3Q A;  4G7O A;  2V6S A;  3GTQ K;  4A3G C;  3BP3 A;  3H0G K;  5FLM K;  1O2B A;  3L4K A;  2W7V A;  1WOR A;  3GTG A;  4A3D K;  4BBR C;  2CFA B;  1J6W A;  5CJ9 A;  2WB1 D;  4A3C C;  2VUM A;  5IYC C;  4LK0 A;  4C3H K;  4MEY A;  1ZXO A;  1TWC C;  1EQR A;  1TWA A;  1TWH K;  2NVY A;  4G7Z A;  3S1R K;  3A8I A;  1YX2 A;  4G0U A;  4GT9 A;  4ZH4 A;  2D6F C;  4O2D A;  3FKI K;  2NVT K;  3S14 K;  3N3Y A;  4RMF A;  3PO3 K;  3CAG A;  1DCO A;  1R9T K;  1I3Q C;  3S16 C;  3GTM A;  1ZBS A;  3GTP A;  1ZYR A;  5D4D A;  4KMU A;  3TFI A;  4C2M K;  2NVQ C;  4WIL A;  1I6V A;  3DXJ A;  3GDZ A;  2R93 K;  4QJV A;  4GTA A;  2Y0S D;  3H3V L;  4YFX A;  1IW7 A;  3GTJ C;  1I6H K;  2YU9 C;  1XPP A;  2E2I K;  1O28 A;  1DD5 A;  1AB4 A;  3GTL C;  5CHP A; 
#chains in the Genus database with same CATH homology
 3HKZ D;  2JA5 K;  4A3F K;  4OIQ A;  4YG2 A;  4A3L C;  4X6A C;  4BBR K;  4KN7 A;  5IYB C;  2R7Z K;  4GZY A;  3S16 K;  3HOX C;  3S1M K;  4C3J K;  4A93 K;  2A69 A;  3GTQ C;  1K83 C;  3HOW C;  1TWH C;  2PA8 L;  4XSX A;  4LK1 A;  4BBS C;  3H0G C;  2JA8 K;  4Y7N K;  5FLM C;  3GTG K;  3I4M K;  5C44 C;  3HOV C;  3S1Q K;  3FKI C;  3HKZ L;  4QIW D;  4Q4Z A;  2NVT C;  2O5I A;  3K7A K;  5C3E K;  2B63 K;  2JA7 C;  3CQZ K;  3GTM C;  5IP7 K;  1TWF K;  4BY1 C;  3S14 C;  3S2D C;  5M5X K;  2E2H C;  1WCM C;  1TWG K;  5TMC A;  1SFO K;  3GTP C;  3I4N K;  3M4O C;  2R92 C;  3RZD K;  2WAQ L;  2JA6 K;  1I50 K;  4A3K K;  5M5Y K;  3M3Y C;  4QIW L;  4BY7 C;  4BXX K;  3S15 K;  4A3J C;  1Y1W C;  3RZO K;  4A3B C;  5FJ8 K;  5IYD K;  1TWA K;  4XSZ A;  2PPB A;  3GTL K;  2NVY K;  2Y0S L;  3S2H K;  3WOD A;  1I3Q K;  2BE5 A;  5IYB K;  3HOU K;  5IP9 K;  4QJV B;  3S1R C;  4G7O A;  4G7H A;  3GTQ K;  4A3G C;  3HOW K;  3EQL A;  3PO2 K;  2E2J C;  4KN4 A;  4BBS K;  1SMY A;  3H0G K;  3S17 C;  5FLM K;  3HOY C;  5C44 K;  5C4J C;  2E2I C;  2NVQ K;  3PO3 C;  5M5W K;  2JA7 K;  2O5J A;  3GTM K;  4A3D K;  4BY1 K;  3GTK C;  2PMZ D;  4MEX A;  3S2D K;  1R9T C;  2VUM K;  2NVX C;  4BBR C;  3GTO C;  2R7Z C;  3GTJ K;  1WCM K;  3GTP K;  4A93 C;  3M4O K;  2WB1 D;  2YU9 K;  4A3E K;  2R92 K;  4A3C C;  2CW0 A;  4LJZ A;  4JK1 A;  4AYB D;  1YNJ A;  1Y1V C;  5IYC C;  3M3Y K;  4BY7 K;  4LK0 A;  4A3M C;  4Y7N C;  4A3J K;  4C3H K;  4MEY A;  5TMF A;  5C4X K;  1Y1W K;  3I4M C;  4A3B K;  2PMZ L;  3S1N C;  4OIO A;  4A3L K;  1TWC C;  3K7A C;  2B63 C;  4X6A K;  3CQZ C;  3HOZ C;  2R93 C;  1TWF C;  3HOX K;  4LLG A;  1K83 K;  4A3I C;  1TWH K;  4G7Z A;  3S1R K;  4AYB L;  4A3G K;  1SFO C;  4ZH4 A;  4Y52 C;  1I6H C;  3RZD C;  2JA6 C;  3HOV K;  2A6E A;  3S17 K;  3FKI K;  2NVT K;  2A6H A;  3HOY K;  3S14 K;  1YNN A;  5C4J K;  3PO3 K;  2JA5 C;  4A3F C;  1BDF A;  3S2H C;  3GTK K;  2E2H K;  1R9T K;  1I3Q C;  3S16 C;  3S1M C;  5M3F K;  2NVX K;  3GTO K;  3HOU C;  5IP9 C;  4YFK A;  4NOI A;  4OIR A;  4OIP A;  4A3C K;  2JA8 C;  3H3V D;  3GTG C;  3PO2 C;  5IYC K;  1Y1V K;  1ZYR A;  5D4D A;  4KMU A;  4OIN A;  3S1Q C;  4XLP A;  4A3M K;  2WAQ D;  5C3E C;  4MQ9 A;  4C2M K;  2NVQ C;  3S1N K;  5IP7 C;  1I6V A;  2A68 A;  3DXJ A;  1TWC K;  4YFN A;  2WB1 L;  3HOZ K;  4XLN A;  4A3D C;  2R93 K;  4QJV A;  4A3I K;  1TWG C;  2VUM C;  3I4N C;  2Y0S D;  3H3V L;  2E2J K;  4YFX A;  1HQM A;  1IW7 A;  1I50 C;  3GTJ C;  4A3K C;  4Y52 K;  1I6H K;  4Q5S A;  2YU9 C;  1XPP A;  4A3E C;  2PA8 D;  4BXX C;  3S15 C;  2E2I K;  3RZO C;  5M3M K;  5IYD C;  1TWA C;  3GTL C;  5C4X C;  4C3I K;  2NVY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...