1I50K

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i50K00
2NVXK 4QJVB 2JA7K 4A3FK 3PO2C 4A93K 4C3HK 3S2DK 3GTLK 3HOYC 5C4XC 3HOZK 4LK1A 2E2IC 4YG2A 2JA8C 3S1MK 3S1NK 2BE5A 4KN4A 3S2HC 2WAQD 3S1RC 4YFKA 3I4MK 3I4NK 3WODA 3DXJA 3RZOC 4BXXK 1I6VA 5TMCA 5IYDC 4MEYA 5FLMC 3HOXK 4Y7NC 2E2HK 3S17C 4G7HA 4MEXA 1TWCC 1WCMC 1K83C 4BBRC 1Y1WK 1YNJA 4A3KC 2R92K 3GTKK 3HOWK 3HKZL 3K7AK 4BY1C 2NVYC 4QIWL 5IP9K 2E2JK 2NVTK 2PPBA 2JA6K 2NVQK 1TWAK 4A3GC 1TWHK 5IYBK 3GTPC 3GTGK 4JK1A 3S14C 2PMZL 4Y52C 5C4JC 4LJZA 3PO2K 1SMYA 4YFNA 4XSZA 5TMFA 3HOYK 5C4XK 4A3LC 4LLGA 2E2IK 2B63C 2JA8K 4KMUA 3S2HK 3GTMC 3S1RK 1I50C 2Y0SL 3H0GC 3RZOK 2R93C 3H3VL 4A3IC 1R9TC 2A68A 1I3QC 2A6HA 5FLMK 4Y7NK 5C3EC 3S17K 5IYDK 3S16C 4X6AC 1TWCK 1WCMK 1K83K 2PA8L 2Y0SD 4BBRK 4A3KK 3HOUC 5IYCC 4A3JC 5C44C 4BY1K 3PO3C 2NVYK 5M5YK 4A3GK 3FKIC 4A3DC 4A3CC 4GZYA 4LK0A 2YU9C 3HKZD 3GTPK 3S15C 4YFXA 2R7ZC 3M3YC 3S14K 4QIWD 4AYBL 5IP7C 5C4JK 4A3EC 4Y52K 5M5XK 2VUMC 4G7ZA 1TWFC 3CQZC 1YNNA 4A3LK 2B63K 3GTMK 2PMZD 4A3BC 1I50K 3GTOC 3H0GK 2A69A 4OIQA 3EQLA 1I6HC 2R93K 4ZH4A 4A3IK 2O5JA 5M3FK 1R9TK 1I3QK 5C3EK 2WB1L 3S16K 4X6AK 4XSXA 3HOUK 5IYCK 3GTQC 3RZDC 4OIOA 4A3JK 5C44K 3H3VD 3PO3K 4A3MC 4C3IK 3M4OK 5M5WK 3GTJC 1TWGC 2PA8D 3FKIK 4A3CK 3M4OC 3S1QC 4XLNA 4A3DK 1Y1VC 5FJ8K 2YU9K 3S15K 2R7ZK 1XPPA 4OIPA 3M3YK 4Q5SA 5IP7K 1SFOC 4BBSC 4A3EK 1ZYRA 2CW0A 2WAQL 2JA5C 2VUMK 4BY7C 1TWFK 3CQZK 2NVXC 4OINA 4A3FC 2JA7C 4A93C 5D4DA 4A3BK 3S2DC 3GTLC 4AYBD 4XLPA 3GTOK 3HOZC 3HOVK 4G7OA 4QJVA 3S1MC 3S1NC 4OIRA 4KN7A 1I6HK 3I4MC 3I4NC 4BXXC 4C3JK 2E2HC 4C2MK 3HOXC 3GTQK 3RZDK 3HOVC 1IW7A 1Y1WC 2R92C 3GTKC 4A3MK 3HOWC 4Q4ZA 3K7AC 2WB1D 4NOIA 3GTJK 1TWGK 5IP9C 2E2JC 2NVTC 3S1QK 2JA6C 2NVQC 1Y1VK 1TWAC 2O5IA 5M3MK 1TWHC 5IYBC 2A6EA 4MQ9A 1SFOK 1HQMA 1BDFA 3GTGC 4BBSK 2JA5K 4BY7K
chains in the Genus database with same CATH superfamily
3GTQA 2JH3A 4P9SA 3S2DK 4WJ3M 3GTLK 3S0XA 2GAHC 2JA8C 3S1NK 2BE5A 3S2HC 3S1RC 1TWAA 3I4NK 1XZQB 1Y1VA 1I6VA 2E2HK 4MEYA 1USOA 3AD7C 3HOVK 1K83C 2R92K 1XZQA 2NVYC 1VGXA 4QIWL 2E2JK 2NVTK 2NVXA 2JA7A 2JA6K 4A3GC 4LR2A 2PMZL 3T02A 1J6WA 3TFIA 1ZBSA 2JA8K 4KMUA 3S2HK 3S1RK 4G0WA 4A3IC 2ZUEA 2A68A 2A6HA 3AQPA 3S16C 4X6AC 1BJTA 1K83K 2PA8L 4KARA 5IYCC 3PO3C 3CAGA 2NVYK 3ERED 4A3GK 4A3CC 4P5AA 4GZYA 2E2IA 3H0GA 4FZBA 3M3YC 2CFAB 1JOEA 2GAGC 4LOWA 1TWCA 4DDQA 1IS1A 2CFAA 4OIQA 1I6HC 2FQTA 3EQLA 5CJ9A 4RMFA 4A3IK 4BLBA 5M3FK 4GTEA 3S16K 4X6AK 5IORA 1O28A 4G0VA 5IYCK 3RZDC 2V6UA 3PO3K 2VUMA 3T01A 3GTJC 3S1QC 4A3CK 4OIPA 3M3YK 1JVIA 4Q5SA 1ZYRA 2JA5C 4A93C 4GT9A 1F7UA 3HOZC 1I6HK 4QJVA 3S1MC 5CHPA 4OIRA 4KN7A 4BXXC 3FKIA 2ZFZA 3HOXC 5E68A 3RZDK 1Y1WC 3A8IA 2XCOA 3GTKC 5TJ3A 2GSNA 4Q4ZA 4NOIA 4AH6A 3GTJK 5IP9C 3S1QK 3GTLA 4PAAA 3VA7A 3GTOA 1TWHC 1J6XA 1HQMA 3GTGC 2JA5K 2R92A 3GEEA 1X31C 3PO2C 4A93K 5C4XC 3HOZK 4KATA 1WORA 4LK1A 4YG2A 3S1MK 1WQGA 1VLOA 2WAQD 4YFKA 4BXXK 1TWGA 3RZOC 3TFHA 1J6VA 1USMA 1XZPB 3HOXK 3S17C 1WCMC 1Y1WK 3GTKK 3GEHA 1XZPA 1RU0A 5IP9K 2PPBA 1TWHK 3GTGK 2RH6A 1YCLA 4P5BA 4Y52C 3PO2K 1PJ6A 1SMYA 4YFNA 3BP3A 5TMFA 5C4XK 4A3LC 2B63C 2XCQA 3RZOK 1WSVA 3H3VL 1R9TC 1I3QC 3S17K 5C3EC 1O26A 1WCMK 1F9NA 3SZYA 1JQWA 4J3NA 5IOTA 5L46A 5M5YK 3L4JA 4KB4A 4LK0A 2YU9C 3HKZD 2W7VA 3LAJA 4C45A 2R7ZC 3IPJA 5EGEA 5IP7C 4Y52K 1TWFC 3CQZC 1IE0A 1YNNA 4A3LK 2B63K 4A3BC 2O5JA 1R9TK 1I3QK 1PJ7A 5C3EK 1O27A 3GTQC 1YX2A 4OIOA 4A3MC 1BS2A 3LPXA 3M4OK 4GTAA 3TTGA 4XLNA 1Y1VC 1O29A 2YU9K 1O2AA 4GTFA 2R7ZK 3JSTA 3GTMA 1I50A 4KDDA 2R93A 1VRQC 2KWAA 5IP7K 2CW0A 1F7VA 4KC6A 3LAPA 1TWFK 3CQZK 2ZUFA 2NVXC 2FQOA 2JA7C 4KMHA 4C3HC 4A3BK 4AYBD 3G4AA 3GTJA 3BP8C 3GTQK 1IW7A 4A3MK 2P5MA 4FM9A 1IBAA 2WB1D 1GE9A 2NVQC 1Y1VK 5HL8A 5IYBC 2A6EA 2NVXK 4QJVB 2JA7K 3GTKA 4C3HK 3HOYC 2E2IC 4ILDA 4KN4A 3OEPA 3WODA 1VJEA 5TMCA 5FLMC 4WJ4A 4Y7NC 4G7HA 1TWCC 4BBRC 1YNJA 4A3KC 1SFOA 4PABA 2NVQK 3FOFA 5IYBK 3GTPC 1DCOA 4KB2A 3S14C 3FOEA 4KMAA 1KQ4A 2E2HA 1WCMA 5C4JC 4GTLA 1EQRA 1F93A 2RGRA 3HOYK 2E2IK 2D6FC 4KM9A 2P8TA 3OREA 2V6SA 2Y0SL 3G4CA 3FHZA 2JA6A 5FLMK 4Y7NK 1EFWA 1TWCK 4BBRK 4A3KK 4A3JC 5C44C 2PHCB 3FKIC 1DD5A 3GTPK 1VH2A 3S14K 4QIWD 5C4JK 4A3EC 1WIHA 1O2FB 4G7ZA 1K83A 3GSIA 2PMZD 1EI6A 3V4GA 2NVYA 3GTOC 4WILA 1WOPA 4ZH4A 1V5VA 2YU9A 2GSOA 2R7ZA 4KM8A 1PJ5A 4XSXA 1B4AA 4A3JK 5C44K 1B4BA 4C3IK 5M5WK 1TWGC 2PA8D 3FKIK 4LQYA 3MMLB 3M4OC 5FJ8K 1XPPA 5EGHA 4A3EK 1XXAA 4XCHA 2WAQL 1WOOA 3HXAA 1O2BA 4A3FC 4GTBA 5D4DA 4XLPA 3GTOK 3I4MC 4G0UA 1DCHA 4O2DA 3HOWC 3K7AC 1TWGK 1ZQ1C 3A8JA 1TWAC 1AB4A 1BDFA 4GTCA 2XCRB 4A3FK 3N3YA 1BGWA 3AQOA 3Q3QA 3I4MK 2GSUA 3OPFA 3DXJA 5IYDC 4MEXA 3HOWK 3HKZL 3K7AK 5JFEA 4BY1C 2JA5A 3QX3A 1TWAK 3AD8C 1G51A 3L4KA 4JK1A 3GIRA 1UV7A 1ZVUA 4LJZA 4XSZA 1Y1WA 4LLGA 1IQ0A 3GTMC 1I50C 1WOSA 1J98A 3H0GC 2R93C 1C0AA 5IYDK 4KAWX 1L0WA 3GTPA 1TWHA 5IOSA 2Y0SD 3HOUC 3GTGA 3AH5A 1EK8A 4BY1K 4KASA 1WQHA 3GEIA 3TFJA 4A3DC 1XXCA 3S15C 4YFXA 4M1XA 4AYBL 5M5XK 2VUMC 3AD9C 4KMDA 4BKWA 3GTMK 1ISEA 1I50K 3A8KA 3H0GK 2A69A 2R93K 1INNA 2WB1L 4C3JC 2EBBA 3NUHA 4C2MC 3HOUK 3H3VD 1HI9A 3SZZA 4C3IC 4A3DK 2B63A 1EH1A 3S15K 5JVOA 3N0BA 1O24A 1WSRA 1DCPA 1R9TA 1I3QA 1SFOC 4BBSC 4BLAA 2VUMK 4BY7C 4OINA 3ADAC 3S2DC 4GFQA 3GTLC 4G7OA 2Y3PA 3S1NC 3T00A 3I4NC 1O25A 4C3JK 2E2HC 1ZXOA 4C2MK 1XXBA 3HOVC 2R92C 2V6TA 1WQFA 1TWFA 3CQZA 2E2JC 2NVTC 3GDZA 5IOQA 2O5IA 1IL2A 2JA6C 5M3MK 4MQ9A 3N0CA 3BUEA 4GTDA 1SFOK 4BBSK 4BY7K
chains in the Genus database with same CATH topology
2NVXK 4QJVB 2JA7K 4A3FK 3PO2C 4A93K 4C3HK 3S2DK 3GTLK 3HOYC 5C4XC 3HOZK 4LK1A 2E2IC 4YG2A 2JA8C 3S1MK 3S1NK 2BE5A 4KN4A 3S2HC 2WAQD 3S1RC 4YFKA 3I4MK 3I4NK 3WODA 3DXJA 3RZOC 4BXXK 1I6VA 5TMCA 5IYDC 4MEYA 5FLMC 3HOXK 4Y7NC 2E2HK 3S17C 4G7HA 4MEXA 1TWCC 1WCMC 1K83C 4BBRC 1Y1WK 1YNJA 4A3KC 2R92K 3GTKK 3HOWK 3HKZL 3K7AK 4BY1C 2NVYC 4QIWL 5IP9K 2E2JK 2NVTK 2PPBA 2JA6K 2NVQK 1TWAK 4A3GC 1TWHK 5IYBK 3GTPC 3GTGK 4JK1A 3S14C 2PMZL 4Y52C 5C4JC 4LJZA 3PO2K 1SMYA 4YFNA 4XSZA 5TMFA 3HOYK 5C4XK 4A3LC 4LLGA 2E2IK 2B63C 2JA8K 4KMUA 3S2HK 3GTMC 3S1RK 1I50C 2Y0SL 3H0GC 3RZOK 2R93C 3H3VL 4A3IC 1R9TC 2A68A 1I3QC 2A6HA 5FLMK 4Y7NK 5C3EC 3S17K 5IYDK 3S16C 4X6AC 1TWCK 1WCMK 1K83K 2PA8L 2Y0SD 4BBRK 4A3KK 3HOUC 5IYCC 4A3JC 5C44C 4BY1K 3PO3C 2NVYK 5M5YK 4A3GK 3FKIC 4A3DC 4A3CC 4GZYA 4LK0A 2YU9C 3HKZD 3GTPK 3S15C 4YFXA 2R7ZC 3M3YC 3S14K 4QIWD 4AYBL 5IP7C 5C4JK 4A3EC 4Y52K 5M5XK 2VUMC 4G7ZA 1TWFC 3CQZC 1YNNA 4A3LK 2B63K 3GTMK 2PMZD 4A3BC 1I50K 3GTOC 3H0GK 2A69A 4OIQA 3EQLA 1I6HC 2R93K 4ZH4A 4A3IK 2O5JA 5M3FK 1R9TK 1I3QK 5C3EK 2WB1L 3S16K 4X6AK 4XSXA 3HOUK 5IYCK 3GTQC 3RZDC 4OIOA 4A3JK 5C44K 3H3VD 3PO3K 4A3MC 4C3IK 3M4OK 5M5WK 3GTJC 1TWGC 2PA8D 3FKIK 4A3CK 3M4OC 3S1QC 4XLNA 4A3DK 1Y1VC 5FJ8K 2YU9K 3S15K 2R7ZK 1XPPA 4OIPA 3M3YK 4Q5SA 5IP7K 1SFOC 4BBSC 4A3EK 1ZYRA 2CW0A 2WAQL 2JA5C 2VUMK 4BY7C 1TWFK 3CQZK 2NVXC 4OINA 4A3FC 2JA7C 4A93C 5D4DA 4A3BK 3S2DC 3GTLC 4AYBD 4XLPA 3GTOK 3HOZC 3HOVK 4G7OA 4QJVA 3S1MC 3S1NC 4OIRA 4KN7A 1I6HK 3I4MC 3I4NC 4BXXC 4C3JK 2E2HC 4C2MK 3HOXC 3GTQK 3RZDK 3HOVC 1IW7A 1Y1WC 2R92C 3GTKC 4A3MK 3HOWC 4Q4ZA 3K7AC 2WB1D 4NOIA 3GTJK 1TWGK 5IP9C 2E2JC 2NVTC 3S1QK 2JA6C 2NVQC 1Y1VK 1TWAC 2O5IA 5M3MK 1TWHC 5IYBC 2A6EA 4MQ9A 1SFOK 1HQMA 1BDFA 3GTGC 4BBSK 2JA5K 4BY7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX K;  4QJV B;  2JA7 K;  4A3F K;  3PO2 C;  4A93 K;  4C3H K;  3S2D K;  3GTL K;  3HOY C;  5C4X C;  3HOZ K;  4LK1 A;  2E2I C;  4YG2 A;  2JA8 C;  3S1M K;  3S1N K;  2BE5 A;  4KN4 A;  3S2H C;  2WAQ D;  3S1R C;  4YFK A;  3I4M K;  3I4N K;  3WOD A;  3DXJ A;  3RZO C;  4BXX K;  1I6V A;  5TMC A;  5IYD C;  4MEY A;  5FLM C;  3HOX K;  4Y7N C;  2E2H K;  3S17 C;  4G7H A;  4MEX A;  1TWC C;  1WCM C;  1K83 C;  4BBR C;  1Y1W K;  1YNJ A;  4A3K C;  2R92 K;  3GTK K;  3HOW K;  3HKZ L;  3K7A K;  4BY1 C;  2NVY C;  4QIW L;  5IP9 K;  2E2J K;  2NVT K;  2PPB A;  2JA6 K;  2NVQ K;  1TWA K;  4A3G C;  1TWH K;  5IYB K;  3GTP C;  3GTG K;  4JK1 A;  3S14 C;  2PMZ L;  4Y52 C;  5C4J C;  4LJZ A;  3PO2 K;  1SMY A;  4YFN A;  4XSZ A;  5TMF A;  3HOY K;  5C4X K;  4A3L C;  4LLG A;  2E2I K;  2B63 C;  2JA8 K;  4KMU A;  3S2H K;  3GTM C;  3S1R K;  1I50 C;  2Y0S L;  3H0G C;  3RZO K;  2R93 C;  3H3V L;  4A3I C;  1R9T C;  2A68 A;  1I3Q C;  2A6H A;  5FLM K;  4Y7N K;  5C3E C;  3S17 K;  5IYD K;  3S16 C;  4X6A C;  1TWC K;  1WCM K;  1K83 K;  2PA8 L;  2Y0S D;  4BBR K;  4A3K K;  3HOU C;  5IYC C;  4A3J C;  5C44 C;  4BY1 K;  3PO3 C;  2NVY K;  5M5Y K;  4A3G K;  3FKI C;  4A3D C;  4A3C C;  4GZY A;  4LK0 A;  2YU9 C;  3HKZ D;  3GTP K;  3S15 C;  4YFX A;  2R7Z C;  3M3Y C;  3S14 K;  4QIW D;  4AYB L;  5IP7 C;  5C4J K;  4A3E C;  4Y52 K;  5M5X K;  2VUM C;  4G7Z A;  1TWF C;  3CQZ C;  1YNN A;  4A3L K;  2B63 K;  3GTM K;  2PMZ D;  4A3B C;  1I50 K;  3GTO C;  3H0G K;  2A69 A;  4OIQ A;  3EQL A;  1I6H C;  2R93 K;  4ZH4 A;  4A3I K;  2O5J A;  5M3F K;  1R9T K;  1I3Q K;  5C3E K;  2WB1 L;  3S16 K;  4X6A K;  4XSX A;  3HOU K;  5IYC K;  3GTQ C;  3RZD C;  4OIO A;  4A3J K;  5C44 K;  3H3V D;  3PO3 K;  4A3M C;  4C3I K;  3M4O K;  5M5W K;  3GTJ C;  1TWG C;  2PA8 D;  3FKI K;  4A3C K;  3M4O C;  3S1Q C;  4XLN A;  4A3D K;  1Y1V C;  5FJ8 K;  2YU9 K;  3S15 K;  2R7Z K;  1XPP A;  4OIP A;  3M3Y K;  4Q5S A;  5IP7 K;  1SFO C;  4BBS C;  4A3E K;  1ZYR A;  2CW0 A;  2WAQ L;  2JA5 C;  2VUM K;  4BY7 C;  1TWF K;  3CQZ K;  2NVX C;  4OIN A;  4A3F C;  2JA7 C;  4A93 C;  5D4D A;  4A3B K;  3S2D C;  3GTL C;  4AYB D;  4XLP A;  3GTO K;  3HOZ C;  3HOV K;  4G7O A;  4QJV A;  3S1M C;  3S1N C;  4OIR A;  4KN7 A;  1I6H K;  3I4M C;  3I4N C;  4BXX C;  4C3J K;  2E2H C;  4C2M K;  3HOX C;  3GTQ K;  3RZD K;  3HOV C;  1IW7 A;  1Y1W C;  2R92 C;  3GTK C;  4A3M K;  3HOW C;  4Q4Z A;  3K7A C;  2WB1 D;  4NOI A;  3GTJ K;  1TWG K;  5IP9 C;  2E2J C;  2NVT C;  3S1Q K;  2JA6 C;  2NVQ C;  1Y1V K;  1TWA C;  2O5I A;  5M3M K;  1TWH C;  5IYB C;  2A6E A;  4MQ9 A;  1SFO K;  1HQM A;  1BDF A;  3GTG C;  4BBS K;  2JA5 K;  4BY7 K; 
#chains in the Genus database with same CATH topology
 3GTQ A;  2JH3 A;  4P9S A;  3S2D K;  4WJ3 M;  3GTL K;  3S0X A;  2GAH C;  2JA8 C;  3S1N K;  2BE5 A;  3S2H C;  3S1R C;  1TWA A;  3I4N K;  1XZQ B;  1Y1V A;  1I6V A;  2E2H K;  4MEY A;  1USO A;  3AD7 C;  3HOV K;  1K83 C;  2R92 K;  1XZQ A;  2NVY C;  1VGX A;  4QIW L;  2E2J K;  2NVT K;  2NVX A;  2JA7 A;  2JA6 K;  4A3G C;  4LR2 A;  2PMZ L;  3T02 A;  1J6W A;  3TFI A;  1ZBS A;  2JA8 K;  4KMU A;  3S2H K;  3S1R K;  4G0W A;  4A3I C;  2ZUE A;  2A68 A;  2A6H A;  3AQP A;  3S16 C;  4X6A C;  1BJT A;  1K83 K;  2PA8 L;  4KAR A;  5IYC C;  3PO3 C;  3CAG A;  2NVY K;  3ERE D;  4A3G K;  4A3C C;  4P5A A;  4GZY A;  2E2I A;  3H0G A;  4FZB A;  3M3Y C;  2CFA B;  1JOE A;  2GAG C;  4LOW A;  1TWC A;  4DDQ A;  1IS1 A;  2CFA A;  4OIQ A;  1I6H C;  2FQT A;  3EQL A;  5CJ9 A;  4RMF A;  4A3I K;  4BLB A;  5M3F K;  4GTE A;  3S16 K;  4X6A K;  5IOR A;  1O28 A;  4G0V A;  5IYC K;  3RZD C;  2V6U A;  3PO3 K;  2VUM A;  3T01 A;  3GTJ C;  3S1Q C;  4A3C K;  4OIP A;  3M3Y K;  1JVI A;  4Q5S A;  1ZYR A;  2JA5 C;  4A93 C;  4GT9 A;  1F7U A;  3HOZ C;  1I6H K;  4QJV A;  3S1M C;  5CHP A;  4OIR A;  4KN7 A;  4BXX C;  3FKI A;  2ZFZ A;  3HOX C;  5E68 A;  3RZD K;  1Y1W C;  3A8I A;  2XCO A;  3GTK C;  5TJ3 A;  2GSN A;  4Q4Z A;  4NOI A;  4AH6 A;  3GTJ K;  5IP9 C;  3S1Q K;  3GTL A;  4PAA A;  3VA7 A;  3GTO A;  1TWH C;  1J6X A;  1HQM A;  3GTG C;  2JA5 K;  2R92 A;  3GEE A;  1X31 C;  3PO2 C;  4A93 K;  5C4X C;  3HOZ K;  4KAT A;  1WOR A;  4LK1 A;  4YG2 A;  3S1M K;  1WQG A;  1VLO A;  2WAQ D;  4YFK A;  4BXX K;  1TWG A;  3RZO C;  3TFH A;  1J6V A;  1USM A;  1XZP B;  3HOX K;  3S17 C;  1WCM C;  1Y1W K;  3GTK K;  3GEH A;  1XZP A;  1RU0 A;  5IP9 K;  2PPB A;  1TWH K;  3GTG K;  2RH6 A;  1YCL A;  4P5B A;  4Y52 C;  3PO2 K;  1PJ6 A;  1SMY A;  4YFN A;  3BP3 A;  5TMF A;  5C4X K;  4A3L C;  2B63 C;  2XCQ A;  3RZO K;  1WSV A;  3H3V L;  1R9T C;  1I3Q C;  3S17 K;  5C3E C;  1O26 A;  1WCM K;  1F9N A;  3SZY A;  1JQW A;  4J3N A;  5IOT A;  5L46 A;  5M5Y K;  3L4J A;  4KB4 A;  4LK0 A;  2YU9 C;  3HKZ D;  2W7V A;  3LAJ A;  4C45 A;  2R7Z C;  3IPJ A;  5EGE A;  5IP7 C;  4Y52 K;  1TWF C;  3CQZ C;  1IE0 A;  1YNN A;  4A3L K;  2B63 K;  4A3B C;  2O5J A;  1R9T K;  1I3Q K;  1PJ7 A;  5C3E K;  1O27 A;  3GTQ C;  1YX2 A;  4OIO A;  4A3M C;  1BS2 A;  3LPX A;  3M4O K;  4GTA A;  3TTG A;  4XLN A;  1Y1V C;  1O29 A;  2YU9 K;  1O2A A;  4GTF A;  2R7Z K;  3JST A;  3GTM A;  1I50 A;  4KDD A;  2R93 A;  1VRQ C;  2KWA A;  5IP7 K;  2CW0 A;  1F7V A;  4KC6 A;  3LAP A;  1TWF K;  3CQZ K;  2ZUF A;  2NVX C;  2FQO A;  2JA7 C;  4KMH A;  4C3H C;  4A3B K;  4AYB D;  3G4A A;  3GTJ A;  3BP8 C;  3GTQ K;  1IW7 A;  4A3M K;  2P5M A;  4FM9 A;  1IBA A;  2WB1 D;  1GE9 A;  2NVQ C;  1Y1V K;  5HL8 A;  5IYB C;  2A6E A;  2NVX K;  4QJV B;  2JA7 K;  3GTK A;  4C3H K;  3HOY C;  2E2I C;  4ILD A;  4KN4 A;  3OEP A;  3WOD A;  1VJE A;  5TMC A;  5FLM C;  4WJ4 A;  4Y7N C;  4G7H A;  1TWC C;  4BBR C;  1YNJ A;  4A3K C;  1SFO A;  4PAB A;  2NVQ K;  3FOF A;  5IYB K;  3GTP C;  1DCO A;  4KB2 A;  3S14 C;  3FOE A;  4KMA A;  1KQ4 A;  2E2H A;  1WCM A;  5C4J C;  4GTL A;  1EQR A;  1F93 A;  2RGR A;  3HOY K;  2E2I K;  2D6F C;  4KM9 A;  2P8T A;  3ORE A;  2V6S A;  2Y0S L;  3G4C A;  3FHZ A;  2JA6 A;  5FLM K;  4Y7N K;  1EFW A;  1TWC K;  4BBR K;  4A3K K;  4A3J C;  5C44 C;  2PHC B;  3FKI C;  1DD5 A;  3GTP K;  1VH2 A;  3S14 K;  4QIW D;  5C4J K;  4A3E C;  1WIH A;  1O2F B;  4G7Z A;  1K83 A;  3GSI A;  2PMZ D;  1EI6 A;  3V4G A;  2NVY A;  3GTO C;  4WIL A;  1WOP A;  4ZH4 A;  1V5V A;  2YU9 A;  2GSO A;  2R7Z A;  4KM8 A;  1PJ5 A;  4XSX A;  1B4A A;  4A3J K;  5C44 K;  1B4B A;  4C3I K;  5M5W K;  1TWG C;  2PA8 D;  3FKI K;  4LQY A;  3MML B;  3M4O C;  5FJ8 K;  1XPP A;  5EGH A;  4A3E K;  1XXA A;  4XCH A;  2WAQ L;  1WOO A;  3HXA A;  1O2B A;  4A3F C;  4GTB A;  5D4D A;  4XLP A;  3GTO K;  3I4M C;  4G0U A;  1DCH A;  4O2D A;  3HOW C;  3K7A C;  1TWG K;  1ZQ1 C;  3A8J A;  1TWA C;  1AB4 A;  1BDF A;  4GTC A;  2XCR B;  4A3F K;  3N3Y A;  1BGW A;  3AQO A;  3Q3Q A;  3I4M K;  2GSU A;  3OPF A;  3DXJ A;  5IYD C;  4MEX A;  3HOW K;  3HKZ L;  3K7A K;  5JFE A;  4BY1 C;  2JA5 A;  3QX3 A;  1TWA K;  3AD8 C;  1G51 A;  3L4K A;  4JK1 A;  3GIR A;  1UV7 A;  1ZVU A;  4LJZ A;  4XSZ A;  1Y1W A;  4LLG A;  1IQ0 A;  3GTM C;  1I50 C;  1WOS A;  1J98 A;  3H0G C;  2R93 C;  1C0A A;  5IYD K;  4KAW X;  1L0W A;  3GTP A;  1TWH A;  5IOS A;  2Y0S D;  3HOU C;  3GTG A;  3AH5 A;  1EK8 A;  4BY1 K;  4KAS A;  1WQH A;  3GEI A;  3TFJ A;  4A3D C;  1XXC A;  3S15 C;  4YFX A;  4M1X A;  4AYB L;  5M5X K;  2VUM C;  3AD9 C;  4KMD A;  4BKW A;  3GTM K;  1ISE A;  1I50 K;  3A8K A;  3H0G K;  2A69 A;  2R93 K;  1INN A;  2WB1 L;  4C3J C;  2EBB A;  3NUH A;  4C2M C;  3HOU K;  3H3V D;  1HI9 A;  3SZZ A;  4C3I C;  4A3D K;  2B63 A;  1EH1 A;  3S15 K;  5JVO A;  3N0B A;  1O24 A;  1WSR A;  1DCP A;  1R9T A;  1I3Q A;  1SFO C;  4BBS C;  4BLA A;  2VUM K;  4BY7 C;  4OIN A;  3ADA C;  3S2D C;  4GFQ A;  3GTL C;  4G7O A;  2Y3P A;  3S1N C;  3T00 A;  3I4N C;  1O25 A;  4C3J K;  2E2H C;  1ZXO A;  4C2M K;  1XXB A;  3HOV C;  2R92 C;  2V6T A;  1WQF A;  1TWF A;  3CQZ A;  2E2J C;  2NVT C;  3GDZ A;  5IOQ A;  2O5I A;  1IL2 A;  2JA6 C;  5M3M K;  4MQ9 A;  3N0C A;  3BUE A;  4GTD A;  1SFO K;  4BBS K;  4BY7 K; 
#chains in the Genus database with same CATH homology
 2NVX K;  4QJV B;  2JA7 K;  4A3F K;  3PO2 C;  4A93 K;  4C3H K;  3S2D K;  3GTL K;  3HOY C;  5C4X C;  3HOZ K;  4LK1 A;  2E2I C;  4YG2 A;  2JA8 C;  3S1M K;  3S1N K;  2BE5 A;  4KN4 A;  3S2H C;  2WAQ D;  3S1R C;  4YFK A;  3I4M K;  3I4N K;  3WOD A;  3DXJ A;  3RZO C;  4BXX K;  1I6V A;  5TMC A;  5IYD C;  4MEY A;  5FLM C;  3HOX K;  4Y7N C;  2E2H K;  3S17 C;  4G7H A;  4MEX A;  1TWC C;  1WCM C;  1K83 C;  4BBR C;  1Y1W K;  1YNJ A;  4A3K C;  2R92 K;  3GTK K;  3HOW K;  3HKZ L;  3K7A K;  4BY1 C;  2NVY C;  4QIW L;  5IP9 K;  2E2J K;  2NVT K;  2PPB A;  2JA6 K;  2NVQ K;  1TWA K;  4A3G C;  1TWH K;  5IYB K;  3GTP C;  3GTG K;  4JK1 A;  3S14 C;  2PMZ L;  4Y52 C;  5C4J C;  4LJZ A;  3PO2 K;  1SMY A;  4YFN A;  4XSZ A;  5TMF A;  3HOY K;  5C4X K;  4A3L C;  4LLG A;  2E2I K;  2B63 C;  2JA8 K;  4KMU A;  3S2H K;  3GTM C;  3S1R K;  1I50 C;  2Y0S L;  3H0G C;  3RZO K;  2R93 C;  3H3V L;  4A3I C;  1R9T C;  2A68 A;  1I3Q C;  2A6H A;  5FLM K;  4Y7N K;  5C3E C;  3S17 K;  5IYD K;  3S16 C;  4X6A C;  1TWC K;  1WCM K;  1K83 K;  2PA8 L;  2Y0S D;  4BBR K;  4A3K K;  3HOU C;  5IYC C;  4A3J C;  5C44 C;  4BY1 K;  3PO3 C;  2NVY K;  5M5Y K;  4A3G K;  3FKI C;  4A3D C;  4A3C C;  4GZY A;  4LK0 A;  2YU9 C;  3HKZ D;  3GTP K;  3S15 C;  4YFX A;  2R7Z C;  3M3Y C;  3S14 K;  4QIW D;  4AYB L;  5IP7 C;  5C4J K;  4A3E C;  4Y52 K;  5M5X K;  2VUM C;  4G7Z A;  1TWF C;  3CQZ C;  1YNN A;  4A3L K;  2B63 K;  3GTM K;  2PMZ D;  4A3B C;  1I50 K;  3GTO C;  3H0G K;  2A69 A;  4OIQ A;  3EQL A;  1I6H C;  2R93 K;  4ZH4 A;  4A3I K;  2O5J A;  5M3F K;  1R9T K;  1I3Q K;  5C3E K;  2WB1 L;  3S16 K;  4X6A K;  4XSX A;  3HOU K;  5IYC K;  3GTQ C;  3RZD C;  4OIO A;  4A3J K;  5C44 K;  3H3V D;  3PO3 K;  4A3M C;  4C3I K;  3M4O K;  5M5W K;  3GTJ C;  1TWG C;  2PA8 D;  3FKI K;  4A3C K;  3M4O C;  3S1Q C;  4XLN A;  4A3D K;  1Y1V C;  5FJ8 K;  2YU9 K;  3S15 K;  2R7Z K;  1XPP A;  4OIP A;  3M3Y K;  4Q5S A;  5IP7 K;  1SFO C;  4BBS C;  4A3E K;  1ZYR A;  2CW0 A;  2WAQ L;  2JA5 C;  2VUM K;  4BY7 C;  1TWF K;  3CQZ K;  2NVX C;  4OIN A;  4A3F C;  2JA7 C;  4A93 C;  5D4D A;  4A3B K;  3S2D C;  3GTL C;  4AYB D;  4XLP A;  3GTO K;  3HOZ C;  3HOV K;  4G7O A;  4QJV A;  3S1M C;  3S1N C;  4OIR A;  4KN7 A;  1I6H K;  3I4M C;  3I4N C;  4BXX C;  4C3J K;  2E2H C;  4C2M K;  3HOX C;  3GTQ K;  3RZD K;  3HOV C;  1IW7 A;  1Y1W C;  2R92 C;  3GTK C;  4A3M K;  3HOW C;  4Q4Z A;  3K7A C;  2WB1 D;  4NOI A;  3GTJ K;  1TWG K;  5IP9 C;  2E2J C;  2NVT C;  3S1Q K;  2JA6 C;  2NVQ C;  1Y1V K;  1TWA C;  2O5I A;  5M3M K;  1TWH C;  5IYB C;  2A6E A;  4MQ9 A;  1SFO K;  1HQM A;  1BDF A;  3GTG C;  4BBS K;  2JA5 K;  4BY7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...