1I50K

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i50K00
2PMZD 5IP9K 4C3JK 1I6VA 5IP9C 5IYCK 5IYCC 5FLMK 3M3YC 2B63K 3GTQC 2E2HK 2B63C 3HOUK 4AYBL 2E2HC 4OIOA 4OIQA 2NVTK 3HOUC 3S1NK 2NVTC 1SMYA 4MQ9A 3S1NC 2WB1D 3GTPK 2WAQL 3GTMK 3HOYK 3GTPC 3GTMC 3S1MK 3S1MC 4QJVB 4A3KK 1I3QC 3CQZK 3DXJA 1R9TC 2PA8D 2BE5A 1Y1VK 5C3EK 4G7OA 5TMCA 5C3EC 4G7ZA 3S1RK 5IYDK 2Y0SD 5IP7K 1SFOK 4C2MK 1TWCK 4Y7NK 4QIWD 1BDFA 1TWCC 4Y7NC 4YFXA 3HKZL 4X6AK 3M4OK 5C4JC 3GTGK 3M4OC 3FKIK 3GTGC 4BY7K 3FKIC 4BY7C 4BBSK 2R93K 4LK0A 2R7ZK 4BY1K 4BBSC 2R93C 2WB1L 4BY1C 4A3FK 2R7ZC 3S2DC 3I4NK 2A6HA 4A3FC 4A3IK 4A3MK 3H3VL 3I4NC 4A3MC 2YU9K 4Y52K 2JA7K 4Y52C 3S2HK 5FLMC 4OIRA 3RZDK 3S2HC 3GTLK 1TWAK 3GTLC 3I4MK 4A3LK 4KMUA 4XLPA 4A3CK 4LK1A 3S1QK 4A3LC 3S1QC 3HOYC 4A3BK 2CW0A 3HOXK 4A3BC 3HOXC 5C44K 3HOVK 1K83K 4XLNA 3HOVC 4QJVA 1XPPA 4A3KC 3CQZC 3S16K 3K7AK 4LJZA 3K7AC 4LLGA 4Q4ZA 1Y1VC 5IYBK 4A3EK 4A3JK 3S1RC 5IYDC 1Y1WK 5IP7C 1SFOC 2PMZL 4A93K 3H0GK 4A93C 3H0GC 4A3CC 2O5IA 4X6AC 5M3FK 3WODA 4G7HA 2E2IK 1WCMK 1WCMC 1TWFK 5TMFA 2R92K 4OIPA 2R92C 3GTJK 5D4DA 3GTJC 4A3IC 4A3GK 2YU9C 4BBRK 2JA7C 4A3GC 1ZYRA 4BBRC 4MEYA 3RZDC 3GTKK 5M5XK 3GTKC 1TWAC 2NVYK 4AYBD 2NVYC 3I4MC 2JA6K 2A69A 1TWGK 2PA8L 3S15K 4JK1A 1TWGC 3PO2K 4YFKA 2PPBA 3HOZK 4NOIA 3HOZC 3PO2C 3S15C 2WAQD 2Y0SL 4BXXK 5C44C 4BXXC 4QIWL 1K83C 3RZOK 3RZOC 3S17K 2NVXK 3S16C 4YG2A 4OINA 3HOWK 3EQLA 3HOWC 5IYBC 4A3EC 4A3JC 1TWHK 2A6EA 1TWHC 5FJ8K 1Y1WC 2E2JK 4MEXA 4KN4A 4GZYA 4C3HK 3HKZD 3M3YK 3GTQK 5M5WK 1YNJA 2VUMK 3GTOK 2E2IC 2VUMC 3GTOC 4A3DK 4A3DC 2JA5K 1TWFC 2JA5C 4XSZA 4YFNA 4Q5SA 4C3IK 3H3VD 5C4XK 5M3MK 5C4XC 4ZH4A 1I3QK 2JA8K 1YNNA 2JA8C 1R9TK 2JA6C 3PO3K 5M5YK 3PO3C 2NVQK 2NVQC 2O5JA 2A68A 3S17C 1HQMA 1I50K 2NVXC 1I50C 5C4JK 4XSXA 3S2DK 1I6HK 3S14K 1I6HC 3S14C 2E2JC 1IW7A 4KN7A
chains in the Genus database with same CATH superfamily
4BLAA 5IP9C 1XZQA 5FLMK 4KMDA 3HOUK 2E2HC 2NVTK 1SMYA 3AQOA 2WB1D 3GTPK 4KM9A 3AH5A 1O2AA 1EH1A 3S1MC 1ZBSA 3GTQA 3CQZK 1J6WA 3FOFA 1Y1VK 1PJ7A 5C3EK 4G7OA 1F7VA 1WQGA 4C2MK 1TWCK 1RU0A 1VH2A 4Y7NC 1R9TA 2XCQA 3T00A 4KC6A 3M4OK 3N3YA 3FKIC 4BBSC 3GEIA 4BY1C 2A6HA 4A3FC 1IE0A 4A3IK 3G4AA 3H3VL 4A3MC 2YU9K 3S2HK 5FLMC 3GTLC 2RH6A 3I4MK 3S1QC 3HOXK 4A3BC 4KM8A 1ISEA 3CQZC 2V6TA 3K7AC 1Y1VC 1XZPA 3H0GK 2ZUEA 2O5IA 4GTFA 3WODA 1WCMC 2CFAA 3BUEA 3GEHA 4P5AA 3AD8C 4RMFA 4A3IC 2YU9C 3GTGA 3GTKC 3OEPA 2R93A 2NVYK 3I4MC 2R7ZA 2PA8L 2R92A 4JK1A 5TJ3A 3PO2K 4NOIA 3HOZC 3SZYA 2JA7A 1EI6A 3RZOC 3S17K 4PAAA 1WOOA 2NVXK 4YG2A 3HOWC 3M3YK 3JSTA 1USMA 5JVOA 2VUMK 3GTOC 1JOEA 1WOPA 1TWHA 3L4JA 4C3IC 1HI9A 5C4XK 5E68A 1I3QK 1TWFA 3TFJA 3GTJA 1JVIA 5M5YK 4KB4A 1UV7A 2NVQC 2O5JA 3S17C 2NVXC 5C4JK 2JA6A 3S2DK 2ZFZA 3S14C 2PMZD 5IP9K 3M3YC 2E2HK 1JQWA 2B63C 4AYBL 2V6UA 4OIOA 5EGEA 4MQ9A 3GEEA 3HOYK 3GTMC 3S1MK 3S0XA 1BS2A 1O2BA 4QJVB 4A3KK 1I3QC 2JA5A 1V5VA 5IOSA 3QX3A 3TFIA 4GT9A 1WSRA 4Y7NK 4QIWD 1BDFA 4YFXA 5C4JC 3FKIK 3GTGC 3GSIA 3TTGA 4BY7C 4BBSK 2R93C 4BY1K 2WB1L 2R7ZC 5IORA 4A3FK 3S2DC 4A3MK 1TWCA 1I50A 3GTLK 3L4KA 4A3LC 3S1QK 2RGRA 5EGHA 2D6FC 1PJ6A 1DD5A 4XCHA 3HOYC 4A3BK 1K83K 4A3KC 1XPPA 3K7AK 4GTBA 3N0CA 4KB2A 3CAGA 4LOWA 4G7HA 2E2IK 1WCMK 2V6SA 2P8TA 1SFOA 5D4DA 3GTJC 3H0GA 1F7UA 4BBRC 3GTKK 3A8IA 3OREA 4C45A 4YFKA 3HOZK 4ILDA 3S15C 3VA7A 2Y0SL 3RZOK 1K83C 1BJTA 3BP8C 4GTAA 1TWAA 2NVYA 1VLOA 3HOWK 4G0UA 2GAHC 2A6EA 3GTQK 1GE9A 3GTOK 2E2IC 2JA5C 1Y1WA 1O29A 4C3IK 3H3VD 5IOTA 3AD7C 2W7VA 1XXCA 1O2FB 1R9TK 3A8KA 3PO3C 2NVQK 3FOEA 4LQYA 1EFWA 1I50C 1TWGA 4KASA 2XCOA 3AD9C 3GDZA 4BKWA 3S14K 2Y3PA 4AH6A 4KN7A 4C3JK 5IYCC 2XCRB 2B63K 3GTQC 1DCOA 3S1NC 3BP3A 3TFHA 1WORA 2WAQL 5CJ9A 3GTMK 4GFQA 3FHZA 3DXJA 1R9TC 2PA8D 4G7ZA 4P9SA 3HXAA 3HKZL 4KAWX 1IQ0A 3GTGK 4BY7K 2R93K 4KATA 4LK0A 2R7ZK 1EK8A 3I4NC 2JH3A 4C3JC 2JA7K 4Y52C 4OIRA 3FKIA 4A3LK 1X31C 3NUHA 5JFEA 5C44K 1O25A 3HOVC 4QJVA 4J3NA 1DCHA 3S16K 4Q4ZA 3GTPA 5IYBK 2P5MA 2KWAA 4A93C 3CQZA 1J6VA 1YCLA 1Y1VA 1C0AA 3GIRA 1TWFK 5TMFA 4OIPA 2R92C 3GTJK 1ZQ1C 3T01A 4BBRK 2JA7C 1INNA 4A3GC 4MEYA 5M5XK 1XXAA 4LR2A 4AYBD 4WJ3M 2JA6K 2A69A 3S15K 1TWGC 2YU9A 5C44C 4BXXC 1AB4A 1WIHA 3S16C 2FQTA 4OINA 4GTEA 2ZUFA 5IYBC 4WILA 1TWHC 1PJ5A 3N0BA 1XZQB 5L46A 3LAJA 4C3HK 4GZYA 5M5WK 1YNJA 4A3DC 2JA5K 1TWFC 4GTCA 4XSZA 5HL8A 4FM9A 5M3MK 4ZH4A 2JA8C 4KMAA 3GTOA 2JA6C 1EQRA 3PO3K 3G4CA 2A68A 3OPFA 1I50K 1L0WA 3ADAC 3V4GA 4BLBA 1I6HC 1IW7A 1I6VA 5IYCK 2NVXA 4C3HC 1B4BA 3S1NK 4OIQA 3HOUC 2NVTC 1YX2A 3GTPC 2VUMA 2B63A 1XXBA 1XZPB 2BE5A 1J6XA 5TMCA 5C3EC 3S1RK 1IS1A 3GTMA 5IYDK 2Y0SD 5IP7K 1SFOK 1ZVUA 1I3QA 4C2MC 1TWCC 4X6AK 3IPJA 3M4OC 3T02A 4DDQA 2CFAB 3LAPA 3I4NK 1VJEA 4Y52K 3RZDK 3S2HC 1TWAK 4KMUA 4XLPA 4A3CK 4LK1A 1VRQC 1G51A 2CW0A 3HOXC 3HOVK 4XLNA 3MMLB 2E2HA 4PABA 1KQ4A 1USOA 4LJZA 4LLGA 3SZZA 1ZXOA 4A3EK 4A3JK 3S1RC 1WOSA 5CHPA 5IYDC 5IP7C 1Y1WK 2PMZL 1SFOC 4A93K 3H0GC 4X6AC 2PHCB 5M3FK 4GTDA 1WSVA 2R92K 1O24A 4A3GK 1ZYRA 4P5BA 3RZDC 1O28A 1TWAC 2NVYC 4G0WA 4A3CC 1TWGK 2PPBA 3PO2C 2GSOA 2WAQD 4BXXK 4QIWL 1F9NA 2EBBA 3GTLA 3Q3QA 1O27A 3LPXA 3EQLA 4A3EC 4A3JC 1TWHK 1VGXA 3ERED 5FJ8K 3A8JA 1Y1WC 1K83A 2E2JK 1DCPA 4KDDA 4MEXA 4KN4A 1O26A 3HKZD 4GTLA 4KARA 4FZBA 2GAGC 1IL2A 2VUMC 4A3DK 1WQHA 1WQFA 4YFNA 4Q5SA 1BGWA 2GSUA 5C4XC 2JA8K 4O2DA 5IOQA 1YNNA 1B4AA 1WCMA 1J98A 2E2IA 1IBAA 4WJ4A 2GSNA 4G0VA 1F93A 3GTKA 4KMHA 1HQMA 4XSXA 3AQPA 1I6HK 2FQOA 2E2JC 4M1XA
chains in the Genus database with same CATH topology
2PMZD 5IP9K 4C3JK 1I6VA 5IP9C 5IYCK 5IYCC 5FLMK 3M3YC 2B63K 3GTQC 2E2HK 2B63C 3HOUK 4AYBL 2E2HC 4OIOA 4OIQA 2NVTK 3HOUC 3S1NK 2NVTC 1SMYA 4MQ9A 3S1NC 2WB1D 3GTPK 2WAQL 3GTMK 3HOYK 3GTPC 3GTMC 3S1MK 3S1MC 4QJVB 4A3KK 1I3QC 3CQZK 3DXJA 1R9TC 2PA8D 2BE5A 1Y1VK 5C3EK 4G7OA 5TMCA 5C3EC 4G7ZA 3S1RK 5IYDK 2Y0SD 5IP7K 1SFOK 4C2MK 1TWCK 4Y7NK 4QIWD 1BDFA 1TWCC 4Y7NC 4YFXA 3HKZL 4X6AK 3M4OK 5C4JC 3GTGK 3M4OC 3FKIK 3GTGC 4BY7K 3FKIC 4BY7C 4BBSK 2R93K 4LK0A 2R7ZK 4BY1K 4BBSC 2R93C 2WB1L 4BY1C 4A3FK 2R7ZC 3S2DC 3I4NK 2A6HA 4A3FC 4A3IK 4A3MK 3H3VL 3I4NC 4A3MC 2YU9K 4Y52K 2JA7K 4Y52C 3S2HK 5FLMC 4OIRA 3RZDK 3S2HC 3GTLK 1TWAK 3GTLC 3I4MK 4A3LK 4KMUA 4XLPA 4A3CK 4LK1A 3S1QK 4A3LC 3S1QC 3HOYC 4A3BK 2CW0A 3HOXK 4A3BC 3HOXC 5C44K 3HOVK 1K83K 4XLNA 3HOVC 4QJVA 1XPPA 4A3KC 3CQZC 3S16K 3K7AK 4LJZA 3K7AC 4LLGA 4Q4ZA 1Y1VC 5IYBK 4A3EK 4A3JK 3S1RC 5IYDC 1Y1WK 5IP7C 1SFOC 2PMZL 4A93K 3H0GK 4A93C 3H0GC 4A3CC 2O5IA 4X6AC 5M3FK 3WODA 4G7HA 2E2IK 1WCMK 1WCMC 1TWFK 5TMFA 2R92K 4OIPA 2R92C 3GTJK 5D4DA 3GTJC 4A3IC 4A3GK 2YU9C 4BBRK 2JA7C 4A3GC 1ZYRA 4BBRC 4MEYA 3RZDC 3GTKK 5M5XK 3GTKC 1TWAC 2NVYK 4AYBD 2NVYC 3I4MC 2JA6K 2A69A 1TWGK 2PA8L 3S15K 4JK1A 1TWGC 3PO2K 4YFKA 2PPBA 3HOZK 4NOIA 3HOZC 3PO2C 3S15C 2WAQD 2Y0SL 4BXXK 5C44C 4BXXC 4QIWL 1K83C 3RZOK 3RZOC 3S17K 2NVXK 3S16C 4YG2A 4OINA 3HOWK 3EQLA 3HOWC 5IYBC 4A3EC 4A3JC 1TWHK 2A6EA 1TWHC 5FJ8K 1Y1WC 2E2JK 4MEXA 4KN4A 4GZYA 4C3HK 3HKZD 3M3YK 3GTQK 5M5WK 1YNJA 2VUMK 3GTOK 2E2IC 2VUMC 3GTOC 4A3DK 4A3DC 2JA5K 1TWFC 2JA5C 4XSZA 4YFNA 4Q5SA 4C3IK 3H3VD 5C4XK 5M3MK 5C4XC 4ZH4A 1I3QK 2JA8K 1YNNA 2JA8C 1R9TK 2JA6C 3PO3K 5M5YK 3PO3C 2NVQK 2NVQC 2O5JA 2A68A 3S17C 1HQMA 1I50K 2NVXC 1I50C 5C4JK 4XSXA 3S2DK 1I6HK 3S14K 1I6HC 3S14C 2E2JC 1IW7A 4KN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ D;  5IP9 K;  4C3J K;  1I6V A;  5IP9 C;  5IYC K;  5IYC C;  5FLM K;  3M3Y C;  2B63 K;  3GTQ C;  2E2H K;  2B63 C;  3HOU K;  4AYB L;  2E2H C;  4OIO A;  4OIQ A;  2NVT K;  3HOU C;  3S1N K;  2NVT C;  1SMY A;  4MQ9 A;  3S1N C;  2WB1 D;  3GTP K;  2WAQ L;  3GTM K;  3HOY K;  3GTP C;  3GTM C;  3S1M K;  3S1M C;  4QJV B;  4A3K K;  1I3Q C;  3CQZ K;  3DXJ A;  1R9T C;  2PA8 D;  2BE5 A;  1Y1V K;  5C3E K;  4G7O A;  5TMC A;  5C3E C;  4G7Z A;  3S1R K;  5IYD K;  2Y0S D;  5IP7 K;  1SFO K;  4C2M K;  1TWC K;  4Y7N K;  4QIW D;  1BDF A;  1TWC C;  4Y7N C;  4YFX A;  3HKZ L;  4X6A K;  3M4O K;  5C4J C;  3GTG K;  3M4O C;  3FKI K;  3GTG C;  4BY7 K;  3FKI C;  4BY7 C;  4BBS K;  2R93 K;  4LK0 A;  2R7Z K;  4BY1 K;  4BBS C;  2R93 C;  2WB1 L;  4BY1 C;  4A3F K;  2R7Z C;  3S2D C;  3I4N K;  2A6H A;  4A3F C;  4A3I K;  4A3M K;  3H3V L;  3I4N C;  4A3M C;  2YU9 K;  4Y52 K;  2JA7 K;  4Y52 C;  3S2H K;  5FLM C;  4OIR A;  3RZD K;  3S2H C;  3GTL K;  1TWA K;  3GTL C;  3I4M K;  4A3L K;  4KMU A;  4XLP A;  4A3C K;  4LK1 A;  3S1Q K;  4A3L C;  3S1Q C;  3HOY C;  4A3B K;  2CW0 A;  3HOX K;  4A3B C;  3HOX C;  5C44 K;  3HOV K;  1K83 K;  4XLN A;  3HOV C;  4QJV A;  1XPP A;  4A3K C;  3CQZ C;  3S16 K;  3K7A K;  4LJZ A;  3K7A C;  4LLG A;  4Q4Z A;  1Y1V C;  5IYB K;  4A3E K;  4A3J K;  3S1R C;  5IYD C;  1Y1W K;  5IP7 C;  1SFO C;  2PMZ L;  4A93 K;  3H0G K;  4A93 C;  3H0G C;  4A3C C;  2O5I A;  4X6A C;  5M3F K;  3WOD A;  4G7H A;  2E2I K;  1WCM K;  1WCM C;  1TWF K;  5TMF A;  2R92 K;  4OIP A;  2R92 C;  3GTJ K;  5D4D A;  3GTJ C;  4A3I C;  4A3G K;  2YU9 C;  4BBR K;  2JA7 C;  4A3G C;  1ZYR A;  4BBR C;  4MEY A;  3RZD C;  3GTK K;  5M5X K;  3GTK C;  1TWA C;  2NVY K;  4AYB D;  2NVY C;  3I4M C;  2JA6 K;  2A69 A;  1TWG K;  2PA8 L;  3S15 K;  4JK1 A;  1TWG C;  3PO2 K;  4YFK A;  2PPB A;  3HOZ K;  4NOI A;  3HOZ C;  3PO2 C;  3S15 C;  2WAQ D;  2Y0S L;  4BXX K;  5C44 C;  4BXX C;  4QIW L;  1K83 C;  3RZO K;  3RZO C;  3S17 K;  2NVX K;  3S16 C;  4YG2 A;  4OIN A;  3HOW K;  3EQL A;  3HOW C;  5IYB C;  4A3E C;  4A3J C;  1TWH K;  2A6E A;  1TWH C;  5FJ8 K;  1Y1W C;  2E2J K;  4MEX A;  4KN4 A;  4GZY A;  4C3H K;  3HKZ D;  3M3Y K;  3GTQ K;  5M5W K;  1YNJ A;  2VUM K;  3GTO K;  2E2I C;  2VUM C;  3GTO C;  4A3D K;  4A3D C;  2JA5 K;  1TWF C;  2JA5 C;  4XSZ A;  4YFN A;  4Q5S A;  4C3I K;  3H3V D;  5C4X K;  5M3M K;  5C4X C;  4ZH4 A;  1I3Q K;  2JA8 K;  1YNN A;  2JA8 C;  1R9T K;  2JA6 C;  3PO3 K;  5M5Y K;  3PO3 C;  2NVQ K;  2NVQ C;  2O5J A;  2A68 A;  3S17 C;  1HQM A;  1I50 K;  2NVX C;  1I50 C;  5C4J K;  4XSX A;  3S2D K;  1I6H K;  3S14 K;  1I6H C;  3S14 C;  2E2J C;  1IW7 A;  4KN7 A; 
#chains in the Genus database with same CATH topology
 4BLA A;  5IP9 C;  1XZQ A;  5FLM K;  4KMD A;  3HOU K;  2E2H C;  2NVT K;  1SMY A;  3AQO A;  2WB1 D;  3GTP K;  4KM9 A;  3AH5 A;  1O2A A;  1EH1 A;  3S1M C;  1ZBS A;  3GTQ A;  3CQZ K;  1J6W A;  3FOF A;  1Y1V K;  1PJ7 A;  5C3E K;  4G7O A;  1F7V A;  1WQG A;  4C2M K;  1TWC K;  1RU0 A;  1VH2 A;  4Y7N C;  1R9T A;  2XCQ A;  3T00 A;  4KC6 A;  3M4O K;  3N3Y A;  3FKI C;  4BBS C;  3GEI A;  4BY1 C;  2A6H A;  4A3F C;  1IE0 A;  4A3I K;  3G4A A;  3H3V L;  4A3M C;  2YU9 K;  3S2H K;  5FLM C;  3GTL C;  2RH6 A;  3I4M K;  3S1Q C;  3HOX K;  4A3B C;  4KM8 A;  1ISE A;  3CQZ C;  2V6T A;  3K7A C;  1Y1V C;  1XZP A;  3H0G K;  2ZUE A;  2O5I A;  4GTF A;  3WOD A;  1WCM C;  2CFA A;  3BUE A;  3GEH A;  4P5A A;  3AD8 C;  4RMF A;  4A3I C;  2YU9 C;  3GTG A;  3GTK C;  3OEP A;  2R93 A;  2NVY K;  3I4M C;  2R7Z A;  2PA8 L;  2R92 A;  4JK1 A;  5TJ3 A;  3PO2 K;  4NOI A;  3HOZ C;  3SZY A;  2JA7 A;  1EI6 A;  3RZO C;  3S17 K;  4PAA A;  1WOO A;  2NVX K;  4YG2 A;  3HOW C;  3M3Y K;  3JST A;  1USM A;  5JVO A;  2VUM K;  3GTO C;  1JOE A;  1WOP A;  1TWH A;  3L4J A;  4C3I C;  1HI9 A;  5C4X K;  5E68 A;  1I3Q K;  1TWF A;  3TFJ A;  3GTJ A;  1JVI A;  5M5Y K;  4KB4 A;  1UV7 A;  2NVQ C;  2O5J A;  3S17 C;  2NVX C;  5C4J K;  2JA6 A;  3S2D K;  2ZFZ A;  3S14 C;  2PMZ D;  5IP9 K;  3M3Y C;  2E2H K;  1JQW A;  2B63 C;  4AYB L;  2V6U A;  4OIO A;  5EGE A;  4MQ9 A;  3GEE A;  3HOY K;  3GTM C;  3S1M K;  3S0X A;  1BS2 A;  1O2B A;  4QJV B;  4A3K K;  1I3Q C;  2JA5 A;  1V5V A;  5IOS A;  3QX3 A;  3TFI A;  4GT9 A;  1WSR A;  4Y7N K;  4QIW D;  1BDF A;  4YFX A;  5C4J C;  3FKI K;  3GTG C;  3GSI A;  3TTG A;  4BY7 C;  4BBS K;  2R93 C;  4BY1 K;  2WB1 L;  2R7Z C;  5IOR A;  4A3F K;  3S2D C;  4A3M K;  1TWC A;  1I50 A;  3GTL K;  3L4K A;  4A3L C;  3S1Q K;  2RGR A;  5EGH A;  2D6F C;  1PJ6 A;  1DD5 A;  4XCH A;  3HOY C;  4A3B K;  1K83 K;  4A3K C;  1XPP A;  3K7A K;  4GTB A;  3N0C A;  4KB2 A;  3CAG A;  4LOW A;  4G7H A;  2E2I K;  1WCM K;  2V6S A;  2P8T A;  1SFO A;  5D4D A;  3GTJ C;  3H0G A;  1F7U A;  4BBR C;  3GTK K;  3A8I A;  3ORE A;  4C45 A;  4YFK A;  3HOZ K;  4ILD A;  3S15 C;  3VA7 A;  2Y0S L;  3RZO K;  1K83 C;  1BJT A;  3BP8 C;  4GTA A;  1TWA A;  2NVY A;  1VLO A;  3HOW K;  4G0U A;  2GAH C;  2A6E A;  3GTQ K;  1GE9 A;  3GTO K;  2E2I C;  2JA5 C;  1Y1W A;  1O29 A;  4C3I K;  3H3V D;  5IOT A;  3AD7 C;  2W7V A;  1XXC A;  1O2F B;  1R9T K;  3A8K A;  3PO3 C;  2NVQ K;  3FOE A;  4LQY A;  1EFW A;  1I50 C;  1TWG A;  4KAS A;  2XCO A;  3AD9 C;  3GDZ A;  4BKW A;  3S14 K;  2Y3P A;  4AH6 A;  4KN7 A;  4C3J K;  5IYC C;  2XCR B;  2B63 K;  3GTQ C;  1DCO A;  3S1N C;  3BP3 A;  3TFH A;  1WOR A;  2WAQ L;  5CJ9 A;  3GTM K;  4GFQ A;  3FHZ A;  3DXJ A;  1R9T C;  2PA8 D;  4G7Z A;  4P9S A;  3HXA A;  3HKZ L;  4KAW X;  1IQ0 A;  3GTG K;  4BY7 K;  2R93 K;  4KAT A;  4LK0 A;  2R7Z K;  1EK8 A;  3I4N C;  2JH3 A;  4C3J C;  2JA7 K;  4Y52 C;  4OIR A;  3FKI A;  4A3L K;  1X31 C;  3NUH A;  5JFE A;  5C44 K;  1O25 A;  3HOV C;  4QJV A;  4J3N A;  1DCH A;  3S16 K;  4Q4Z A;  3GTP A;  5IYB K;  2P5M A;  2KWA A;  4A93 C;  3CQZ A;  1J6V A;  1YCL A;  1Y1V A;  1C0A A;  3GIR A;  1TWF K;  5TMF A;  4OIP A;  2R92 C;  3GTJ K;  1ZQ1 C;  3T01 A;  4BBR K;  2JA7 C;  1INN A;  4A3G C;  4MEY A;  5M5X K;  1XXA A;  4LR2 A;  4AYB D;  4WJ3 M;  2JA6 K;  2A69 A;  3S15 K;  1TWG C;  2YU9 A;  5C44 C;  4BXX C;  1AB4 A;  1WIH A;  3S16 C;  2FQT A;  4OIN A;  4GTE A;  2ZUF A;  5IYB C;  4WIL A;  1TWH C;  1PJ5 A;  3N0B A;  1XZQ B;  5L46 A;  3LAJ A;  4C3H K;  4GZY A;  5M5W K;  1YNJ A;  4A3D C;  2JA5 K;  1TWF C;  4GTC A;  4XSZ A;  5HL8 A;  4FM9 A;  5M3M K;  4ZH4 A;  2JA8 C;  4KMA A;  3GTO A;  2JA6 C;  1EQR A;  3PO3 K;  3G4C A;  2A68 A;  3OPF A;  1I50 K;  1L0W A;  3ADA C;  3V4G A;  4BLB A;  1I6H C;  1IW7 A;  1I6V A;  5IYC K;  2NVX A;  4C3H C;  1B4B A;  3S1N K;  4OIQ A;  3HOU C;  2NVT C;  1YX2 A;  3GTP C;  2VUM A;  2B63 A;  1XXB A;  1XZP B;  2BE5 A;  1J6X A;  5TMC A;  5C3E C;  3S1R K;  1IS1 A;  3GTM A;  5IYD K;  2Y0S D;  5IP7 K;  1SFO K;  1ZVU A;  1I3Q A;  4C2M C;  1TWC C;  4X6A K;  3IPJ A;  3M4O C;  3T02 A;  4DDQ A;  2CFA B;  3LAP A;  3I4N K;  1VJE A;  4Y52 K;  3RZD K;  3S2H C;  1TWA K;  4KMU A;  4XLP A;  4A3C K;  4LK1 A;  1VRQ C;  1G51 A;  2CW0 A;  3HOX C;  3HOV K;  4XLN A;  3MML B;  2E2H A;  4PAB A;  1KQ4 A;  1USO A;  4LJZ A;  4LLG A;  3SZZ A;  1ZXO A;  4A3E K;  4A3J K;  3S1R C;  1WOS A;  5CHP A;  5IYD C;  5IP7 C;  1Y1W K;  2PMZ L;  1SFO C;  4A93 K;  3H0G C;  4X6A C;  2PHC B;  5M3F K;  4GTD A;  1WSV A;  2R92 K;  1O24 A;  4A3G K;  1ZYR A;  4P5B A;  3RZD C;  1O28 A;  1TWA C;  2NVY C;  4G0W A;  4A3C C;  1TWG K;  2PPB A;  3PO2 C;  2GSO A;  2WAQ D;  4BXX K;  4QIW L;  1F9N A;  2EBB A;  3GTL A;  3Q3Q A;  1O27 A;  3LPX A;  3EQL A;  4A3E C;  4A3J C;  1TWH K;  1VGX A;  3ERE D;  5FJ8 K;  3A8J A;  1Y1W C;  1K83 A;  2E2J K;  1DCP A;  4KDD A;  4MEX A;  4KN4 A;  1O26 A;  3HKZ D;  4GTL A;  4KAR A;  4FZB A;  2GAG C;  1IL2 A;  2VUM C;  4A3D K;  1WQH A;  1WQF A;  4YFN A;  4Q5S A;  1BGW A;  2GSU A;  5C4X C;  2JA8 K;  4O2D A;  5IOQ A;  1YNN A;  1B4A A;  1WCM A;  1J98 A;  2E2I A;  1IBA A;  4WJ4 A;  2GSN A;  4G0V A;  1F93 A;  3GTK A;  4KMH A;  1HQM A;  4XSX A;  3AQP A;  1I6H K;  2FQO A;  2E2J C;  4M1X A; 
#chains in the Genus database with same CATH homology
 2PMZ D;  5IP9 K;  4C3J K;  1I6V A;  5IP9 C;  5IYC K;  5IYC C;  5FLM K;  3M3Y C;  2B63 K;  3GTQ C;  2E2H K;  2B63 C;  3HOU K;  4AYB L;  2E2H C;  4OIO A;  4OIQ A;  2NVT K;  3HOU C;  3S1N K;  2NVT C;  1SMY A;  4MQ9 A;  3S1N C;  2WB1 D;  3GTP K;  2WAQ L;  3GTM K;  3HOY K;  3GTP C;  3GTM C;  3S1M K;  3S1M C;  4QJV B;  4A3K K;  1I3Q C;  3CQZ K;  3DXJ A;  1R9T C;  2PA8 D;  2BE5 A;  1Y1V K;  5C3E K;  4G7O A;  5TMC A;  5C3E C;  4G7Z A;  3S1R K;  5IYD K;  2Y0S D;  5IP7 K;  1SFO K;  4C2M K;  1TWC K;  4Y7N K;  4QIW D;  1BDF A;  1TWC C;  4Y7N C;  4YFX A;  3HKZ L;  4X6A K;  3M4O K;  5C4J C;  3GTG K;  3M4O C;  3FKI K;  3GTG C;  4BY7 K;  3FKI C;  4BY7 C;  4BBS K;  2R93 K;  4LK0 A;  2R7Z K;  4BY1 K;  4BBS C;  2R93 C;  2WB1 L;  4BY1 C;  4A3F K;  2R7Z C;  3S2D C;  3I4N K;  2A6H A;  4A3F C;  4A3I K;  4A3M K;  3H3V L;  3I4N C;  4A3M C;  2YU9 K;  4Y52 K;  2JA7 K;  4Y52 C;  3S2H K;  5FLM C;  4OIR A;  3RZD K;  3S2H C;  3GTL K;  1TWA K;  3GTL C;  3I4M K;  4A3L K;  4KMU A;  4XLP A;  4A3C K;  4LK1 A;  3S1Q K;  4A3L C;  3S1Q C;  3HOY C;  4A3B K;  2CW0 A;  3HOX K;  4A3B C;  3HOX C;  5C44 K;  3HOV K;  1K83 K;  4XLN A;  3HOV C;  4QJV A;  1XPP A;  4A3K C;  3CQZ C;  3S16 K;  3K7A K;  4LJZ A;  3K7A C;  4LLG A;  4Q4Z A;  1Y1V C;  5IYB K;  4A3E K;  4A3J K;  3S1R C;  5IYD C;  1Y1W K;  5IP7 C;  1SFO C;  2PMZ L;  4A93 K;  3H0G K;  4A93 C;  3H0G C;  4A3C C;  2O5I A;  4X6A C;  5M3F K;  3WOD A;  4G7H A;  2E2I K;  1WCM K;  1WCM C;  1TWF K;  5TMF A;  2R92 K;  4OIP A;  2R92 C;  3GTJ K;  5D4D A;  3GTJ C;  4A3I C;  4A3G K;  2YU9 C;  4BBR K;  2JA7 C;  4A3G C;  1ZYR A;  4BBR C;  4MEY A;  3RZD C;  3GTK K;  5M5X K;  3GTK C;  1TWA C;  2NVY K;  4AYB D;  2NVY C;  3I4M C;  2JA6 K;  2A69 A;  1TWG K;  2PA8 L;  3S15 K;  4JK1 A;  1TWG C;  3PO2 K;  4YFK A;  2PPB A;  3HOZ K;  4NOI A;  3HOZ C;  3PO2 C;  3S15 C;  2WAQ D;  2Y0S L;  4BXX K;  5C44 C;  4BXX C;  4QIW L;  1K83 C;  3RZO K;  3RZO C;  3S17 K;  2NVX K;  3S16 C;  4YG2 A;  4OIN A;  3HOW K;  3EQL A;  3HOW C;  5IYB C;  4A3E C;  4A3J C;  1TWH K;  2A6E A;  1TWH C;  5FJ8 K;  1Y1W C;  2E2J K;  4MEX A;  4KN4 A;  4GZY A;  4C3H K;  3HKZ D;  3M3Y K;  3GTQ K;  5M5W K;  1YNJ A;  2VUM K;  3GTO K;  2E2I C;  2VUM C;  3GTO C;  4A3D K;  4A3D C;  2JA5 K;  1TWF C;  2JA5 C;  4XSZ A;  4YFN A;  4Q5S A;  4C3I K;  3H3V D;  5C4X K;  5M3M K;  5C4X C;  4ZH4 A;  1I3Q K;  2JA8 K;  1YNN A;  2JA8 C;  1R9T K;  2JA6 C;  3PO3 K;  5M5Y K;  3PO3 C;  2NVQ K;  2NVQ C;  2O5J A;  2A68 A;  3S17 C;  1HQM A;  1I50 K;  2NVX C;  1I50 C;  5C4J K;  4XSX A;  3S2D K;  1I6H K;  3S14 K;  1I6H C;  3S14 C;  2E2J C;  1IW7 A;  4KN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...