3S1NK

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1nK00
1ZYRA 3GTQK 1R9TC 1TWAK 4LK1A 3S1MK 3S1QK 3PO2C 1WCMC 3FKIK 3RZOC 5C4JK 3RZDC 4C3JK 3S1NC 3GTLK 4MEXA 2JA5C 4YFKA 2R7ZC 3GTGK 3S1MC 3GTQC 1TWAC 4A3IK 3HOZK 3S2DK 4GZYA 3HKZL 3S1QC 4A3LK 3FKIC 3S17K 5IYCK 5C4JC 2PA8L 3M4OK 2WAQD 3I4NK 4A3BC 3GTGC 3GTLC 2O5IA 4YG2A 2A6EA 4KN4A 4A3IC 3S1RK 3HOZC 3S2DC 2NVYK 4A3LC 3S17C 5IP9K 5IYCC 3M4OC 3I4NC 4A3GK 4BY7K 3S1RC 5C44K 2A69A 1YNNA 3PO3K 2NVYC 4ZH4A 5M5WK 5IYDK 5IP9C 4A3GC 4BY7C 4OIPA 4A3CK 5C44C 4AYBL 3PO3C 1SMYA 5IP7K 4X6AK 5IYDC 4MEYA 1I3QK 4A3FK 2NVXC 3S14K 3GTPK 3H3VL 4OIQA 2VUMK 4Y7NK 4A3CC 3M3YK 1IW7A 5IP7C 3S16K 2E2IK 3DXJA 4XLPA 3EQLA 1I3QC 4A3FC 3S14C 4XSZA 3GTPC 2NVTK 3S15K 2R93K 2VUMC 3K7AK 3HOWK 4Y7NC 1BDFA 2Y0SL 3M3YC 4A3MC 4A3DK 4G7HA 3HOVK 1XPPA 3S16C 2WB1L 4XLNA 4Y52K 4LLGA 1TWGK 4MQ9A 4Q5SA 4C3IK 2NVTC 3S15C 2R93C 3K7AC 2NVQK 3HOWC 5C4XK 4OIRA 3HOVC 3HKZD 3WODA 3S2HK 4Y52C 1TWGC 2BE5A 2PA8D 3I4MK 1TWCK 2E2HK 4XSXA 4QIWL 3HOUK 2NVQC 5M5XK 5TMFA 4NOIA 5C4XC 5TMCA 4A3KK 4BXXK 1SFOK 1K83K 5IYBK 2JA7K 3S2HC 3GTKK 3I4MC 1TWCC 2E2HC 5FLMK 3HOUC 1HQMA 4A3KC 4BXXC 1SFOC 1K83C 2CW0A 4YFNA 5IYBC 2JA7C 4LK0A 2A6HA 5FJ8K 3CQZK 2PPBA 4OINA 3GTKC 3GTOK 3H0GK 4Q4ZA 5FLMC 2O5JA 1Y1VK 4QIWD 2R7ZK 4BY1K 4AYBD 2E2IC 2WAQL 4G7ZA 4A3EK 2JA5K 2B63K 1Y1WK 3GTOC 3CQZC 1I50K 4OIOA 5M5YK 5C3EK 3H0GC 2JA6K 4QJVA 4BBRK 4YFXA 3H3VD 1I6VA 1Y1VC 3GTMK 4BY1C 4A93K 3HOXK 4G7OA 1I6HK 4A3EC 2B63C 4A3BK 2PMZL 4QJVB 1Y1WC 1I50C 2JA8K 4KMUA 5C3EC 2NVXK 4C2MK 4BBRC 2E2JK 2JA6C 3GTMC 4A3DC 2Y0SD 4X6AC 5D4DA 3HOXC 3HOYK 4A93C 1I6HC 2WB1D 1TWHK 4LJZA 2JA8C 4A3JK 1YNJA 2A68A 1TWFK 2E2JC 4BBSK 5M3FK 3HOYC 2R92K 2YU9K 3GTJK 4A3MK 4C3HK 1TWHC 1R9TK 2PMZD 4A3JC 3PO2K 1TWFC 4BBSC 1WCMK 3RZOK 4KN7A 4JK1A 3RZDK 2R92C 3S1NK 2YU9C 3GTJC 5M3MK
chains in the Genus database with same CATH superfamily
4KMHA 3FHZA 1B4AA 4C3JK 1YX2A 3GTLK 3S1NC 1WOSA 1TWAC 4A3IK 3S2DK 3S17K 3M4OK 4A3BC 3I4NK 1O28A 1ZVUA 3BP3A 4YG2A 3S1RK 3HOZC 2B63A 3G4CA 4A3GK 2JA6A 1C0AA 1YNNA 5IOTA 1HI9A 5M5WK 1TWCA 5IP9C 3TFHA 1WORA 2XCRB 5IYDC 3GTPK 1VH2A 1EQRA 4Y7NK 5CJ9A 2KWAA 4A3CC 1PJ5A 5IP7C 3VA7A 2YU9A 4A3FC 1Y1VA 3N0CA 2R93K 3K7AK 1XZQA 1ZQ1C 1DCHA 1Y1WA 1I50A 4XLNA 3BUEA 4Y52K 1O2BA 1TWGK 2V6UA 3S15C 2RH6A 1IQ0A 2PA8D 3I4MK 2E2HK 1UV7A 4XSXA 3HOUK 2NVQC 4P9SA 1IBAA 5TMCA 4A3KK 4BXXK 3QX3A 3GEIA 1EFWA 5FLMK 2R92A 1HQMA 3GTJA 4KMDA 1K83C 2CW0A 2JA7C 3GTOK 3GTKC 3GDZA 4BY1K 2E2IC 2WAQL 4G7ZA 2JH3A 3CQZC 3H3VD 4YFXA 4X6AK 1I6VA 4G7OA 1EH1A 1VRQC 4GTAA 4QJVB 3T02A 3OREA 3GTMC 3HOYK 3HOXC 2WB1D 4KC6A 4A3JK 4C2MC 4C3HK 1TWHC 4BBSC 1WCMK 1DCOA 2GAGC 4LR2A 5JVOA 5M3MK 1ZYRA 3GTQK 1R9TC 3S1MK 2FQTA 3PO2C 5JFEA 3L4KA 3FKIK 1I3QA 4GTEA 5C4JK 3RZDC 4MEXA 2JA5C 4YFKA 2R7ZC 1RU0A 2E2IA 1O2AA 3HKZL 2ZUFA 3CQZA 3SZZA 5IYCK 3TFIA 1IS1A 4C3JC 3GTLC 4XCHA 3OPFA 2A6EA 4A3IC 3S2DC 4G0UA 2NVYK 3S17C 3M4OC 1IL2A 3I4NC 4KM9A 5IORA 1J6XA 3GTMA 3S1RC 5C44K 3PO3K 2GSNA 2CFAA 4A3GC 1WSVA 1SFOA 3AH5A 1VJEA 3FOEA 1EK8A 1TWHA 3S14K 3GSIA 3T01A 2VUMK 1IW7A 4XLPA 1VGXA 1X31C 5TJ3A 3GTPC 1F7VA 5EGEA 4Y7NC 1BDFA 1YCLA 3HOVK 2GSUA 4P5AA 1WOPA 1DD5A 2R93C 2P8TA 3K7AC 3A8JA 5C4XK 1O27A 4ILDA 1J6VA 3GTLA 3WODA 1O26A 4GTBA 4Y52C 1TWGC 1TWCK 4QIWL 5L46A 4GTFA 4NOIA 4BLBA 5IYBK 4KAWX 1J98A 1TWFA 3I4MC 3AQOA 2E2HC 3HOUC 4KASA 1ZXOA 4A3KC 4BXXC 3ADAC 3NUHA 2PPBA 3H0GK 4KB4A 5FLMC 4Q4ZA 4G0WA 1Y1VK 4QIWD 3AQPA 1TWAA 1Y1WK 3GTOC 1I50K 5E68A 4OIOA 4A3DK 1XZPB 4BY1C 1I6HK 3GTPA 1BGWA 1WQGA 4A3BK 4X6AC 5D4DA 3FOFA 2R93A 4WILA 1ZBSA 3GEHA 1TWGA 3HOYC 3AD8C 2R92K 3GTJK 4A3MK 3JSTA 1B4BA 4A3JC 4FZBA 3AD7C 3RZOK 2E2HA 4C3HC 4LK1A 3S1QK 4KMAA 4GTLA 1WCMC 3GIRA 3GTGK 3S1MC 3GTQC 4A3LK 1O25A 3FKIC 5C4JC 4KB2A 2WAQD 1USMA 4KN4A 1IE0A 1F9NA 2P5MA 5CHPA 1INNA 5IYCC 4BY7K 5HL8A 3N0BA 2NVYC 3BP8C 1USOA 5IOSA 1K83A 2GSOA 5C44C 4AYBL 2JA7A 3PO3C 3GTKA 4MEYA 1I3QK 2NVXC 4OIQA 4BKWA 3TFJA 1WSRA 3M3YK 3S16K 2E2IK 1F7UA 3IPJA 3S14C 4G0VA 4XSZA 2NVTK 1WCMA 2VUMC 3HOWK 2Y0SL 1XPPA 1XZPA 2FQOA 4AH6A 3TTGA 4C3IK 2V6TA 3HOVC 3HKZD 3S2HK 3G4AA 4KATA 4WJ3M 3LAPA 5TMFA 5C4XC 1PJ7A 1SFOK 1BJTA 1TWCC 2XCOA 1GE9A 4BLAA 5IYBC 1R9TA 2A6HA 4OINA 3ERED 2D6FC 2O5JA 2R7ZK 2R7ZA 2NVXA 2JA5A 4A3EK 2B63K 3Q3QA 4KDDA 2Y3PA 5M5YK 5C3EK 3H0GC 2ZUEA 2JA6K 3GEEA 4QJVA 4BBRK 4Q5SA 1Y1VC 2RGRA 4A93K 4M1XA 2VUMA 1Y1WC 1I50C 2JA8K 1XXAA 2NVXK 4A3DC 2E2JK 1I6HC 2PHCB 4LJZA 4PABA 4PAAA 1YNJA 2A68A 1TWFK 1XXCA 3LAJA 2YU9K 4C45A 1O29A 1DCPA 4LQYA 4KN7A 4JK1A 2R92C 3S1NK 3GTJC 4A3MC 3CAGA 1TWAK 4GTDA 4GT9A 1F93A 3RZOC 4J3NA 1V5VA 1O2FB 3HOZK 4GZYA 1VLOA 3S1QC 1G51A 2PA8L 3H0GA 3GTGC 2O5IA 3A8IA 4A3LC 3LPXA 2EBBA 5IP9K 1WQHA 2A69A 4ZH4A 5IYDK 3L4JA 2XCQA 4KM8A 1JOEA 4BY7C 4OIPA 4A3CK 2CFAB 1SMYA 5IP7K 4GTCA 2GAHC 4A3FK 3H3VL 3V4GA 3AD9C 4LOWA 3A8KA 4FM9A 3GTOA 3DXJA 3EQLA 1I3QC 3S15K 3M3YC 4G7HA 3S16C 2WB1L 4LLGA 1JQWA 4MQ9A 2NVTC 1WIHA 2NVQK 3HOWC 4OIRA 3GTGA 3OEPA 2BE5A 4C3IC 1BS2A 1J6WA 5M5XK 3N3YA 1EI6A 1K83K 5IOQA 2JA7K 2V6SA 3S2HC 1JVIA 3GTKK 4DDQA 4O2DA 3S0XA 1WQFA 1SFOC 4YFNA 1XXBA 5EGHA 4LK0A 5FJ8K 3CQZK 4WJ4A 1O24A 4AYBD 4GFQA 1XZQB 3GTQA 3FKIA 3GTMK 3SZYA 3HOXK 4A3EC 2B63C 2PMZL 3MMLB 4KMUA 5C3EC 2JA6C 1AB4A 4BBRC 4C2MK 1PJ6A 2Y0SD 4A93C 4P5BA 1L0WA 4RMFA 1TWHK 2NVYA 2JA8C 3HXAA 2E2JC 4BBSK 5M3FK 4KARA 2ZFZA 1R9TK 2PMZD 3PO2K 1TWFC 1ISEA 3T00A 1KQ4A 1WOOA 3RZDK 2YU9C 2W7VA 2JA5K
chains in the Genus database with same CATH topology
1ZYRA 3GTQK 1R9TC 1TWAK 4LK1A 3S1MK 3S1QK 3PO2C 1WCMC 3FKIK 3RZOC 5C4JK 3RZDC 4C3JK 3S1NC 3GTLK 4MEXA 2JA5C 4YFKA 2R7ZC 3GTGK 3S1MC 3GTQC 1TWAC 4A3IK 3HOZK 3S2DK 4GZYA 3HKZL 3S1QC 4A3LK 3FKIC 3S17K 5IYCK 5C4JC 2PA8L 3M4OK 2WAQD 3I4NK 4A3BC 3GTGC 3GTLC 2O5IA 4YG2A 2A6EA 4KN4A 4A3IC 3S1RK 3HOZC 3S2DC 2NVYK 4A3LC 3S17C 5IP9K 5IYCC 3M4OC 3I4NC 4A3GK 4BY7K 3S1RC 5C44K 2A69A 1YNNA 3PO3K 2NVYC 4ZH4A 5M5WK 5IYDK 5IP9C 4A3GC 4BY7C 4OIPA 4A3CK 5C44C 4AYBL 3PO3C 1SMYA 5IP7K 4X6AK 5IYDC 4MEYA 1I3QK 4A3FK 2NVXC 3S14K 3GTPK 3H3VL 4OIQA 2VUMK 4Y7NK 4A3CC 3M3YK 1IW7A 5IP7C 3S16K 2E2IK 3DXJA 4XLPA 3EQLA 1I3QC 4A3FC 3S14C 4XSZA 3GTPC 2NVTK 3S15K 2R93K 2VUMC 3K7AK 3HOWK 4Y7NC 1BDFA 2Y0SL 3M3YC 4A3MC 4A3DK 4G7HA 3HOVK 1XPPA 3S16C 2WB1L 4XLNA 4Y52K 4LLGA 1TWGK 4MQ9A 4Q5SA 4C3IK 2NVTC 3S15C 2R93C 3K7AC 2NVQK 3HOWC 5C4XK 4OIRA 3HOVC 3HKZD 3WODA 3S2HK 4Y52C 1TWGC 2BE5A 2PA8D 3I4MK 1TWCK 2E2HK 4XSXA 4QIWL 3HOUK 2NVQC 5M5XK 5TMFA 4NOIA 5C4XC 5TMCA 4A3KK 4BXXK 1SFOK 1K83K 5IYBK 2JA7K 3S2HC 3GTKK 3I4MC 1TWCC 2E2HC 5FLMK 3HOUC 1HQMA 4A3KC 4BXXC 1SFOC 1K83C 2CW0A 4YFNA 5IYBC 2JA7C 4LK0A 2A6HA 5FJ8K 3CQZK 2PPBA 4OINA 3GTKC 3GTOK 3H0GK 4Q4ZA 5FLMC 2O5JA 1Y1VK 4QIWD 2R7ZK 4BY1K 4AYBD 2E2IC 2WAQL 4G7ZA 4A3EK 2JA5K 2B63K 1Y1WK 3GTOC 3CQZC 1I50K 4OIOA 5M5YK 5C3EK 3H0GC 2JA6K 4QJVA 4BBRK 4YFXA 3H3VD 1I6VA 1Y1VC 3GTMK 4BY1C 4A93K 3HOXK 4G7OA 1I6HK 4A3EC 2B63C 4A3BK 2PMZL 4QJVB 1Y1WC 1I50C 2JA8K 4KMUA 5C3EC 2NVXK 4C2MK 4BBRC 2E2JK 2JA6C 3GTMC 4A3DC 2Y0SD 4X6AC 5D4DA 3HOXC 3HOYK 4A93C 1I6HC 2WB1D 1TWHK 4LJZA 2JA8C 4A3JK 1YNJA 2A68A 1TWFK 2E2JC 4BBSK 5M3FK 3HOYC 2R92K 2YU9K 3GTJK 4A3MK 4C3HK 1TWHC 1R9TK 2PMZD 4A3JC 3PO2K 1TWFC 4BBSC 1WCMK 3RZOK 4KN7A 4JK1A 3RZDK 2R92C 3S1NK 2YU9C 3GTJC 5M3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR A;  3GTQ K;  1R9T C;  1TWA K;  4LK1 A;  3S1M K;  3S1Q K;  3PO2 C;  1WCM C;  3FKI K;  3RZO C;  5C4J K;  3RZD C;  4C3J K;  3S1N C;  3GTL K;  4MEX A;  2JA5 C;  4YFK A;  2R7Z C;  3GTG K;  3S1M C;  3GTQ C;  1TWA C;  4A3I K;  3HOZ K;  3S2D K;  4GZY A;  3HKZ L;  3S1Q C;  4A3L K;  3FKI C;  3S17 K;  5IYC K;  5C4J C;  2PA8 L;  3M4O K;  2WAQ D;  3I4N K;  4A3B C;  3GTG C;  3GTL C;  2O5I A;  4YG2 A;  2A6E A;  4KN4 A;  4A3I C;  3S1R K;  3HOZ C;  3S2D C;  2NVY K;  4A3L C;  3S17 C;  5IP9 K;  5IYC C;  3M4O C;  3I4N C;  4A3G K;  4BY7 K;  3S1R C;  5C44 K;  2A69 A;  1YNN A;  3PO3 K;  2NVY C;  4ZH4 A;  5M5W K;  5IYD K;  5IP9 C;  4A3G C;  4BY7 C;  4OIP A;  4A3C K;  5C44 C;  4AYB L;  3PO3 C;  1SMY A;  5IP7 K;  4X6A K;  5IYD C;  4MEY A;  1I3Q K;  4A3F K;  2NVX C;  3S14 K;  3GTP K;  3H3V L;  4OIQ A;  2VUM K;  4Y7N K;  4A3C C;  3M3Y K;  1IW7 A;  5IP7 C;  3S16 K;  2E2I K;  3DXJ A;  4XLP A;  3EQL A;  1I3Q C;  4A3F C;  3S14 C;  4XSZ A;  3GTP C;  2NVT K;  3S15 K;  2R93 K;  2VUM C;  3K7A K;  3HOW K;  4Y7N C;  1BDF A;  2Y0S L;  3M3Y C;  4A3M C;  4A3D K;  4G7H A;  3HOV K;  1XPP A;  3S16 C;  2WB1 L;  4XLN A;  4Y52 K;  4LLG A;  1TWG K;  4MQ9 A;  4Q5S A;  4C3I K;  2NVT C;  3S15 C;  2R93 C;  3K7A C;  2NVQ K;  3HOW C;  5C4X K;  4OIR A;  3HOV C;  3HKZ D;  3WOD A;  3S2H K;  4Y52 C;  1TWG C;  2BE5 A;  2PA8 D;  3I4M K;  1TWC K;  2E2H K;  4XSX A;  4QIW L;  3HOU K;  2NVQ C;  5M5X K;  5TMF A;  4NOI A;  5C4X C;  5TMC A;  4A3K K;  4BXX K;  1SFO K;  1K83 K;  5IYB K;  2JA7 K;  3S2H C;  3GTK K;  3I4M C;  1TWC C;  2E2H C;  5FLM K;  3HOU C;  1HQM A;  4A3K C;  4BXX C;  1SFO C;  1K83 C;  2CW0 A;  4YFN A;  5IYB C;  2JA7 C;  4LK0 A;  2A6H A;  5FJ8 K;  3CQZ K;  2PPB A;  4OIN A;  3GTK C;  3GTO K;  3H0G K;  4Q4Z A;  5FLM C;  2O5J A;  1Y1V K;  4QIW D;  2R7Z K;  4BY1 K;  4AYB D;  2E2I C;  2WAQ L;  4G7Z A;  4A3E K;  2JA5 K;  2B63 K;  1Y1W K;  3GTO C;  3CQZ C;  1I50 K;  4OIO A;  5M5Y K;  5C3E K;  3H0G C;  2JA6 K;  4QJV A;  4BBR K;  4YFX A;  3H3V D;  1I6V A;  1Y1V C;  3GTM K;  4BY1 C;  4A93 K;  3HOX K;  4G7O A;  1I6H K;  4A3E C;  2B63 C;  4A3B K;  2PMZ L;  4QJV B;  1Y1W C;  1I50 C;  2JA8 K;  4KMU A;  5C3E C;  2NVX K;  4C2M K;  4BBR C;  2E2J K;  2JA6 C;  3GTM C;  4A3D C;  2Y0S D;  4X6A C;  5D4D A;  3HOX C;  3HOY K;  4A93 C;  1I6H C;  2WB1 D;  1TWH K;  4LJZ A;  2JA8 C;  4A3J K;  1YNJ A;  2A68 A;  1TWF K;  2E2J C;  4BBS K;  5M3F K;  3HOY C;  2R92 K;  2YU9 K;  3GTJ K;  4A3M K;  4C3H K;  1TWH C;  1R9T K;  2PMZ D;  4A3J C;  3PO2 K;  1TWF C;  4BBS C;  1WCM K;  3RZO K;  4KN7 A;  4JK1 A;  3RZD K;  2R92 C;  3S1N K;  2YU9 C;  3GTJ C;  5M3M K; 
#chains in the Genus database with same CATH topology
 4KMH A;  3FHZ A;  1B4A A;  4C3J K;  1YX2 A;  3GTL K;  3S1N C;  1WOS A;  1TWA C;  4A3I K;  3S2D K;  3S17 K;  3M4O K;  4A3B C;  3I4N K;  1O28 A;  1ZVU A;  3BP3 A;  4YG2 A;  3S1R K;  3HOZ C;  2B63 A;  3G4C A;  4A3G K;  2JA6 A;  1C0A A;  1YNN A;  5IOT A;  1HI9 A;  5M5W K;  1TWC A;  5IP9 C;  3TFH A;  1WOR A;  2XCR B;  5IYD C;  3GTP K;  1VH2 A;  1EQR A;  4Y7N K;  5CJ9 A;  2KWA A;  4A3C C;  1PJ5 A;  5IP7 C;  3VA7 A;  2YU9 A;  4A3F C;  1Y1V A;  3N0C A;  2R93 K;  3K7A K;  1XZQ A;  1ZQ1 C;  1DCH A;  1Y1W A;  1I50 A;  4XLN A;  3BUE A;  4Y52 K;  1O2B A;  1TWG K;  2V6U A;  3S15 C;  2RH6 A;  1IQ0 A;  2PA8 D;  3I4M K;  2E2H K;  1UV7 A;  4XSX A;  3HOU K;  2NVQ C;  4P9S A;  1IBA A;  5TMC A;  4A3K K;  4BXX K;  3QX3 A;  3GEI A;  1EFW A;  5FLM K;  2R92 A;  1HQM A;  3GTJ A;  4KMD A;  1K83 C;  2CW0 A;  2JA7 C;  3GTO K;  3GTK C;  3GDZ A;  4BY1 K;  2E2I C;  2WAQ L;  4G7Z A;  2JH3 A;  3CQZ C;  3H3V D;  4YFX A;  4X6A K;  1I6V A;  4G7O A;  1EH1 A;  1VRQ C;  4GTA A;  4QJV B;  3T02 A;  3ORE A;  3GTM C;  3HOY K;  3HOX C;  2WB1 D;  4KC6 A;  4A3J K;  4C2M C;  4C3H K;  1TWH C;  4BBS C;  1WCM K;  1DCO A;  2GAG C;  4LR2 A;  5JVO A;  5M3M K;  1ZYR A;  3GTQ K;  1R9T C;  3S1M K;  2FQT A;  3PO2 C;  5JFE A;  3L4K A;  3FKI K;  1I3Q A;  4GTE A;  5C4J K;  3RZD C;  4MEX A;  2JA5 C;  4YFK A;  2R7Z C;  1RU0 A;  2E2I A;  1O2A A;  3HKZ L;  2ZUF A;  3CQZ A;  3SZZ A;  5IYC K;  3TFI A;  1IS1 A;  4C3J C;  3GTL C;  4XCH A;  3OPF A;  2A6E A;  4A3I C;  3S2D C;  4G0U A;  2NVY K;  3S17 C;  3M4O C;  1IL2 A;  3I4N C;  4KM9 A;  5IOR A;  1J6X A;  3GTM A;  3S1R C;  5C44 K;  3PO3 K;  2GSN A;  2CFA A;  4A3G C;  1WSV A;  1SFO A;  3AH5 A;  1VJE A;  3FOE A;  1EK8 A;  1TWH A;  3S14 K;  3GSI A;  3T01 A;  2VUM K;  1IW7 A;  4XLP A;  1VGX A;  1X31 C;  5TJ3 A;  3GTP C;  1F7V A;  5EGE A;  4Y7N C;  1BDF A;  1YCL A;  3HOV K;  2GSU A;  4P5A A;  1WOP A;  1DD5 A;  2R93 C;  2P8T A;  3K7A C;  3A8J A;  5C4X K;  1O27 A;  4ILD A;  1J6V A;  3GTL A;  3WOD A;  1O26 A;  4GTB A;  4Y52 C;  1TWG C;  1TWC K;  4QIW L;  5L46 A;  4GTF A;  4NOI A;  4BLB A;  5IYB K;  4KAW X;  1J98 A;  1TWF A;  3I4M C;  3AQO A;  2E2H C;  3HOU C;  4KAS A;  1ZXO A;  4A3K C;  4BXX C;  3ADA C;  3NUH A;  2PPB A;  3H0G K;  4KB4 A;  5FLM C;  4Q4Z A;  4G0W A;  1Y1V K;  4QIW D;  3AQP A;  1TWA A;  1Y1W K;  3GTO C;  1I50 K;  5E68 A;  4OIO A;  4A3D K;  1XZP B;  4BY1 C;  1I6H K;  3GTP A;  1BGW A;  1WQG A;  4A3B K;  4X6A C;  5D4D A;  3FOF A;  2R93 A;  4WIL A;  1ZBS A;  3GEH A;  1TWG A;  3HOY C;  3AD8 C;  2R92 K;  3GTJ K;  4A3M K;  3JST A;  1B4B A;  4A3J C;  4FZB A;  3AD7 C;  3RZO K;  2E2H A;  4C3H C;  4LK1 A;  3S1Q K;  4KMA A;  4GTL A;  1WCM C;  3GIR A;  3GTG K;  3S1M C;  3GTQ C;  4A3L K;  1O25 A;  3FKI C;  5C4J C;  4KB2 A;  2WAQ D;  1USM A;  4KN4 A;  1IE0 A;  1F9N A;  2P5M A;  5CHP A;  1INN A;  5IYC C;  4BY7 K;  5HL8 A;  3N0B A;  2NVY C;  3BP8 C;  1USO A;  5IOS A;  1K83 A;  2GSO A;  5C44 C;  4AYB L;  2JA7 A;  3PO3 C;  3GTK A;  4MEY A;  1I3Q K;  2NVX C;  4OIQ A;  4BKW A;  3TFJ A;  1WSR A;  3M3Y K;  3S16 K;  2E2I K;  1F7U A;  3IPJ A;  3S14 C;  4G0V A;  4XSZ A;  2NVT K;  1WCM A;  2VUM C;  3HOW K;  2Y0S L;  1XPP A;  1XZP A;  2FQO A;  4AH6 A;  3TTG A;  4C3I K;  2V6T A;  3HOV C;  3HKZ D;  3S2H K;  3G4A A;  4KAT A;  4WJ3 M;  3LAP A;  5TMF A;  5C4X C;  1PJ7 A;  1SFO K;  1BJT A;  1TWC C;  2XCO A;  1GE9 A;  4BLA A;  5IYB C;  1R9T A;  2A6H A;  4OIN A;  3ERE D;  2D6F C;  2O5J A;  2R7Z K;  2R7Z A;  2NVX A;  2JA5 A;  4A3E K;  2B63 K;  3Q3Q A;  4KDD A;  2Y3P A;  5M5Y K;  5C3E K;  3H0G C;  2ZUE A;  2JA6 K;  3GEE A;  4QJV A;  4BBR K;  4Q5S A;  1Y1V C;  2RGR A;  4A93 K;  4M1X A;  2VUM A;  1Y1W C;  1I50 C;  2JA8 K;  1XXA A;  2NVX K;  4A3D C;  2E2J K;  1I6H C;  2PHC B;  4LJZ A;  4PAB A;  4PAA A;  1YNJ A;  2A68 A;  1TWF K;  1XXC A;  3LAJ A;  2YU9 K;  4C45 A;  1O29 A;  1DCP A;  4LQY A;  4KN7 A;  4JK1 A;  2R92 C;  3S1N K;  3GTJ C;  4A3M C;  3CAG A;  1TWA K;  4GTD A;  4GT9 A;  1F93 A;  3RZO C;  4J3N A;  1V5V A;  1O2F B;  3HOZ K;  4GZY A;  1VLO A;  3S1Q C;  1G51 A;  2PA8 L;  3H0G A;  3GTG C;  2O5I A;  3A8I A;  4A3L C;  3LPX A;  2EBB A;  5IP9 K;  1WQH A;  2A69 A;  4ZH4 A;  5IYD K;  3L4J A;  2XCQ A;  4KM8 A;  1JOE A;  4BY7 C;  4OIP A;  4A3C K;  2CFA B;  1SMY A;  5IP7 K;  4GTC A;  2GAH C;  4A3F K;  3H3V L;  3V4G A;  3AD9 C;  4LOW A;  3A8K A;  4FM9 A;  3GTO A;  3DXJ A;  3EQL A;  1I3Q C;  3S15 K;  3M3Y C;  4G7H A;  3S16 C;  2WB1 L;  4LLG A;  1JQW A;  4MQ9 A;  2NVT C;  1WIH A;  2NVQ K;  3HOW C;  4OIR A;  3GTG A;  3OEP A;  2BE5 A;  4C3I C;  1BS2 A;  1J6W A;  5M5X K;  3N3Y A;  1EI6 A;  1K83 K;  5IOQ A;  2JA7 K;  2V6S A;  3S2H C;  1JVI A;  3GTK K;  4DDQ A;  4O2D A;  3S0X A;  1WQF A;  1SFO C;  4YFN A;  1XXB A;  5EGH A;  4LK0 A;  5FJ8 K;  3CQZ K;  4WJ4 A;  1O24 A;  4AYB D;  4GFQ A;  1XZQ B;  3GTQ A;  3FKI A;  3GTM K;  3SZY A;  3HOX K;  4A3E C;  2B63 C;  2PMZ L;  3MML B;  4KMU A;  5C3E C;  2JA6 C;  1AB4 A;  4BBR C;  4C2M K;  1PJ6 A;  2Y0S D;  4A93 C;  4P5B A;  1L0W A;  4RMF A;  1TWH K;  2NVY A;  2JA8 C;  3HXA A;  2E2J C;  4BBS K;  5M3F K;  4KAR A;  2ZFZ A;  1R9T K;  2PMZ D;  3PO2 K;  1TWF C;  1ISE A;  3T00 A;  1KQ4 A;  1WOO A;  3RZD K;  2YU9 C;  2W7V A;  2JA5 K; 
#chains in the Genus database with same CATH homology
 1ZYR A;  3GTQ K;  1R9T C;  1TWA K;  4LK1 A;  3S1M K;  3S1Q K;  3PO2 C;  1WCM C;  3FKI K;  3RZO C;  5C4J K;  3RZD C;  4C3J K;  3S1N C;  3GTL K;  4MEX A;  2JA5 C;  4YFK A;  2R7Z C;  3GTG K;  3S1M C;  3GTQ C;  1TWA C;  4A3I K;  3HOZ K;  3S2D K;  4GZY A;  3HKZ L;  3S1Q C;  4A3L K;  3FKI C;  3S17 K;  5IYC K;  5C4J C;  2PA8 L;  3M4O K;  2WAQ D;  3I4N K;  4A3B C;  3GTG C;  3GTL C;  2O5I A;  4YG2 A;  2A6E A;  4KN4 A;  4A3I C;  3S1R K;  3HOZ C;  3S2D C;  2NVY K;  4A3L C;  3S17 C;  5IP9 K;  5IYC C;  3M4O C;  3I4N C;  4A3G K;  4BY7 K;  3S1R C;  5C44 K;  2A69 A;  1YNN A;  3PO3 K;  2NVY C;  4ZH4 A;  5M5W K;  5IYD K;  5IP9 C;  4A3G C;  4BY7 C;  4OIP A;  4A3C K;  5C44 C;  4AYB L;  3PO3 C;  1SMY A;  5IP7 K;  4X6A K;  5IYD C;  4MEY A;  1I3Q K;  4A3F K;  2NVX C;  3S14 K;  3GTP K;  3H3V L;  4OIQ A;  2VUM K;  4Y7N K;  4A3C C;  3M3Y K;  1IW7 A;  5IP7 C;  3S16 K;  2E2I K;  3DXJ A;  4XLP A;  3EQL A;  1I3Q C;  4A3F C;  3S14 C;  4XSZ A;  3GTP C;  2NVT K;  3S15 K;  2R93 K;  2VUM C;  3K7A K;  3HOW K;  4Y7N C;  1BDF A;  2Y0S L;  3M3Y C;  4A3M C;  4A3D K;  4G7H A;  3HOV K;  1XPP A;  3S16 C;  2WB1 L;  4XLN A;  4Y52 K;  4LLG A;  1TWG K;  4MQ9 A;  4Q5S A;  4C3I K;  2NVT C;  3S15 C;  2R93 C;  3K7A C;  2NVQ K;  3HOW C;  5C4X K;  4OIR A;  3HOV C;  3HKZ D;  3WOD A;  3S2H K;  4Y52 C;  1TWG C;  2BE5 A;  2PA8 D;  3I4M K;  1TWC K;  2E2H K;  4XSX A;  4QIW L;  3HOU K;  2NVQ C;  5M5X K;  5TMF A;  4NOI A;  5C4X C;  5TMC A;  4A3K K;  4BXX K;  1SFO K;  1K83 K;  5IYB K;  2JA7 K;  3S2H C;  3GTK K;  3I4M C;  1TWC C;  2E2H C;  5FLM K;  3HOU C;  1HQM A;  4A3K C;  4BXX C;  1SFO C;  1K83 C;  2CW0 A;  4YFN A;  5IYB C;  2JA7 C;  4LK0 A;  2A6H A;  5FJ8 K;  3CQZ K;  2PPB A;  4OIN A;  3GTK C;  3GTO K;  3H0G K;  4Q4Z A;  5FLM C;  2O5J A;  1Y1V K;  4QIW D;  2R7Z K;  4BY1 K;  4AYB D;  2E2I C;  2WAQ L;  4G7Z A;  4A3E K;  2JA5 K;  2B63 K;  1Y1W K;  3GTO C;  3CQZ C;  1I50 K;  4OIO A;  5M5Y K;  5C3E K;  3H0G C;  2JA6 K;  4QJV A;  4BBR K;  4YFX A;  3H3V D;  1I6V A;  1Y1V C;  3GTM K;  4BY1 C;  4A93 K;  3HOX K;  4G7O A;  1I6H K;  4A3E C;  2B63 C;  4A3B K;  2PMZ L;  4QJV B;  1Y1W C;  1I50 C;  2JA8 K;  4KMU A;  5C3E C;  2NVX K;  4C2M K;  4BBR C;  2E2J K;  2JA6 C;  3GTM C;  4A3D C;  2Y0S D;  4X6A C;  5D4D A;  3HOX C;  3HOY K;  4A93 C;  1I6H C;  2WB1 D;  1TWH K;  4LJZ A;  2JA8 C;  4A3J K;  1YNJ A;  2A68 A;  1TWF K;  2E2J C;  4BBS K;  5M3F K;  3HOY C;  2R92 K;  2YU9 K;  3GTJ K;  4A3M K;  4C3H K;  1TWH C;  1R9T K;  2PMZ D;  4A3J C;  3PO2 K;  1TWF C;  4BBS C;  1WCM K;  3RZO K;  4KN7 A;  4JK1 A;  3RZD K;  2R92 C;  3S1N K;  2YU9 C;  3GTJ C;  5M3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...