3S1NK

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1nK00
4OIPA 4A3EC 2R7ZK 5C4XK 4XSXA 4A3JK 3GTQC 1WCMC 2A69A 1TWFK 1XPPA 4A3CK 3S2DK 3H0GC 4BY1K 1SFOC 4BXXK 5C44C 3S1RK 1I3QC 4Q4ZA 3CQZK 5TMFA 3S14K 4BY7C 4A3IC 2WB1D 3K7AC 4OIRA 2JA5K 1IW7A 3GTOC 4A93K 4LLGA 4A3FK 1R9TK 3GTMC 1I6HC 5C4XC 2JA6K 4A3GC 4QJVA 1Y1WC 4XLPA 2E2HC 2NVTK 3HOZK 4A3LK 3S1QC 5C3EK 3M4OC 2R93K 3HOVC 1TWCK 1I50K 5M5XK 4OIQA 4Y7NC 2NVXC 3H3VD 4Q5SA 2WAQD 5IYDK 3GTGK 2JA7K 4XSZA 1TWAK 4QJVB 4X6AK 2E2IC 3PO3C 2PA8L 3S1NK 2B63C 2PMZL 4MEXA 2R92K 1K83C 2JA8C 4YG2A 3S1MK 5IYBK 5FLMC 4BBRC 5IP7K 2A68A 3HOYC 4OIOA 3HOXC 1ZYRA 4YFXA 4LJZA 5IYCC 4KN4A 4A3KC 2E2JK 3HOUC 4Y52K 1TWGK 1Y1VK 3PO2K 4A3EK 5IP9K 4BBSC 3GTQK 3I4MC 1SMYA 1SFOK 2R7ZC 4A3BC 2BE5A 2NVYK 5C44K 4MEYA 4KMUA 5M5WK 4AYBL 3K7AK 4LK1A 4G7HA 4A3IK 5D4DA 3S16K 4BY1C 3GTKK 3GTJC 4YFKA 3I4MK 4G7OA 3CQZC 1Y1WK 3GTPC 3S1QK 4ZH4A 3M4OK 3EQLA 3S2HK 4OINA 1TWHK 4QIWL 3FKIK 2PA8D 4QIWD 2JA6C 3HOWC 5M5YK 4LK0A 2PMZD 3GTLC 2VUMC 4A3LC 4MQ9A 1TWCC 4A3MC 4C3IK 3RZOC 3I4NC 1HQMA 4C2MK 4XLNA 1BDFA 2YU9C 2NVQK 2A6EA 2CW0A 5IYDC 2A6HA 3GTGC 5M3FK 5FJ8K 5C4JC 1K83K 3RZDC 2JA8K 5FLMK 2Y0SL 3M3YC 1WCMK 3S15C 3S1NC 3HOZC 3HOYK 3H0GK 3HOXK 4GZYA 5TMCA 5IYBC 1I3QK 3HKZD 3HKZL 4A3KK 4A3JC 3HOUK 4BY7K 4AYBD 2PPBA 1TWFC 4A3CC 3S2DC 4BBSK 3GTOK 3S17C 4A3DC 4BXXC 3GTMK 3S1RC 3S14C 4A3GK 1TWGC 2E2HK 1Y1VC 3PO2C 4A3BK 5IP9C 4JK1A 1I6VA 2JA5C 1I6HK 4A93C 3HOVK 4A3FC 1R9TC 4G7ZA 3S17K 4A3DK 4C3JK 3GTJK 2NVTC 4Y7NK 3DXJA 2NVXK 2NVYC 5C3EC 2R93C 4C3HK 1I50C 2WB1L 4YFNA 3GTPK 3S16C 3GTKC 2E2IK 3PO3K 3HOWK 2JA7C 2B63K 1TWAC 3GTLK 2VUMK 4X6AC 3S2HC 1YNNA 4A3MK 2Y0SD 3I4NK 1TWHC 3RZOK 3FKIC 4BBRK 2YU9K 3WODA 2O5JA 2R92C 2O5IA 3H3VL 3S1MC 5IYCK 2WAQL 5M3MK 5C4JK 5IP7C 3RZDK 1YNJA 2NVQC 4KN7A 3M3YK 3S15K 4NOIA 2E2JC 4Y52C
chains in the Genus database with same CATH superfamily
4GT9A 4A3EC 1WCMC 3S2DK 4BXXK 3S1RK 1BS2A 2JA5K 4A3FK 1WCMA 4A3GC 4A3LK 3SZYA 5C3EK 1I50K 1EI6A 5M5XK 4M1XA 3H3VD 3MMLB 4LQYA 5IYDK 1XZPB 4X6AK 3S1NK 2GAHC 2B63C 2PMZL 4MEXA 3GTJA 1K83C 2RGRA 3S1MK 1B4AA 1IBAA 5FLMC 3Q3QA 3HOXC 1ZYRA 4KAWX 1TWGK 4Y52K 1Y1VK 2EBBA 4A3EK 2B63A 1K83A 5IOQA 2R7ZC 4KB2A 5M5WK 4AYBL 4G7HA 3G4AA 5D4DA 4C3JC 4KM8A 3L4KA 2W7VA 3CQZC 1EFWA 3TFHA 5JFEA 4FM9A 2R7ZA 3EQLA 1DD5A 1TWFA 5M5YK 4LK0A 4MQ9A 3RZOC 3CQZA 5EGHA 4C2MK 1BDFA 4XLNA 3QX3A 1R9TA 3OEPA 2ZFZA 4BKWA 5FJ8K 1K83K 5FLMK 2RH6A 2R93A 4P9SA 3HOXK 4GZYA 5TMCA 5IYBC 5C4XC 1XXBA 2PPBA 4LR2A 1O2FB 3GTOK 1O28A 3GTMK 1I6HK 3S0XA 4GTFA 4JK1A 4KDDA 1F7VA 4C3JK 2NVTC 1F9NA 2NVYC 1BGWA 2ZUEA 3AD8C 2NVYA 3S2HC 4PABA 2Y0SD 3RZOK 1TWHC 3FKIC 1RU0A 4GTEA 3T00A 5M3MK 2XCQA 1Y1WA 2NVQC 4NOIA 1TWHA 3FKIA 5C4XK 4KASA 4BY1K 4BLBA 3GEIA 1HI9A 1I3QC 4BY7C 1IW7A 2E2HC 2NVTK 3TFIA 5IOTA 1TWCK 1WQHA 1XXCA 1I3QA 4KMHA 4J3NA 1XZQB 4Y7NC 2NVXC 1F7UA 1C0AA 1O2BA 2WAQD 3GTGK 1JQWA 2E2HA 4QJVB 4RMFA 3GIRA 1XXAA 1JOEA 1EH1A 1WIHA 2NVXA 3GTPA 3CAGA 4GTBA 3HOYC 5IYCC 4A3KC 3PO2K 1WORA 1O26A 1SMYA 4A3BC 4MEYA 3S16K 3GTJC 3AH5A 3GSIA 4G0VA 1IL2A 4QIWL 2PA8D 4GTLA 2JA6C 1O27A 4A3MC 3N3YA 3JSTA 1EQRA 1VJEA 4GTCA 1GE9A 2JA6A 5M3FK 1WCMK 3BP8C 3HOZC 3GDZA 3HOYK 4A3KK 3HKZL 4A3JC 2JA7A 1TWFC 4A3CC 1TWAA 3ADAC 3S14C 3OREA 4A3GK 4A3BK 5IP9C 1I6VA 4KB4A 3TFJA 4A93C 1R9TC 4GFQA 1L0WA 3GTJK 2R93C 3GTKC 4KM9A 1V5VA 3GTQA 2ZUFA 2B63K 2CFAA 4A3MK 2O5JA 3GTKA 3AQOA 2O5IA 2XCRB 2R92C 3H3VL 3GEHA 3HXAA 2P8TA 4WJ4A 4FZBA 2E2JC 3HOZK 2R7ZK 1WOSA 2R92A 1AB4A 1VRQC 4XSXA 4A3JK 2A69A 1TWFK 4G0WA 4A3CK 3H0GC 3S14K 3CQZK 2WB1D 3AD7C 4A93K 2V6UA 4LLGA 1R9TK 1USMA 1XZPA 1Y1WC 4XLPA 3H0GA 3S1QC 3T01A 2R93K 4WJ3M 3HOVC 3VA7A 1WSRA 1O24A 4KC6A 1DCHA 4O2DA 4C3HC 4C3IC 4XSZA 1WQFA 1VH2A 4KMDA 1VLOA 2E2IC 3PO3C 4GTAA 2GSOA 2R92K 2FQOA 2JA8C 5IYBK 1YCLA 3BUEA 4BBRC 2A68A 4OIOA 1O25A 3AQPA 2E2IA 4KN4A 2E2JK 3HOUC 4BBSC 3GTLA 3SZZA 1J6VA 3I4MC 2YU9A 2NVYK 4KMUA 4LK1A 3S17C 4A3DC 2GSNA 4KARA 1Y1WK 3GTPC 3S1QK 3S2HK 3G4CA 1TWHK 4QIWD 3FKIK 3HOWC 4A3LC 5CHPA 2PMZD 4C3IK 2NVQK 4XCHA 1O29A 1ZVUA 2GSUA 5IYDC 3RZDC 2JA8K 2Y0SL 1I50A 3S1NC 1PJ7A 1EK8A 1WOPA 1I3QK 3HKZD 5IORA 3HOUK 4BY7K 4AYBD 4BBSK 1TWGC 1X31C 1Y1VC 2E2HK 3IPJA 2D6FC 4GTDA 3S17K 1IS1A 4A3DK 1O2AA 4Y7NK 2NVXK 2P5MA 5EGEA 3GTPK 1ZQ1C 4YFNA 1TWGA 1Y1VA 1F93A 1IQ0A 3HOWK 4KATA 4C45A 2JA7C 1TWAC 2PHCB 2JH3A 1WQGA 4LOWA 5IYCK 2WAQL 1IE0A 4C2MC 5IP7C 3RZDK 3FHZA 3V4GA 5TJ3A 4OIPA 3GTQC 1BJTA 1XPPA 1SFOC 5C44C 4Q4ZA 5TMFA 4A3IC 3K7AC 4WILA 4OIRA 4P5AA 1XZQA 3GTOC 5L46A 3FOFA 3GTMC 2JA6K 3OPFA 4QJVA 1I6HC 1SFOA 3M4OC 3TTGA 4OIQA 3GTOA 3AD9C 4Q5SA 3GTMA 2JA7K 1TWAK 1VGXA 3T02A 3LAJA 2V6SA 5HL8A 2PA8L 1DCPA 4YG2A 1G51A 4DDQA 3A8IA 5IP7K 3L4JA 1WOOA 4ILDA 1YX2A 4LJZA 4YFXA 2XCOA 5IP9K 1USOA 1J6XA 3A8JA 3GTQK 2V6TA 1SFOK 2BE5A 2FQTA 5C44K 3BP3A 2KWAA 4A3IK 3K7AK 4BY1C 3GTKK 4YFKA 4G7OA 5CJ9A 3NUHA 1DCOA 4ZH4A 3M4OK 3LAPA 4OINA 5E68A 3ERED 3GTLC 2VUMC 2GAGC 1TWCC 3I4NC 1HQMA 2YU9C 1KQ4A 2Y3PA 2A6EA 2CW0A 3FOEA 2A6HA 3GTGC 5C4JC 1PJ6A 3A8KA 2VUMA 1J6WA 3M3YC 1TWCA 3S15C 3H0GK 1ZXOA 1PJ5A 3GTGA 3GEEA 3S2DC 1J98A 1ISEA 4PAAA 4BXXC 3S1RC 3N0CA 3PO2C 2JA5C 1B4BA 3HOVK 4A3FC 4G7ZA 1JVIA 4KMAA 4G0UA 4AH6A 5JVOA 3DXJA 3LPXA 5C3EC 1WSVA 4C3HK 1I50C 2WB1L 3S16C 2JA5A 2E2IK 3PO3K 5IOSA 3GTLK 2VUMK 3N0BA 4X6AC 1YNNA 3I4NK 4BBRK 2YU9K 3WODA 3S1MC 5C4JK 1ZBSA 1YNJA 2CFAB 4KN7A 1INNA 4BLAA 3M3YK 3S15K 3I4MK 1UV7A 4Y52C 4P5BA
chains in the Genus database with same CATH topology
4OIPA 4A3EC 2R7ZK 5C4XK 4XSXA 4A3JK 3GTQC 1WCMC 2A69A 1TWFK 1XPPA 4A3CK 3S2DK 3H0GC 4BY1K 1SFOC 4BXXK 5C44C 3S1RK 1I3QC 4Q4ZA 3CQZK 5TMFA 3S14K 4BY7C 4A3IC 2WB1D 3K7AC 4OIRA 2JA5K 1IW7A 3GTOC 4A93K 4LLGA 4A3FK 1R9TK 3GTMC 1I6HC 5C4XC 2JA6K 4A3GC 4QJVA 1Y1WC 4XLPA 2E2HC 2NVTK 3HOZK 4A3LK 3S1QC 5C3EK 3M4OC 2R93K 3HOVC 1TWCK 1I50K 5M5XK 4OIQA 4Y7NC 2NVXC 3H3VD 4Q5SA 2WAQD 5IYDK 3GTGK 2JA7K 4XSZA 1TWAK 4QJVB 4X6AK 2E2IC 3PO3C 2PA8L 3S1NK 2B63C 2PMZL 4MEXA 2R92K 1K83C 2JA8C 4YG2A 3S1MK 5IYBK 5FLMC 4BBRC 5IP7K 2A68A 3HOYC 4OIOA 3HOXC 1ZYRA 4YFXA 4LJZA 5IYCC 4KN4A 4A3KC 2E2JK 3HOUC 4Y52K 1TWGK 1Y1VK 3PO2K 4A3EK 5IP9K 4BBSC 3GTQK 3I4MC 1SMYA 1SFOK 2R7ZC 4A3BC 2BE5A 2NVYK 5C44K 4MEYA 4KMUA 5M5WK 4AYBL 3K7AK 4LK1A 4G7HA 4A3IK 5D4DA 3S16K 4BY1C 3GTKK 3GTJC 4YFKA 3I4MK 4G7OA 3CQZC 1Y1WK 3GTPC 3S1QK 4ZH4A 3M4OK 3EQLA 3S2HK 4OINA 1TWHK 4QIWL 3FKIK 2PA8D 4QIWD 2JA6C 3HOWC 5M5YK 4LK0A 2PMZD 3GTLC 2VUMC 4A3LC 4MQ9A 1TWCC 4A3MC 4C3IK 3RZOC 3I4NC 1HQMA 4C2MK 4XLNA 1BDFA 2YU9C 2NVQK 2A6EA 2CW0A 5IYDC 2A6HA 3GTGC 5M3FK 5FJ8K 5C4JC 1K83K 3RZDC 2JA8K 5FLMK 2Y0SL 3M3YC 1WCMK 3S15C 3S1NC 3HOZC 3HOYK 3H0GK 3HOXK 4GZYA 5TMCA 5IYBC 1I3QK 3HKZD 3HKZL 4A3KK 4A3JC 3HOUK 4BY7K 4AYBD 2PPBA 1TWFC 4A3CC 3S2DC 4BBSK 3GTOK 3S17C 4A3DC 4BXXC 3GTMK 3S1RC 3S14C 4A3GK 1TWGC 2E2HK 1Y1VC 3PO2C 4A3BK 5IP9C 4JK1A 1I6VA 2JA5C 1I6HK 4A93C 3HOVK 4A3FC 1R9TC 4G7ZA 3S17K 4A3DK 4C3JK 3GTJK 2NVTC 4Y7NK 3DXJA 2NVXK 2NVYC 5C3EC 2R93C 4C3HK 1I50C 2WB1L 4YFNA 3GTPK 3S16C 3GTKC 2E2IK 3PO3K 3HOWK 2JA7C 2B63K 1TWAC 3GTLK 2VUMK 4X6AC 3S2HC 1YNNA 4A3MK 2Y0SD 3I4NK 1TWHC 3RZOK 3FKIC 4BBRK 2YU9K 3WODA 2O5JA 2R92C 2O5IA 3H3VL 3S1MC 5IYCK 2WAQL 5M3MK 5C4JK 5IP7C 3RZDK 1YNJA 2NVQC 4KN7A 3M3YK 3S15K 4NOIA 2E2JC 4Y52C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP A;  4A3E C;  2R7Z K;  5C4X K;  4XSX A;  4A3J K;  3GTQ C;  1WCM C;  2A69 A;  1TWF K;  1XPP A;  4A3C K;  3S2D K;  3H0G C;  4BY1 K;  1SFO C;  4BXX K;  5C44 C;  3S1R K;  1I3Q C;  4Q4Z A;  3CQZ K;  5TMF A;  3S14 K;  4BY7 C;  4A3I C;  2WB1 D;  3K7A C;  4OIR A;  2JA5 K;  1IW7 A;  3GTO C;  4A93 K;  4LLG A;  4A3F K;  1R9T K;  3GTM C;  1I6H C;  5C4X C;  2JA6 K;  4A3G C;  4QJV A;  1Y1W C;  4XLP A;  2E2H C;  2NVT K;  3HOZ K;  4A3L K;  3S1Q C;  5C3E K;  3M4O C;  2R93 K;  3HOV C;  1TWC K;  1I50 K;  5M5X K;  4OIQ A;  4Y7N C;  2NVX C;  3H3V D;  4Q5S A;  2WAQ D;  5IYD K;  3GTG K;  2JA7 K;  4XSZ A;  1TWA K;  4QJV B;  4X6A K;  2E2I C;  3PO3 C;  2PA8 L;  3S1N K;  2B63 C;  2PMZ L;  4MEX A;  2R92 K;  1K83 C;  2JA8 C;  4YG2 A;  3S1M K;  5IYB K;  5FLM C;  4BBR C;  5IP7 K;  2A68 A;  3HOY C;  4OIO A;  3HOX C;  1ZYR A;  4YFX A;  4LJZ A;  5IYC C;  4KN4 A;  4A3K C;  2E2J K;  3HOU C;  4Y52 K;  1TWG K;  1Y1V K;  3PO2 K;  4A3E K;  5IP9 K;  4BBS C;  3GTQ K;  3I4M C;  1SMY A;  1SFO K;  2R7Z C;  4A3B C;  2BE5 A;  2NVY K;  5C44 K;  4MEY A;  4KMU A;  5M5W K;  4AYB L;  3K7A K;  4LK1 A;  4G7H A;  4A3I K;  5D4D A;  3S16 K;  4BY1 C;  3GTK K;  3GTJ C;  4YFK A;  3I4M K;  4G7O A;  3CQZ C;  1Y1W K;  3GTP C;  3S1Q K;  4ZH4 A;  3M4O K;  3EQL A;  3S2H K;  4OIN A;  1TWH K;  4QIW L;  3FKI K;  2PA8 D;  4QIW D;  2JA6 C;  3HOW C;  5M5Y K;  4LK0 A;  2PMZ D;  3GTL C;  2VUM C;  4A3L C;  4MQ9 A;  1TWC C;  4A3M C;  4C3I K;  3RZO C;  3I4N C;  1HQM A;  4C2M K;  4XLN A;  1BDF A;  2YU9 C;  2NVQ K;  2A6E A;  2CW0 A;  5IYD C;  2A6H A;  3GTG C;  5M3F K;  5FJ8 K;  5C4J C;  1K83 K;  3RZD C;  2JA8 K;  5FLM K;  2Y0S L;  3M3Y C;  1WCM K;  3S15 C;  3S1N C;  3HOZ C;  3HOY K;  3H0G K;  3HOX K;  4GZY A;  5TMC A;  5IYB C;  1I3Q K;  3HKZ D;  3HKZ L;  4A3K K;  4A3J C;  3HOU K;  4BY7 K;  4AYB D;  2PPB A;  1TWF C;  4A3C C;  3S2D C;  4BBS K;  3GTO K;  3S17 C;  4A3D C;  4BXX C;  3GTM K;  3S1R C;  3S14 C;  4A3G K;  1TWG C;  2E2H K;  1Y1V C;  3PO2 C;  4A3B K;  5IP9 C;  4JK1 A;  1I6V A;  2JA5 C;  1I6H K;  4A93 C;  3HOV K;  4A3F C;  1R9T C;  4G7Z A;  3S17 K;  4A3D K;  4C3J K;  3GTJ K;  2NVT C;  4Y7N K;  3DXJ A;  2NVX K;  2NVY C;  5C3E C;  2R93 C;  4C3H K;  1I50 C;  2WB1 L;  4YFN A;  3GTP K;  3S16 C;  3GTK C;  2E2I K;  3PO3 K;  3HOW K;  2JA7 C;  2B63 K;  1TWA C;  3GTL K;  2VUM K;  4X6A C;  3S2H C;  1YNN A;  4A3M K;  2Y0S D;  3I4N K;  1TWH C;  3RZO K;  3FKI C;  4BBR K;  2YU9 K;  3WOD A;  2O5J A;  2R92 C;  2O5I A;  3H3V L;  3S1M C;  5IYC K;  2WAQ L;  5M3M K;  5C4J K;  5IP7 C;  3RZD K;  1YNJ A;  2NVQ C;  4KN7 A;  3M3Y K;  3S15 K;  4NOI A;  2E2J C;  4Y52 C; 
#chains in the Genus database with same CATH topology
 4GT9 A;  4A3E C;  1WCM C;  3S2D K;  4BXX K;  3S1R K;  1BS2 A;  2JA5 K;  4A3F K;  1WCM A;  4A3G C;  4A3L K;  3SZY A;  5C3E K;  1I50 K;  1EI6 A;  5M5X K;  4M1X A;  3H3V D;  3MML B;  4LQY A;  5IYD K;  1XZP B;  4X6A K;  3S1N K;  2GAH C;  2B63 C;  2PMZ L;  4MEX A;  3GTJ A;  1K83 C;  2RGR A;  3S1M K;  1B4A A;  1IBA A;  5FLM C;  3Q3Q A;  3HOX C;  1ZYR A;  4KAW X;  1TWG K;  4Y52 K;  1Y1V K;  2EBB A;  4A3E K;  2B63 A;  1K83 A;  5IOQ A;  2R7Z C;  4KB2 A;  5M5W K;  4AYB L;  4G7H A;  3G4A A;  5D4D A;  4C3J C;  4KM8 A;  3L4K A;  2W7V A;  3CQZ C;  1EFW A;  3TFH A;  5JFE A;  4FM9 A;  2R7Z A;  3EQL A;  1DD5 A;  1TWF A;  5M5Y K;  4LK0 A;  4MQ9 A;  3RZO C;  3CQZ A;  5EGH A;  4C2M K;  1BDF A;  4XLN A;  3QX3 A;  1R9T A;  3OEP A;  2ZFZ A;  4BKW A;  5FJ8 K;  1K83 K;  5FLM K;  2RH6 A;  2R93 A;  4P9S A;  3HOX K;  4GZY A;  5TMC A;  5IYB C;  5C4X C;  1XXB A;  2PPB A;  4LR2 A;  1O2F B;  3GTO K;  1O28 A;  3GTM K;  1I6H K;  3S0X A;  4GTF A;  4JK1 A;  4KDD A;  1F7V A;  4C3J K;  2NVT C;  1F9N A;  2NVY C;  1BGW A;  2ZUE A;  3AD8 C;  2NVY A;  3S2H C;  4PAB A;  2Y0S D;  3RZO K;  1TWH C;  3FKI C;  1RU0 A;  4GTE A;  3T00 A;  5M3M K;  2XCQ A;  1Y1W A;  2NVQ C;  4NOI A;  1TWH A;  3FKI A;  5C4X K;  4KAS A;  4BY1 K;  4BLB A;  3GEI A;  1HI9 A;  1I3Q C;  4BY7 C;  1IW7 A;  2E2H C;  2NVT K;  3TFI A;  5IOT A;  1TWC K;  1WQH A;  1XXC A;  1I3Q A;  4KMH A;  4J3N A;  1XZQ B;  4Y7N C;  2NVX C;  1F7U A;  1C0A A;  1O2B A;  2WAQ D;  3GTG K;  1JQW A;  2E2H A;  4QJV B;  4RMF A;  3GIR A;  1XXA A;  1JOE A;  1EH1 A;  1WIH A;  2NVX A;  3GTP A;  3CAG A;  4GTB A;  3HOY C;  5IYC C;  4A3K C;  3PO2 K;  1WOR A;  1O26 A;  1SMY A;  4A3B C;  4MEY A;  3S16 K;  3GTJ C;  3AH5 A;  3GSI A;  4G0V A;  1IL2 A;  4QIW L;  2PA8 D;  4GTL A;  2JA6 C;  1O27 A;  4A3M C;  3N3Y A;  3JST A;  1EQR A;  1VJE A;  4GTC A;  1GE9 A;  2JA6 A;  5M3F K;  1WCM K;  3BP8 C;  3HOZ C;  3GDZ A;  3HOY K;  4A3K K;  3HKZ L;  4A3J C;  2JA7 A;  1TWF C;  4A3C C;  1TWA A;  3ADA C;  3S14 C;  3ORE A;  4A3G K;  4A3B K;  5IP9 C;  1I6V A;  4KB4 A;  3TFJ A;  4A93 C;  1R9T C;  4GFQ A;  1L0W A;  3GTJ K;  2R93 C;  3GTK C;  4KM9 A;  1V5V A;  3GTQ A;  2ZUF A;  2B63 K;  2CFA A;  4A3M K;  2O5J A;  3GTK A;  3AQO A;  2O5I A;  2XCR B;  2R92 C;  3H3V L;  3GEH A;  3HXA A;  2P8T A;  4WJ4 A;  4FZB A;  2E2J C;  3HOZ K;  2R7Z K;  1WOS A;  2R92 A;  1AB4 A;  1VRQ C;  4XSX A;  4A3J K;  2A69 A;  1TWF K;  4G0W A;  4A3C K;  3H0G C;  3S14 K;  3CQZ K;  2WB1 D;  3AD7 C;  4A93 K;  2V6U A;  4LLG A;  1R9T K;  1USM A;  1XZP A;  1Y1W C;  4XLP A;  3H0G A;  3S1Q C;  3T01 A;  2R93 K;  4WJ3 M;  3HOV C;  3VA7 A;  1WSR A;  1O24 A;  4KC6 A;  1DCH A;  4O2D A;  4C3H C;  4C3I C;  4XSZ A;  1WQF A;  1VH2 A;  4KMD A;  1VLO A;  2E2I C;  3PO3 C;  4GTA A;  2GSO A;  2R92 K;  2FQO A;  2JA8 C;  5IYB K;  1YCL A;  3BUE A;  4BBR C;  2A68 A;  4OIO A;  1O25 A;  3AQP A;  2E2I A;  4KN4 A;  2E2J K;  3HOU C;  4BBS C;  3GTL A;  3SZZ A;  1J6V A;  3I4M C;  2YU9 A;  2NVY K;  4KMU A;  4LK1 A;  3S17 C;  4A3D C;  2GSN A;  4KAR A;  1Y1W K;  3GTP C;  3S1Q K;  3S2H K;  3G4C A;  1TWH K;  4QIW D;  3FKI K;  3HOW C;  4A3L C;  5CHP A;  2PMZ D;  4C3I K;  2NVQ K;  4XCH A;  1O29 A;  1ZVU A;  2GSU A;  5IYD C;  3RZD C;  2JA8 K;  2Y0S L;  1I50 A;  3S1N C;  1PJ7 A;  1EK8 A;  1WOP A;  1I3Q K;  3HKZ D;  5IOR A;  3HOU K;  4BY7 K;  4AYB D;  4BBS K;  1TWG C;  1X31 C;  1Y1V C;  2E2H K;  3IPJ A;  2D6F C;  4GTD A;  3S17 K;  1IS1 A;  4A3D K;  1O2A A;  4Y7N K;  2NVX K;  2P5M A;  5EGE A;  3GTP K;  1ZQ1 C;  4YFN A;  1TWG A;  1Y1V A;  1F93 A;  1IQ0 A;  3HOW K;  4KAT A;  4C45 A;  2JA7 C;  1TWA C;  2PHC B;  2JH3 A;  1WQG A;  4LOW A;  5IYC K;  2WAQ L;  1IE0 A;  4C2M C;  5IP7 C;  3RZD K;  3FHZ A;  3V4G A;  5TJ3 A;  4OIP A;  3GTQ C;  1BJT A;  1XPP A;  1SFO C;  5C44 C;  4Q4Z A;  5TMF A;  4A3I C;  3K7A C;  4WIL A;  4OIR A;  4P5A A;  1XZQ A;  3GTO C;  5L46 A;  3FOF A;  3GTM C;  2JA6 K;  3OPF A;  4QJV A;  1I6H C;  1SFO A;  3M4O C;  3TTG A;  4OIQ A;  3GTO A;  3AD9 C;  4Q5S A;  3GTM A;  2JA7 K;  1TWA K;  1VGX A;  3T02 A;  3LAJ A;  2V6S A;  5HL8 A;  2PA8 L;  1DCP A;  4YG2 A;  1G51 A;  4DDQ A;  3A8I A;  5IP7 K;  3L4J A;  1WOO A;  4ILD A;  1YX2 A;  4LJZ A;  4YFX A;  2XCO A;  5IP9 K;  1USO A;  1J6X A;  3A8J A;  3GTQ K;  2V6T A;  1SFO K;  2BE5 A;  2FQT A;  5C44 K;  3BP3 A;  2KWA A;  4A3I K;  3K7A K;  4BY1 C;  3GTK K;  4YFK A;  4G7O A;  5CJ9 A;  3NUH A;  1DCO A;  4ZH4 A;  3M4O K;  3LAP A;  4OIN A;  5E68 A;  3ERE D;  3GTL C;  2VUM C;  2GAG C;  1TWC C;  3I4N C;  1HQM A;  2YU9 C;  1KQ4 A;  2Y3P A;  2A6E A;  2CW0 A;  3FOE A;  2A6H A;  3GTG C;  5C4J C;  1PJ6 A;  3A8K A;  2VUM A;  1J6W A;  3M3Y C;  1TWC A;  3S15 C;  3H0G K;  1ZXO A;  1PJ5 A;  3GTG A;  3GEE A;  3S2D C;  1J98 A;  1ISE A;  4PAA A;  4BXX C;  3S1R C;  3N0C A;  3PO2 C;  2JA5 C;  1B4B A;  3HOV K;  4A3F C;  4G7Z A;  1JVI A;  4KMA A;  4G0U A;  4AH6 A;  5JVO A;  3DXJ A;  3LPX A;  5C3E C;  1WSV A;  4C3H K;  1I50 C;  2WB1 L;  3S16 C;  2JA5 A;  2E2I K;  3PO3 K;  5IOS A;  3GTL K;  2VUM K;  3N0B A;  4X6A C;  1YNN A;  3I4N K;  4BBR K;  2YU9 K;  3WOD A;  3S1M C;  5C4J K;  1ZBS A;  1YNJ A;  2CFA B;  4KN7 A;  1INN A;  4BLA A;  3M3Y K;  3S15 K;  3I4M K;  1UV7 A;  4Y52 C;  4P5B A; 
#chains in the Genus database with same CATH homology
 4OIP A;  4A3E C;  2R7Z K;  5C4X K;  4XSX A;  4A3J K;  3GTQ C;  1WCM C;  2A69 A;  1TWF K;  1XPP A;  4A3C K;  3S2D K;  3H0G C;  4BY1 K;  1SFO C;  4BXX K;  5C44 C;  3S1R K;  1I3Q C;  4Q4Z A;  3CQZ K;  5TMF A;  3S14 K;  4BY7 C;  4A3I C;  2WB1 D;  3K7A C;  4OIR A;  2JA5 K;  1IW7 A;  3GTO C;  4A93 K;  4LLG A;  4A3F K;  1R9T K;  3GTM C;  1I6H C;  5C4X C;  2JA6 K;  4A3G C;  4QJV A;  1Y1W C;  4XLP A;  2E2H C;  2NVT K;  3HOZ K;  4A3L K;  3S1Q C;  5C3E K;  3M4O C;  2R93 K;  3HOV C;  1TWC K;  1I50 K;  5M5X K;  4OIQ A;  4Y7N C;  2NVX C;  3H3V D;  4Q5S A;  2WAQ D;  5IYD K;  3GTG K;  2JA7 K;  4XSZ A;  1TWA K;  4QJV B;  4X6A K;  2E2I C;  3PO3 C;  2PA8 L;  3S1N K;  2B63 C;  2PMZ L;  4MEX A;  2R92 K;  1K83 C;  2JA8 C;  4YG2 A;  3S1M K;  5IYB K;  5FLM C;  4BBR C;  5IP7 K;  2A68 A;  3HOY C;  4OIO A;  3HOX C;  1ZYR A;  4YFX A;  4LJZ A;  5IYC C;  4KN4 A;  4A3K C;  2E2J K;  3HOU C;  4Y52 K;  1TWG K;  1Y1V K;  3PO2 K;  4A3E K;  5IP9 K;  4BBS C;  3GTQ K;  3I4M C;  1SMY A;  1SFO K;  2R7Z C;  4A3B C;  2BE5 A;  2NVY K;  5C44 K;  4MEY A;  4KMU A;  5M5W K;  4AYB L;  3K7A K;  4LK1 A;  4G7H A;  4A3I K;  5D4D A;  3S16 K;  4BY1 C;  3GTK K;  3GTJ C;  4YFK A;  3I4M K;  4G7O A;  3CQZ C;  1Y1W K;  3GTP C;  3S1Q K;  4ZH4 A;  3M4O K;  3EQL A;  3S2H K;  4OIN A;  1TWH K;  4QIW L;  3FKI K;  2PA8 D;  4QIW D;  2JA6 C;  3HOW C;  5M5Y K;  4LK0 A;  2PMZ D;  3GTL C;  2VUM C;  4A3L C;  4MQ9 A;  1TWC C;  4A3M C;  4C3I K;  3RZO C;  3I4N C;  1HQM A;  4C2M K;  4XLN A;  1BDF A;  2YU9 C;  2NVQ K;  2A6E A;  2CW0 A;  5IYD C;  2A6H A;  3GTG C;  5M3F K;  5FJ8 K;  5C4J C;  1K83 K;  3RZD C;  2JA8 K;  5FLM K;  2Y0S L;  3M3Y C;  1WCM K;  3S15 C;  3S1N C;  3HOZ C;  3HOY K;  3H0G K;  3HOX K;  4GZY A;  5TMC A;  5IYB C;  1I3Q K;  3HKZ D;  3HKZ L;  4A3K K;  4A3J C;  3HOU K;  4BY7 K;  4AYB D;  2PPB A;  1TWF C;  4A3C C;  3S2D C;  4BBS K;  3GTO K;  3S17 C;  4A3D C;  4BXX C;  3GTM K;  3S1R C;  3S14 C;  4A3G K;  1TWG C;  2E2H K;  1Y1V C;  3PO2 C;  4A3B K;  5IP9 C;  4JK1 A;  1I6V A;  2JA5 C;  1I6H K;  4A93 C;  3HOV K;  4A3F C;  1R9T C;  4G7Z A;  3S17 K;  4A3D K;  4C3J K;  3GTJ K;  2NVT C;  4Y7N K;  3DXJ A;  2NVX K;  2NVY C;  5C3E C;  2R93 C;  4C3H K;  1I50 C;  2WB1 L;  4YFN A;  3GTP K;  3S16 C;  3GTK C;  2E2I K;  3PO3 K;  3HOW K;  2JA7 C;  2B63 K;  1TWA C;  3GTL K;  2VUM K;  4X6A C;  3S2H C;  1YNN A;  4A3M K;  2Y0S D;  3I4N K;  1TWH C;  3RZO K;  3FKI C;  4BBR K;  2YU9 K;  3WOD A;  2O5J A;  2R92 C;  2O5I A;  3H3V L;  3S1M C;  5IYC K;  2WAQ L;  5M3M K;  5C4J K;  5IP7 C;  3RZD K;  1YNJ A;  2NVQ C;  4KN7 A;  3M3Y K;  3S15 K;  4NOI A;  2E2J C;  4Y52 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...