3S1NK

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1nK00
5IP9C 4G7ZA 5FLMK 3GTKC 2A68A 3S1QK 3GTJC 2NVYK 2Y0SD 5TMCA 5FLMC 4A3BC 4KN7A 3GTOC 3S14K 3M4OC 5M5XK 3HOWK 3PO3C 4BY7C 1TWHK 1BDFA 3S16C 4A3DK 1Y1VC 1I50K 3FKIK 4AYBL 4MEXA 2NVQK 3HOUC 5IP7K 3HOZK 4A3GC 4X6AC 2E2HC 2JA6K 1SFOK 3PO2K 2B63C 3S2HC 2JA8K 4QIWL 5M5WK 4A3CK 4A93C 3CQZC 3I4NC 1TWAC 2B63K 3GTLC 4ZH4A 5M5YK 4KMUA 3FKIC 2R93K 1Y1VK 4LK1A 4Q4ZA 4C2MK 3RZDK 4BY1C 1TWCC 2E2IC 1TWHC 4MEYA 5IYBK 3HOXK 4QJVB 4A3MC 4YG2A 1R9TC 3GTOK 2R7ZC 4KN4A 4NOIA 4OIRA 3S1QC 2CW0A 3K7AK 1YNJA 3GTKK 4OIOA 2R7ZK 5IYDC 5IYCC 2A69A 2O5JA 4YFXA 2WAQL 1Y1WC 4G7HA 3HOXC 1TWFC 5C44K 5C3EC 4A3JC 3S15C 2JA5C 2NVTK 2Y0SL 4BY1K 4BXXK 1WCMK 3S1NK 3HOYC 2R93C 4A3FK 2R92K 3HKZD 3GTPK 3GTGC 3I4MK 3H0GK 3M4OK 3S1RK 2JA8C 5C4JC 4A3CC 3PO2C 5C4XC 2R92C 2E2HK 2VUMK 1I6HC 3HOUK 3EQLA 5M3MK 1I50C 3DXJA 4BXXC 4A3DC 5M3FK 2NVTC 3S1MK 4BY7K 5TMFA 3H3VL 1XPPA 4MQ9A 2JA7K 3HOWC 3HKZL 4C3HK 5IYCK 4A3BK 4A3EC 2NVYC 4JK1A 3GTMC 3K7AC 5D4DA 4A3EK 3GTMK 4XLPA 1R9TK 1TWGC 5IYBC 1I3QK 2WAQD 3S2DC 4A3LC 3S1MC 4XLNA 4A3IC 4OIQA 5C44C 4XSZA 3RZDC 3HOVK 2PA8D 4LLGA 2PMZD 4BBRK 2YU9C 1K83K 3GTLK 2E2JK 1TWAK 4OINA 3H0GC 3GTGK 2E2JC 2WB1L 5FJ8K 1SFOC 1K83C 2YU9K 5IP7C 4GZYA 2NVQC 3HOVC 3HOYK 1WCMC 3GTQC 4A3IK 4Q5SA 2WB1D 4A3JK 4XSXA 1HQMA 1Y1WK 2A6EA 4LK0A 4Y52C 2PPBA 3M3YC 5IYDK 3GTJK 3M3YK 5IP9K 4Y52K 1SMYA 2A6HA 4YFKA 4A3MK 2JA7C 4BBSK 4QIWD 1TWCK 2E2IK 3GTQK 4A3KC 2PMZL 2NVXC 2PA8L 4AYBD 4OIPA 4Y7NK 4C3JK 2VUMC 1I6HK 1IW7A 3RZOC 4C3IK 3S17C 5C4XK 5C4JK 3S1RC 3CQZK 4QJVA 3WODA 4YFNA 3I4NK 3I4MC 3GTPC 3S17K 4A93K 4G7OA 2JA6C 3S2HK 4LJZA 3RZOK 4A3FC 1ZYRA 4BBRC 3HOZC 2BE5A 4Y7NC 3S1NC 2NVXK 2O5IA 4A3GK 4X6AK 1I6VA 4A3KK 3S16K 2JA5K 4BBSC 4A3LK 5C3EK 3S15K 1I3QC 1TWFK 3PO3K 3S2DK 1TWGK 3H3VD 1YNNA 3S14C
chains in the Genus database with same CATH superfamily
4KASA 1XZQB 5EGHA 5FLMK 4LR2A 5TMCA 2Y0SD 4A3BC 4PAAA 3GTOC 1O24A 3HOWK 4C2MC 4KATA 1I50K 4X6AC 2NVQK 1USMA 2B63C 2JA8K 3T01A 3CQZC 3I4NC 1WORA 4KDDA 3QX3A 4KMUA 3FKIC 2R93K 4G0UA 3RZDK 4GTLA 4Q4ZA 1Y1WA 1O25A 4MEYA 1F9NA 1BGWA 2KWAA 3GTJA 4YG2A 1R9TC 3GTOK 1ZQ1C 2R7ZA 3TFJA 1O29A 1TWCA 5C44K 4A3JC 4C45A 1O2FB 2R93C 3GTQA 2CFAA 3ADAC 3HKZD 3GTPK 4A3CC 2R92C 1I6HC 3G4CA 5M3MK 4BXXC 5M3FK 4BY7K 3H3VL 1XPPA 1TWFA 4A3BK 2Y3PA 3K7AC 5IORA 4FZBA 4A3IC 4O2DA 1K83A 1J98A 2XCRB 5TJ3A 1I50A 1TWAK 3TFIA 3GTLA 2E2JC 5FJ8K 1DCOA 1SFOC 1WSRA 2YU9K 3GTGA 4FM9A 4A3IK 1Y1VA 5IOQA 1HQMA 1DD5A 2PPBA 3M3YC 1EH1A 4LOWA 5EGEA 4KARA 4KAWX 4Y52K 3GTKA 1SMYA 2A6HA 4YFKA 2EBBA 2GSOA 4WJ4A 3AD8C 1O28A 1WQHA 2PMZL 4OIPA 1I6HK 1IW7A 5C4JK 3GTPC 1IE0A 4A3FC 2P5MA 1VLOA 4BBRC 4BLBA 3Q3QA 3S16K 4KB2A 1TWFK 3M4OK 1JVIA 2V6UA 3S1QK 5JFEA 5FLMC 2ZUFA 5CHPA 5HL8A 1IBAA 3S16C 4AYBL 4KM8A 2JA6K 1SFOK 4A3CK 1TWAC 2B63K 2R93A 1KQ4A 3A8IA 4ZH4A 5M5YK 1B4BA 4C2MK 1TWCC 4GTEA 1O2BA 4QJVB 1USOA 2R7ZC 4KN4A 4KMDA 4OIRA 2CW0A 3K7AK 3A8KA 2O5JA 1F93A 4YFXA 2WAQL 1Y1WC 3AQOA 5C3EC 2Y0SL 2V6TA 3OPFA 3N0BA 4A3FK 4GFQA 5C4JC 3PO2C 1V5VA 3H0GA 2VUMK 3EQLA 3LPXA 4A3DC 3GDZA 3S1MK 4MQ9A 3HOWC 4C3HK 1WOOA 5IYCK 4A3EC 1DCHA 1I3QA 3BP3A 1TWGC 3N0CA 2WAQD 5IYBC 4A3LC 2XCOA 4OIQA 4BKWA 4KMAA 4XSZA 3RZDC 3HOVK 2PMZD 4OINA 5IOSA 3H0GC 3GTGK 2WB1L 2RH6A 1K83C 3G4AA 4J3NA 4GTBA 5IP7C 4GZYA 3HOYK 3FOEA 2WB1D 4A3JK 4LK0A 2V6SA 3GEHA 4LQYA 1VGXA 5IP9K 4A3MK 2JA7C 4BBSK 4QIWD 4XCHA 2E2IK 4A3KC 2R92A 2VUMC 2GAHC 1B4AA 2XCQA 3S17C 1O26A 3CQZK 3I4NK 3MMLB 1J6XA 4KM9A 1L0WA 4G7OA 2JA6C 4C3IC 1VJEA 3BUEA 4AH6A 3HOZC 1I6VA 2VUMA 5JVOA 4BBSC 3S15K 3AD9C 5C44C 1WOSA 3PO3K 3H3VD 1G51A 2FQOA 5IP9C 3S14C 5IOTA 2JA7A 4G7ZA 1R9TA 3GTJC 1J6WA 3M4OC 1C0AA 5M5XK 2JH3A 3GIRA 1TWHK 3FKIA 1F7VA 4MEXA 3HOZK 3HOUC 5IP7K 1EI6A 1EFWA 3S2HC 1VH2A 3T00A 2B63A 4QIWL 5M5WK 4A93C 1WIHA 4P9SA 1AB4A 4ILDA 4BY1C 1ISEA 4KB4A 3GTOA 3HOXK 3AQPA 1VRQC 4DDQA 2CFAB 1PJ5A 1YNJA 3GTKK 2R7ZK 5IYCC 2A69A 2W7VA 2E2IA 2P8TA 4WILA 2JA5C 2NVTK 3TTGA 1WCMK 3JSTA 2R92K 3GTGC 2E2HA 3S1RK 2E2HK 1I50C 2PHCB 3L4KA 3HKZL 3GTMC 2NVYC 3GEEA 1YCLA 1ZBSA 3S0XA 4A3EK 4XLPA 4C3HC 1R9TK 4GTCA 3A8JA 3S2DC 1XZQA 3S1MC 4XLNA 2PA8D 2YU9A 1TWAA 3V4GA 2NVQC 3HOVC 4G0VA 3GTQC 4Q5SA 3FOFA 3N3YA 1ZVUA 1PJ6A 1Y1WK 2A6EA 3GTJK 3M3YK 3HXAA 1BJTA 4GT9A 5L46A 1WOPA 3T02A 4Y7NK 4AYBD 4C3JK 3RZOC 3IPJA 5C4XK 1IS1A 3S1RC 3I4MC 4A93K 4WJ3M 4GTDA 3S17K 3GTPA 3S2HK 3CQZA 3GSIA 4A3GK 3ERED 3S1NC 2O5IA 4A3KK 1X31C 4A3LK 3LAPA 3S2DK 1TWGK 3NUHA 1YNNA 3AH5A 1EQRA 2NVYA 3GTMA 3GTKC 2A68A 1IL2A 1RU0A 1WQGA 2NVYK 4KN7A 3S14K 1XZPB 1TWHA 4RMFA 3PO3C 4BY7C 2GAGC 1BDFA 1INNA 4A3DK 1Y1VC 3FKIK 4A3GC 1ZXOA 4P5AA 2GSNA 2E2HC 3PO2K 1WQFA 1BS2A 5CJ9A 4KMHA 1SFOA 3GTLC 1JQWA 1XXCA 2RGRA 4GTFA 3FHZA 1Y1VK 4LK1A 2E2IC 1TWHC 1WSVA 5IYBK 4A3MC 3BP8C 4NOIA 3S1QC 1PJ7A 4G0WA 4OIOA 5IYDC 4G7HA 3HOXC 1TWFC 3S15C 1EK8A 2GSUA 3SZZA 4BY1K 4BXXK 3S1NK 3HOYC 1WCMA 4M1XA 3I4MK 3H0GK 2JA8C 5C4XC 4GTAA 3HOUK 3DXJA 1HI9A 2NVTC 5TMFA 2JA7K 4JK1A 3OEPA 5D4DA 3GTMK 5E68A 4KC6A 1I3QK 1XXAA 3VA7A 1O2AA 2JA6A 4LLGA 4BBRK 2D6FC 1IQ0A 2YU9C 1K83K 3GTLK 2E2JK 1DCPA 3TFHA 2ZUEA 1UV7A 2ZFZA 4C3JC 1WCMC 3GEIA 1XZPA 1GE9A 3AD7C 4XSXA 4Y52C 2FQTA 5IYDK 3CAGA 1J6VA 1F7UA 1JOEA 3L4JA 1TWCK 3GTQK 2NVXC 2PA8L 3LAJA 4PABA 1O27A 4C3IK 4QJVA 3OREA 3WODA 4YFNA 4BLAA 4LJZA 3RZOK 1ZYRA 4X6AK 2BE5A 4Y7NC 4P5BA 2NVXK 2JA5A 1XXBA 1TWGA 2JA5K 2NVXA 5C3EK 1I3QC 3SZYA 1YX2A
chains in the Genus database with same CATH topology
5IP9C 4G7ZA 5FLMK 3GTKC 2A68A 3S1QK 3GTJC 2NVYK 2Y0SD 5TMCA 5FLMC 4A3BC 4KN7A 3GTOC 3S14K 3M4OC 5M5XK 3HOWK 3PO3C 4BY7C 1TWHK 1BDFA 3S16C 4A3DK 1Y1VC 1I50K 3FKIK 4AYBL 4MEXA 2NVQK 3HOUC 5IP7K 3HOZK 4A3GC 4X6AC 2E2HC 2JA6K 1SFOK 3PO2K 2B63C 3S2HC 2JA8K 4QIWL 5M5WK 4A3CK 4A93C 3CQZC 3I4NC 1TWAC 2B63K 3GTLC 4ZH4A 5M5YK 4KMUA 3FKIC 2R93K 1Y1VK 4LK1A 4Q4ZA 4C2MK 3RZDK 4BY1C 1TWCC 2E2IC 1TWHC 4MEYA 5IYBK 3HOXK 4QJVB 4A3MC 4YG2A 1R9TC 3GTOK 2R7ZC 4KN4A 4NOIA 4OIRA 3S1QC 2CW0A 3K7AK 1YNJA 3GTKK 4OIOA 2R7ZK 5IYDC 5IYCC 2A69A 2O5JA 4YFXA 2WAQL 1Y1WC 4G7HA 3HOXC 1TWFC 5C44K 5C3EC 4A3JC 3S15C 2JA5C 2NVTK 2Y0SL 4BY1K 4BXXK 1WCMK 3S1NK 3HOYC 2R93C 4A3FK 2R92K 3HKZD 3GTPK 3GTGC 3I4MK 3H0GK 3M4OK 3S1RK 2JA8C 5C4JC 4A3CC 3PO2C 5C4XC 2R92C 2E2HK 2VUMK 1I6HC 3HOUK 3EQLA 5M3MK 1I50C 3DXJA 4BXXC 4A3DC 5M3FK 2NVTC 3S1MK 4BY7K 5TMFA 3H3VL 1XPPA 4MQ9A 2JA7K 3HOWC 3HKZL 4C3HK 5IYCK 4A3BK 4A3EC 2NVYC 4JK1A 3GTMC 3K7AC 5D4DA 4A3EK 3GTMK 4XLPA 1R9TK 1TWGC 5IYBC 1I3QK 2WAQD 3S2DC 4A3LC 3S1MC 4XLNA 4A3IC 4OIQA 5C44C 4XSZA 3RZDC 3HOVK 2PA8D 4LLGA 2PMZD 4BBRK 2YU9C 1K83K 3GTLK 2E2JK 1TWAK 4OINA 3H0GC 3GTGK 2E2JC 2WB1L 5FJ8K 1SFOC 1K83C 2YU9K 5IP7C 4GZYA 2NVQC 3HOVC 3HOYK 1WCMC 3GTQC 4A3IK 4Q5SA 2WB1D 4A3JK 4XSXA 1HQMA 1Y1WK 2A6EA 4LK0A 4Y52C 2PPBA 3M3YC 5IYDK 3GTJK 3M3YK 5IP9K 4Y52K 1SMYA 2A6HA 4YFKA 4A3MK 2JA7C 4BBSK 4QIWD 1TWCK 2E2IK 3GTQK 4A3KC 2PMZL 2NVXC 2PA8L 4AYBD 4OIPA 4Y7NK 4C3JK 2VUMC 1I6HK 1IW7A 3RZOC 4C3IK 3S17C 5C4XK 5C4JK 3S1RC 3CQZK 4QJVA 3WODA 4YFNA 3I4NK 3I4MC 3GTPC 3S17K 4A93K 4G7OA 2JA6C 3S2HK 4LJZA 3RZOK 4A3FC 1ZYRA 4BBRC 3HOZC 2BE5A 4Y7NC 3S1NC 2NVXK 2O5IA 4A3GK 4X6AK 1I6VA 4A3KK 3S16K 2JA5K 4BBSC 4A3LK 5C3EK 3S15K 1I3QC 1TWFK 3PO3K 3S2DK 1TWGK 3H3VD 1YNNA 3S14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 C;  4G7Z A;  5FLM K;  3GTK C;  2A68 A;  3S1Q K;  3GTJ C;  2NVY K;  2Y0S D;  5TMC A;  5FLM C;  4A3B C;  4KN7 A;  3GTO C;  3S14 K;  3M4O C;  5M5X K;  3HOW K;  3PO3 C;  4BY7 C;  1TWH K;  1BDF A;  3S16 C;  4A3D K;  1Y1V C;  1I50 K;  3FKI K;  4AYB L;  4MEX A;  2NVQ K;  3HOU C;  5IP7 K;  3HOZ K;  4A3G C;  4X6A C;  2E2H C;  2JA6 K;  1SFO K;  3PO2 K;  2B63 C;  3S2H C;  2JA8 K;  4QIW L;  5M5W K;  4A3C K;  4A93 C;  3CQZ C;  3I4N C;  1TWA C;  2B63 K;  3GTL C;  4ZH4 A;  5M5Y K;  4KMU A;  3FKI C;  2R93 K;  1Y1V K;  4LK1 A;  4Q4Z A;  4C2M K;  3RZD K;  4BY1 C;  1TWC C;  2E2I C;  1TWH C;  4MEY A;  5IYB K;  3HOX K;  4QJV B;  4A3M C;  4YG2 A;  1R9T C;  3GTO K;  2R7Z C;  4KN4 A;  4NOI A;  4OIR A;  3S1Q C;  2CW0 A;  3K7A K;  1YNJ A;  3GTK K;  4OIO A;  2R7Z K;  5IYD C;  5IYC C;  2A69 A;  2O5J A;  4YFX A;  2WAQ L;  1Y1W C;  4G7H A;  3HOX C;  1TWF C;  5C44 K;  5C3E C;  4A3J C;  3S15 C;  2JA5 C;  2NVT K;  2Y0S L;  4BY1 K;  4BXX K;  1WCM K;  3S1N K;  3HOY C;  2R93 C;  4A3F K;  2R92 K;  3HKZ D;  3GTP K;  3GTG C;  3I4M K;  3H0G K;  3M4O K;  3S1R K;  2JA8 C;  5C4J C;  4A3C C;  3PO2 C;  5C4X C;  2R92 C;  2E2H K;  2VUM K;  1I6H C;  3HOU K;  3EQL A;  5M3M K;  1I50 C;  3DXJ A;  4BXX C;  4A3D C;  5M3F K;  2NVT C;  3S1M K;  4BY7 K;  5TMF A;  3H3V L;  1XPP A;  4MQ9 A;  2JA7 K;  3HOW C;  3HKZ L;  4C3H K;  5IYC K;  4A3B K;  4A3E C;  2NVY C;  4JK1 A;  3GTM C;  3K7A C;  5D4D A;  4A3E K;  3GTM K;  4XLP A;  1R9T K;  1TWG C;  5IYB C;  1I3Q K;  2WAQ D;  3S2D C;  4A3L C;  3S1M C;  4XLN A;  4A3I C;  4OIQ A;  5C44 C;  4XSZ A;  3RZD C;  3HOV K;  2PA8 D;  4LLG A;  2PMZ D;  4BBR K;  2YU9 C;  1K83 K;  3GTL K;  2E2J K;  1TWA K;  4OIN A;  3H0G C;  3GTG K;  2E2J C;  2WB1 L;  5FJ8 K;  1SFO C;  1K83 C;  2YU9 K;  5IP7 C;  4GZY A;  2NVQ C;  3HOV C;  3HOY K;  1WCM C;  3GTQ C;  4A3I K;  4Q5S A;  2WB1 D;  4A3J K;  4XSX A;  1HQM A;  1Y1W K;  2A6E A;  4LK0 A;  4Y52 C;  2PPB A;  3M3Y C;  5IYD K;  3GTJ K;  3M3Y K;  5IP9 K;  4Y52 K;  1SMY A;  2A6H A;  4YFK A;  4A3M K;  2JA7 C;  4BBS K;  4QIW D;  1TWC K;  2E2I K;  3GTQ K;  4A3K C;  2PMZ L;  2NVX C;  2PA8 L;  4AYB D;  4OIP A;  4Y7N K;  4C3J K;  2VUM C;  1I6H K;  1IW7 A;  3RZO C;  4C3I K;  3S17 C;  5C4X K;  5C4J K;  3S1R C;  3CQZ K;  4QJV A;  3WOD A;  4YFN A;  3I4N K;  3I4M C;  3GTP C;  3S17 K;  4A93 K;  4G7O A;  2JA6 C;  3S2H K;  4LJZ A;  3RZO K;  4A3F C;  1ZYR A;  4BBR C;  3HOZ C;  2BE5 A;  4Y7N C;  3S1N C;  2NVX K;  2O5I A;  4A3G K;  4X6A K;  1I6V A;  4A3K K;  3S16 K;  2JA5 K;  4BBS C;  4A3L K;  5C3E K;  3S15 K;  1I3Q C;  1TWF K;  3PO3 K;  3S2D K;  1TWG K;  3H3V D;  1YNN A;  3S14 C; 
#chains in the Genus database with same CATH topology
 4KAS A;  1XZQ B;  5EGH A;  5FLM K;  4LR2 A;  5TMC A;  2Y0S D;  4A3B C;  4PAA A;  3GTO C;  1O24 A;  3HOW K;  4C2M C;  4KAT A;  1I50 K;  4X6A C;  2NVQ K;  1USM A;  2B63 C;  2JA8 K;  3T01 A;  3CQZ C;  3I4N C;  1WOR A;  4KDD A;  3QX3 A;  4KMU A;  3FKI C;  2R93 K;  4G0U A;  3RZD K;  4GTL A;  4Q4Z A;  1Y1W A;  1O25 A;  4MEY A;  1F9N A;  1BGW A;  2KWA A;  3GTJ A;  4YG2 A;  1R9T C;  3GTO K;  1ZQ1 C;  2R7Z A;  3TFJ A;  1O29 A;  1TWC A;  5C44 K;  4A3J C;  4C45 A;  1O2F B;  2R93 C;  3GTQ A;  2CFA A;  3ADA C;  3HKZ D;  3GTP K;  4A3C C;  2R92 C;  1I6H C;  3G4C A;  5M3M K;  4BXX C;  5M3F K;  4BY7 K;  3H3V L;  1XPP A;  1TWF A;  4A3B K;  2Y3P A;  3K7A C;  5IOR A;  4FZB A;  4A3I C;  4O2D A;  1K83 A;  1J98 A;  2XCR B;  5TJ3 A;  1I50 A;  1TWA K;  3TFI A;  3GTL A;  2E2J C;  5FJ8 K;  1DCO A;  1SFO C;  1WSR A;  2YU9 K;  3GTG A;  4FM9 A;  4A3I K;  1Y1V A;  5IOQ A;  1HQM A;  1DD5 A;  2PPB A;  3M3Y C;  1EH1 A;  4LOW A;  5EGE A;  4KAR A;  4KAW X;  4Y52 K;  3GTK A;  1SMY A;  2A6H A;  4YFK A;  2EBB A;  2GSO A;  4WJ4 A;  3AD8 C;  1O28 A;  1WQH A;  2PMZ L;  4OIP A;  1I6H K;  1IW7 A;  5C4J K;  3GTP C;  1IE0 A;  4A3F C;  2P5M A;  1VLO A;  4BBR C;  4BLB A;  3Q3Q A;  3S16 K;  4KB2 A;  1TWF K;  3M4O K;  1JVI A;  2V6U A;  3S1Q K;  5JFE A;  5FLM C;  2ZUF A;  5CHP A;  5HL8 A;  1IBA A;  3S16 C;  4AYB L;  4KM8 A;  2JA6 K;  1SFO K;  4A3C K;  1TWA C;  2B63 K;  2R93 A;  1KQ4 A;  3A8I A;  4ZH4 A;  5M5Y K;  1B4B A;  4C2M K;  1TWC C;  4GTE A;  1O2B A;  4QJV B;  1USO A;  2R7Z C;  4KN4 A;  4KMD A;  4OIR A;  2CW0 A;  3K7A K;  3A8K A;  2O5J A;  1F93 A;  4YFX A;  2WAQ L;  1Y1W C;  3AQO A;  5C3E C;  2Y0S L;  2V6T A;  3OPF A;  3N0B A;  4A3F K;  4GFQ A;  5C4J C;  3PO2 C;  1V5V A;  3H0G A;  2VUM K;  3EQL A;  3LPX A;  4A3D C;  3GDZ A;  3S1M K;  4MQ9 A;  3HOW C;  4C3H K;  1WOO A;  5IYC K;  4A3E C;  1DCH A;  1I3Q A;  3BP3 A;  1TWG C;  3N0C A;  2WAQ D;  5IYB C;  4A3L C;  2XCO A;  4OIQ A;  4BKW A;  4KMA A;  4XSZ A;  3RZD C;  3HOV K;  2PMZ D;  4OIN A;  5IOS A;  3H0G C;  3GTG K;  2WB1 L;  2RH6 A;  1K83 C;  3G4A A;  4J3N A;  4GTB A;  5IP7 C;  4GZY A;  3HOY K;  3FOE A;  2WB1 D;  4A3J K;  4LK0 A;  2V6S A;  3GEH A;  4LQY A;  1VGX A;  5IP9 K;  4A3M K;  2JA7 C;  4BBS K;  4QIW D;  4XCH A;  2E2I K;  4A3K C;  2R92 A;  2VUM C;  2GAH C;  1B4A A;  2XCQ A;  3S17 C;  1O26 A;  3CQZ K;  3I4N K;  3MML B;  1J6X A;  4KM9 A;  1L0W A;  4G7O A;  2JA6 C;  4C3I C;  1VJE A;  3BUE A;  4AH6 A;  3HOZ C;  1I6V A;  2VUM A;  5JVO A;  4BBS C;  3S15 K;  3AD9 C;  5C44 C;  1WOS A;  3PO3 K;  3H3V D;  1G51 A;  2FQO A;  5IP9 C;  3S14 C;  5IOT A;  2JA7 A;  4G7Z A;  1R9T A;  3GTJ C;  1J6W A;  3M4O C;  1C0A A;  5M5X K;  2JH3 A;  3GIR A;  1TWH K;  3FKI A;  1F7V A;  4MEX A;  3HOZ K;  3HOU C;  5IP7 K;  1EI6 A;  1EFW A;  3S2H C;  1VH2 A;  3T00 A;  2B63 A;  4QIW L;  5M5W K;  4A93 C;  1WIH A;  4P9S A;  1AB4 A;  4ILD A;  4BY1 C;  1ISE A;  4KB4 A;  3GTO A;  3HOX K;  3AQP A;  1VRQ C;  4DDQ A;  2CFA B;  1PJ5 A;  1YNJ A;  3GTK K;  2R7Z K;  5IYC C;  2A69 A;  2W7V A;  2E2I A;  2P8T A;  4WIL A;  2JA5 C;  2NVT K;  3TTG A;  1WCM K;  3JST A;  2R92 K;  3GTG C;  2E2H A;  3S1R K;  2E2H K;  1I50 C;  2PHC B;  3L4K A;  3HKZ L;  3GTM C;  2NVY C;  3GEE A;  1YCL A;  1ZBS A;  3S0X A;  4A3E K;  4XLP A;  4C3H C;  1R9T K;  4GTC A;  3A8J A;  3S2D C;  1XZQ A;  3S1M C;  4XLN A;  2PA8 D;  2YU9 A;  1TWA A;  3V4G A;  2NVQ C;  3HOV C;  4G0V A;  3GTQ C;  4Q5S A;  3FOF A;  3N3Y A;  1ZVU A;  1PJ6 A;  1Y1W K;  2A6E A;  3GTJ K;  3M3Y K;  3HXA A;  1BJT A;  4GT9 A;  5L46 A;  1WOP A;  3T02 A;  4Y7N K;  4AYB D;  4C3J K;  3RZO C;  3IPJ A;  5C4X K;  1IS1 A;  3S1R C;  3I4M C;  4A93 K;  4WJ3 M;  4GTD A;  3S17 K;  3GTP A;  3S2H K;  3CQZ A;  3GSI A;  4A3G K;  3ERE D;  3S1N C;  2O5I A;  4A3K K;  1X31 C;  4A3L K;  3LAP A;  3S2D K;  1TWG K;  3NUH A;  1YNN A;  3AH5 A;  1EQR A;  2NVY A;  3GTM A;  3GTK C;  2A68 A;  1IL2 A;  1RU0 A;  1WQG A;  2NVY K;  4KN7 A;  3S14 K;  1XZP B;  1TWH A;  4RMF A;  3PO3 C;  4BY7 C;  2GAG C;  1BDF A;  1INN A;  4A3D K;  1Y1V C;  3FKI K;  4A3G C;  1ZXO A;  4P5A A;  2GSN A;  2E2H C;  3PO2 K;  1WQF A;  1BS2 A;  5CJ9 A;  4KMH A;  1SFO A;  3GTL C;  1JQW A;  1XXC A;  2RGR A;  4GTF A;  3FHZ A;  1Y1V K;  4LK1 A;  2E2I C;  1TWH C;  1WSV A;  5IYB K;  4A3M C;  3BP8 C;  4NOI A;  3S1Q C;  1PJ7 A;  4G0W A;  4OIO A;  5IYD C;  4G7H A;  3HOX C;  1TWF C;  3S15 C;  1EK8 A;  2GSU A;  3SZZ A;  4BY1 K;  4BXX K;  3S1N K;  3HOY C;  1WCM A;  4M1X A;  3I4M K;  3H0G K;  2JA8 C;  5C4X C;  4GTA A;  3HOU K;  3DXJ A;  1HI9 A;  2NVT C;  5TMF A;  2JA7 K;  4JK1 A;  3OEP A;  5D4D A;  3GTM K;  5E68 A;  4KC6 A;  1I3Q K;  1XXA A;  3VA7 A;  1O2A A;  2JA6 A;  4LLG A;  4BBR K;  2D6F C;  1IQ0 A;  2YU9 C;  1K83 K;  3GTL K;  2E2J K;  1DCP A;  3TFH A;  2ZUE A;  1UV7 A;  2ZFZ A;  4C3J C;  1WCM C;  3GEI A;  1XZP A;  1GE9 A;  3AD7 C;  4XSX A;  4Y52 C;  2FQT A;  5IYD K;  3CAG A;  1J6V A;  1F7U A;  1JOE A;  3L4J A;  1TWC K;  3GTQ K;  2NVX C;  2PA8 L;  3LAJ A;  4PAB A;  1O27 A;  4C3I K;  4QJV A;  3ORE A;  3WOD A;  4YFN A;  4BLA A;  4LJZ A;  3RZO K;  1ZYR A;  4X6A K;  2BE5 A;  4Y7N C;  4P5B A;  2NVX K;  2JA5 A;  1XXB A;  1TWG A;  2JA5 K;  2NVX A;  5C3E K;  1I3Q C;  3SZY A;  1YX2 A; 
#chains in the Genus database with same CATH homology
 5IP9 C;  4G7Z A;  5FLM K;  3GTK C;  2A68 A;  3S1Q K;  3GTJ C;  2NVY K;  2Y0S D;  5TMC A;  5FLM C;  4A3B C;  4KN7 A;  3GTO C;  3S14 K;  3M4O C;  5M5X K;  3HOW K;  3PO3 C;  4BY7 C;  1TWH K;  1BDF A;  3S16 C;  4A3D K;  1Y1V C;  1I50 K;  3FKI K;  4AYB L;  4MEX A;  2NVQ K;  3HOU C;  5IP7 K;  3HOZ K;  4A3G C;  4X6A C;  2E2H C;  2JA6 K;  1SFO K;  3PO2 K;  2B63 C;  3S2H C;  2JA8 K;  4QIW L;  5M5W K;  4A3C K;  4A93 C;  3CQZ C;  3I4N C;  1TWA C;  2B63 K;  3GTL C;  4ZH4 A;  5M5Y K;  4KMU A;  3FKI C;  2R93 K;  1Y1V K;  4LK1 A;  4Q4Z A;  4C2M K;  3RZD K;  4BY1 C;  1TWC C;  2E2I C;  1TWH C;  4MEY A;  5IYB K;  3HOX K;  4QJV B;  4A3M C;  4YG2 A;  1R9T C;  3GTO K;  2R7Z C;  4KN4 A;  4NOI A;  4OIR A;  3S1Q C;  2CW0 A;  3K7A K;  1YNJ A;  3GTK K;  4OIO A;  2R7Z K;  5IYD C;  5IYC C;  2A69 A;  2O5J A;  4YFX A;  2WAQ L;  1Y1W C;  4G7H A;  3HOX C;  1TWF C;  5C44 K;  5C3E C;  4A3J C;  3S15 C;  2JA5 C;  2NVT K;  2Y0S L;  4BY1 K;  4BXX K;  1WCM K;  3S1N K;  3HOY C;  2R93 C;  4A3F K;  2R92 K;  3HKZ D;  3GTP K;  3GTG C;  3I4M K;  3H0G K;  3M4O K;  3S1R K;  2JA8 C;  5C4J C;  4A3C C;  3PO2 C;  5C4X C;  2R92 C;  2E2H K;  2VUM K;  1I6H C;  3HOU K;  3EQL A;  5M3M K;  1I50 C;  3DXJ A;  4BXX C;  4A3D C;  5M3F K;  2NVT C;  3S1M K;  4BY7 K;  5TMF A;  3H3V L;  1XPP A;  4MQ9 A;  2JA7 K;  3HOW C;  3HKZ L;  4C3H K;  5IYC K;  4A3B K;  4A3E C;  2NVY C;  4JK1 A;  3GTM C;  3K7A C;  5D4D A;  4A3E K;  3GTM K;  4XLP A;  1R9T K;  1TWG C;  5IYB C;  1I3Q K;  2WAQ D;  3S2D C;  4A3L C;  3S1M C;  4XLN A;  4A3I C;  4OIQ A;  5C44 C;  4XSZ A;  3RZD C;  3HOV K;  2PA8 D;  4LLG A;  2PMZ D;  4BBR K;  2YU9 C;  1K83 K;  3GTL K;  2E2J K;  1TWA K;  4OIN A;  3H0G C;  3GTG K;  2E2J C;  2WB1 L;  5FJ8 K;  1SFO C;  1K83 C;  2YU9 K;  5IP7 C;  4GZY A;  2NVQ C;  3HOV C;  3HOY K;  1WCM C;  3GTQ C;  4A3I K;  4Q5S A;  2WB1 D;  4A3J K;  4XSX A;  1HQM A;  1Y1W K;  2A6E A;  4LK0 A;  4Y52 C;  2PPB A;  3M3Y C;  5IYD K;  3GTJ K;  3M3Y K;  5IP9 K;  4Y52 K;  1SMY A;  2A6H A;  4YFK A;  4A3M K;  2JA7 C;  4BBS K;  4QIW D;  1TWC K;  2E2I K;  3GTQ K;  4A3K C;  2PMZ L;  2NVX C;  2PA8 L;  4AYB D;  4OIP A;  4Y7N K;  4C3J K;  2VUM C;  1I6H K;  1IW7 A;  3RZO C;  4C3I K;  3S17 C;  5C4X K;  5C4J K;  3S1R C;  3CQZ K;  4QJV A;  3WOD A;  4YFN A;  3I4N K;  3I4M C;  3GTP C;  3S17 K;  4A93 K;  4G7O A;  2JA6 C;  3S2H K;  4LJZ A;  3RZO K;  4A3F C;  1ZYR A;  4BBR C;  3HOZ C;  2BE5 A;  4Y7N C;  3S1N C;  2NVX K;  2O5I A;  4A3G K;  4X6A K;  1I6V A;  4A3K K;  3S16 K;  2JA5 K;  4BBS C;  4A3L K;  5C3E K;  3S15 K;  1I3Q C;  1TWF K;  3PO3 K;  3S2D K;  1TWG K;  3H3V D;  1YNN A;  3S14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...