3S1NK

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1nK00
1WCMC 4A3JC 5M5WK 2NVTC 3S16K 3S1QK 4A3MC 2R93K 5IYDK 4QJVA 5C4JK 2NVQK 1SMYA 4Y7NK 4A3KK 3M4OK 4A93K 3HOXC 2NVXC 4XSZA 2JA6K 1Y1WC 4OIOA 4C3HK 1TWHK 4QIWL 2E2JK 2JA7C 2R92K 4BBSK 1R9TC 5IP9K 3HOWC 2E2HC 4A3FC 4A3IK 4G7OA 4C2MK 3K7AK 3HOYK 3GTPC 1TWFK 4NOIA 3S2HC 3WODA 4BY1C 1I50C 1TWCK 3CQZC 5C3EC 4XSXA 5D4DA 4QIWD 2VUMK 3FKIC 4LK1A 3RZOK 3S1MK 1ZYRA 4KN4A 4MEXA 3HOUK 4X6AK 2R7ZK 3H0GK 4A3CC 5M3MK 4A3DC 3GTQK 4Q5SA 2B63C 2JA8C 4BXXC 3GTGC 3M3YK 3PO3C 3GTOK 2BE5A 3I4NC 1TWAK 4XLNA 2A69A 3HOVK 5C44K 1I6HC 4A3EC 2NVYK 3GTOC 1Y1VK 2WB1L 2R93C 1BDFA 5IYDC 5C4JC 4LJZA 2NVQC 3HOZC 4Y7NC 4MEYA 4A3KC 3I4MC 3S1NK 1I6VA 2PMZL 3S14C 3RZDK 3S17K 3M4OC 4A93C 4BY7C 3PO2K 4A3LC 4ZH4A 2E2JC 1TWHC 2R92C 4BBSC 3GTKK 2WB1D 4MQ9A 2NVTK 4Q4ZA 5FJ8K 4A3IC 2E2IK 4BBRK 5IP7K 3K7AC 4JK1A 4OIRA 3HOYC 1I3QK 2O5IA 1TWFC 3HOXK 2PMZD 1YNNA 3GTJK 1IW7A 3GTLK 3M3YC 1TWCC 2YU9K 2PPBA 3S1RK 2JA7K 5IYBC 3EQLA 2VUMC 3HOWK 3RZOC 3S1MC 1K83K 3DXJA 4YFKA 1SFOK 3HOUC 2A6HA 3H0GC 2R7ZC 4X6AC 4Y52K 2WAQL 4OINA 3GTQC 1TWGK 4KN7A 4C3IK 3S2HK 3CQZK 5TMFA 5C4XK 5FLMK 1HQMA 5IYCK 2JA5C 2CW0A 5TMCA 3GTMK 2Y0SL 3FKIK 3S16C 3S1QC 2A68A 3S15K 4AYBL 3S2DK 3HOVC 5M5XK 2NVYC 4A3GK 2A6EA 2WAQD 4QJVB 4A3BK 2JA6C 2JA5K 3PO3K 1WCMK 4A3JK 3I4NK 5IP9C 4A3MK 3S1NC 3S17C 3RZDC 3PO2C 2O5JA 4XLPA 3H3VL 4YFXA 3GTKC 4OIPA 2NVXK 1Y1WK 4GZYA 3HOZK 2E2IC 4BBRC 5IP7C 4G7ZA 1R9TK 3I4MK 4LK0A 4A3LK 5M5YK 1I3QC 4G7HA 2E2HK 4A3FK 3S14K 4OIQA 3GTJC 3GTLC 4BY7K 4YG2A 3GTPK 2YU9C 1XPPA 3S1RC 4BY1K 3H3VD 1I50K 5C3EK 1K83C 1SFOC 1YNJA 4Y52C 3HKZL 1TWAC 1TWGC 4C3JK 4A3CK 5C44C 2PA8L 4A3DK 5FLMC 5C4XC 1Y1VC 5IYCC 2B63K 2JA8K 4KMUA 5IYBK 3GTMC 4YFNA 4BXXK 3GTGK 4LLGA 3S15C 3S2DC 5M3FK 2Y0SD 3HKZD 4A3GC 4AYBD 4A3BC 1I6HK 4A3EK 2PA8D
chains in the Genus database with same CATH superfamily
1WCMC 1B4BA 4FZBA 4Y7NK 1DCHA 1V5VA 3LAPA 3FOEA 2NVXC 2JA6K 1AB4A 1XXBA 3NUHA 4WJ3M 1BJTA 1R9TC 3HOWC 2P8TA 4KMHA 3AD8C 4A3FC 4GTDA 1PJ7A 3N0CA 3HOYK 3GTPC 4NOIA 3T01A 4GT9A 1I50C 2RGRA 2E2HA 1SFOA 4XSXA 3QX3A 3FKIC 1ZYRA 4KN4A 4C3JC 3CQZA 1IE0A 5M3MK 3AQOA 1WQFA 3GTQK 1HI9A 4XLNA 2A69A 3HOVK 2NVYK 1WCMA 3GTOC 1G51A 5C4JC 4A3KC 3GDZA 1I6VA 2KWAA 2NVXA 2R93A 3PO2K 2GAHC 4BBSC 1R9TA 2WB1D 4MQ9A 2NVTK 4Q4ZA 3FHZA 3GTPA 3TFHA 1TWFC 4DDQA 2PMZD 1I50A 3HOXK 3S1RK 4PABA 3EQLA 1WOPA 1K83K 4YFKA 1SFOK 1TWCA 2R7ZC 5EGHA 4Y52K 4OINA 4KC6A 3CQZK 5C4XK 1HQMA 5IYCK 3GEHA 2CW0A 3GTMK 1XXAA 1O28A 1JQWA 3GTOA 1WQHA 1ISEA 2JA6C 3PO3K 1WCMK 3I4NK 1PJ6A 5E68A 2O5JA 4ILDA 2NVXK 1VRQC 2FQOA 1EH1A 4KM9A 4BBRC 1R9TK 3I4MK 1TWFA 5M5YK 1EK8A 1WSRA 3S14K 4A3FK 4LQYA 4OIQA 5EGEA 1ZQ1C 3GTPK 2YU9C 3H3VD 1F93A 1I50K 2R7ZA 1WQGA 4PAAA 4C3JK 5FLMC 1INNA 3S15C 2Y3PA 5M3FK 1L0WA 1WOSA 4A3GC 4A3BC 4GTFA 3GTOK 1XZQB 2NVTC 4A3MC 5C4JK 1SMYA 4A3KK 3HOXC 4XSZA 4LOWA 4BBSK 1KQ4A 5IOQA 2V6SA 2E2HC 2YU9A 1XXCA 2JA7A 1TWFK 1WIHA 4BY1C 3CQZC 5D4DA 4LK1A 2ZUFA 2P5MA 1IBAA 2R7ZK 4A3DC 3OEPA 3PO3C 3I4NC 2GSUA 2D6FC 1UV7A 1O26A 2WB1L 3HXAA 5CJ9A 2R93C 4RMFA 5IOTA 4MEYA 3I4MC 2PMZL 3S14C 2E2JC 4C3HC 1WSVA 5FJ8K 4A3IC 4BBRK 4C2MC 3K7AC 4Q5SA 1O27A 1TWCC 2YU9K 2PPBA 2ZUEA 1DD5A 2JA7K 2VUMC 2XCRB 3RZOC 4KATA 4X6AC 1BS2A 2PHCB 1J6WA 5FLMK 3H0GA 3M3YC 5JVOA 2Y0SL 4GTEA 3S15K 4AYBL 5TJ3A 4A3GK 2A6EA 4QJVB 1IL2A 4A3BK 4J3NA 1J6VA 4A3MK 3S17C 3RZDC 1YX2A 1JVIA 3H3VL 3V4GA 3AD9C 3N0BA 3Q3QA 4BLAA 2E2IC 5IP7C 4A3LK 2E2HK 4P5BA 3GTLC 2VUMA 4BY1K 1I3QA 3GTJA 3GEIA 3ADAC 4KM8A 1YNJA 2GSOA 4C3IC 4A3DK 1WOOA 1J98A 4KMUA 1TWAA 5HL8A 3VA7A 1TWGA 4GFQA 1X31C 1DCOA 1Y1VA 2Y0SD 3L4JA 3HKZD 1O24A 2JH3A 4AYBD 1ZBSA 4AH6A 1JOEA 2PA8D 5M5WK 3S16K 2R93K 4KB4A 3IPJA 3GIRA 1BGWA 4GTAA 4GTCA 2E2IA 2E2JK 4C3HK 2JA7C 3T02A 3GTLA 3A8JA 3BP3A 4A3IK 4G7OA 4C2MK 3K7AK 1Y1WA 3WODA 1O2BA 1TWCK 5IORA 4QIWD 2VUMK 4C45A 3RZOK 4X6AK 4A3CC 3T00A 3LPXA 4BXXC 3M3YK 2BE5A 2V6TA 4KDDA 1TWAK 3TFJA 4G0UA 2B63A 5JFEA 5C44K 1Y1VK 1YCLA 4P5AA 3LAJA 5IYDC 2NVQC 4A3LC 3M4OC 3S17K 4A93C 3RZDK 1XZQA 2FQTA 1XZPB 4ZH4A 2R92C 1TWHC 4XCHA 3MMLB 2E2IK 5IP7K 3TFIA 4JK1A 2O5IA 1YNNA 3GTLK 1IW7A 3BP8C 2ZFZA 1B4AA 4KMAA 1XZPA 3S1MC 4KB2A 3DXJA 3HOUC 2A6HA 3H0GC 1O25A 1ZVUA 3S2HK 4C3IK 1O2AA 5TMFA 4WJ4A 3ERED 4BKWA 3G4CA 1DCPA 3S16C 3OPFA 3GTQA 2A68A 3GEEA 3TTGA 3L4KA 3JSTA 5M5XK 2WAQD 3G4AA 3S1NC 1C0AA 3AD7C 2R92A 1TWHA 4XLPA 4YFXA 3GTKC 3HOZK 4G7ZA 2RH6A 4G7HA 1I3QC 2XCOA 3GTJC 4BY7K 4YG2A 1EQRA 3AQPA 4G0VA 1EFWA 3BUEA 3HKZL 1TWAC 1F9NA 1TWGC 1F7UA 4A3CK 5C44C 2PA8L 4P9SA 1K83A 1Y1VC 5IYBK 4KARA 4BXXK 1O2FB 3S2DC 3GTMA 3OREA 2CFAB 2JA5C 4A3JC 3S1QK 1IS1A 4KAWX 5IYDK 4QJVA 2NVQK 3M4OK 1VJEA 1O29A 4GTLA 4A93K 3GTKA 1RU0A 1Y1WC 4OIOA 2EBBA 1TWHK 4QIWL 1USMA 2R92K 2CFAA 5CHPA 4KASA 4LR2A 5IP9K 1VH2A 4O2DA 3S2HC 4M1XA 5C3EC 2W7VA 4G0WA 3S1MK 1VGXA 4MEXA 3HOUK 5IOSA 3H0GK 3FKIA 2B63C 2JA8C 3GTGC 4KMDA 2GAGC 3SZZA 3SZYA 5L46A 2JA5A 1I6HC 4A3EC 1BDFA 4LJZA 3HOZC 4Y7NC 4GTBA 3S1NK 4BY7C 3GTKK 4BLBA 4OIRA 3HOYC 1I3QK 3GTJK 3N3YA 5IYBC 1GE9A 3HOWK 2GSNA 3A8IA 2WAQL 3AH5A 3GSIA 1TWGK 4KN7A 3GTQC 3GTGA 1EI6A 3FOFA 5TMCA 3S1QC 3FKIK 3S2DK 3HOVC 2NVYC 1PJ5A 4WILA 2JA5K 2XCQA 4A3JK 1F7VA 5IP9C 2V6UA 2JA6A 1VLOA 3PO2C 4OIPA 1Y1WK 4GZYA 4LK0A 3A8KA 1XPPA 3S1RC 5C3EK 1J6XA 1K83C 1SFOC 4FM9A 1WORA 4Y52C 1ZXOA 1IQ0A 5C4XC 3S0XA 5IYCC 2B63K 2JA8K 3GTMC 4YFNA 3GTGK 1USOA 4LLGA 2NVYA 1I6HK 4A3EK 3CAGA
chains in the Genus database with same CATH topology
1WCMC 4A3JC 5M5WK 2NVTC 3S16K 3S1QK 4A3MC 2R93K 5IYDK 4QJVA 5C4JK 2NVQK 1SMYA 4Y7NK 4A3KK 3M4OK 4A93K 3HOXC 2NVXC 4XSZA 2JA6K 1Y1WC 4OIOA 4C3HK 1TWHK 4QIWL 2E2JK 2JA7C 2R92K 4BBSK 1R9TC 5IP9K 3HOWC 2E2HC 4A3FC 4A3IK 4G7OA 4C2MK 3K7AK 3HOYK 3GTPC 1TWFK 4NOIA 3S2HC 3WODA 4BY1C 1I50C 1TWCK 3CQZC 5C3EC 4XSXA 5D4DA 4QIWD 2VUMK 3FKIC 4LK1A 3RZOK 3S1MK 1ZYRA 4KN4A 4MEXA 3HOUK 4X6AK 2R7ZK 3H0GK 4A3CC 5M3MK 4A3DC 3GTQK 4Q5SA 2B63C 2JA8C 4BXXC 3GTGC 3M3YK 3PO3C 3GTOK 2BE5A 3I4NC 1TWAK 4XLNA 2A69A 3HOVK 5C44K 1I6HC 4A3EC 2NVYK 3GTOC 1Y1VK 2WB1L 2R93C 1BDFA 5IYDC 5C4JC 4LJZA 2NVQC 3HOZC 4Y7NC 4MEYA 4A3KC 3I4MC 3S1NK 1I6VA 2PMZL 3S14C 3RZDK 3S17K 3M4OC 4A93C 4BY7C 3PO2K 4A3LC 4ZH4A 2E2JC 1TWHC 2R92C 4BBSC 3GTKK 2WB1D 4MQ9A 2NVTK 4Q4ZA 5FJ8K 4A3IC 2E2IK 4BBRK 5IP7K 3K7AC 4JK1A 4OIRA 3HOYC 1I3QK 2O5IA 1TWFC 3HOXK 2PMZD 1YNNA 3GTJK 1IW7A 3GTLK 3M3YC 1TWCC 2YU9K 2PPBA 3S1RK 2JA7K 5IYBC 3EQLA 2VUMC 3HOWK 3RZOC 3S1MC 1K83K 3DXJA 4YFKA 1SFOK 3HOUC 2A6HA 3H0GC 2R7ZC 4X6AC 4Y52K 2WAQL 4OINA 3GTQC 1TWGK 4KN7A 4C3IK 3S2HK 3CQZK 5TMFA 5C4XK 5FLMK 1HQMA 5IYCK 2JA5C 2CW0A 5TMCA 3GTMK 2Y0SL 3FKIK 3S16C 3S1QC 2A68A 3S15K 4AYBL 3S2DK 3HOVC 5M5XK 2NVYC 4A3GK 2A6EA 2WAQD 4QJVB 4A3BK 2JA6C 2JA5K 3PO3K 1WCMK 4A3JK 3I4NK 5IP9C 4A3MK 3S1NC 3S17C 3RZDC 3PO2C 2O5JA 4XLPA 3H3VL 4YFXA 3GTKC 4OIPA 2NVXK 1Y1WK 4GZYA 3HOZK 2E2IC 4BBRC 5IP7C 4G7ZA 1R9TK 3I4MK 4LK0A 4A3LK 5M5YK 1I3QC 4G7HA 2E2HK 4A3FK 3S14K 4OIQA 3GTJC 3GTLC 4BY7K 4YG2A 3GTPK 2YU9C 1XPPA 3S1RC 4BY1K 3H3VD 1I50K 5C3EK 1K83C 1SFOC 1YNJA 4Y52C 3HKZL 1TWAC 1TWGC 4C3JK 4A3CK 5C44C 2PA8L 4A3DK 5FLMC 5C4XC 1Y1VC 5IYCC 2B63K 2JA8K 4KMUA 5IYBK 3GTMC 4YFNA 4BXXK 3GTGK 4LLGA 3S15C 3S2DC 5M3FK 2Y0SD 3HKZD 4A3GC 4AYBD 4A3BC 1I6HK 4A3EK 2PA8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM C;  4A3J C;  5M5W K;  2NVT C;  3S16 K;  3S1Q K;  4A3M C;  2R93 K;  5IYD K;  4QJV A;  5C4J K;  2NVQ K;  1SMY A;  4Y7N K;  4A3K K;  3M4O K;  4A93 K;  3HOX C;  2NVX C;  4XSZ A;  2JA6 K;  1Y1W C;  4OIO A;  4C3H K;  1TWH K;  4QIW L;  2E2J K;  2JA7 C;  2R92 K;  4BBS K;  1R9T C;  5IP9 K;  3HOW C;  2E2H C;  4A3F C;  4A3I K;  4G7O A;  4C2M K;  3K7A K;  3HOY K;  3GTP C;  1TWF K;  4NOI A;  3S2H C;  3WOD A;  4BY1 C;  1I50 C;  1TWC K;  3CQZ C;  5C3E C;  4XSX A;  5D4D A;  4QIW D;  2VUM K;  3FKI C;  4LK1 A;  3RZO K;  3S1M K;  1ZYR A;  4KN4 A;  4MEX A;  3HOU K;  4X6A K;  2R7Z K;  3H0G K;  4A3C C;  5M3M K;  4A3D C;  3GTQ K;  4Q5S A;  2B63 C;  2JA8 C;  4BXX C;  3GTG C;  3M3Y K;  3PO3 C;  3GTO K;  2BE5 A;  3I4N C;  1TWA K;  4XLN A;  2A69 A;  3HOV K;  5C44 K;  1I6H C;  4A3E C;  2NVY K;  3GTO C;  1Y1V K;  2WB1 L;  2R93 C;  1BDF A;  5IYD C;  5C4J C;  4LJZ A;  2NVQ C;  3HOZ C;  4Y7N C;  4MEY A;  4A3K C;  3I4M C;  3S1N K;  1I6V A;  2PMZ L;  3S14 C;  3RZD K;  3S17 K;  3M4O C;  4A93 C;  4BY7 C;  3PO2 K;  4A3L C;  4ZH4 A;  2E2J C;  1TWH C;  2R92 C;  4BBS C;  3GTK K;  2WB1 D;  4MQ9 A;  2NVT K;  4Q4Z A;  5FJ8 K;  4A3I C;  2E2I K;  4BBR K;  5IP7 K;  3K7A C;  4JK1 A;  4OIR A;  3HOY C;  1I3Q K;  2O5I A;  1TWF C;  3HOX K;  2PMZ D;  1YNN A;  3GTJ K;  1IW7 A;  3GTL K;  3M3Y C;  1TWC C;  2YU9 K;  2PPB A;  3S1R K;  2JA7 K;  5IYB C;  3EQL A;  2VUM C;  3HOW K;  3RZO C;  3S1M C;  1K83 K;  3DXJ A;  4YFK A;  1SFO K;  3HOU C;  2A6H A;  3H0G C;  2R7Z C;  4X6A C;  4Y52 K;  2WAQ L;  4OIN A;  3GTQ C;  1TWG K;  4KN7 A;  4C3I K;  3S2H K;  3CQZ K;  5TMF A;  5C4X K;  5FLM K;  1HQM A;  5IYC K;  2JA5 C;  2CW0 A;  5TMC A;  3GTM K;  2Y0S L;  3FKI K;  3S16 C;  3S1Q C;  2A68 A;  3S15 K;  4AYB L;  3S2D K;  3HOV C;  5M5X K;  2NVY C;  4A3G K;  2A6E A;  2WAQ D;  4QJV B;  4A3B K;  2JA6 C;  2JA5 K;  3PO3 K;  1WCM K;  4A3J K;  3I4N K;  5IP9 C;  4A3M K;  3S1N C;  3S17 C;  3RZD C;  3PO2 C;  2O5J A;  4XLP A;  3H3V L;  4YFX A;  3GTK C;  4OIP A;  2NVX K;  1Y1W K;  4GZY A;  3HOZ K;  2E2I C;  4BBR C;  5IP7 C;  4G7Z A;  1R9T K;  3I4M K;  4LK0 A;  4A3L K;  5M5Y K;  1I3Q C;  4G7H A;  2E2H K;  4A3F K;  3S14 K;  4OIQ A;  3GTJ C;  3GTL C;  4BY7 K;  4YG2 A;  3GTP K;  2YU9 C;  1XPP A;  3S1R C;  4BY1 K;  3H3V D;  1I50 K;  5C3E K;  1K83 C;  1SFO C;  1YNJ A;  4Y52 C;  3HKZ L;  1TWA C;  1TWG C;  4C3J K;  4A3C K;  5C44 C;  2PA8 L;  4A3D K;  5FLM C;  5C4X C;  1Y1V C;  5IYC C;  2B63 K;  2JA8 K;  4KMU A;  5IYB K;  3GTM C;  4YFN A;  4BXX K;  3GTG K;  4LLG A;  3S15 C;  3S2D C;  5M3F K;  2Y0S D;  3HKZ D;  4A3G C;  4AYB D;  4A3B C;  1I6H K;  4A3E K;  2PA8 D; 
#chains in the Genus database with same CATH topology
 1WCM C;  1B4B A;  4FZB A;  4Y7N K;  1DCH A;  1V5V A;  3LAP A;  3FOE A;  2NVX C;  2JA6 K;  1AB4 A;  1XXB A;  3NUH A;  4WJ3 M;  1BJT A;  1R9T C;  3HOW C;  2P8T A;  4KMH A;  3AD8 C;  4A3F C;  4GTD A;  1PJ7 A;  3N0C A;  3HOY K;  3GTP C;  4NOI A;  3T01 A;  4GT9 A;  1I50 C;  2RGR A;  2E2H A;  1SFO A;  4XSX A;  3QX3 A;  3FKI C;  1ZYR A;  4KN4 A;  4C3J C;  3CQZ A;  1IE0 A;  5M3M K;  3AQO A;  1WQF A;  3GTQ K;  1HI9 A;  4XLN A;  2A69 A;  3HOV K;  2NVY K;  1WCM A;  3GTO C;  1G51 A;  5C4J C;  4A3K C;  3GDZ A;  1I6V A;  2KWA A;  2NVX A;  2R93 A;  3PO2 K;  2GAH C;  4BBS C;  1R9T A;  2WB1 D;  4MQ9 A;  2NVT K;  4Q4Z A;  3FHZ A;  3GTP A;  3TFH A;  1TWF C;  4DDQ A;  2PMZ D;  1I50 A;  3HOX K;  3S1R K;  4PAB A;  3EQL A;  1WOP A;  1K83 K;  4YFK A;  1SFO K;  1TWC A;  2R7Z C;  5EGH A;  4Y52 K;  4OIN A;  4KC6 A;  3CQZ K;  5C4X K;  1HQM A;  5IYC K;  3GEH A;  2CW0 A;  3GTM K;  1XXA A;  1O28 A;  1JQW A;  3GTO A;  1WQH A;  1ISE A;  2JA6 C;  3PO3 K;  1WCM K;  3I4N K;  1PJ6 A;  5E68 A;  2O5J A;  4ILD A;  2NVX K;  1VRQ C;  2FQO A;  1EH1 A;  4KM9 A;  4BBR C;  1R9T K;  3I4M K;  1TWF A;  5M5Y K;  1EK8 A;  1WSR A;  3S14 K;  4A3F K;  4LQY A;  4OIQ A;  5EGE A;  1ZQ1 C;  3GTP K;  2YU9 C;  3H3V D;  1F93 A;  1I50 K;  2R7Z A;  1WQG A;  4PAA A;  4C3J K;  5FLM C;  1INN A;  3S15 C;  2Y3P A;  5M3F K;  1L0W A;  1WOS A;  4A3G C;  4A3B C;  4GTF A;  3GTO K;  1XZQ B;  2NVT C;  4A3M C;  5C4J K;  1SMY A;  4A3K K;  3HOX C;  4XSZ A;  4LOW A;  4BBS K;  1KQ4 A;  5IOQ A;  2V6S A;  2E2H C;  2YU9 A;  1XXC A;  2JA7 A;  1TWF K;  1WIH A;  4BY1 C;  3CQZ C;  5D4D A;  4LK1 A;  2ZUF A;  2P5M A;  1IBA A;  2R7Z K;  4A3D C;  3OEP A;  3PO3 C;  3I4N C;  2GSU A;  2D6F C;  1UV7 A;  1O26 A;  2WB1 L;  3HXA A;  5CJ9 A;  2R93 C;  4RMF A;  5IOT A;  4MEY A;  3I4M C;  2PMZ L;  3S14 C;  2E2J C;  4C3H C;  1WSV A;  5FJ8 K;  4A3I C;  4BBR K;  4C2M C;  3K7A C;  4Q5S A;  1O27 A;  1TWC C;  2YU9 K;  2PPB A;  2ZUE A;  1DD5 A;  2JA7 K;  2VUM C;  2XCR B;  3RZO C;  4KAT A;  4X6A C;  1BS2 A;  2PHC B;  1J6W A;  5FLM K;  3H0G A;  3M3Y C;  5JVO A;  2Y0S L;  4GTE A;  3S15 K;  4AYB L;  5TJ3 A;  4A3G K;  2A6E A;  4QJV B;  1IL2 A;  4A3B K;  4J3N A;  1J6V A;  4A3M K;  3S17 C;  3RZD C;  1YX2 A;  1JVI A;  3H3V L;  3V4G A;  3AD9 C;  3N0B A;  3Q3Q A;  4BLA A;  2E2I C;  5IP7 C;  4A3L K;  2E2H K;  4P5B A;  3GTL C;  2VUM A;  4BY1 K;  1I3Q A;  3GTJ A;  3GEI A;  3ADA C;  4KM8 A;  1YNJ A;  2GSO A;  4C3I C;  4A3D K;  1WOO A;  1J98 A;  4KMU A;  1TWA A;  5HL8 A;  3VA7 A;  1TWG A;  4GFQ A;  1X31 C;  1DCO A;  1Y1V A;  2Y0S D;  3L4J A;  3HKZ D;  1O24 A;  2JH3 A;  4AYB D;  1ZBS A;  4AH6 A;  1JOE A;  2PA8 D;  5M5W K;  3S16 K;  2R93 K;  4KB4 A;  3IPJ A;  3GIR A;  1BGW A;  4GTA A;  4GTC A;  2E2I A;  2E2J K;  4C3H K;  2JA7 C;  3T02 A;  3GTL A;  3A8J A;  3BP3 A;  4A3I K;  4G7O A;  4C2M K;  3K7A K;  1Y1W A;  3WOD A;  1O2B A;  1TWC K;  5IOR A;  4QIW D;  2VUM K;  4C45 A;  3RZO K;  4X6A K;  4A3C C;  3T00 A;  3LPX A;  4BXX C;  3M3Y K;  2BE5 A;  2V6T A;  4KDD A;  1TWA K;  3TFJ A;  4G0U A;  2B63 A;  5JFE A;  5C44 K;  1Y1V K;  1YCL A;  4P5A A;  3LAJ A;  5IYD C;  2NVQ C;  4A3L C;  3M4O C;  3S17 K;  4A93 C;  3RZD K;  1XZQ A;  2FQT A;  1XZP B;  4ZH4 A;  2R92 C;  1TWH C;  4XCH A;  3MML B;  2E2I K;  5IP7 K;  3TFI A;  4JK1 A;  2O5I A;  1YNN A;  3GTL K;  1IW7 A;  3BP8 C;  2ZFZ A;  1B4A A;  4KMA A;  1XZP A;  3S1M C;  4KB2 A;  3DXJ A;  3HOU C;  2A6H A;  3H0G C;  1O25 A;  1ZVU A;  3S2H K;  4C3I K;  1O2A A;  5TMF A;  4WJ4 A;  3ERE D;  4BKW A;  3G4C A;  1DCP A;  3S16 C;  3OPF A;  3GTQ A;  2A68 A;  3GEE A;  3TTG A;  3L4K A;  3JST A;  5M5X K;  2WAQ D;  3G4A A;  3S1N C;  1C0A A;  3AD7 C;  2R92 A;  1TWH A;  4XLP A;  4YFX A;  3GTK C;  3HOZ K;  4G7Z A;  2RH6 A;  4G7H A;  1I3Q C;  2XCO A;  3GTJ C;  4BY7 K;  4YG2 A;  1EQR A;  3AQP A;  4G0V A;  1EFW A;  3BUE A;  3HKZ L;  1TWA C;  1F9N A;  1TWG C;  1F7U A;  4A3C K;  5C44 C;  2PA8 L;  4P9S A;  1K83 A;  1Y1V C;  5IYB K;  4KAR A;  4BXX K;  1O2F B;  3S2D C;  3GTM A;  3ORE A;  2CFA B;  2JA5 C;  4A3J C;  3S1Q K;  1IS1 A;  4KAW X;  5IYD K;  4QJV A;  2NVQ K;  3M4O K;  1VJE A;  1O29 A;  4GTL A;  4A93 K;  3GTK A;  1RU0 A;  1Y1W C;  4OIO A;  2EBB A;  1TWH K;  4QIW L;  1USM A;  2R92 K;  2CFA A;  5CHP A;  4KAS A;  4LR2 A;  5IP9 K;  1VH2 A;  4O2D A;  3S2H C;  4M1X A;  5C3E C;  2W7V A;  4G0W A;  3S1M K;  1VGX A;  4MEX A;  3HOU K;  5IOS A;  3H0G K;  3FKI A;  2B63 C;  2JA8 C;  3GTG C;  4KMD A;  2GAG C;  3SZZ A;  3SZY A;  5L46 A;  2JA5 A;  1I6H C;  4A3E C;  1BDF A;  4LJZ A;  3HOZ C;  4Y7N C;  4GTB A;  3S1N K;  4BY7 C;  3GTK K;  4BLB A;  4OIR A;  3HOY C;  1I3Q K;  3GTJ K;  3N3Y A;  5IYB C;  1GE9 A;  3HOW K;  2GSN A;  3A8I A;  2WAQ L;  3AH5 A;  3GSI A;  1TWG K;  4KN7 A;  3GTQ C;  3GTG A;  1EI6 A;  3FOF A;  5TMC A;  3S1Q C;  3FKI K;  3S2D K;  3HOV C;  2NVY C;  1PJ5 A;  4WIL A;  2JA5 K;  2XCQ A;  4A3J K;  1F7V A;  5IP9 C;  2V6U A;  2JA6 A;  1VLO A;  3PO2 C;  4OIP A;  1Y1W K;  4GZY A;  4LK0 A;  3A8K A;  1XPP A;  3S1R C;  5C3E K;  1J6X A;  1K83 C;  1SFO C;  4FM9 A;  1WOR A;  4Y52 C;  1ZXO A;  1IQ0 A;  5C4X C;  3S0X A;  5IYC C;  2B63 K;  2JA8 K;  3GTM C;  4YFN A;  3GTG K;  1USO A;  4LLG A;  2NVY A;  1I6H K;  4A3E K;  3CAG A; 
#chains in the Genus database with same CATH homology
 1WCM C;  4A3J C;  5M5W K;  2NVT C;  3S16 K;  3S1Q K;  4A3M C;  2R93 K;  5IYD K;  4QJV A;  5C4J K;  2NVQ K;  1SMY A;  4Y7N K;  4A3K K;  3M4O K;  4A93 K;  3HOX C;  2NVX C;  4XSZ A;  2JA6 K;  1Y1W C;  4OIO A;  4C3H K;  1TWH K;  4QIW L;  2E2J K;  2JA7 C;  2R92 K;  4BBS K;  1R9T C;  5IP9 K;  3HOW C;  2E2H C;  4A3F C;  4A3I K;  4G7O A;  4C2M K;  3K7A K;  3HOY K;  3GTP C;  1TWF K;  4NOI A;  3S2H C;  3WOD A;  4BY1 C;  1I50 C;  1TWC K;  3CQZ C;  5C3E C;  4XSX A;  5D4D A;  4QIW D;  2VUM K;  3FKI C;  4LK1 A;  3RZO K;  3S1M K;  1ZYR A;  4KN4 A;  4MEX A;  3HOU K;  4X6A K;  2R7Z K;  3H0G K;  4A3C C;  5M3M K;  4A3D C;  3GTQ K;  4Q5S A;  2B63 C;  2JA8 C;  4BXX C;  3GTG C;  3M3Y K;  3PO3 C;  3GTO K;  2BE5 A;  3I4N C;  1TWA K;  4XLN A;  2A69 A;  3HOV K;  5C44 K;  1I6H C;  4A3E C;  2NVY K;  3GTO C;  1Y1V K;  2WB1 L;  2R93 C;  1BDF A;  5IYD C;  5C4J C;  4LJZ A;  2NVQ C;  3HOZ C;  4Y7N C;  4MEY A;  4A3K C;  3I4M C;  3S1N K;  1I6V A;  2PMZ L;  3S14 C;  3RZD K;  3S17 K;  3M4O C;  4A93 C;  4BY7 C;  3PO2 K;  4A3L C;  4ZH4 A;  2E2J C;  1TWH C;  2R92 C;  4BBS C;  3GTK K;  2WB1 D;  4MQ9 A;  2NVT K;  4Q4Z A;  5FJ8 K;  4A3I C;  2E2I K;  4BBR K;  5IP7 K;  3K7A C;  4JK1 A;  4OIR A;  3HOY C;  1I3Q K;  2O5I A;  1TWF C;  3HOX K;  2PMZ D;  1YNN A;  3GTJ K;  1IW7 A;  3GTL K;  3M3Y C;  1TWC C;  2YU9 K;  2PPB A;  3S1R K;  2JA7 K;  5IYB C;  3EQL A;  2VUM C;  3HOW K;  3RZO C;  3S1M C;  1K83 K;  3DXJ A;  4YFK A;  1SFO K;  3HOU C;  2A6H A;  3H0G C;  2R7Z C;  4X6A C;  4Y52 K;  2WAQ L;  4OIN A;  3GTQ C;  1TWG K;  4KN7 A;  4C3I K;  3S2H K;  3CQZ K;  5TMF A;  5C4X K;  5FLM K;  1HQM A;  5IYC K;  2JA5 C;  2CW0 A;  5TMC A;  3GTM K;  2Y0S L;  3FKI K;  3S16 C;  3S1Q C;  2A68 A;  3S15 K;  4AYB L;  3S2D K;  3HOV C;  5M5X K;  2NVY C;  4A3G K;  2A6E A;  2WAQ D;  4QJV B;  4A3B K;  2JA6 C;  2JA5 K;  3PO3 K;  1WCM K;  4A3J K;  3I4N K;  5IP9 C;  4A3M K;  3S1N C;  3S17 C;  3RZD C;  3PO2 C;  2O5J A;  4XLP A;  3H3V L;  4YFX A;  3GTK C;  4OIP A;  2NVX K;  1Y1W K;  4GZY A;  3HOZ K;  2E2I C;  4BBR C;  5IP7 C;  4G7Z A;  1R9T K;  3I4M K;  4LK0 A;  4A3L K;  5M5Y K;  1I3Q C;  4G7H A;  2E2H K;  4A3F K;  3S14 K;  4OIQ A;  3GTJ C;  3GTL C;  4BY7 K;  4YG2 A;  3GTP K;  2YU9 C;  1XPP A;  3S1R C;  4BY1 K;  3H3V D;  1I50 K;  5C3E K;  1K83 C;  1SFO C;  1YNJ A;  4Y52 C;  3HKZ L;  1TWA C;  1TWG C;  4C3J K;  4A3C K;  5C44 C;  2PA8 L;  4A3D K;  5FLM C;  5C4X C;  1Y1V C;  5IYC C;  2B63 K;  2JA8 K;  4KMU A;  5IYB K;  3GTM C;  4YFN A;  4BXX K;  3GTG K;  4LLG A;  3S15 C;  3S2D C;  5M3F K;  2Y0S D;  3HKZ D;  4A3G C;  4AYB D;  4A3B C;  1I6H K;  4A3E K;  2PA8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...