1J6XA

Crystal structure of helicobacter pylori luxs
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
b'MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEIIRNHANYVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKAKEVPASNEKQCGWAANHTLEGAQNLARAFLDKRAEWSEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6xA00
1JQWA 2FQTA 5E68A 1VH2A 1VGXA 1JVIA 1J6XA 1INNA 1J6WA 1IE0A 1YCLA 4XCHA 1VJEA 1J98A 1JOEA 1J6VA 2FQOA
chains in the Genus database with same CATH superfamily
1SFOA 3FOEA 1O27A 3GTPA 5IP7K 3S0XA 4WJ4A 3GSIA 1I6HK 2JA8K 3TFHA 3H0GC 1DD5A 2YU9A 4C3IC 4A93C 3K7AK 1C0AA 4GTEA 4ZH4A 2R93C 4Y52C 4WILA 2V6UA 3TTGA 2WB1D 1YNNA 1I3QA 3NUHA 3GTJA 4A3CC 1F93A 1L0WA 2NVTC 3IPJA 2Y0SD 5IOSA 3GTKK 4A3GC 2XCRB 2JH3A 2NVYA 1F7UA 1K83K 5IP7C 4QIWD 3AD9C 2ZFZA 1I6HC 5IYBK 2JA8C 2FQOA 3I4MK 3A8KA 4FM9A 2E2HA 3GTMK 5M5YK 5IP9K 3M3YK 1BGWA 3GDZA 4AH6A 4Y7NK 1O2BA 3GTKC 1SMYA 1WORA 5FJ8K 1IL2A 4G7HA 3BP8C 2VUMA 1IQ0A 5D4DA 3GTQC 2B63K 4A3DK 3I4MC 3CAGA 3FOFA 2JA7K 4Q4ZA 3M4OK 3HOYK 4KB4A 4BY7K 3HOXK 3OPFA 1JVIA 2Y3PA 4Y7NC 4A3JK 3ADAC 1PJ5A 3GTLK 1B4BA 1USMA 1Y1WK 4PABA 1VGXA 2B63C 3S1QC 1AB4A 1RU0A 1HQMA 3GTOK 1K83A 3A8IA 1USOA 3A8JA 4AYBL 2ZUEA 3M4OC 2WAQD 4C45A 3S1RK 1WCMK 3HOXC 3GTGK 4BLBA 2EBBA 3CQZC 1IS1A 4OIPA 3H3VD 1BJTA 5CHPA 3GTMA 2RGRA 5TMFA 3GTLC 1Y1WC 2CW0A 2NVQK 1XXAA 1R9TK 3HKZL 2GSOA 4LOWA 3S14K 3GTOC 1EQRA 1ZQ1C 1G51A 1Y1VK 5M3MK 4C3IK 4A93K 4GZYA 4DDQA 4Y52K 4PAAA 5C4XK 1TWFC 3GTGC 2JA6K 4A3CK 4BXXK 2JA7A 2A6EA 4A3MC 1TWGA 4A3EC 5JFEA 1WOPA 1WSVA 3GIRA 4A3GK 4YFNA 2NVQC 5E68A 4MEXA 3OEPA 1R9TC 3S14C 1ZBSA 1VLOA 4G7OA 3L4JA 2A6HA 4NOIA 1TWCK 1BDFA 4OIOA 1Y1VC 3HOVK 3I4NC 2R92K 4P5AA 3GEEA 2V6SA 5C4XC 5L46A 2JA6C 4BXXC 3GEIA 1IE0A 4GTFA 4QJVB 3RZDC 3HOUC 5HL8A 1ZVUA 5IOQA 5C4JC 4WJ3M 2XCOA 2R7ZK 3SZYA 3DXJA 4A3LC 4KDDA 1B4AA 2E2IK 3RZOK 4KARA 3VA7A 4KB2A 3GTQK 1TWCC 3HXAA 3AD8C 3HOVC 1I50K 2R92C 2PHCB 4C3JC 1BS2A 1TWAC 2O5JA 4KN7A 4MQ9A 2JA5A 4JK1A 4P5BA 2WB1L 1WQHA 2GAGC 3H0GA 3MMLB 2PMZD 1WOSA 2R93A 4GT9A 2Y0SL 4ILDA 1EFWA 2R7ZC 4A3FK 1WQFA 1O29A 2E2IC 3RZOC 4KATA 3FKIK 5C44C 4QIWL 2BE5A 1HI9A 3S1QK 1I50C 4X6AK 1WOOA 4BY1C 3S1NC 2GAHC 4C3HK 1TWHC 1XXCA 5C3EK 1UV7A 1XZQA 4A3BK 3CQZK 1PJ6A 3L4KA 1EK8A 2KWAA 4QJVA 3FHZA 3JSTA 4A3FC 4C2MK 4LK1A 4BBSK 1ZXOA 3FKIC 3GTKA 3BUEA 4Q5SA 3N3YA 3S16K 4X6AC 1XZPB 2XCQA 4G7ZA 4A3IC 3LAPA 3S17C 2CFAB 4C3HC 3HOZK 1JOEA 3GTQA 2GSUA 1DCOA 5C3EC 3HOWC 5EGEA 4A3BC 2P8TA 1TWFK 2NVXC 1SFOK 4LR2A 3TFJA 3GTPK 4A3MK 4A3EK 4O2DA 4C2MC 2YU9K 4BBSC 1YX2A 2A69A 3AQPA 1WQGA 3Q3QA 1J6XA 1I3QK 1INNA 4GTBA 3OREA 3S16C 2PPBA 4LQYA 4OIQA 4GTAA 2ZUFA 3HOZC 1VRQC 3LPXA 1X31C 3I4NK 5IORA 4YFXA 2WAQL 2B63A 1I6VA 3GEHA 1SFOC 3GTPC 4KN4A 4KMHA 1O2FB 3RZDK 2E2JC 3HOUK 3H3VL 2YU9C 5C4JK 1VJEA 3S1MK 3CQZA 4A3LK 3GTJC 1I3QC 3PO3K 4GFQA 3GTLA 1Y1WA 1PJ7A 3V4GA 5TJ3A 4GTDA 1XZPA 1YCLA 1O26A 4C3JK 4LK0A 1TWAK 2CFAA 1DCHA 3AD7C 4XSXA 1ZYRA 1XZQB 2NVYC 4KMUA 3GTOA 1O2AA 4RMFA 4KM9A 2FQTA 4LJZA 2P5MA 4XLPA 1WCMA 5IYDC 2D6FC 1TWFA 3GTGA 4LLGA 3S1MC 1IW7A 4FZBA 2W7VA 2JA5C 4P9SA 3S2HC 2E2HC 5C44K 4OIRA 3PO3C 4GTCA 3T00A 1R9TA 4BY1K 1WIHA 3S1NK 1J98A 1TWHK 5M5XK 2VUMC 1Y1VA 1V5VA 3S15C 2JA6A 2GSNA 1WSRA 4XSZA 5FLMK 4MEYA 5M3FK 3K7AC 1IBAA 4A3IK 3S17K 1DCPA 1TWCA 3HOWK 2PMZL 2R92A 2NVXK 1TWAA 5IYCK 4KASA 5JVOA 1K83C 1EH1A 3N0CA 5FLMC 5IYBC 3N0BA 4YG2A 4KAWX 4AYBD 2R7ZA 4M1XA 1TWGK 2E2IA 4GTLA 3GTMC 2RH6A 5IP9C 3M3YC 3WODA 1VH2A 4BBRK 1F7VA 1I50A 4KC6A 1TWHA 5IYCC 3T01A 1EI6A 2E2JK 3T02A 5M5WK 1GE9A 1J6VA 3HKZD 2A68A 5IOTA 4XLNA 4A3DC 4G0WA 3GTJK 5EGHA 2JA7C 1XXBA 2PA8D 1TWGC 3AQOA 5CJ9A 3HOYC 3AH5A 4XCHA 3FKIA 4A3KK 4G0UA 4BY7C 1YNJA 3S2DK 4BBRC 3LAJA 3BP3A 3G4AA 4KMAA 1ISEA 2NVYK 1XPPA 3G4CA 4A3JC 4G0VA 4KMDA 3QX3A 1J6WA 3PO2K 4YFKA 5IYDK 3TFIA 2NVXA 1O28A 2JA5K 1O24A 3S2HK 2E2HK 3H0GK 1KQ4A 3ERED 1F9NA 3EQLA 2PA8L 4BLAA 2R93K 3S1RC 4A3KC 1WCMC 4OINA 3S2DC 4KM8A 4J3NA 4BKWA 2NVTK 2O5IA 2VUMK 1JQWA 5TMCA 3S15K 3SZZA 3PO2C 2V6TA 1O25A
chains in the Genus database with same CATH topology
1JQWA 2FQTA 5E68A 1VH2A 1VGXA 1JVIA 1J6XA 1INNA 1J6WA 1IE0A 1YCLA 4XCHA 1VJEA 1J98A 1JOEA 1J6VA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  2FQT A;  5E68 A;  1VH2 A;  1VGX A;  1JVI A;  1J6X A;  1INN A;  1J6W A;  1IE0 A;  1YCL A;  4XCH A;  1VJE A;  1J98 A;  1JOE A;  1J6V A;  2FQO A; 
#chains in the Genus database with same CATH topology
 1SFO A;  3FOE A;  1O27 A;  3GTP A;  5IP7 K;  3S0X A;  4WJ4 A;  3GSI A;  1I6H K;  2JA8 K;  3TFH A;  3H0G C;  1DD5 A;  2YU9 A;  4C3I C;  4A93 C;  3K7A K;  1C0A A;  4GTE A;  4ZH4 A;  2R93 C;  4Y52 C;  4WIL A;  2V6U A;  3TTG A;  2WB1 D;  1YNN A;  1I3Q A;  3NUH A;  3GTJ A;  4A3C C;  1F93 A;  1L0W A;  2NVT C;  3IPJ A;  2Y0S D;  5IOS A;  3GTK K;  4A3G C;  2XCR B;  2JH3 A;  2NVY A;  1F7U A;  1K83 K;  5IP7 C;  4QIW D;  3AD9 C;  2ZFZ A;  1I6H C;  5IYB K;  2JA8 C;  2FQO A;  3I4M K;  3A8K A;  4FM9 A;  2E2H A;  3GTM K;  5M5Y K;  5IP9 K;  3M3Y K;  1BGW A;  3GDZ A;  4AH6 A;  4Y7N K;  1O2B A;  3GTK C;  1SMY A;  1WOR A;  5FJ8 K;  1IL2 A;  4G7H A;  3BP8 C;  2VUM A;  1IQ0 A;  5D4D A;  3GTQ C;  2B63 K;  4A3D K;  3I4M C;  3CAG A;  3FOF A;  2JA7 K;  4Q4Z A;  3M4O K;  3HOY K;  4KB4 A;  4BY7 K;  3HOX K;  3OPF A;  1JVI A;  2Y3P A;  4Y7N C;  4A3J K;  3ADA C;  1PJ5 A;  3GTL K;  1B4B A;  1USM A;  1Y1W K;  4PAB A;  1VGX A;  2B63 C;  3S1Q C;  1AB4 A;  1RU0 A;  1HQM A;  3GTO K;  1K83 A;  3A8I A;  1USO A;  3A8J A;  4AYB L;  2ZUE A;  3M4O C;  2WAQ D;  4C45 A;  3S1R K;  1WCM K;  3HOX C;  3GTG K;  4BLB A;  2EBB A;  3CQZ C;  1IS1 A;  4OIP A;  3H3V D;  1BJT A;  5CHP A;  3GTM A;  2RGR A;  5TMF A;  3GTL C;  1Y1W C;  2CW0 A;  2NVQ K;  1XXA A;  1R9T K;  3HKZ L;  2GSO A;  4LOW A;  3S14 K;  3GTO C;  1EQR A;  1ZQ1 C;  1G51 A;  1Y1V K;  5M3M K;  4C3I K;  4A93 K;  4GZY A;  4DDQ A;  4Y52 K;  4PAA A;  5C4X K;  1TWF C;  3GTG C;  2JA6 K;  4A3C K;  4BXX K;  2JA7 A;  2A6E A;  4A3M C;  1TWG A;  4A3E C;  5JFE A;  1WOP A;  1WSV A;  3GIR A;  4A3G K;  4YFN A;  2NVQ C;  5E68 A;  4MEX A;  3OEP A;  1R9T C;  3S14 C;  1ZBS A;  1VLO A;  4G7O A;  3L4J A;  2A6H A;  4NOI A;  1TWC K;  1BDF A;  4OIO A;  1Y1V C;  3HOV K;  3I4N C;  2R92 K;  4P5A A;  3GEE A;  2V6S A;  5C4X C;  5L46 A;  2JA6 C;  4BXX C;  3GEI A;  1IE0 A;  4GTF A;  4QJV B;  3RZD C;  3HOU C;  5HL8 A;  1ZVU A;  5IOQ A;  5C4J C;  4WJ3 M;  2XCO A;  2R7Z K;  3SZY A;  3DXJ A;  4A3L C;  4KDD A;  1B4A A;  2E2I K;  3RZO K;  4KAR A;  3VA7 A;  4KB2 A;  3GTQ K;  1TWC C;  3HXA A;  3AD8 C;  3HOV C;  1I50 K;  2R92 C;  2PHC B;  4C3J C;  1BS2 A;  1TWA C;  2O5J A;  4KN7 A;  4MQ9 A;  2JA5 A;  4JK1 A;  4P5B A;  2WB1 L;  1WQH A;  2GAG C;  3H0G A;  3MML B;  2PMZ D;  1WOS A;  2R93 A;  4GT9 A;  2Y0S L;  4ILD A;  1EFW A;  2R7Z C;  4A3F K;  1WQF A;  1O29 A;  2E2I C;  3RZO C;  4KAT A;  3FKI K;  5C44 C;  4QIW L;  2BE5 A;  1HI9 A;  3S1Q K;  1I50 C;  4X6A K;  1WOO A;  4BY1 C;  3S1N C;  2GAH C;  4C3H K;  1TWH C;  1XXC A;  5C3E K;  1UV7 A;  1XZQ A;  4A3B K;  3CQZ K;  1PJ6 A;  3L4K A;  1EK8 A;  2KWA A;  4QJV A;  3FHZ A;  3JST A;  4A3F C;  4C2M K;  4LK1 A;  4BBS K;  1ZXO A;  3FKI C;  3GTK A;  3BUE A;  4Q5S A;  3N3Y A;  3S16 K;  4X6A C;  1XZP B;  2XCQ A;  4G7Z A;  4A3I C;  3LAP A;  3S17 C;  2CFA B;  4C3H C;  3HOZ K;  1JOE A;  3GTQ A;  2GSU A;  1DCO A;  5C3E C;  3HOW C;  5EGE A;  4A3B C;  2P8T A;  1TWF K;  2NVX C;  1SFO K;  4LR2 A;  3TFJ A;  3GTP K;  4A3M K;  4A3E K;  4O2D A;  4C2M C;  2YU9 K;  4BBS C;  1YX2 A;  2A69 A;  3AQP A;  1WQG A;  3Q3Q A;  1J6X A;  1I3Q K;  1INN A;  4GTB A;  3ORE A;  3S16 C;  2PPB A;  4LQY A;  4OIQ A;  4GTA A;  2ZUF A;  3HOZ C;  1VRQ C;  3LPX A;  1X31 C;  3I4N K;  5IOR A;  4YFX A;  2WAQ L;  2B63 A;  1I6V A;  3GEH A;  1SFO C;  3GTP C;  4KN4 A;  4KMH A;  1O2F B;  3RZD K;  2E2J C;  3HOU K;  3H3V L;  2YU9 C;  5C4J K;  1VJE A;  3S1M K;  3CQZ A;  4A3L K;  3GTJ C;  1I3Q C;  3PO3 K;  4GFQ A;  3GTL A;  1Y1W A;  1PJ7 A;  3V4G A;  5TJ3 A;  4GTD A;  1XZP A;  1YCL A;  1O26 A;  4C3J K;  4LK0 A;  1TWA K;  2CFA A;  1DCH A;  3AD7 C;  4XSX A;  1ZYR A;  1XZQ B;  2NVY C;  4KMU A;  3GTO A;  1O2A A;  4RMF A;  4KM9 A;  2FQT A;  4LJZ A;  2P5M A;  4XLP A;  1WCM A;  5IYD C;  2D6F C;  1TWF A;  3GTG A;  4LLG A;  3S1M C;  1IW7 A;  4FZB A;  2W7V A;  2JA5 C;  4P9S A;  3S2H C;  2E2H C;  5C44 K;  4OIR A;  3PO3 C;  4GTC A;  3T00 A;  1R9T A;  4BY1 K;  1WIH A;  3S1N K;  1J98 A;  1TWH K;  5M5X K;  2VUM C;  1Y1V A;  1V5V A;  3S15 C;  2JA6 A;  2GSN A;  1WSR A;  4XSZ A;  5FLM K;  4MEY A;  5M3F K;  3K7A C;  1IBA A;  4A3I K;  3S17 K;  1DCP A;  1TWC A;  3HOW K;  2PMZ L;  2R92 A;  2NVX K;  1TWA A;  5IYC K;  4KAS A;  5JVO A;  1K83 C;  1EH1 A;  3N0C A;  5FLM C;  5IYB C;  3N0B A;  4YG2 A;  4KAW X;  4AYB D;  2R7Z A;  4M1X A;  1TWG K;  2E2I A;  4GTL A;  3GTM C;  2RH6 A;  5IP9 C;  3M3Y C;  3WOD A;  1VH2 A;  4BBR K;  1F7V A;  1I50 A;  4KC6 A;  1TWH A;  5IYC C;  3T01 A;  1EI6 A;  2E2J K;  3T02 A;  5M5W K;  1GE9 A;  1J6V A;  3HKZ D;  2A68 A;  5IOT A;  4XLN A;  4A3D C;  4G0W A;  3GTJ K;  5EGH A;  2JA7 C;  1XXB A;  2PA8 D;  1TWG C;  3AQO A;  5CJ9 A;  3HOY C;  3AH5 A;  4XCH A;  3FKI A;  4A3K K;  4G0U A;  4BY7 C;  1YNJ A;  3S2D K;  4BBR C;  3LAJ A;  3BP3 A;  3G4A A;  4KMA A;  1ISE A;  2NVY K;  1XPP A;  3G4C A;  4A3J C;  4G0V A;  4KMD A;  3QX3 A;  1J6W A;  3PO2 K;  4YFK A;  5IYD K;  3TFI A;  2NVX A;  1O28 A;  2JA5 K;  1O24 A;  3S2H K;  2E2H K;  3H0G K;  1KQ4 A;  3ERE D;  1F9N A;  3EQL A;  2PA8 L;  4BLA A;  2R93 K;  3S1R C;  4A3K C;  1WCM C;  4OIN A;  3S2D C;  4KM8 A;  4J3N A;  4BKW A;  2NVT K;  2O5I A;  2VUM K;  1JQW A;  5TMC A;  3S15 K;  3SZZ A;  3PO2 C;  2V6T A;  1O25 A; 
#chains in the Genus database with same CATH homology
 1JQW A;  2FQT A;  5E68 A;  1VH2 A;  1VGX A;  1JVI A;  1J6X A;  1INN A;  1J6W A;  1IE0 A;  1YCL A;  4XCH A;  1VJE A;  1J98 A;  1JOE A;  1J6V A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...