1J6XA

Crystal structure of helicobacter pylori luxs
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEIIRNHANYVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKAKEVPASNEKQCGWAANHTLEGAQNLARAFLDKRAEWSEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6xA00
1JQWA 2FQOA 1VH2A 1VJEA 1J98A 1JOEA 1IE0A 1J6WA 4XCHA 1INNA 1YCLA 1VGXA 2FQTA 1J6XA 1J6VA 5E68A 1JVIA
chains in the Genus database with same CATH superfamily
4WILA 1JQWA 5M5XK 1VLOA 3OEPA 3M4OK 4BLAA 1IL2A 3EQLA 2V6TA 3K7AC 1X31C 4GT9A 2E2IA 4KMAA 1EQRA 4A3EC 4A3JC 1B4AA 1PJ5A 5IYCC 1EK8A 1INNA 1Y1VA 1Y1WK 4A3DK 3HOXC 1I6VA 4BKWA 5IOQA 4A3KC 3BUEA 1Y1WA 4QJVB 4XCHA 3HOYK 4MEXA 4BXXK 1TWFC 1O27A 1XXAA 2R92C 4BXXC 4OIRA 3S2DK 2JA5K 4ZH4A 3HOXK 2PA8L 4G7ZA 2V6SA 1Y1VC 5C4XK 1VGXA 3ERED 4BBSK 5M5WK 2CFAA 2EBBA 4OIPA 5JVOA 2NVTC 3M3YC 3VA7A 4KMHA 4RMFA 3NUHA 1EFWA 4G0UA 4FZBA 3S1NC 3PO2C 3PO3K 5C44K 2A68A 3HOUC 5C4XC 2P5MA 3GTGC 4G7OA 1O24A 4BY7K 3HKZL 1YNJA 3TTGA 3S2DC 1TWGK 5C3EC 4GFQA 1TWGC 5C3EK 5IORA 4A3LK 4BY7C 1O2FB 3GTGK 3FKIA 1DCOA 3T00A 5IYCK 1IS1A 3S1NK 3MMLB 1O25A 3AD8C 1ISEA 3S17C 3K7AK 2NVTK 3M3YK 1TWCK 1B4BA 1O26A 2JH3A 4LJZA 4KARA 2PA8D 2FQOA 2NVYA 4KMUA 4G0VA 1Y1VK 4GTCA 4C3JK 4AYBL 2JA7C 1O2BA 3S14K 4P9SA 2R92K 2ZUEA 3GEIA 3G4CA 3CQZK 5IOSA 3GEHA 3HOYC 4A3CK 2YU9A 2Y0SD 4LOWA 3N0BA 1WIHA 5FLMC 4KAWX 1HQMA 3H0GA 1WSRA 1WORA 3T01A 2YU9C 3A8KA 1J6VA 4A3JK 1F9NA 1WOPA 3FKIC 5IP9K 1ZXOA 3A8IA 1J6XA 2ZUFA 2GSOA 3M4OC 1BJTA 4X6AC 2B63A 2E2IC 2WB1D 3GTGA 3HXAA 5CJ9A 1TWAK 1SFOK 2WAQD 3GTPC 3GTMK 1PJ6A 1KQ4A 4QIWL 2P8TA 4XSXA 2Y0SL 4GTLA 3DXJA 2JA8K 1DCPA 3S1RC 5IP7K 2E2HA 1ZYRA 1ZBSA 3LAPA 3QX3A 4KM9A 4C3HC 3GTMA 3T02A 4Y7NC 4A3MK 4LQYA 1G51A 2NVXK 4Q5SA 1I6HK 3S1MK 2VUMA 4OIQA 2A6HA 2FQTA 1XZQB 2PMZL 2NVYC 2JA5A 2O5IA 1WCMC 3GTKC 3TFHA 5C4JK 1WSVA 4AH6A 3S1QC 3GDZA 3HOZK 1F7VA 1TWFA 1V5VA 4OIOA 4Y52K 1O29A 1UV7A 3GTQA 1DCHA 1I3QC 3GTJK 2R7ZC 2NVQK 2GSUA 3GTJA 2D6FC 4C2MK 1I50K 4GTBA 1WCMA 3AQPA 3CAGA 2VUMC 3S2HK 3HKZD 4BY1K 4GZYA 1YCLA 4A3FC 3S16K 5IYDK 1USOA 3RZOC 3TFJA 1WQGA 5EGEA 4A3BC 1F7UA 3BP8C 2E2HC 3GTOC 3GTLK 1I50A 2B63K 4KATA 4BBRC 3RZDC 4GTAA 1K83C 5TJ3A 3I4NK 2CW0A 3HOVC 1TWAA 1SFOA 3RZDK 3GTLA 3G4AA 1WOSA 2R93K 3LAJA 2O5JA 1C0AA 2NVXA 4DDQA 3H3VD 3GTQC 1TWHA 3GTOK 4P5AA 1HI9A 1XZPA 1TWHK 3GTOA 1IE0A 1TWCA 1R9TK 5TMFA 3H0GC 3S16C 2R7ZA 2GAHC 1RU0A 4Q4ZA 3S15K 3HOWC 4NOIA 1JVIA 4O2DA 4A93C 4LR2A 3GTQK 2NVQC 2V6UA 2E2JK 1AB4A 4BLBA 2R93C 5HL8A 4Y52C 4C3IK 3BP3A 3I4MC 1R9TA 3CQZA 1BGWA 2KWAA 1IW7A 5M3MK 4YFKA 3GTKK 3I4MK 1WCMK 1PJ7A 4A3GK 3A8JA 2E2JC 1YX2A 4KB4A 3FHZA 4A3IC 5IYBK 1I6HC 3HOWK 3S15C 2PMZD 4YFXA 3V4GA 4XLNA 4A3MC 2JA6C 1XZPB 1TWGA 1SMYA 3Q3QA 3H0GK 2XCOA 4LLGA 2JA6A 4YFNA 1VH2A 4C3HK 2JA6K 1TWHC 1EH1A 5IYBC 4A3IK 4C2MC 3IPJA 1WQFA 2R7ZK 3L4JA 1I3QK 1XPPA 3GTJC 4KASA 4KB2A 4QJVA 4A3GC 4C45A 3GTPK 5C4JC 1F93A 3HOVK 4MEYA 3ADAC 3I4NC 3GTPA 4GTFA 3TFIA 5D4DA 1K83K 4C3IC 2A69A 1O2AA 1XXBA 2NVYK 3SZZA 1WQHA 2A6EA 4KC6A 1VRQC 5CHPA 4YG2A 3GTLC 2RH6A 4A93K 3S1MC 2E2HK 4OINA 1XZQA 4Y7NK 1IBAA 4G0WA 2CFAB 1BDFA 1R9TC 2RGRA 1K83A 3RZOK 2JA7A 1ZVUA 5IYDC 2YU9K 4ILDA 3S2HC 3H3VL 5FLMK 3GEEA 3S14C 3FOEA 2JA7K 3AQOA 4LK0A 4XLPA 3LPXA 2PPBA 4MQ9A 4JK1A 3AD9C 5M5YK 4WJ4A 4BBRK 4X6AK 2B63C 3WODA 5TMCA 4J3NA 4PAAA 1TWCC 4P5BA 2NVXC 4A3BK 1J98A 5IP9C 4KDDA 3FKIK 2XCQA 3GTKA 1VJEA 1YNNA 3N0CA 4A3FK 1O28A 4BY1C 1JOEA 2PHCB 4KMDA 2GSNA 2VUMK 1XXCA 4XSZA 5E68A 1I50C 5IP7C 4G7HA 4A3CC 3L4KA 1I3QA 4GTEA 3S1RK 3CQZC 5EGHA 5JFEA 4WJ3M 3HOZC 3GTMC 3S1QK 2R93A 4C3JC 1TWAC 3GIRA 1SFOC 2XCRB 3N3YA 3FOFA 1GE9A 1EI6A 1J6WA 1IQ0A 1BS2A 3SZYA 3HOUK 2E2IK 3S0XA 3PO2K 3PO3C 1USMA 4KN7A 4KM8A 2BE5A 2WB1L 5L46A 3OPFA 3S17K 4BBSC 2R92A 2W7VA 1L0WA 3AD7C 5M3FK 1DD5A 4KN4A 2JA5C 3GSIA 4M1XA 4QIWD 4A3LC 2WAQL 5IOTA 1WOOA 2JA8C 4PABA 4LK1A 2Y3PA 2ZFZA 1TWFK 3OREA 3AH5A 4FM9A 4A3KK 1Y1WC 3JSTA 4A3DC 2GAGC 4GTDA 5FJ8K 1ZQ1C 5C44C 4AYBD 4A3EK
chains in the Genus database with same CATH topology
1JQWA 2FQOA 1VH2A 1VJEA 1J98A 1JOEA 1IE0A 1J6WA 4XCHA 1INNA 1YCLA 1VGXA 2FQTA 1J6XA 1J6VA 5E68A 1JVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  2FQO A;  1VH2 A;  1VJE A;  1J98 A;  1JOE A;  1IE0 A;  1J6W A;  4XCH A;  1INN A;  1YCL A;  1VGX A;  2FQT A;  1J6X A;  1J6V A;  5E68 A;  1JVI A; 
#chains in the Genus database with same CATH topology
 4WIL A;  1JQW A;  5M5X K;  1VLO A;  3OEP A;  3M4O K;  4BLA A;  1IL2 A;  3EQL A;  2V6T A;  3K7A C;  1X31 C;  4GT9 A;  2E2I A;  4KMA A;  1EQR A;  4A3E C;  4A3J C;  1B4A A;  1PJ5 A;  5IYC C;  1EK8 A;  1INN A;  1Y1V A;  1Y1W K;  4A3D K;  3HOX C;  1I6V A;  4BKW A;  5IOQ A;  4A3K C;  3BUE A;  1Y1W A;  4QJV B;  4XCH A;  3HOY K;  4MEX A;  4BXX K;  1TWF C;  1O27 A;  1XXA A;  2R92 C;  4BXX C;  4OIR A;  3S2D K;  2JA5 K;  4ZH4 A;  3HOX K;  2PA8 L;  4G7Z A;  2V6S A;  1Y1V C;  5C4X K;  1VGX A;  3ERE D;  4BBS K;  5M5W K;  2CFA A;  2EBB A;  4OIP A;  5JVO A;  2NVT C;  3M3Y C;  3VA7 A;  4KMH A;  4RMF A;  3NUH A;  1EFW A;  4G0U A;  4FZB A;  3S1N C;  3PO2 C;  3PO3 K;  5C44 K;  2A68 A;  3HOU C;  5C4X C;  2P5M A;  3GTG C;  4G7O A;  1O24 A;  4BY7 K;  3HKZ L;  1YNJ A;  3TTG A;  3S2D C;  1TWG K;  5C3E C;  4GFQ A;  1TWG C;  5C3E K;  5IOR A;  4A3L K;  4BY7 C;  1O2F B;  3GTG K;  3FKI A;  1DCO A;  3T00 A;  5IYC K;  1IS1 A;  3S1N K;  3MML B;  1O25 A;  3AD8 C;  1ISE A;  3S17 C;  3K7A K;  2NVT K;  3M3Y K;  1TWC K;  1B4B A;  1O26 A;  2JH3 A;  4LJZ A;  4KAR A;  2PA8 D;  2FQO A;  2NVY A;  4KMU A;  4G0V A;  1Y1V K;  4GTC A;  4C3J K;  4AYB L;  2JA7 C;  1O2B A;  3S14 K;  4P9S A;  2R92 K;  2ZUE A;  3GEI A;  3G4C A;  3CQZ K;  5IOS A;  3GEH A;  3HOY C;  4A3C K;  2YU9 A;  2Y0S D;  4LOW A;  3N0B A;  1WIH A;  5FLM C;  4KAW X;  1HQM A;  3H0G A;  1WSR A;  1WOR A;  3T01 A;  2YU9 C;  3A8K A;  1J6V A;  4A3J K;  1F9N A;  1WOP A;  3FKI C;  5IP9 K;  1ZXO A;  3A8I A;  1J6X A;  2ZUF A;  2GSO A;  3M4O C;  1BJT A;  4X6A C;  2B63 A;  2E2I C;  2WB1 D;  3GTG A;  3HXA A;  5CJ9 A;  1TWA K;  1SFO K;  2WAQ D;  3GTP C;  3GTM K;  1PJ6 A;  1KQ4 A;  4QIW L;  2P8T A;  4XSX A;  2Y0S L;  4GTL A;  3DXJ A;  2JA8 K;  1DCP A;  3S1R C;  5IP7 K;  2E2H A;  1ZYR A;  1ZBS A;  3LAP A;  3QX3 A;  4KM9 A;  4C3H C;  3GTM A;  3T02 A;  4Y7N C;  4A3M K;  4LQY A;  1G51 A;  2NVX K;  4Q5S A;  1I6H K;  3S1M K;  2VUM A;  4OIQ A;  2A6H A;  2FQT A;  1XZQ B;  2PMZ L;  2NVY C;  2JA5 A;  2O5I A;  1WCM C;  3GTK C;  3TFH A;  5C4J K;  1WSV A;  4AH6 A;  3S1Q C;  3GDZ A;  3HOZ K;  1F7V A;  1TWF A;  1V5V A;  4OIO A;  4Y52 K;  1O29 A;  1UV7 A;  3GTQ A;  1DCH A;  1I3Q C;  3GTJ K;  2R7Z C;  2NVQ K;  2GSU A;  3GTJ A;  2D6F C;  4C2M K;  1I50 K;  4GTB A;  1WCM A;  3AQP A;  3CAG A;  2VUM C;  3S2H K;  3HKZ D;  4BY1 K;  4GZY A;  1YCL A;  4A3F C;  3S16 K;  5IYD K;  1USO A;  3RZO C;  3TFJ A;  1WQG A;  5EGE A;  4A3B C;  1F7U A;  3BP8 C;  2E2H C;  3GTO C;  3GTL K;  1I50 A;  2B63 K;  4KAT A;  4BBR C;  3RZD C;  4GTA A;  1K83 C;  5TJ3 A;  3I4N K;  2CW0 A;  3HOV C;  1TWA A;  1SFO A;  3RZD K;  3GTL A;  3G4A A;  1WOS A;  2R93 K;  3LAJ A;  2O5J A;  1C0A A;  2NVX A;  4DDQ A;  3H3V D;  3GTQ C;  1TWH A;  3GTO K;  4P5A A;  1HI9 A;  1XZP A;  1TWH K;  3GTO A;  1IE0 A;  1TWC A;  1R9T K;  5TMF A;  3H0G C;  3S16 C;  2R7Z A;  2GAH C;  1RU0 A;  4Q4Z A;  3S15 K;  3HOW C;  4NOI A;  1JVI A;  4O2D A;  4A93 C;  4LR2 A;  3GTQ K;  2NVQ C;  2V6U A;  2E2J K;  1AB4 A;  4BLB A;  2R93 C;  5HL8 A;  4Y52 C;  4C3I K;  3BP3 A;  3I4M C;  1R9T A;  3CQZ A;  1BGW A;  2KWA A;  1IW7 A;  5M3M K;  4YFK A;  3GTK K;  3I4M K;  1WCM K;  1PJ7 A;  4A3G K;  3A8J A;  2E2J C;  1YX2 A;  4KB4 A;  3FHZ A;  4A3I C;  5IYB K;  1I6H C;  3HOW K;  3S15 C;  2PMZ D;  4YFX A;  3V4G A;  4XLN A;  4A3M C;  2JA6 C;  1XZP B;  1TWG A;  1SMY A;  3Q3Q A;  3H0G K;  2XCO A;  4LLG A;  2JA6 A;  4YFN A;  1VH2 A;  4C3H K;  2JA6 K;  1TWH C;  1EH1 A;  5IYB C;  4A3I K;  4C2M C;  3IPJ A;  1WQF A;  2R7Z K;  3L4J A;  1I3Q K;  1XPP A;  3GTJ C;  4KAS A;  4KB2 A;  4QJV A;  4A3G C;  4C45 A;  3GTP K;  5C4J C;  1F93 A;  3HOV K;  4MEY A;  3ADA C;  3I4N C;  3GTP A;  4GTF A;  3TFI A;  5D4D A;  1K83 K;  4C3I C;  2A69 A;  1O2A A;  1XXB A;  2NVY K;  3SZZ A;  1WQH A;  2A6E A;  4KC6 A;  1VRQ C;  5CHP A;  4YG2 A;  3GTL C;  2RH6 A;  4A93 K;  3S1M C;  2E2H K;  4OIN A;  1XZQ A;  4Y7N K;  1IBA A;  4G0W A;  2CFA B;  1BDF A;  1R9T C;  2RGR A;  1K83 A;  3RZO K;  2JA7 A;  1ZVU A;  5IYD C;  2YU9 K;  4ILD A;  3S2H C;  3H3V L;  5FLM K;  3GEE A;  3S14 C;  3FOE A;  2JA7 K;  3AQO A;  4LK0 A;  4XLP A;  3LPX A;  2PPB A;  4MQ9 A;  4JK1 A;  3AD9 C;  5M5Y K;  4WJ4 A;  4BBR K;  4X6A K;  2B63 C;  3WOD A;  5TMC A;  4J3N A;  4PAA A;  1TWC C;  4P5B A;  2NVX C;  4A3B K;  1J98 A;  5IP9 C;  4KDD A;  3FKI K;  2XCQ A;  3GTK A;  1VJE A;  1YNN A;  3N0C A;  4A3F K;  1O28 A;  4BY1 C;  1JOE A;  2PHC B;  4KMD A;  2GSN A;  2VUM K;  1XXC A;  4XSZ A;  5E68 A;  1I50 C;  5IP7 C;  4G7H A;  4A3C C;  3L4K A;  1I3Q A;  4GTE A;  3S1R K;  3CQZ C;  5EGH A;  5JFE A;  4WJ3 M;  3HOZ C;  3GTM C;  3S1Q K;  2R93 A;  4C3J C;  1TWA C;  3GIR A;  1SFO C;  2XCR B;  3N3Y A;  3FOF A;  1GE9 A;  1EI6 A;  1J6W A;  1IQ0 A;  1BS2 A;  3SZY A;  3HOU K;  2E2I K;  3S0X A;  3PO2 K;  3PO3 C;  1USM A;  4KN7 A;  4KM8 A;  2BE5 A;  2WB1 L;  5L46 A;  3OPF A;  3S17 K;  4BBS C;  2R92 A;  2W7V A;  1L0W A;  3AD7 C;  5M3F K;  1DD5 A;  4KN4 A;  2JA5 C;  3GSI A;  4M1X A;  4QIW D;  4A3L C;  2WAQ L;  5IOT A;  1WOO A;  2JA8 C;  4PAB A;  4LK1 A;  2Y3P A;  2ZFZ A;  1TWF K;  3ORE A;  3AH5 A;  4FM9 A;  4A3K K;  1Y1W C;  3JST A;  4A3D C;  2GAG C;  4GTD A;  5FJ8 K;  1ZQ1 C;  5C44 C;  4AYB D;  4A3E K; 
#chains in the Genus database with same CATH homology
 1JQW A;  2FQO A;  1VH2 A;  1VJE A;  1J98 A;  1JOE A;  1IE0 A;  1J6W A;  4XCH A;  1INN A;  1YCL A;  1VGX A;  2FQT A;  1J6X A;  1J6V A;  5E68 A;  1JVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...