1J6XA

Crystal structure of helicobacter pylori luxs
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEIIRNHANYVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKAKEVPASNEKQCGWAANHTLEGAQNLARAFLDKRAEWSEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6xA00
1JQWA 1JVIA 1VH2A 1JOEA 1J6WA 1J98A 2FQTA 1INNA 1VJEA 5E68A 1J6XA 2FQOA 1VGXA 4XCHA 1IE0A 1J6VA 1YCLA
chains in the Genus database with same CATH superfamily
1I6VA 1IL2A 2W7VA 3TTGA 4C3JC 4XSZA 1USMA 4KMUA 2PA8D 2XCOA 1TWFA 1SFOK 3DXJA 3H0GC 3N0CA 4A3CK 4WJ3M 2JA8K 4QIWD 3H3VD 4GTDA 4LJZA 1WCMK 2P5MA 1AB4A 3S1QC 3BP8C 3GTKA 2XCQA 5IYDK 1RU0A 3S17K 1J6XA 4A3LK 1R9TC 4PAAA 5IYBC 5EGEA 5E68A 1TWCK 2JA6K 2FQOA 1XXCA 1WQFA 3RZDK 5IOSA 3S15C 3M3YC 2GSOA 3GTMC 2Y3PA 3GTPK 3GTQC 2E2JC 2E2HC 3PO2K 4X6AC 3HOUC 3L4KA 2VUMK 4O2DA 1EH1A 2PA8L 3S2DC 4J3NA 2NVQK 4BKWA 5D4DA 1XXBA 4G0VA 1WCMA 1VGXA 1XZQA 5FLMC 1VH2A 4BBRC 4KARA 3H3VL 1I50K 4A3KK 5C3EC 1I3QC 1WSRA 4A3EK 4KN4A 4KMHA 1O2AA 2O5JA 1Y1VA 4G0WA 3EQLA 1EK8A 4KMDA 4BLBA 2A6EA 2ZUEA 2GAHC 4YFXA 2XCRB 1IQ0A 1PJ7A 5HL8A 3AQPA 3GDZA 1BGWA 4C3HC 2ZUFA 1JQWA 4KM9A 1ZXOA 3HOWK 1TWHK 2WAQD 2V6TA 4P5AA 3JSTA 3FOEA 4FZBA 2NVXA 4KM8A 1YNJA 3S2HK 4A93K 1DCOA 5IP7K 4A3IC 1IW7A 3LPXA 3GEHA 2V6UA 2E2HA 4AYBD 2R7ZA 3K7AC 4BXXC 3GTKC 1I50A 5TJ3A 3N3YA 1O2FB 1YCLA 1XZPB 1O24A 3A8KA 4QJVB 1O25A 3HOVC 2YU9A 3S1NK 1WOPA 4YG2A 3MMLB 4C2MC 2NVYA 5C4XC 4GTBA 2PPBA 1JVIA 5JFEA 3HOXK 3GTOK 1TWHA 1WORA 3FHZA 4WJ4A 2WAQL 4ILDA 3OPFA 3IPJA 3CQZA 3HXAA 4A3JK 2O5IA 1GE9A 2JA8C 2JA7K 4XLNA 1DCHA 1TWGK 3I4NC 1WCMC 3HOYC 3S17C 4G7OA 4AYBL 4DDQA 3N0BA 4KB2A 1ZVUA 3PO3C 4A3DK 5EGHA 3LAJA 4A3MC 5IP9K 1Y1VC 2JA6C 3NUHA 5TMCA 4Y52K 4Y7NC 5IYCC 2GAGC 3S16K 3GTLK 4A3BC 4XCHA 5CHPA 4KATA 4BY7C 3GTOA 2WB1L 3T01A 3I4MK 3PO2C 3GTJK 3GTGA 2PMZL 2R92A 4G0UA 2NVXC 1DD5A 1K83K 1PJ5A 3G4CA 5IORA 2JH3A 1Y1WA 3TFIA 4KDDA 1YNNA 1YX2A 4C3JK 1TWGA 3S1RK 3S14C 1VJEA 2GSNA 3TFHA 2R7ZC 2B63K 4RMFA 1UV7A 4OIPA 1I50C 4A3FC 4A3KC 1SFOA 4A3GK 1X31C 2A68A 4C3IK 4OIRA 1F9NA 4NOIA 2NVTC 3S1QK 3T02A 1PJ6A 5IOQA 2YU9C 1J98A 4FM9A 2NVYC 3AD9C 4XSXA 4BY1C 3HOWC 1TWHC 1TWCA 2JA6A 3S15K 1ISEA 3GTMK 1ZQ1C 3FKIK 1EQRA 4GT9A 4G7HA 3GTQK 4A93C 3V4GA 3CQZC 2E2JK 3M4OK 3GTPA 5C4JK 4KN7A 4X6AK 2B63A 1BJTA 2VUMA 1WQGA 1WOSA 3S1MK 1O2BA 3TFJA 2RH6A 1IBAA 3AD8C 3CAGA 2R93K 2JA5K 3OEPA 1G51A 2ZFZA 2CFAB 4QJVA 5FLMK 5TMFA 3BP3A 5C3EK 1INNA 2CW0A 5M5YK 3Q3QA 3GTOC 3GEEA 3SZZA 3HOZC 2GSUA 5L46A 3GTGC 2D6FC 2R92C 5C44K 2PHCB 3FKIA 3LAPA 4OIQA 4BBSC 4Q4ZA 1DCPA 3T00A 4GZYA 2E2IK 2WB1D 1Y1WC 4A3JC 1I6HC 3QX3A 2PMZD 4Q5SA 1TWGC 5JVOA 3BUEA 3HKZD 2BE5A 1TWFK 4A3IK 3AD7C 2R93A 5CJ9A 1SFOC 2JA5A 4A3DC 3OREA 4G7ZA 4A3CC 5IP9C 2E2IA 4BXXK 3VA7A 3GTKK 3WODA 5IYDC 4KB4A 1ZYRA 2Y0SD 3GTLC 4ZH4A 4A3LC 4MEYA 2P8TA 3I4MC 4AH6A 1J6WA 4KC6A 1TWCC 3RZDC 3L4JA 1USOA 2A69A 2FQTA 4XLPA 1VRQC 3GTPC 1O29A 1TWAK 4WILA 3S1RC 1O27A 4KASA 3RZOK 1KQ4A 2B63C 4KMAA 4LR2A 2VUMC 1WQHA 4A3GC 3HKZL 4C3IC 3FOFA 2NVQC 2JA7A 3I4NK 1F7UA 4OIOA 3HOYK 3ADAC 5IOTA 3PO3K 2EBBA 4LK0A 4A3EC 3H0GK 4A3MK 2Y0SL 4YFNA 1Y1VK 3GEIA 1V5VA 3A8JA 4P5BA 4MEXA 4Y7NK 5IYCK 5M5WK 1C0AA 3FKIC 4YFKA 4A3BK 2V6SA 4GTLA 3GTLA 1R9TK 4BY7K 3M4OC 1TWAA 5C4JC 1O26A 3G4AA 5IYBK 3GTJA 4PABA 1JOEA 3M3YK 2NVXK 1WIHA 3S1MC 3GSIA 1K83A 3S2HC 3A8IA 1HI9A 2R93C 5IP7C 1B4AA 2JA5C 2E2HK 3S14K 4KAWX 4OINA 3HOUK 2CFAA 4QIWL 4P9SA 2R7ZK 4GTFA 1L0WA 4A3FK 3AQOA 3S2DK 3H0GA 4LQYA 1EI6A 1XZPA 2NVTK 1XZQB 1F93A 3SZYA 1IS1A 5C44C 2YU9K 4BBRK 3S1NC 1I3QK 1WSVA 2NVYK 2E2IC 1R9TA 4BY1K 1F7VA 4GTCA 3HOXC 4LLGA 3AH5A 1VLOA 3S0XA 1B4BA 1ZBSA 5M3FK 5FJ8K 3GTMA 4GTAA 1TWFC 3CQZK 5M5XK 3GTQA 4M1XA 4C3HK 3ERED 1XPPA 2JA7C 1BS2A 1HQMA 1WOOA 4GTEA 1O28A 1BDFA 2RGRA 4C2MK 3K7AK 4JK1A 4C45A 4Y52C 1I3QA 2A6HA 4MQ9A 1IE0A 1SMYA 3S16C 3GIRA 5M3MK 1TWAC 4BLAA 3HOZK 3GTGK 2KWAA 3GTJC 1EFWA 2R92K 3RZOC 3HOVK 1J6VA 4GFQA 4BBSK 4LK1A 1Y1WK 1K83C 5C4XK 1XXAA 1I6HK 4LOWA
chains in the Genus database with same CATH topology
1JQWA 1JVIA 1VH2A 1JOEA 1J6WA 1J98A 2FQTA 1INNA 1VJEA 5E68A 1J6XA 2FQOA 1VGXA 4XCHA 1IE0A 1J6VA 1YCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1JVI A;  1VH2 A;  1JOE A;  1J6W A;  1J98 A;  2FQT A;  1INN A;  1VJE A;  5E68 A;  1J6X A;  2FQO A;  1VGX A;  4XCH A;  1IE0 A;  1J6V A;  1YCL A; 
#chains in the Genus database with same CATH topology
 1I6V A;  1IL2 A;  2W7V A;  3TTG A;  4C3J C;  4XSZ A;  1USM A;  4KMU A;  2PA8 D;  2XCO A;  1TWF A;  1SFO K;  3DXJ A;  3H0G C;  3N0C A;  4A3C K;  4WJ3 M;  2JA8 K;  4QIW D;  3H3V D;  4GTD A;  4LJZ A;  1WCM K;  2P5M A;  1AB4 A;  3S1Q C;  3BP8 C;  3GTK A;  2XCQ A;  5IYD K;  1RU0 A;  3S17 K;  1J6X A;  4A3L K;  1R9T C;  4PAA A;  5IYB C;  5EGE A;  5E68 A;  1TWC K;  2JA6 K;  2FQO A;  1XXC A;  1WQF A;  3RZD K;  5IOS A;  3S15 C;  3M3Y C;  2GSO A;  3GTM C;  2Y3P A;  3GTP K;  3GTQ C;  2E2J C;  2E2H C;  3PO2 K;  4X6A C;  3HOU C;  3L4K A;  2VUM K;  4O2D A;  1EH1 A;  2PA8 L;  3S2D C;  4J3N A;  2NVQ K;  4BKW A;  5D4D A;  1XXB A;  4G0V A;  1WCM A;  1VGX A;  1XZQ A;  5FLM C;  1VH2 A;  4BBR C;  4KAR A;  3H3V L;  1I50 K;  4A3K K;  5C3E C;  1I3Q C;  1WSR A;  4A3E K;  4KN4 A;  4KMH A;  1O2A A;  2O5J A;  1Y1V A;  4G0W A;  3EQL A;  1EK8 A;  4KMD A;  4BLB A;  2A6E A;  2ZUE A;  2GAH C;  4YFX A;  2XCR B;  1IQ0 A;  1PJ7 A;  5HL8 A;  3AQP A;  3GDZ A;  1BGW A;  4C3H C;  2ZUF A;  1JQW A;  4KM9 A;  1ZXO A;  3HOW K;  1TWH K;  2WAQ D;  2V6T A;  4P5A A;  3JST A;  3FOE A;  4FZB A;  2NVX A;  4KM8 A;  1YNJ A;  3S2H K;  4A93 K;  1DCO A;  5IP7 K;  4A3I C;  1IW7 A;  3LPX A;  3GEH A;  2V6U A;  2E2H A;  4AYB D;  2R7Z A;  3K7A C;  4BXX C;  3GTK C;  1I50 A;  5TJ3 A;  3N3Y A;  1O2F B;  1YCL A;  1XZP B;  1O24 A;  3A8K A;  4QJV B;  1O25 A;  3HOV C;  2YU9 A;  3S1N K;  1WOP A;  4YG2 A;  3MML B;  4C2M C;  2NVY A;  5C4X C;  4GTB A;  2PPB A;  1JVI A;  5JFE A;  3HOX K;  3GTO K;  1TWH A;  1WOR A;  3FHZ A;  4WJ4 A;  2WAQ L;  4ILD A;  3OPF A;  3IPJ A;  3CQZ A;  3HXA A;  4A3J K;  2O5I A;  1GE9 A;  2JA8 C;  2JA7 K;  4XLN A;  1DCH A;  1TWG K;  3I4N C;  1WCM C;  3HOY C;  3S17 C;  4G7O A;  4AYB L;  4DDQ A;  3N0B A;  4KB2 A;  1ZVU A;  3PO3 C;  4A3D K;  5EGH A;  3LAJ A;  4A3M C;  5IP9 K;  1Y1V C;  2JA6 C;  3NUH A;  5TMC A;  4Y52 K;  4Y7N C;  5IYC C;  2GAG C;  3S16 K;  3GTL K;  4A3B C;  4XCH A;  5CHP A;  4KAT A;  4BY7 C;  3GTO A;  2WB1 L;  3T01 A;  3I4M K;  3PO2 C;  3GTJ K;  3GTG A;  2PMZ L;  2R92 A;  4G0U A;  2NVX C;  1DD5 A;  1K83 K;  1PJ5 A;  3G4C A;  5IOR A;  2JH3 A;  1Y1W A;  3TFI A;  4KDD A;  1YNN A;  1YX2 A;  4C3J K;  1TWG A;  3S1R K;  3S14 C;  1VJE A;  2GSN A;  3TFH A;  2R7Z C;  2B63 K;  4RMF A;  1UV7 A;  4OIP A;  1I50 C;  4A3F C;  4A3K C;  1SFO A;  4A3G K;  1X31 C;  2A68 A;  4C3I K;  4OIR A;  1F9N A;  4NOI A;  2NVT C;  3S1Q K;  3T02 A;  1PJ6 A;  5IOQ A;  2YU9 C;  1J98 A;  4FM9 A;  2NVY C;  3AD9 C;  4XSX A;  4BY1 C;  3HOW C;  1TWH C;  1TWC A;  2JA6 A;  3S15 K;  1ISE A;  3GTM K;  1ZQ1 C;  3FKI K;  1EQR A;  4GT9 A;  4G7H A;  3GTQ K;  4A93 C;  3V4G A;  3CQZ C;  2E2J K;  3M4O K;  3GTP A;  5C4J K;  4KN7 A;  4X6A K;  2B63 A;  1BJT A;  2VUM A;  1WQG A;  1WOS A;  3S1M K;  1O2B A;  3TFJ A;  2RH6 A;  1IBA A;  3AD8 C;  3CAG A;  2R93 K;  2JA5 K;  3OEP A;  1G51 A;  2ZFZ A;  2CFA B;  4QJV A;  5FLM K;  5TMF A;  3BP3 A;  5C3E K;  1INN A;  2CW0 A;  5M5Y K;  3Q3Q A;  3GTO C;  3GEE A;  3SZZ A;  3HOZ C;  2GSU A;  5L46 A;  3GTG C;  2D6F C;  2R92 C;  5C44 K;  2PHC B;  3FKI A;  3LAP A;  4OIQ A;  4BBS C;  4Q4Z A;  1DCP A;  3T00 A;  4GZY A;  2E2I K;  2WB1 D;  1Y1W C;  4A3J C;  1I6H C;  3QX3 A;  2PMZ D;  4Q5S A;  1TWG C;  5JVO A;  3BUE A;  3HKZ D;  2BE5 A;  1TWF K;  4A3I K;  3AD7 C;  2R93 A;  5CJ9 A;  1SFO C;  2JA5 A;  4A3D C;  3ORE A;  4G7Z A;  4A3C C;  5IP9 C;  2E2I A;  4BXX K;  3VA7 A;  3GTK K;  3WOD A;  5IYD C;  4KB4 A;  1ZYR A;  2Y0S D;  3GTL C;  4ZH4 A;  4A3L C;  4MEY A;  2P8T A;  3I4M C;  4AH6 A;  1J6W A;  4KC6 A;  1TWC C;  3RZD C;  3L4J A;  1USO A;  2A69 A;  2FQT A;  4XLP A;  1VRQ C;  3GTP C;  1O29 A;  1TWA K;  4WIL A;  3S1R C;  1O27 A;  4KAS A;  3RZO K;  1KQ4 A;  2B63 C;  4KMA A;  4LR2 A;  2VUM C;  1WQH A;  4A3G C;  3HKZ L;  4C3I C;  3FOF A;  2NVQ C;  2JA7 A;  3I4N K;  1F7U A;  4OIO A;  3HOY K;  3ADA C;  5IOT A;  3PO3 K;  2EBB A;  4LK0 A;  4A3E C;  3H0G K;  4A3M K;  2Y0S L;  4YFN A;  1Y1V K;  3GEI A;  1V5V A;  3A8J A;  4P5B A;  4MEX A;  4Y7N K;  5IYC K;  5M5W K;  1C0A A;  3FKI C;  4YFK A;  4A3B K;  2V6S A;  4GTL A;  3GTL A;  1R9T K;  4BY7 K;  3M4O C;  1TWA A;  5C4J C;  1O26 A;  3G4A A;  5IYB K;  3GTJ A;  4PAB A;  1JOE A;  3M3Y K;  2NVX K;  1WIH A;  3S1M C;  3GSI A;  1K83 A;  3S2H C;  3A8I A;  1HI9 A;  2R93 C;  5IP7 C;  1B4A A;  2JA5 C;  2E2H K;  3S14 K;  4KAW X;  4OIN A;  3HOU K;  2CFA A;  4QIW L;  4P9S A;  2R7Z K;  4GTF A;  1L0W A;  4A3F K;  3AQO A;  3S2D K;  3H0G A;  4LQY A;  1EI6 A;  1XZP A;  2NVT K;  1XZQ B;  1F93 A;  3SZY A;  1IS1 A;  5C44 C;  2YU9 K;  4BBR K;  3S1N C;  1I3Q K;  1WSV A;  2NVY K;  2E2I C;  1R9T A;  4BY1 K;  1F7V A;  4GTC A;  3HOX C;  4LLG A;  3AH5 A;  1VLO A;  3S0X A;  1B4B A;  1ZBS A;  5M3F K;  5FJ8 K;  3GTM A;  4GTA A;  1TWF C;  3CQZ K;  5M5X K;  3GTQ A;  4M1X A;  4C3H K;  3ERE D;  1XPP A;  2JA7 C;  1BS2 A;  1HQM A;  1WOO A;  4GTE A;  1O28 A;  1BDF A;  2RGR A;  4C2M K;  3K7A K;  4JK1 A;  4C45 A;  4Y52 C;  1I3Q A;  2A6H A;  4MQ9 A;  1IE0 A;  1SMY A;  3S16 C;  3GIR A;  5M3M K;  1TWA C;  4BLA A;  3HOZ K;  3GTG K;  2KWA A;  3GTJ C;  1EFW A;  2R92 K;  3RZO C;  3HOV K;  1J6V A;  4GFQ A;  4BBS K;  4LK1 A;  1Y1W K;  1K83 C;  5C4X K;  1XXA A;  1I6H K;  4LOW A; 
#chains in the Genus database with same CATH homology
 1JQW A;  1JVI A;  1VH2 A;  1JOE A;  1J6W A;  1J98 A;  2FQT A;  1INN A;  1VJE A;  5E68 A;  1J6X A;  2FQO A;  1VGX A;  4XCH A;  1IE0 A;  1J6V A;  1YCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...