1J6XA

Crystal structure of helicobacter pylori luxs
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEIIRNHANYVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKAKEVPASNEKQCGWAANHTLEGAQNLARAFLDKRAEWSEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6xA00
1VH2A 1IE0A 1INNA 1JQWA 1VGXA 4XCHA 1JOEA 1J6WA 2FQOA 5E68A 1YCLA 1JVIA 1VJEA 1J6VA 1J6XA 1J98A 2FQTA
chains in the Genus database with same CATH superfamily
4FZBA 2E2HK 4Y52C 4A3KC 3GTLA 3A8KA 2XCOA 1IBAA 4LK0A 2V6TA 4KMAA 1Y1VK 4OIOA 1BGWA 1TWHC 3SZZA 3S0XA 2PA8D 3NUHA 3GTQK 3S2DC 1IW7A 5IYBC 2GSNA 4C3JC 3TFHA 3OPFA 3FKIC 3S14K 4LQYA 2JA7A 1SFOC 4GTLA 3GTKA 2GAGC 2XCRB 1TWCA 4GTAA 4QJVB 4MEXA 1VRQC 4G0UA 4OIQA 3I4NK 1UV7A 2CFAB 1GE9A 4BXXK 3GIRA 4A3GC 4C2MK 4BY1C 3T00A 4KC6A 4XSXA 1XXBA 4G0VA 3GTMA 2R93K 5IYDC 1R9TA 5D4DA 2VUMC 2JA6A 4P5BA 4M1XA 4XLPA 1WCMC 4G7HA 4QJVA 3VA7A 3HKZL 3GTPA 2NVXC 3S17K 4A3KK 4Y52K 5C4XC 3GTKC 4C3IC 4KASA 2YU9C 2WAQD 3GTOA 5CJ9A 3HOWC 3FOFA 2NVYK 4LOWA 3LAPA 4XSZA 5HL8A 3SZYA 3DXJA 2R7ZA 2FQOA 5M3FK 5IYBK 1WQHA 1IL2A 3GTMC 4C3JK 1DCOA 1R9TC 2JA6C 4BKWA 4AYBL 3FKIK 2Y0SL 3QX3A 3A8JA 1F7VA 1J6XA 1SFOK 4A3MC 3GSIA 3GTPC 3S15C 3GTLK 4BBRC 1AB4A 5C4JC 2PMZD 4DDQA 4KAWX 4ILDA 2NVTK 1XZPB 3PO3C 2GAHC 1O24A 3AQOA 4G7ZA 3GTOC 4A3GK 4BY1K 4QIWD 4GTFA 1I6HC 3HOYC 5EGEA 1TWHA 5IYDK 2W7VA 5IP7C 1I6VA 3JSTA 3HOVC 2R92C 2Y3PA 3G4CA 3S1MK 3S2HK 3S1NC 2ZUEA 3T01A 1B4AA 2ZUFA 2JA7K 5C4XK 1WOOA 2PA8L 1JQWA 1SMYA 2A69A 3GTKK 1DCPA 1EQRA 1TWCK 1XZPA 1YNJA 4A3DC 5C44C 1IQ0A 5M5WK 3CAGA 3FOEA 3N3YA 2JA5C 3HOZC 4KB2A 2D6FC 2E2IA 5C3EK 3RZOC 3GTMK 4C45A 2PPBA 4GFQA 1R9TK 2O5JA 4A3IC 1K83A 2JA6K 4ZH4A 4FM9A 2VUMA 4KN7A 1ZYRA 4A93K 4Q4ZA 3Q3QA 4A3MK 5M5XK 3GTPK 1WCMA 1I50A 3S15K 2NVQC 4BBRK 1O2FB 5C4JK 2NVXA 2FQTA 3PO3K 4G0WA 3GTOK 1EK8A 2YU9A 4WJ4A 3LAJA 1YNNA 4WILA 5FJ8K 3HOYK 1I6HK 3M4OK 4P5AA 3AD8C 2E2IC 3CQZA 5IP7K 1Y1WA 1VJEA 3HOVK 2R7ZK 3GEIA 4X6AK 1F93A 4XCHA 2WAQL 3BP8C 3S1NK 4A3FC 1C0AA 3G4AA 3AD9C 3N0CA 1K83C 2JA8C 1HQMA 3HOXC 2B63A 1O2BA 1G51A 3GTJA 2E2JC 4A3DK 1I50C 4JK1A 5E68A 3S16C 5TMFA 1PJ5A 3HOZK 5M3MK 2V6SA 1ISEA 4KMUA 1JVIA 1DCHA 4KDDA 1O27A 4YFNA 3T02A 5CHPA 3GTGA 2A68A 5M5YK 1X31C 1TWHK 3CQZC 1EH1A 1WQFA 4A3IK 1Y1WC 4A3BC 2PMZL 4KARA 4RMFA 3S2DK 2R92A 4QIWL 4MEYA 1TWFA 2WB1D 5FLMC 4YG2A 1I3QC 4G7OA 3GEEA 2KWAA 1V5VA 1BS2A 4KN4A 2B63C 1ZBSA 1XPPA 3GTJC 2E2HC 1J98A 2A6HA 4A3EC 2JA5A 2E2IK 3MMLB 5IOQA 4J3NA 1WQGA 3GTGC 2ZFZA 1WIHA 4A3FK 2BE5A 1VH2A 4KATA 1K83K 3ERED 2GSOA 2JA8K 2VUMK 4A3JC 3HOXK 2E2JK 1TWFC 1I50K 1WCMK 3K7AC 4KMDA 4P9SA 3S14C 2NVXK 4XLNA 2V6UA 2RH6A 4C3IK 1YCLA 1DD5A 2YU9K 1O25A 1RU0A 1J6WA 3HOWK 3AQPA 3H3VD 1WOPA 3BP3A 4GZYA 3CQZK 1Y1WK 4A3BK 4MQ9A 1USMA 4OIRA 2R93C 1VGXA 4BBSC 2GSUA 5FLMK 3RZDC 1WSVA 4KMHA 5JFEA 1B4BA 3S1RC 2B63K 1EI6A 1WSRA 4O2DA 3GTJK 1TWAA 4OINA 5TJ3A 3S17C 4GTBA 4A3EK 4YFXA 1PJ6A 3LPXA 4GT9A 1KQ4A 1BJTA 2P8TA 2CW0A 1TWGA 4A3LC 3GTGK 2NVYC 1O26A 3AD7C 1BDFA 3OREA 3PO2C 3OEPA 4Q5SA 4A3JK 2R92K 1JOEA 3BUEA 4BY7C 5IOTA 1F9NA 4KM8A 1EFWA 5JVOA 3I4MC 1TWFK 3K7AK 3AH5A 1HI9A 1I3QA 3S1QC 1O28A 3TFJA 3EQLA 5IYCC 3GDZA 3H0GA 3IPJA 1TWAC 4Y7NC 3GTLC 4OIPA 5C44K 2E2HA 2WB1L 1O2AA 4AH6A 2JA5K 2NVTC 3GEHA 1TWGC 1Y1VA 3RZOK 2EBBA 4PAAA 4BBSK 4KB4A 3TFIA 3RZDK 3HOUC 3GTQA 3ADAC 2RGRA 3FHZA 4LLGA 1XXCA 4C3HC 3S1RK 3S1MC 3S2HC 1YX2A 1XZQB 3HXAA 5TMCA 4A3CC 2XCQA 3L4JA 2A6EA 3M3YC 1F7UA 3V4GA 2JA7C 2NVQK 2CFAA 1IE0A 1INNA 1TWCC 1XXAA 5IP9C 3H0GC 1IS1A 1L0WA 4NOIA 3A8IA 4A3LK 4KM9A 4GTCA 1PJ7A 1ZQ1C 4BLBA 5IOSA 3PO2K 5C3EC 1Y1VC 4LJZA 1XZQA 4BY7K 3HKZD 2R93A 3I4MK 5IORA 3H3VL 3GTQC 5EGHA 3S1QK 4BLAA 4A93C 3WODA 5IYCK 2O5IA 1TWAK 4Y7NK 3S16K 1USOA 2JH3A 4PABA 1VLOA 1ZVUA 1J6VA 4LR2A 5L46A 2PHCB 1TWGK 4YFKA 4LK1A 1WORA 2NVYA 4GTEA 3M4OC 1O29A 4AYBD 3I4NC 4WJ3M 2Y0SD 4BXXC 3HOUK 2R7ZC 3TTGA 4X6AC 3N0BA 4GTDA 4C2MC 4C3HK 4A3CK 3M3YK 1I3QK 1ZXOA 3FKIA 1SFOA 1WOSA 3L4KA 5IP9K 3H0GK 2P5MA
chains in the Genus database with same CATH topology
1VH2A 1IE0A 1INNA 1JQWA 1VGXA 4XCHA 1JOEA 1J6WA 2FQOA 5E68A 1YCLA 1JVIA 1VJEA 1J6VA 1J6XA 1J98A 2FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH2 A;  1IE0 A;  1INN A;  1JQW A;  1VGX A;  4XCH A;  1JOE A;  1J6W A;  2FQO A;  5E68 A;  1YCL A;  1JVI A;  1VJE A;  1J6V A;  1J6X A;  1J98 A;  2FQT A; 
#chains in the Genus database with same CATH topology
 4FZB A;  2E2H K;  4Y52 C;  4A3K C;  3GTL A;  3A8K A;  2XCO A;  1IBA A;  4LK0 A;  2V6T A;  4KMA A;  1Y1V K;  4OIO A;  1BGW A;  1TWH C;  3SZZ A;  3S0X A;  2PA8 D;  3NUH A;  3GTQ K;  3S2D C;  1IW7 A;  5IYB C;  2GSN A;  4C3J C;  3TFH A;  3OPF A;  3FKI C;  3S14 K;  4LQY A;  2JA7 A;  1SFO C;  4GTL A;  3GTK A;  2GAG C;  2XCR B;  1TWC A;  4GTA A;  4QJV B;  4MEX A;  1VRQ C;  4G0U A;  4OIQ A;  3I4N K;  1UV7 A;  2CFA B;  1GE9 A;  4BXX K;  3GIR A;  4A3G C;  4C2M K;  4BY1 C;  3T00 A;  4KC6 A;  4XSX A;  1XXB A;  4G0V A;  3GTM A;  2R93 K;  5IYD C;  1R9T A;  5D4D A;  2VUM C;  2JA6 A;  4P5B A;  4M1X A;  4XLP A;  1WCM C;  4G7H A;  4QJV A;  3VA7 A;  3HKZ L;  3GTP A;  2NVX C;  3S17 K;  4A3K K;  4Y52 K;  5C4X C;  3GTK C;  4C3I C;  4KAS A;  2YU9 C;  2WAQ D;  3GTO A;  5CJ9 A;  3HOW C;  3FOF A;  2NVY K;  4LOW A;  3LAP A;  4XSZ A;  5HL8 A;  3SZY A;  3DXJ A;  2R7Z A;  2FQO A;  5M3F K;  5IYB K;  1WQH A;  1IL2 A;  3GTM C;  4C3J K;  1DCO A;  1R9T C;  2JA6 C;  4BKW A;  4AYB L;  3FKI K;  2Y0S L;  3QX3 A;  3A8J A;  1F7V A;  1J6X A;  1SFO K;  4A3M C;  3GSI A;  3GTP C;  3S15 C;  3GTL K;  4BBR C;  1AB4 A;  5C4J C;  2PMZ D;  4DDQ A;  4KAW X;  4ILD A;  2NVT K;  1XZP B;  3PO3 C;  2GAH C;  1O24 A;  3AQO A;  4G7Z A;  3GTO C;  4A3G K;  4BY1 K;  4QIW D;  4GTF A;  1I6H C;  3HOY C;  5EGE A;  1TWH A;  5IYD K;  2W7V A;  5IP7 C;  1I6V A;  3JST A;  3HOV C;  2R92 C;  2Y3P A;  3G4C A;  3S1M K;  3S2H K;  3S1N C;  2ZUE A;  3T01 A;  1B4A A;  2ZUF A;  2JA7 K;  5C4X K;  1WOO A;  2PA8 L;  1JQW A;  1SMY A;  2A69 A;  3GTK K;  1DCP A;  1EQR A;  1TWC K;  1XZP A;  1YNJ A;  4A3D C;  5C44 C;  1IQ0 A;  5M5W K;  3CAG A;  3FOE A;  3N3Y A;  2JA5 C;  3HOZ C;  4KB2 A;  2D6F C;  2E2I A;  5C3E K;  3RZO C;  3GTM K;  4C45 A;  2PPB A;  4GFQ A;  1R9T K;  2O5J A;  4A3I C;  1K83 A;  2JA6 K;  4ZH4 A;  4FM9 A;  2VUM A;  4KN7 A;  1ZYR A;  4A93 K;  4Q4Z A;  3Q3Q A;  4A3M K;  5M5X K;  3GTP K;  1WCM A;  1I50 A;  3S15 K;  2NVQ C;  4BBR K;  1O2F B;  5C4J K;  2NVX A;  2FQT A;  3PO3 K;  4G0W A;  3GTO K;  1EK8 A;  2YU9 A;  4WJ4 A;  3LAJ A;  1YNN A;  4WIL A;  5FJ8 K;  3HOY K;  1I6H K;  3M4O K;  4P5A A;  3AD8 C;  2E2I C;  3CQZ A;  5IP7 K;  1Y1W A;  1VJE A;  3HOV K;  2R7Z K;  3GEI A;  4X6A K;  1F93 A;  4XCH A;  2WAQ L;  3BP8 C;  3S1N K;  4A3F C;  1C0A A;  3G4A A;  3AD9 C;  3N0C A;  1K83 C;  2JA8 C;  1HQM A;  3HOX C;  2B63 A;  1O2B A;  1G51 A;  3GTJ A;  2E2J C;  4A3D K;  1I50 C;  4JK1 A;  5E68 A;  3S16 C;  5TMF A;  1PJ5 A;  3HOZ K;  5M3M K;  2V6S A;  1ISE A;  4KMU A;  1JVI A;  1DCH A;  4KDD A;  1O27 A;  4YFN A;  3T02 A;  5CHP A;  3GTG A;  2A68 A;  5M5Y K;  1X31 C;  1TWH K;  3CQZ C;  1EH1 A;  1WQF A;  4A3I K;  1Y1W C;  4A3B C;  2PMZ L;  4KAR A;  4RMF A;  3S2D K;  2R92 A;  4QIW L;  4MEY A;  1TWF A;  2WB1 D;  5FLM C;  4YG2 A;  1I3Q C;  4G7O A;  3GEE A;  2KWA A;  1V5V A;  1BS2 A;  4KN4 A;  2B63 C;  1ZBS A;  1XPP A;  3GTJ C;  2E2H C;  1J98 A;  2A6H A;  4A3E C;  2JA5 A;  2E2I K;  3MML B;  5IOQ A;  4J3N A;  1WQG A;  3GTG C;  2ZFZ A;  1WIH A;  4A3F K;  2BE5 A;  1VH2 A;  4KAT A;  1K83 K;  3ERE D;  2GSO A;  2JA8 K;  2VUM K;  4A3J C;  3HOX K;  2E2J K;  1TWF C;  1I50 K;  1WCM K;  3K7A C;  4KMD A;  4P9S A;  3S14 C;  2NVX K;  4XLN A;  2V6U A;  2RH6 A;  4C3I K;  1YCL A;  1DD5 A;  2YU9 K;  1O25 A;  1RU0 A;  1J6W A;  3HOW K;  3AQP A;  3H3V D;  1WOP A;  3BP3 A;  4GZY A;  3CQZ K;  1Y1W K;  4A3B K;  4MQ9 A;  1USM A;  4OIR A;  2R93 C;  1VGX A;  4BBS C;  2GSU A;  5FLM K;  3RZD C;  1WSV A;  4KMH A;  5JFE A;  1B4B A;  3S1R C;  2B63 K;  1EI6 A;  1WSR A;  4O2D A;  3GTJ K;  1TWA A;  4OIN A;  5TJ3 A;  3S17 C;  4GTB A;  4A3E K;  4YFX A;  1PJ6 A;  3LPX A;  4GT9 A;  1KQ4 A;  1BJT A;  2P8T A;  2CW0 A;  1TWG A;  4A3L C;  3GTG K;  2NVY C;  1O26 A;  3AD7 C;  1BDF A;  3ORE A;  3PO2 C;  3OEP A;  4Q5S A;  4A3J K;  2R92 K;  1JOE A;  3BUE A;  4BY7 C;  5IOT A;  1F9N A;  4KM8 A;  1EFW A;  5JVO A;  3I4M C;  1TWF K;  3K7A K;  3AH5 A;  1HI9 A;  1I3Q A;  3S1Q C;  1O28 A;  3TFJ A;  3EQL A;  5IYC C;  3GDZ A;  3H0G A;  3IPJ A;  1TWA C;  4Y7N C;  3GTL C;  4OIP A;  5C44 K;  2E2H A;  2WB1 L;  1O2A A;  4AH6 A;  2JA5 K;  2NVT C;  3GEH A;  1TWG C;  1Y1V A;  3RZO K;  2EBB A;  4PAA A;  4BBS K;  4KB4 A;  3TFI A;  3RZD K;  3HOU C;  3GTQ A;  3ADA C;  2RGR A;  3FHZ A;  4LLG A;  1XXC A;  4C3H C;  3S1R K;  3S1M C;  3S2H C;  1YX2 A;  1XZQ B;  3HXA A;  5TMC A;  4A3C C;  2XCQ A;  3L4J A;  2A6E A;  3M3Y C;  1F7U A;  3V4G A;  2JA7 C;  2NVQ K;  2CFA A;  1IE0 A;  1INN A;  1TWC C;  1XXA A;  5IP9 C;  3H0G C;  1IS1 A;  1L0W A;  4NOI A;  3A8I A;  4A3L K;  4KM9 A;  4GTC A;  1PJ7 A;  1ZQ1 C;  4BLB A;  5IOS A;  3PO2 K;  5C3E C;  1Y1V C;  4LJZ A;  1XZQ A;  4BY7 K;  3HKZ D;  2R93 A;  3I4M K;  5IOR A;  3H3V L;  3GTQ C;  5EGH A;  3S1Q K;  4BLA A;  4A93 C;  3WOD A;  5IYC K;  2O5I A;  1TWA K;  4Y7N K;  3S16 K;  1USO A;  2JH3 A;  4PAB A;  1VLO A;  1ZVU A;  1J6V A;  4LR2 A;  5L46 A;  2PHC B;  1TWG K;  4YFK A;  4LK1 A;  1WOR A;  2NVY A;  4GTE A;  3M4O C;  1O29 A;  4AYB D;  3I4N C;  4WJ3 M;  2Y0S D;  4BXX C;  3HOU K;  2R7Z C;  3TTG A;  4X6A C;  3N0B A;  4GTD A;  4C2M C;  4C3H K;  4A3C K;  3M3Y K;  1I3Q K;  1ZXO A;  3FKI A;  1SFO A;  1WOS A;  3L4K A;  5IP9 K;  3H0G K;  2P5M A; 
#chains in the Genus database with same CATH homology
 1VH2 A;  1IE0 A;  1INN A;  1JQW A;  1VGX A;  4XCH A;  1JOE A;  1J6W A;  2FQO A;  5E68 A;  1YCL A;  1JVI A;  1VJE A;  1J6V A;  1J6X A;  1J98 A;  2FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...