3TTGA

Crystal structure of putative aminomethyltransferase from leptospirillum rubarum
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
337
Chain Sequence
NLYFQGMLTEVSDTRIAHKKFGLFYPSVSRPSIFVEGEDRKNFLQGIASQDILKQDEKSLSYSFFLNPKARILFDAWCGNFEDKIALFPPAGTREEFVNHLKKYLFFRTKAKITDMSDHFREIRLVGPETISVLLSLFDNNFSGSSFRMLKNGGYVLIHPTSFQHNLDVGLQADLFIPIDQFETTQKSLEDFTSNKGGVLLDESSYLAYLTEKGIPLFPSELNDSFFPAEAGLDSVGVSYNKGCYVGQEPVTRLKFQGHLNRSLAGFRLEGPKMEFPVTLFNPKDGNEAGILTRTSSSDILGSGIGLGYIKRNFSENGTELLLPDAQLVRVHSLPFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aminomethyltransferase
publication title Crystal structure of putative aminomethyltransferase from Leptospirillum rubarum
rcsb
source organism Leptospirillum rubarum
molecule tags Transferase
total genus 95
structure length 337
sequence length 340
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ttgA00
3GIRA 1WOSA 4PAAA 3GEIA 3TFJA 3GEEA 3TTGA 3A8JA 3AD8C 3TFHA 1YX2A 1VLOA 3GSIA 3A8KA 1VRQC 1WORA 3AD9C 1PJ5A 2GAHC 3GEHA 4P9SA 3TFIA 1XZPB 3A8IA 1WOPA 4PABA 1XZPA 1WSVA 1PJ6A 3AD7C 2GAGC 3ADAC 1V5VA 1XZQB 5L46A 1PJ7A 1X31C 1XZQA 1WSRA 1WOOA
chains in the Genus database with same CATH superfamily
1EK8A 3TFJA 3LAJA 1Y1WK 2GSNA 3TTGA 3AD8C 2FQTA 1IS1A 4BY1C 3H0GC 1TWAC 2A69A 1O2AA 4GZYA 3HOYK 4LK1A 1XXBA 2GSOA 2KWAA 3H0GA 4AYBL 4AH6A 1BJTA 1AB4A 4C3JC 2WB1D 2PMZL 4QIWL 4C45A 2PA8L 5C4JC 2R7ZK 3AH5A 3S2HC 3QX3A 1WQGA 2JA6A 2NVXC 3S1MC 3HKZD 4KN4A 1I50K 2NVXA 4A3BC 4A3CK 1DCOA 1EI6A 4LK0A 2E2HK 4A3GC 1V5VA 4A3KC 4GTAA 4MQ9A 3S1NK 4A93C 2CW0A 3HOVC 4XLNA 1I3QC 5C44C 3S17C 2A6HA 4A3EK 1WOSA 4BBRC 2ZFZA 3I4NK 1EFWA 4P5BA 1I3QA 1O28A 3DXJA 3OREA 2NVQC 3SZZA 3WODA 4OIRA 1ZYRA 1EQRA 1VGXA 5E68A 5FLMK 1KQ4A 3H3VD 3GTQK 5IP9C 2O5JA 2Y3PA 5L46A 3M3YK 1XZQA 1WSRA 3GTMK 2XCRB 1XPPA 3HOUC 3RZOK 2E2IK 4KAWX 3CQZC 3FKIK 5TJ3A 3VA7A 3A8JA 2JA5C 4Q5SA 3LAPA 5TMCA 4XCHA 4BLAA 4LJZA 4Q4ZA 3GTKC 4BKWA 1IE0A 3CQZA 1C0AA 1TWFC 3G4CA 2JA5A 3GTLC 1PJ6A 3S1RC 3GTKA 5IYBC 2B63C 1TWFA 1WCMC 1INNA 3HOZC 3GTLA 4BXXC 4NOIA 5IYCK 4KC6A 2B63A 3GEEA 3I4MC 4BBSK 3M4OK 4BY7C 1WORA 1R9TK 4KM8A 3S2DK 2W7VA 2GAGC 3PO3C 3OEPA 4GTCA 3HOXC 2PHCB 1DCPA 4JK1A 1Y1VK 3AQPA 1ISEA 2FQOA 1SFOK 4KMDA 1ZBSA 2A6EA 5IYDK 5M3FK 1DCHA 3CAGA 4LOWA 4RMFA 1O25A 1J6VA 2Y0SD 4A3LC 3A8IA 2JA7K 3AQOA 4PABA 4C3IK 1WSVA 3OPFA 2GSUA 2WB1L 2RH6A 3FOFA 3PO2K 2BE5A 1PJ7A 1TWAA 1J6WA 2EBBA 2JH3A 4KATA 4J3NA 4A3JK 4MEYA 1SMYA 3HKZL 4A3FK 1TWGK 4GTLA 4Y52K 5IOSA 2WAQD 4MEXA 4C3HK 4BY1K 3BP8C 2NVYK 1I50C 3GEHA 1F7UA 5C3EK 4GTDA 2NVTC 1TWHK 5CHPA 4KB4A 1I50A 3L4KA 2R93K 4A3DK 4C3JK 2JA6K 2VUMK 4AYBD 5IP7C 4OIPA 4A3EC 1BS2A 4G0UA 3I4NC 4YFXA 2P5MA 3V4GA 2CFAA 1F93A 3HXAA 1ZVUA 5IORA 3L4JA 1TWCC 4WJ4A 4P5AA 3H3VL 4YFNA 4XLPA 3S14K 3S15C 4X6AC 3GTQC 3ADAC 3N3YA 4A93K 2V6SA 1TWCA 1USMA 4QJVB 3ERED 4OIOA 3M3YC 1I3QK 4LR2A 3GTMC 1WQHA 1WIHA 3GIRA 2E2JK 4BBRK 1EH1A 3GTJK 3RZOC 3GTQA 2E2IC 5CJ9A 5C4XK 3FKIC 2V6UA 4GTBA 1HI9A 2CFAB 3FHZA 3GTMA 1O2BA 2R92C 2E2IA 1O29A 3FKIA 3FOEA 4A3MC 2R92A 3HOWK 2ZUFA 4XSXA 4LQYA 1B4AA 4Y7NK 2XCQA 4GT9A 4G7HA 3K7AK 2A68A 3GDZA 1I6HK 5IYCC 1O2FB 3GEIA 1K83K 2PPBA 1WCMA 1YCLA 1JVIA 4KDDA 2YU9K 4G7OA 3TFHA 4OINA 3GSIA 2JA8K 3M4OC 1TWFK 4P9SA 1R9TC 2GAHC 3GTPC 1HQMA 1O24A 3GTOK 2XCOA 3S0XA 3GTGC 2B63K 1R9TA 3GTPA 4C2MK 3T02A 4WILA 1O26A 1Y1VC 4GFQA 3RZDC 3BP3A 3GTGA 3N0BA 1ZQ1C 4PAAA 5IYDC 1JQWA 2Y0SL 1G51A 4KM9A 1Y1VA 1UV7A 2P8TA 1O27A 1BDFA 1Y1WC 3G4AA 3I4MK 1VH2A 1VLOA 4KMHA 3A8KA 4DDQA 3AD9C 3TFIA 1Y1WA 1XZPA 4C3IC 4FM9A 3HOYC 5M5XK 5M5WK 3PO3K 1BGWA 3S16K 3PO2C 4A3IK 4BLBA 2D6FC 1YNNA 3N0CA 3EQLA 3S1QK 4G0WA 2V6TA 4A3JC 1WOOA 1XXAA 4WJ3M 2WAQL 2R7ZC 4A3FC 1TWGC 4Y52C 1YX2A 4C3HC 3Q3QA 2NVYC 2R7ZA 4A3LK 5EGHA 1VRQC 1TWGA 3H0GK 1TWAK 1XZPB 5C3EC 3BUEA 1TWHC 4A3CC 2NVYA 2E2HC 2R93C 1J6XA 4A3DC 5D4DA 3S1NC 2JA6C 2VUMC 1WQFA 1TWHA 4QJVA 5C4JK 2R93A 2E2HA 1J98A 4QIWD 2PMZD 3S2HK 1VJEA 5M3MK 5JVOA 2PA8D 1XXCA 2VUMA 2NVXK 3S1MK 2O5IA 2RGRA 5TMFA 4XSZA 1YNJA 2NVTK 4KB2A 4LLGA 3S14C 4A3BK 4KMUA 3T00A 1ZXOA 4A3GK 5FLMC 1RU0A 4A3KK 1X31C 3SZYA 5IP7K 3HOVK 5C44K 3S17K 4GTFA 2E2JC 3GTJC 5C4XC 1USOA 1IQ0A 3GTJA 2ZUEA 4O2DA 2NVQK 1TWCK 1PJ5A 4KARA 4KMAA 3S15K 4X6AK 3AD7C 1F9NA 3HOWC 1IBAA 5IOTA 5FJ8K 5IP9K 3NUHA 1GE9A 1L0WA 4Y7NC 4M1XA 3K7AC 1I6HC 3HOUK 4GTEA 1K83C 4FZBA 3CQZK 3LPXA 1F7VA 2YU9C 1B4BA 2JA5K 2R92K 4G7ZA 1IW7A 4G0VA 2JA8C 3GTKK 1K83A 4BBSC 5EGEA 4A3MK 2YU9A 3S2DC 3GTOC 5IOQA 3GTLK 4OIQA 3S1QC 3S1RK 5IYBK 1XZQB 1WCMK 4C2MC 3HOZK 4ZH4A 3GTOA 4BXXK 3T01A 3IPJA 1IL2A 1SFOC 4ILDA 3MMLB 4YG2A 5M5YK 3GTPK 1SFOA 4KASA 3JSTA 4BY7K 1DD5A 5JFEA 1I6VA 1WOPA 2JA7C 3GTGK 3S16C 4A3IC 1JOEA 5HL8A 3HOXK 2JA7A 3RZDK 4KN7A 4YFKA
chains in the Genus database with same CATH topology
3GIRA 1WOSA 4PAAA 3GEIA 3TFJA 3GEEA 3TTGA 3A8JA 3AD8C 3TFHA 1YX2A 1VLOA 3GSIA 3A8KA 1VRQC 1WORA 3AD9C 1PJ5A 2GAHC 3GEHA 4P9SA 3TFIA 1XZPB 3A8IA 1WOPA 4PABA 1XZPA 1WSVA 1PJ6A 3AD7C 2GAGC 3ADAC 1V5VA 1XZQB 5L46A 1PJ7A 1X31C 1XZQA 1WSRA 1WOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIR A;  1WOS A;  4PAA A;  3GEI A;  3TFJ A;  3GEE A;  3TTG A;  3A8J A;  3AD8 C;  3TFH A;  1YX2 A;  1VLO A;  3GSI A;  3A8K A;  1VRQ C;  1WOR A;  3AD9 C;  1PJ5 A;  2GAH C;  3GEH A;  4P9S A;  3TFI A;  1XZP B;  3A8I A;  1WOP A;  4PAB A;  1XZP A;  1WSV A;  1PJ6 A;  3AD7 C;  2GAG C;  3ADA C;  1V5V A;  1XZQ B;  5L46 A;  1PJ7 A;  1X31 C;  1XZQ A;  1WSR A;  1WOO A; 
#chains in the Genus database with same CATH topology
 1EK8 A;  3TFJ A;  3LAJ A;  1Y1W K;  2GSN A;  3TTG A;  3AD8 C;  2FQT A;  1IS1 A;  4BY1 C;  3H0G C;  1TWA C;  2A69 A;  1O2A A;  4GZY A;  3HOY K;  4LK1 A;  1XXB A;  2GSO A;  2KWA A;  3H0G A;  4AYB L;  4AH6 A;  1BJT A;  1AB4 A;  4C3J C;  2WB1 D;  2PMZ L;  4QIW L;  4C45 A;  2PA8 L;  5C4J C;  2R7Z K;  3AH5 A;  3S2H C;  3QX3 A;  1WQG A;  2JA6 A;  2NVX C;  3S1M C;  3HKZ D;  4KN4 A;  1I50 K;  2NVX A;  4A3B C;  4A3C K;  1DCO A;  1EI6 A;  4LK0 A;  2E2H K;  4A3G C;  1V5V A;  4A3K C;  4GTA A;  4MQ9 A;  3S1N K;  4A93 C;  2CW0 A;  3HOV C;  4XLN A;  1I3Q C;  5C44 C;  3S17 C;  2A6H A;  4A3E K;  1WOS A;  4BBR C;  2ZFZ A;  3I4N K;  1EFW A;  4P5B A;  1I3Q A;  1O28 A;  3DXJ A;  3ORE A;  2NVQ C;  3SZZ A;  3WOD A;  4OIR A;  1ZYR A;  1EQR A;  1VGX A;  5E68 A;  5FLM K;  1KQ4 A;  3H3V D;  3GTQ K;  5IP9 C;  2O5J A;  2Y3P A;  5L46 A;  3M3Y K;  1XZQ A;  1WSR A;  3GTM K;  2XCR B;  1XPP A;  3HOU C;  3RZO K;  2E2I K;  4KAW X;  3CQZ C;  3FKI K;  5TJ3 A;  3VA7 A;  3A8J A;  2JA5 C;  4Q5S A;  3LAP A;  5TMC A;  4XCH A;  4BLA A;  4LJZ A;  4Q4Z A;  3GTK C;  4BKW A;  1IE0 A;  3CQZ A;  1C0A A;  1TWF C;  3G4C A;  2JA5 A;  3GTL C;  1PJ6 A;  3S1R C;  3GTK A;  5IYB C;  2B63 C;  1TWF A;  1WCM C;  1INN A;  3HOZ C;  3GTL A;  4BXX C;  4NOI A;  5IYC K;  4KC6 A;  2B63 A;  3GEE A;  3I4M C;  4BBS K;  3M4O K;  4BY7 C;  1WOR A;  1R9T K;  4KM8 A;  3S2D K;  2W7V A;  2GAG C;  3PO3 C;  3OEP A;  4GTC A;  3HOX C;  2PHC B;  1DCP A;  4JK1 A;  1Y1V K;  3AQP A;  1ISE A;  2FQO A;  1SFO K;  4KMD A;  1ZBS A;  2A6E A;  5IYD K;  5M3F K;  1DCH A;  3CAG A;  4LOW A;  4RMF A;  1O25 A;  1J6V A;  2Y0S D;  4A3L C;  3A8I A;  2JA7 K;  3AQO A;  4PAB A;  4C3I K;  1WSV A;  3OPF A;  2GSU A;  2WB1 L;  2RH6 A;  3FOF A;  3PO2 K;  2BE5 A;  1PJ7 A;  1TWA A;  1J6W A;  2EBB A;  2JH3 A;  4KAT A;  4J3N A;  4A3J K;  4MEY A;  1SMY A;  3HKZ L;  4A3F K;  1TWG K;  4GTL A;  4Y52 K;  5IOS A;  2WAQ D;  4MEX A;  4C3H K;  4BY1 K;  3BP8 C;  2NVY K;  1I50 C;  3GEH A;  1F7U A;  5C3E K;  4GTD A;  2NVT C;  1TWH K;  5CHP A;  4KB4 A;  1I50 A;  3L4K A;  2R93 K;  4A3D K;  4C3J K;  2JA6 K;  2VUM K;  4AYB D;  5IP7 C;  4OIP A;  4A3E C;  1BS2 A;  4G0U A;  3I4N C;  4YFX A;  2P5M A;  3V4G A;  2CFA A;  1F93 A;  3HXA A;  1ZVU A;  5IOR A;  3L4J A;  1TWC C;  4WJ4 A;  4P5A A;  3H3V L;  4YFN A;  4XLP A;  3S14 K;  3S15 C;  4X6A C;  3GTQ C;  3ADA C;  3N3Y A;  4A93 K;  2V6S A;  1TWC A;  1USM A;  4QJV B;  3ERE D;  4OIO A;  3M3Y C;  1I3Q K;  4LR2 A;  3GTM C;  1WQH A;  1WIH A;  3GIR A;  2E2J K;  4BBR K;  1EH1 A;  3GTJ K;  3RZO C;  3GTQ A;  2E2I C;  5CJ9 A;  5C4X K;  3FKI C;  2V6U A;  4GTB A;  1HI9 A;  2CFA B;  3FHZ A;  3GTM A;  1O2B A;  2R92 C;  2E2I A;  1O29 A;  3FKI A;  3FOE A;  4A3M C;  2R92 A;  3HOW K;  2ZUF A;  4XSX A;  4LQY A;  1B4A A;  4Y7N K;  2XCQ A;  4GT9 A;  4G7H A;  3K7A K;  2A68 A;  3GDZ A;  1I6H K;  5IYC C;  1O2F B;  3GEI A;  1K83 K;  2PPB A;  1WCM A;  1YCL A;  1JVI A;  4KDD A;  2YU9 K;  4G7O A;  3TFH A;  4OIN A;  3GSI A;  2JA8 K;  3M4O C;  1TWF K;  4P9S A;  1R9T C;  2GAH C;  3GTP C;  1HQM A;  1O24 A;  3GTO K;  2XCO A;  3S0X A;  3GTG C;  2B63 K;  1R9T A;  3GTP A;  4C2M K;  3T02 A;  4WIL A;  1O26 A;  1Y1V C;  4GFQ A;  3RZD C;  3BP3 A;  3GTG A;  3N0B A;  1ZQ1 C;  4PAA A;  5IYD C;  1JQW A;  2Y0S L;  1G51 A;  4KM9 A;  1Y1V A;  1UV7 A;  2P8T A;  1O27 A;  1BDF A;  1Y1W C;  3G4A A;  3I4M K;  1VH2 A;  1VLO A;  4KMH A;  3A8K A;  4DDQ A;  3AD9 C;  3TFI A;  1Y1W A;  1XZP A;  4C3I C;  4FM9 A;  3HOY C;  5M5X K;  5M5W K;  3PO3 K;  1BGW A;  3S16 K;  3PO2 C;  4A3I K;  4BLB A;  2D6F C;  1YNN A;  3N0C A;  3EQL A;  3S1Q K;  4G0W A;  2V6T A;  4A3J C;  1WOO A;  1XXA A;  4WJ3 M;  2WAQ L;  2R7Z C;  4A3F C;  1TWG C;  4Y52 C;  1YX2 A;  4C3H C;  3Q3Q A;  2NVY C;  2R7Z A;  4A3L K;  5EGH A;  1VRQ C;  1TWG A;  3H0G K;  1TWA K;  1XZP B;  5C3E C;  3BUE A;  1TWH C;  4A3C C;  2NVY A;  2E2H C;  2R93 C;  1J6X A;  4A3D C;  5D4D A;  3S1N C;  2JA6 C;  2VUM C;  1WQF A;  1TWH A;  4QJV A;  5C4J K;  2R93 A;  2E2H A;  1J98 A;  4QIW D;  2PMZ D;  3S2H K;  1VJE A;  5M3M K;  5JVO A;  2PA8 D;  1XXC A;  2VUM A;  2NVX K;  3S1M K;  2O5I A;  2RGR A;  5TMF A;  4XSZ A;  1YNJ A;  2NVT K;  4KB2 A;  4LLG A;  3S14 C;  4A3B K;  4KMU A;  3T00 A;  1ZXO A;  4A3G K;  5FLM C;  1RU0 A;  4A3K K;  1X31 C;  3SZY A;  5IP7 K;  3HOV K;  5C44 K;  3S17 K;  4GTF A;  2E2J C;  3GTJ C;  5C4X C;  1USO A;  1IQ0 A;  3GTJ A;  2ZUE A;  4O2D A;  2NVQ K;  1TWC K;  1PJ5 A;  4KAR A;  4KMA A;  3S15 K;  4X6A K;  3AD7 C;  1F9N A;  3HOW C;  1IBA A;  5IOT A;  5FJ8 K;  5IP9 K;  3NUH A;  1GE9 A;  1L0W A;  4Y7N C;  4M1X A;  3K7A C;  1I6H C;  3HOU K;  4GTE A;  1K83 C;  4FZB A;  3CQZ K;  3LPX A;  1F7V A;  2YU9 C;  1B4B A;  2JA5 K;  2R92 K;  4G7Z A;  1IW7 A;  4G0V A;  2JA8 C;  3GTK K;  1K83 A;  4BBS C;  5EGE A;  4A3M K;  2YU9 A;  3S2D C;  3GTO C;  5IOQ A;  3GTL K;  4OIQ A;  3S1Q C;  3S1R K;  5IYB K;  1XZQ B;  1WCM K;  4C2M C;  3HOZ K;  4ZH4 A;  3GTO A;  4BXX K;  3T01 A;  3IPJ A;  1IL2 A;  1SFO C;  4ILD A;  3MML B;  4YG2 A;  5M5Y K;  3GTP K;  1SFO A;  4KAS A;  3JST A;  4BY7 K;  1DD5 A;  5JFE A;  1I6V A;  1WOP A;  2JA7 C;  3GTG K;  3S16 C;  4A3I C;  1JOE A;  5HL8 A;  3HOX K;  2JA7 A;  3RZD K;  4KN7 A;  4YFK A; 
#chains in the Genus database with same CATH homology
 3GIR A;  1WOS A;  4PAA A;  3GEI A;  3TFJ A;  3GEE A;  3TTG A;  3A8J A;  3AD8 C;  3TFH A;  1YX2 A;  1VLO A;  3GSI A;  3A8K A;  1VRQ C;  1WOR A;  3AD9 C;  1PJ5 A;  2GAH C;  3GEH A;  4P9S A;  3TFI A;  1XZP B;  3A8I A;  1WOP A;  4PAB A;  1XZP A;  1WSV A;  1PJ6 A;  3AD7 C;  2GAG C;  3ADA C;  1V5V A;  1XZQ B;  5L46 A;  1PJ7 A;  1X31 C;  1XZQ A;  1WSR A;  1WOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...