3TTGA

Crystal structure of putative aminomethyltransferase from leptospirillum rubarum
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
337
Chain Sequence
b'NLYFQGMLTEVSDTRIAHKKFGLFYPSVSRPSIFVEGEDRKNFLQGIASQDILKQDEKSLSYSFFLNPKARILFDAWCGNFEDKIALFPPAGTREEFVNHLKKYLFFRTKAKITDMSDHFREIRLVGPETISVLLSLFDNNFSGSSFRMLKNGGYVLIHPTSFQHNLDVGLQADLFIPIDQFETTQKSLEDFTSNKGGVLLDESSYLAYLTEKGIPLFPSELNDSFFPAEAGLDSVGVSYNKGCYVGQEPVTRLKFQGHLNRSLAGFRLEGPKMEFPVTLFNPKDGNEAGILTRTSSSDILGSGIGLGYIKRNFSENGTELLLPDAQLVRVHSLPFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aminomethyltransferase
publication title Crystal structure of putative aminomethyltransferase from Leptospirillum rubarum
rcsb
source organism Leptospirillum rubarum
molecule tags Transferase
total genus 95
structure length 337
sequence length 340
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ttgA00
4PABA 1X31C 3GEIA 1WOPA 1XZQB 2GAHC 3AD8C 1WOSA 1XZPB 3AD9C 3ADAC 3AD7C 1WSRA 4PAAA 1V5VA 3GEEA 3TTGA 3A8IA 4P9SA 1VRQC 3TFJA 1PJ5A 1PJ6A 3A8KA 1XZQA 3GSIA 3GIRA 1XZPA 1WSVA 3A8JA 5L46A 2GAGC 1YX2A 1WOOA 3TFIA 3TFHA 1VLOA 3GEHA 1PJ7A 1WORA
chains in the Genus database with same CATH superfamily
2E2IK 1HI9A 2V6SA 2R7ZC 2P5MA 3S0XA 1USMA 4BXXK 2EBBA 1XXCA 3S1MK 1DCOA 4C3JC 3I4NK 1ZXOA 2R93A 1R9TA 4PAAA 2NVYK 4A3GK 2A69A 5IP9C 1VGXA 1BGWA 3GTOK 2CW0A 4AYBD 3K7AK 3S1NC 5C4XC 5IYBC 4G0WA 1WORA 3HOZC 4KARA 3HOXK 4P5BA 3S17C 5CHPA 3GTGK 1F93A 3S2DK 1XXBA 5TJ3A 4GTEA 5C3EC 4C3HC 2PA8D 3N3YA 4LLGA 1SFOA 2B63C 3CQZC 1IE0A 3AD9C 4GTDA 2JA6C 3GTLC 1V5VA 4BBRK 3A8KA 2E2JC 3GSIA 3GTKC 3DXJA 1Y1VA 3LAPA 1YX2A 4LQYA 2O5IA 4BY1C 4WJ4A 3H3VD 1O2AA 1X31C 3OPFA 5TMCA 2R7ZA 1TWAC 1TWGC 3SZYA 3HOWK 3SZZA 3GTPC 2R7ZK 3G4AA 4LK1A 5CJ9A 5TMFA 4XSXA 4C3JK 3H3VL 1O2FB 2WB1D 1PJ6A 4YG2A 2GSOA 1XZPA 5IP9K 1ZVUA 4GFQA 5IOSA 3I4MC 3FOEA 1PJ7A 5D4DA 3JSTA 4G7HA 2W7VA 4GTBA 2WB1L 3S1NK 5C4XK 5IYBK 2GAHC 3HOZK 1USOA 4KATA 2D6FC 3N0BA 2PMZD 1BS2A 3S17K 4A3LC 3L4KA 1IQ0A 3ADAC 5C3EK 2R93C 4C3HK 1R9TC 3BUEA 2B63K 4P9SA 3FHZA 2A6EA 1PJ5A 3CQZK 2ZUFA 2JA6K 3GTLK 3GTKA 1J6VA 4QJVA 4BBSC 2PMZL 2E2JK 3GTKK 3TFHA 1VLOA 4C3IC 4M1XA 2RH6A 4A3BC 1F9NA 4MQ9A 1TWAA 4BY1K 4A93C 3GTPA 3FKIC 4GTAA 1TWAK 3G4CA 1TWGK 4JK1A 4KN7A 5M3FK 4BLBA 1SFOC 3GTPK 2JA7C 3AQPA 4BLAA 1Y1VC 2RGRA 3S14C 5EGEA 3S1RC 4KMDA 4OIOA 5IOTA 5M5WK 3I4MK 1WQFA 4FM9A 1WCMC 1XXAA 2PHCB 4MEXA 4GTFA 1O26A 2ZUEA 1EI6A 3AD7C 4A3LK 3GDZA 4Y52C 1J6XA 4A3EC 1XZQA 2R93K 1R9TK 1Y1WC 1WQHA 4OIRA 2A68A 5M3MK 3M4OC 4KM9A 4BBSK 2JA5A 1I6VA 4YFKA 4C3IK 2PPBA 4Q5SA 3FKIA 1YCLA 4A3BK 3VA7A 2O5JA 4AYBL 1G51A 4A93K 3FKIK 1IBAA 4XCHA 2JA7A 1DCPA 3Q3QA 3TTGA 3AH5A 1SFOK 2JA7K 3S1QC 1WSVA 4A3FC 4KB2A 5JVOA 3T02A 2PA8L 3PO2C 3S15C 2VUMC 1Y1VK 3S14K 5HL8A 3QX3A 3RZOC 3S1RK 1WCMA 4LK0A 3M3YK 1WCMK 3HOYC 1TWHA 4YFXA 3GEEA 4G0UA 1IS1A 3T00A 4LJZA 2JH3A 5IP7C 4ILDA 4Y52K 1Y1WA 1TWFA 4A3EK 4A3MC 1INNA 4A3KC 1BDFA 2NVXA 4Y7NC 1Y1WK 2NVQC 1WQGA 3ERED 5C44C 3M4OK 1ISEA 3RZDC 4AH6A 2YU9A 1BJTA 2P8TA 2JA8C 1WOSA 4ZH4A 4LR2A 3N0CA 1TWCC 1XPPA 3GIRA 1J98A 3S1QK 3GTJA 4A3FK 2VUMA 2JA5C 4C2MC 2GSNA 3PO2K 1EFWA 3S15K 1WOPA 2VUMK 4GTLA 4YFNA 1O28A 1B4AA 1VJEA 2XCQA 3RZOK 4G7OA 4NOIA 3NUHA 1KQ4A 3H0GA 3V4GA 4KMAA 4XLPA 3HOUC 3HOYK 2XCRB 1ZQ1C 4XSZA 1JVIA 3A8JA 5L46A 1RU0A 4C45A 5IP7K 3FOFA 4A3MK 1VH2A 4A3KK 5IORA 4Y7NK 4DDQA 2NVQK 5C44K 4QJVB 3BP8C 3RZDK 3IPJA 4Q4ZA 5FJ8K 4KB4A 3EQLA 1IW7A 1I3QC 5IYCC 2JA8K 1TWHC 2Y0SD 2KWAA 4KN4A 1YNJA 1TWCA 1O27A 3S16C 1TWCK 2E2IA 2GAGC 1TWFC 4XLNA 2BE5A 1JOEA 3TFIA 2NVXC 2WAQD 2CFAB 2Y0SL 4G7ZA 3HXAA 3PO3C 1EH1A 4KAWX 3AD8C 2JA5K 2YU9C 4KMHA 1O24A 4C2MK 3HOVC 2NVYA 2FQOA 4KC6A 2A6HA 2WAQL 5FLMC 4J3NA 4A3JC 4KDDA 2FQTA 4A3DC 1DD5A 1WSRA 3GTOA 2GSUA 4LOWA 2R92C 3L4JA 3GTMC 1SMYA 1C0AA 3HOUK 2XCOA 3GTGA 3GTJC 3OREA 4GTCA 4OIPA 1XZQB 3CAGA 4A3IC 2E2HC 1I3QA 2Y3PA 1O25A 1YNNA 5IYDC 3A8IA 3H0GC 1I3QK 5IYCK 1TWHK 3HKZD 1I50C 3GTQC 4O2DA 4A3CC 3GEHA 4RMFA 3S16K 2NVTC 1TWFK 1ZYRA 1F7UA 3S2HC 2NVXK 1I6HC 4BY7C 3BP3A 3HKZL 3PO3K 5C4JC 4OIQA 2YU9K 1JQWA 2V6TA 1K83C 3HOVK 1B4BA 4FZBA 4GT9A 1HQMA 3MMLB 1VRQC 1L0WA 2R92A 5FLMK 4A3JK 3GTMA 4A3DK 1EQRA 1F7VA 4X6AC 3M3YC 2R92K 3OEPA 2E2IC 3GTMK 4GZYA 3AQOA 4BXXC 1AB4A 4WJ3M 1GE9A 3S1MC 3LAJA 3GEIA 5E68A 3I4NC 3GTJK 2E2HA 2B63A 1XZPB 1EK8A 4QIWD 4G0VA 2NVYC 4A3GC 3CQZA 2JA6A 3GTLA 4A3IK 2E2HK 4MEYA 5M5XK 3TFJA 1O2BA 2ZFZA 3GTOC 4P5AA 3K7AC 5JFEA 1I50A 5IYDK 3H0GK 5IOQA 4QIWL 3HOXC 1WOOA 3GTQA 3LPXA 1I50K 1ZBSA 5M5YK 3WODA 1DCHA 3GTGC 3GTQK 4PABA 3S2DC 4A3CK 1TWGA 1UV7A 2NVTK 4KMUA 3S2HK 1O29A 4KASA 4BY7K 1I6HK 2V6UA 5EGHA 2CFAA 1J6WA 4BKWA 4BBRC 1K83A 5C4JK 1K83K 1IL2A 1WIHA 4KM8A 4WILA 4X6AK 3T01A 4OINA 3HOWC
chains in the Genus database with same CATH topology
4PABA 1X31C 3GEIA 1WOPA 1XZQB 2GAHC 3AD8C 1WOSA 1XZPB 3AD9C 3ADAC 3AD7C 1WSRA 4PAAA 1V5VA 3GEEA 3TTGA 3A8IA 4P9SA 1VRQC 3TFJA 1PJ5A 1PJ6A 3A8KA 1XZQA 3GSIA 3GIRA 1XZPA 1WSVA 3A8JA 5L46A 2GAGC 1YX2A 1WOOA 3TFIA 3TFHA 1VLOA 3GEHA 1PJ7A 1WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAB A;  1X31 C;  3GEI A;  1WOP A;  1XZQ B;  2GAH C;  3AD8 C;  1WOS A;  1XZP B;  3AD9 C;  3ADA C;  3AD7 C;  1WSR A;  4PAA A;  1V5V A;  3GEE A;  3TTG A;  3A8I A;  4P9S A;  1VRQ C;  3TFJ A;  1PJ5 A;  1PJ6 A;  3A8K A;  1XZQ A;  3GSI A;  3GIR A;  1XZP A;  1WSV A;  3A8J A;  5L46 A;  2GAG C;  1YX2 A;  1WOO A;  3TFI A;  3TFH A;  1VLO A;  3GEH A;  1PJ7 A;  1WOR A; 
#chains in the Genus database with same CATH topology
 2E2I K;  1HI9 A;  2V6S A;  2R7Z C;  2P5M A;  3S0X A;  1USM A;  4BXX K;  2EBB A;  1XXC A;  3S1M K;  1DCO A;  4C3J C;  3I4N K;  1ZXO A;  2R93 A;  1R9T A;  4PAA A;  2NVY K;  4A3G K;  2A69 A;  5IP9 C;  1VGX A;  1BGW A;  3GTO K;  2CW0 A;  4AYB D;  3K7A K;  3S1N C;  5C4X C;  5IYB C;  4G0W A;  1WOR A;  3HOZ C;  4KAR A;  3HOX K;  4P5B A;  3S17 C;  5CHP A;  3GTG K;  1F93 A;  3S2D K;  1XXB A;  5TJ3 A;  4GTE A;  5C3E C;  4C3H C;  2PA8 D;  3N3Y A;  4LLG A;  1SFO A;  2B63 C;  3CQZ C;  1IE0 A;  3AD9 C;  4GTD A;  2JA6 C;  3GTL C;  1V5V A;  4BBR K;  3A8K A;  2E2J C;  3GSI A;  3GTK C;  3DXJ A;  1Y1V A;  3LAP A;  1YX2 A;  4LQY A;  2O5I A;  4BY1 C;  4WJ4 A;  3H3V D;  1O2A A;  1X31 C;  3OPF A;  5TMC A;  2R7Z A;  1TWA C;  1TWG C;  3SZY A;  3HOW K;  3SZZ A;  3GTP C;  2R7Z K;  3G4A A;  4LK1 A;  5CJ9 A;  5TMF A;  4XSX A;  4C3J K;  3H3V L;  1O2F B;  2WB1 D;  1PJ6 A;  4YG2 A;  2GSO A;  1XZP A;  5IP9 K;  1ZVU A;  4GFQ A;  5IOS A;  3I4M C;  3FOE A;  1PJ7 A;  5D4D A;  3JST A;  4G7H A;  2W7V A;  4GTB A;  2WB1 L;  3S1N K;  5C4X K;  5IYB K;  2GAH C;  3HOZ K;  1USO A;  4KAT A;  2D6F C;  3N0B A;  2PMZ D;  1BS2 A;  3S17 K;  4A3L C;  3L4K A;  1IQ0 A;  3ADA C;  5C3E K;  2R93 C;  4C3H K;  1R9T C;  3BUE A;  2B63 K;  4P9S A;  3FHZ A;  2A6E A;  1PJ5 A;  3CQZ K;  2ZUF A;  2JA6 K;  3GTL K;  3GTK A;  1J6V A;  4QJV A;  4BBS C;  2PMZ L;  2E2J K;  3GTK K;  3TFH A;  1VLO A;  4C3I C;  4M1X A;  2RH6 A;  4A3B C;  1F9N A;  4MQ9 A;  1TWA A;  4BY1 K;  4A93 C;  3GTP A;  3FKI C;  4GTA A;  1TWA K;  3G4C A;  1TWG K;  4JK1 A;  4KN7 A;  5M3F K;  4BLB A;  1SFO C;  3GTP K;  2JA7 C;  3AQP A;  4BLA A;  1Y1V C;  2RGR A;  3S14 C;  5EGE A;  3S1R C;  4KMD A;  4OIO A;  5IOT A;  5M5W K;  3I4M K;  1WQF A;  4FM9 A;  1WCM C;  1XXA A;  2PHC B;  4MEX A;  4GTF A;  1O26 A;  2ZUE A;  1EI6 A;  3AD7 C;  4A3L K;  3GDZ A;  4Y52 C;  1J6X A;  4A3E C;  1XZQ A;  2R93 K;  1R9T K;  1Y1W C;  1WQH A;  4OIR A;  2A68 A;  5M3M K;  3M4O C;  4KM9 A;  4BBS K;  2JA5 A;  1I6V A;  4YFK A;  4C3I K;  2PPB A;  4Q5S A;  3FKI A;  1YCL A;  4A3B K;  3VA7 A;  2O5J A;  4AYB L;  1G51 A;  4A93 K;  3FKI K;  1IBA A;  4XCH A;  2JA7 A;  1DCP A;  3Q3Q A;  3TTG A;  3AH5 A;  1SFO K;  2JA7 K;  3S1Q C;  1WSV A;  4A3F C;  4KB2 A;  5JVO A;  3T02 A;  2PA8 L;  3PO2 C;  3S15 C;  2VUM C;  1Y1V K;  3S14 K;  5HL8 A;  3QX3 A;  3RZO C;  3S1R K;  1WCM A;  4LK0 A;  3M3Y K;  1WCM K;  3HOY C;  1TWH A;  4YFX A;  3GEE A;  4G0U A;  1IS1 A;  3T00 A;  4LJZ A;  2JH3 A;  5IP7 C;  4ILD A;  4Y52 K;  1Y1W A;  1TWF A;  4A3E K;  4A3M C;  1INN A;  4A3K C;  1BDF A;  2NVX A;  4Y7N C;  1Y1W K;  2NVQ C;  1WQG A;  3ERE D;  5C44 C;  3M4O K;  1ISE A;  3RZD C;  4AH6 A;  2YU9 A;  1BJT A;  2P8T A;  2JA8 C;  1WOS A;  4ZH4 A;  4LR2 A;  3N0C A;  1TWC C;  1XPP A;  3GIR A;  1J98 A;  3S1Q K;  3GTJ A;  4A3F K;  2VUM A;  2JA5 C;  4C2M C;  2GSN A;  3PO2 K;  1EFW A;  3S15 K;  1WOP A;  2VUM K;  4GTL A;  4YFN A;  1O28 A;  1B4A A;  1VJE A;  2XCQ A;  3RZO K;  4G7O A;  4NOI A;  3NUH A;  1KQ4 A;  3H0G A;  3V4G A;  4KMA A;  4XLP A;  3HOU C;  3HOY K;  2XCR B;  1ZQ1 C;  4XSZ A;  1JVI A;  3A8J A;  5L46 A;  1RU0 A;  4C45 A;  5IP7 K;  3FOF A;  4A3M K;  1VH2 A;  4A3K K;  5IOR A;  4Y7N K;  4DDQ A;  2NVQ K;  5C44 K;  4QJV B;  3BP8 C;  3RZD K;  3IPJ A;  4Q4Z A;  5FJ8 K;  4KB4 A;  3EQL A;  1IW7 A;  1I3Q C;  5IYC C;  2JA8 K;  1TWH C;  2Y0S D;  2KWA A;  4KN4 A;  1YNJ A;  1TWC A;  1O27 A;  3S16 C;  1TWC K;  2E2I A;  2GAG C;  1TWF C;  4XLN A;  2BE5 A;  1JOE A;  3TFI A;  2NVX C;  2WAQ D;  2CFA B;  2Y0S L;  4G7Z A;  3HXA A;  3PO3 C;  1EH1 A;  4KAW X;  3AD8 C;  2JA5 K;  2YU9 C;  4KMH A;  1O24 A;  4C2M K;  3HOV C;  2NVY A;  2FQO A;  4KC6 A;  2A6H A;  2WAQ L;  5FLM C;  4J3N A;  4A3J C;  4KDD A;  2FQT A;  4A3D C;  1DD5 A;  1WSR A;  3GTO A;  2GSU A;  4LOW A;  2R92 C;  3L4J A;  3GTM C;  1SMY A;  1C0A A;  3HOU K;  2XCO A;  3GTG A;  3GTJ C;  3ORE A;  4GTC A;  4OIP A;  1XZQ B;  3CAG A;  4A3I C;  2E2H C;  1I3Q A;  2Y3P A;  1O25 A;  1YNN A;  5IYD C;  3A8I A;  3H0G C;  1I3Q K;  5IYC K;  1TWH K;  3HKZ D;  1I50 C;  3GTQ C;  4O2D A;  4A3C C;  3GEH A;  4RMF A;  3S16 K;  2NVT C;  1TWF K;  1ZYR A;  1F7U A;  3S2H C;  2NVX K;  1I6H C;  4BY7 C;  3BP3 A;  3HKZ L;  3PO3 K;  5C4J C;  4OIQ A;  2YU9 K;  1JQW A;  2V6T A;  1K83 C;  3HOV K;  1B4B A;  4FZB A;  4GT9 A;  1HQM A;  3MML B;  1VRQ C;  1L0W A;  2R92 A;  5FLM K;  4A3J K;  3GTM A;  4A3D K;  1EQR A;  1F7V A;  4X6A C;  3M3Y C;  2R92 K;  3OEP A;  2E2I C;  3GTM K;  4GZY A;  3AQO A;  4BXX C;  1AB4 A;  4WJ3 M;  1GE9 A;  3S1M C;  3LAJ A;  3GEI A;  5E68 A;  3I4N C;  3GTJ K;  2E2H A;  2B63 A;  1XZP B;  1EK8 A;  4QIW D;  4G0V A;  2NVY C;  4A3G C;  3CQZ A;  2JA6 A;  3GTL A;  4A3I K;  2E2H K;  4MEY A;  5M5X K;  3TFJ A;  1O2B A;  2ZFZ A;  3GTO C;  4P5A A;  3K7A C;  5JFE A;  1I50 A;  5IYD K;  3H0G K;  5IOQ A;  4QIW L;  3HOX C;  1WOO A;  3GTQ A;  3LPX A;  1I50 K;  1ZBS A;  5M5Y K;  3WOD A;  1DCH A;  3GTG C;  3GTQ K;  4PAB A;  3S2D C;  4A3C K;  1TWG A;  1UV7 A;  2NVT K;  4KMU A;  3S2H K;  1O29 A;  4KAS A;  4BY7 K;  1I6H K;  2V6U A;  5EGH A;  2CFA A;  1J6W A;  4BKW A;  4BBR C;  1K83 A;  5C4J K;  1K83 K;  1IL2 A;  1WIH A;  4KM8 A;  4WIL A;  4X6A K;  3T01 A;  4OIN A;  3HOW C; 
#chains in the Genus database with same CATH homology
 4PAB A;  1X31 C;  3GEI A;  1WOP A;  1XZQ B;  2GAH C;  3AD8 C;  1WOS A;  1XZP B;  3AD9 C;  3ADA C;  3AD7 C;  1WSR A;  4PAA A;  1V5V A;  3GEE A;  3TTG A;  3A8I A;  4P9S A;  1VRQ C;  3TFJ A;  1PJ5 A;  1PJ6 A;  3A8K A;  1XZQ A;  3GSI A;  3GIR A;  1XZP A;  1WSV A;  3A8J A;  5L46 A;  2GAG C;  1YX2 A;  1WOO A;  3TFI A;  3TFH A;  1VLO A;  3GEH A;  1PJ7 A;  1WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...