3TTGA

Crystal structure of putative aminomethyltransferase from leptospirillum rubarum
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
337
Chain Sequence
NLYFQGMLTEVSDTRIAHKKFGLFYPSVSRPSIFVEGEDRKNFLQGIASQDILKQDEKSLSYSFFLNPKARILFDAWCGNFEDKIALFPPAGTREEFVNHLKKYLFFRTKAKITDMSDHFREIRLVGPETISVLLSLFDNNFSGSSFRMLKNGGYVLIHPTSFQHNLDVGLQADLFIPIDQFETTQKSLEDFTSNKGGVLLDESSYLAYLTEKGIPLFPSELNDSFFPAEAGLDSVGVSYNKGCYVGQEPVTRLKFQGHLNRSLAGFRLEGPKMEFPVTLFNPKDGNEAGILTRTSSSDILGSGIGLGYIKRNFSENGTELLLPDAQLVRVHSLPFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative aminomethyltransferase from Leptospirillum rubarum
rcsb
source organism Leptospirillum rubarum
molecule tags Transferase
molecule keywords Putative aminomethyltransferase
total genus 95
structure length 337
sequence length 340
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ttgA00
3GEHA 1XZPA 1WORA 1WOSA 1WOOA 3A8KA 1XZQB 3AD8C 1WOPA 3AD7C 1VRQC 3TFJA 1XZPB 3TFHA 3A8JA 3TTGA 3GEEA 4P9SA 1WSVA 1XZQA 4PABA 4PAAA 1VLOA 3A8IA 3ADAC 1X31C 1YX2A 1PJ5A 2GAGC 3TFIA 3GIRA 1PJ6A 3AD9C 3GEIA 1PJ7A 1V5VA 1WSRA 5L46A 3GSIA 2GAHC
chains in the Genus database with same CATH superfamily
1IQ0A 4A3LK 1EFWA 3GTGK 3S17C 4A3JK 1O29A 4C3JK 2R7ZA 4XLNA 2YU9C 4BY1K 2FQTA 3BP8C 1R9TK 1VLOA 2W7VA 3VA7A 1HQMA 1DCHA 4XSZA 1SFOA 2R93K 4G0WA 2A69A 1TWAC 4C3HC 1JOEA 3IPJA 3S1NC 1YNNA 3HOVK 3AD7C 1JQWA 4J3NA 2NVYK 4ZH4A 1Y1VA 1F93A 1G51A 4P5BA 3TTGA 1WQFA 2Y0SD 1IL2A 4M1XA 1J6VA 3JSTA 2WAQL 1EK8A 4JK1A 3M3YC 3WODA 1I6HC 3HOYK 2R7ZC 4Y52C 2WB1L 4KN4A 4QIWD 3GSIA 4LK0A 3HXAA 5C4XK 5C44C 4KMUA 1TWGC 3GTOC 2XCOA 4KAWX 3CAGA 5IP7K 2O5JA 1ZXOA 1TWHK 4GTEA 5JFEA 3S2DK 3HKZD 1J6XA 5IYBK 3RZOC 3AH5A 2V6TA 3S0XA 4A3DK 3HOXC 3OPFA 1YX2A 4MQ9A 2NVQC 2V6SA 1O25A 4KASA 3I4NK 1O24A 2JA8K 3MMLB 2B63A 3S16C 2YU9A 2GAHC 1WOSA 4BY7C 2PMZD 3S1NK 3HOZC 2R92A 1TWHC 1INNA 3BUEA 3BP3A 4BXXK 2JA6K 5M5YK 3H3VD 1TWGA 3GTOA 3L4JA 1B4BA 3S15K 2R7ZK 4AYBD 3M3YK 3S15C 4KATA 4LK1A 3GTLK 4C45A 3I4MK 3TFJA 3GTQC 3FOEA 4G7OA 4GTDA 3RZDC 2JA5C 1VJEA 4DDQA 2GAGC 3ERED 1XXAA 4C3IC 4BY7K 4A3EC 4A3MC 3HOWC 1TWAK 2JA7C 3OEPA 2VUMA 3GTQK 3CQZK 1BJTA 1J98A 2E2HC 3FOFA 1WQHA 5IYDK 3NUHA 2E2IC 1GE9A 2Y3PA 4ILDA 5IP9C 1XZPB 4BY1C 1WSVA 3GTMA 3GTMC 3A8IA 1ISEA 4AH6A 4BLAA 1EI6A 2E2HA 1WIHA 1ZVUA 2GSOA 3GTKK 1I3QC 2JA6C 5C44K 3S14C 2A6EA 1VH2A 2ZFZA 5L46A 4G0UA 3V4GA 1USMA 1WCMC 1WCMK 2JA5A 1O27A 1I6HK 3GTLA 1BDFA 3Q3QA 3GTQA 4BLBA 1XZQA 5CHPA 3GTJC 4A93K 4OIOA 2PA8D 3I4NC 3EQLA 1PJ5A 4GTCA 1XXCA 4OIQA 3AQPA 3H0GC 4Q5SA 1PJ6A 2JH3A 2NVTK 3PO2C 5FLMK 3GEHA 1F9NA 1TWFC 5M5XK 5TMFA 3G4CA 4A3FK 1I50A 4XCHA 1TWCC 1C0AA 1DCOA 1J6WA 4KB4A 3S1QK 1WQGA 2EBBA 4A3EK 4A3MK 1TWHA 4C3IK 4GTFA 4Y52K 5EGEA 1KQ4A 3HOYC 4WILA 3LAJA 5FJ8K 1O28A 3AQOA 1BS2A 4NOIA 5M5WK 2B63C 3GIRA 4GTBA 4GTAA 2O5IA 2R92K 2A6HA 1V5VA 5C3EK 5C3EC 1I3QK 2E2JK 4GT9A 4OIRA 2NVYC 2B63K 3DXJA 3SZYA 4KN7A 4Y7NK 2WB1D 3A8JA 1B4AA 3T01A 2NVXK 5IYDC 1I6VA 3GTKA 4C2MK 1F7VA 4BBRC 4A3IK 1TWFA 1UV7A 3GTPK 1ZYRA 1L0WA 1K83A 1Y1WC 4BKWA 2D6FC 2JA7K 4BBSK 1R9TC 3HOWK 3PO2K 4KB2A 2YU9K 1AB4A 4LOWA 1XZPA 4A3JC 1WOOA 3H0GK 4OIPA 1O26A 2KWAA 2E2JC 1I50K 1K83C 4WJ3M 4GZYA 2CW0A 3S1MC 3SZZA 3GTGA 3GTLC 2P8TA 3T02A 4A3GK 2BE5A 2PMZL 4KARA 5M3MK 1DD5A 4A3CK 3T00A 1WSRA 3OREA 2R93A 4QJVA 3A8KA 5D4DA 4A3FC 3PO3C 1IS1A 4KM8A 4KC6A 4O2DA 1EQRA 5IOQA 3GEEA 4P9SA 4A3CC 3LAPA 2ZUEA 4PABA 3HOUC 4KM9A 1YNJA 4MEYA 5JVOA 1R9TA 4A3BC 4YFNA 5HL8A 2E2IK 3K7AC 1XPPA 3TFIA 3S2HK 2VUMK 2VUMC 3CQZC 1I50C 2Y0SL 3AD9C 3GTJK 2GSUA 2JA7A 1YCLA 4LQYA 4KMDA 3FKIA 4YFXA 3AD8C 2WAQD 4XLPA 5TJ3A 3RZOK 5IYBC 2JA5K 1DCPA 3TFHA 2NVXA 4BBSC 4QIWL 4P5AA 1F7UA 4RMFA 3GTPC 3PO3K 1ZBSA 3S14K 5CJ9A 5C4JK 4WJ4A 3N0BA 1XXBA 3S1RC 2NVXC 4YFKA 4KMHA 4C3JC 3HKZL 5IYCC 1USOA 1PJ7A 3S17K 1JVIA 1WCMA 3G4AA 4GTLA 5IP9K 1Y1VK 5TMCA 4LJZA 2GSNA 1WOPA 4LLGA 2E2HK 4X6AK 1K83K 1I3QA 4GFQA 3M4OK 3FKIK 4PAAA 3ADAC 2RH6A 3HOZK 3FHZA 3H0GA 1RU0A 1ZQ1C 3S1QC 5IORA 2P5MA 3RZDK 1Y1WA 3M4OC 2R93C 1SFOK 1O2BA 2RGRA 2PA8L 4BBRK 4A3IC 1SMYA 4OINA 4C2MC 3S2HC 3H3VL 4G0VA 2A68A 2NVQK 1Y1VC 4LR2A 5E68A 2XCQA 3LPXA 2NVTC 5IYCK 3GTGC 3S2DC 4AYBL 1IW7A 1IBAA 1X31C 1IE0A 5IP7C 3S1RK 4FZBA 4A3LC 2JA6A 3L4KA 2NVYA 1TWGK 3GTOK 5C4JC 4BXXC 4A3KK 1XZQB 4A3GC 1BGWA 2E2IA 1HI9A 4A3KC 1VRQC 3QX3A 3S16K 1TWCK 2ZUFA 3GTKC 4YG2A 2JA8C 2FQOA 1TWFK 5FLMC 4G7HA 3HOVC 3K7AK 3GTMK 4KDDA 5EGHA 3HOXK 2CFAB 4A3DC 4A3BK 3HOUK 2PPBA 1TWAA 2V6UA 4C3HK 1Y1WK 4Q4ZA 1WORA 3N3YA 4XSXA 2PHCB 5IOTA 1SFOC 4A93C 5C4XC 3GTJA 4QJVB 2XCRB 4FM9A 4G7ZA 3GTPA 3N0CA 1EH1A 3GDZA 2CFAA 4KMAA 1VGXA 5IOSA 4Y7NC 1O2FB 5M3FK 1TWCA 4MEXA 3FKIC 3CQZA 4X6AC 3S1MK 3GEIA 3I4MC 2R92C 1O2AA
chains in the Genus database with same CATH topology
3GEHA 1XZPA 1WORA 1WOSA 1WOOA 3A8KA 1XZQB 3AD8C 1WOPA 3AD7C 1VRQC 3TFJA 1XZPB 3TFHA 3A8JA 3TTGA 3GEEA 4P9SA 1WSVA 1XZQA 4PABA 4PAAA 1VLOA 3A8IA 3ADAC 1X31C 1YX2A 1PJ5A 2GAGC 3TFIA 3GIRA 1PJ6A 3AD9C 3GEIA 1PJ7A 1V5VA 1WSRA 5L46A 3GSIA 2GAHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEH A;  1XZP A;  1WOR A;  1WOS A;  1WOO A;  3A8K A;  1XZQ B;  3AD8 C;  1WOP A;  3AD7 C;  1VRQ C;  3TFJ A;  1XZP B;  3TFH A;  3A8J A;  3TTG A;  3GEE A;  4P9S A;  1WSV A;  1XZQ A;  4PAB A;  4PAA A;  1VLO A;  3A8I A;  3ADA C;  1X31 C;  1YX2 A;  1PJ5 A;  2GAG C;  3TFI A;  3GIR A;  1PJ6 A;  3AD9 C;  3GEI A;  1PJ7 A;  1V5V A;  1WSR A;  5L46 A;  3GSI A;  2GAH C; 
#chains in the Genus database with same CATH topology
 1IQ0 A;  4A3L K;  1EFW A;  3GTG K;  3S17 C;  4A3J K;  1O29 A;  4C3J K;  2R7Z A;  4XLN A;  2YU9 C;  4BY1 K;  2FQT A;  3BP8 C;  1R9T K;  1VLO A;  2W7V A;  3VA7 A;  1HQM A;  1DCH A;  4XSZ A;  1SFO A;  2R93 K;  4G0W A;  2A69 A;  1TWA C;  4C3H C;  1JOE A;  3IPJ A;  3S1N C;  1YNN A;  3HOV K;  3AD7 C;  1JQW A;  4J3N A;  2NVY K;  4ZH4 A;  1Y1V A;  1F93 A;  1G51 A;  4P5B A;  3TTG A;  1WQF A;  2Y0S D;  1IL2 A;  4M1X A;  1J6V A;  3JST A;  2WAQ L;  1EK8 A;  4JK1 A;  3M3Y C;  3WOD A;  1I6H C;  3HOY K;  2R7Z C;  4Y52 C;  2WB1 L;  4KN4 A;  4QIW D;  3GSI A;  4LK0 A;  3HXA A;  5C4X K;  5C44 C;  4KMU A;  1TWG C;  3GTO C;  2XCO A;  4KAW X;  3CAG A;  5IP7 K;  2O5J A;  1ZXO A;  1TWH K;  4GTE A;  5JFE A;  3S2D K;  3HKZ D;  1J6X A;  5IYB K;  3RZO C;  3AH5 A;  2V6T A;  3S0X A;  4A3D K;  3HOX C;  3OPF A;  1YX2 A;  4MQ9 A;  2NVQ C;  2V6S A;  1O25 A;  4KAS A;  3I4N K;  1O24 A;  2JA8 K;  3MML B;  2B63 A;  3S16 C;  2YU9 A;  2GAH C;  1WOS A;  4BY7 C;  2PMZ D;  3S1N K;  3HOZ C;  2R92 A;  1TWH C;  1INN A;  3BUE A;  3BP3 A;  4BXX K;  2JA6 K;  5M5Y K;  3H3V D;  1TWG A;  3GTO A;  3L4J A;  1B4B A;  3S15 K;  2R7Z K;  4AYB D;  3M3Y K;  3S15 C;  4KAT A;  4LK1 A;  3GTL K;  4C45 A;  3I4M K;  3TFJ A;  3GTQ C;  3FOE A;  4G7O A;  4GTD A;  3RZD C;  2JA5 C;  1VJE A;  4DDQ A;  2GAG C;  3ERE D;  1XXA A;  4C3I C;  4BY7 K;  4A3E C;  4A3M C;  3HOW C;  1TWA K;  2JA7 C;  3OEP A;  2VUM A;  3GTQ K;  3CQZ K;  1BJT A;  1J98 A;  2E2H C;  3FOF A;  1WQH A;  5IYD K;  3NUH A;  2E2I C;  1GE9 A;  2Y3P A;  4ILD A;  5IP9 C;  1XZP B;  4BY1 C;  1WSV A;  3GTM A;  3GTM C;  3A8I A;  1ISE A;  4AH6 A;  4BLA A;  1EI6 A;  2E2H A;  1WIH A;  1ZVU A;  2GSO A;  3GTK K;  1I3Q C;  2JA6 C;  5C44 K;  3S14 C;  2A6E A;  1VH2 A;  2ZFZ A;  5L46 A;  4G0U A;  3V4G A;  1USM A;  1WCM C;  1WCM K;  2JA5 A;  1O27 A;  1I6H K;  3GTL A;  1BDF A;  3Q3Q A;  3GTQ A;  4BLB A;  1XZQ A;  5CHP A;  3GTJ C;  4A93 K;  4OIO A;  2PA8 D;  3I4N C;  3EQL A;  1PJ5 A;  4GTC A;  1XXC A;  4OIQ A;  3AQP A;  3H0G C;  4Q5S A;  1PJ6 A;  2JH3 A;  2NVT K;  3PO2 C;  5FLM K;  3GEH A;  1F9N A;  1TWF C;  5M5X K;  5TMF A;  3G4C A;  4A3F K;  1I50 A;  4XCH A;  1TWC C;  1C0A A;  1DCO A;  1J6W A;  4KB4 A;  3S1Q K;  1WQG A;  2EBB A;  4A3E K;  4A3M K;  1TWH A;  4C3I K;  4GTF A;  4Y52 K;  5EGE A;  1KQ4 A;  3HOY C;  4WIL A;  3LAJ A;  5FJ8 K;  1O28 A;  3AQO A;  1BS2 A;  4NOI A;  5M5W K;  2B63 C;  3GIR A;  4GTB A;  4GTA A;  2O5I A;  2R92 K;  2A6H A;  1V5V A;  5C3E K;  5C3E C;  1I3Q K;  2E2J K;  4GT9 A;  4OIR A;  2NVY C;  2B63 K;  3DXJ A;  3SZY A;  4KN7 A;  4Y7N K;  2WB1 D;  3A8J A;  1B4A A;  3T01 A;  2NVX K;  5IYD C;  1I6V A;  3GTK A;  4C2M K;  1F7V A;  4BBR C;  4A3I K;  1TWF A;  1UV7 A;  3GTP K;  1ZYR A;  1L0W A;  1K83 A;  1Y1W C;  4BKW A;  2D6F C;  2JA7 K;  4BBS K;  1R9T C;  3HOW K;  3PO2 K;  4KB2 A;  2YU9 K;  1AB4 A;  4LOW A;  1XZP A;  4A3J C;  1WOO A;  3H0G K;  4OIP A;  1O26 A;  2KWA A;  2E2J C;  1I50 K;  1K83 C;  4WJ3 M;  4GZY A;  2CW0 A;  3S1M C;  3SZZ A;  3GTG A;  3GTL C;  2P8T A;  3T02 A;  4A3G K;  2BE5 A;  2PMZ L;  4KAR A;  5M3M K;  1DD5 A;  4A3C K;  3T00 A;  1WSR A;  3ORE A;  2R93 A;  4QJV A;  3A8K A;  5D4D A;  4A3F C;  3PO3 C;  1IS1 A;  4KM8 A;  4KC6 A;  4O2D A;  1EQR A;  5IOQ A;  3GEE A;  4P9S A;  4A3C C;  3LAP A;  2ZUE A;  4PAB A;  3HOU C;  4KM9 A;  1YNJ A;  4MEY A;  5JVO A;  1R9T A;  4A3B C;  4YFN A;  5HL8 A;  2E2I K;  3K7A C;  1XPP A;  3TFI A;  3S2H K;  2VUM K;  2VUM C;  3CQZ C;  1I50 C;  2Y0S L;  3AD9 C;  3GTJ K;  2GSU A;  2JA7 A;  1YCL A;  4LQY A;  4KMD A;  3FKI A;  4YFX A;  3AD8 C;  2WAQ D;  4XLP A;  5TJ3 A;  3RZO K;  5IYB C;  2JA5 K;  1DCP A;  3TFH A;  2NVX A;  4BBS C;  4QIW L;  4P5A A;  1F7U A;  4RMF A;  3GTP C;  3PO3 K;  1ZBS A;  3S14 K;  5CJ9 A;  5C4J K;  4WJ4 A;  3N0B A;  1XXB A;  3S1R C;  2NVX C;  4YFK A;  4KMH A;  4C3J C;  3HKZ L;  5IYC C;  1USO A;  1PJ7 A;  3S17 K;  1JVI A;  1WCM A;  3G4A A;  4GTL A;  5IP9 K;  1Y1V K;  5TMC A;  4LJZ A;  2GSN A;  1WOP A;  4LLG A;  2E2H K;  4X6A K;  1K83 K;  1I3Q A;  4GFQ A;  3M4O K;  3FKI K;  4PAA A;  3ADA C;  2RH6 A;  3HOZ K;  3FHZ A;  3H0G A;  1RU0 A;  1ZQ1 C;  3S1Q C;  5IOR A;  2P5M A;  3RZD K;  1Y1W A;  3M4O C;  2R93 C;  1SFO K;  1O2B A;  2RGR A;  2PA8 L;  4BBR K;  4A3I C;  1SMY A;  4OIN A;  4C2M C;  3S2H C;  3H3V L;  4G0V A;  2A68 A;  2NVQ K;  1Y1V C;  4LR2 A;  5E68 A;  2XCQ A;  3LPX A;  2NVT C;  5IYC K;  3GTG C;  3S2D C;  4AYB L;  1IW7 A;  1IBA A;  1X31 C;  1IE0 A;  5IP7 C;  3S1R K;  4FZB A;  4A3L C;  2JA6 A;  3L4K A;  2NVY A;  1TWG K;  3GTO K;  5C4J C;  4BXX C;  4A3K K;  1XZQ B;  4A3G C;  1BGW A;  2E2I A;  1HI9 A;  4A3K C;  1VRQ C;  3QX3 A;  3S16 K;  1TWC K;  2ZUF A;  3GTK C;  4YG2 A;  2JA8 C;  2FQO A;  1TWF K;  5FLM C;  4G7H A;  3HOV C;  3K7A K;  3GTM K;  4KDD A;  5EGH A;  3HOX K;  2CFA B;  4A3D C;  4A3B K;  3HOU K;  2PPB A;  1TWA A;  2V6U A;  4C3H K;  1Y1W K;  4Q4Z A;  1WOR A;  3N3Y A;  4XSX A;  2PHC B;  5IOT A;  1SFO C;  4A93 C;  5C4X C;  3GTJ A;  4QJV B;  2XCR B;  4FM9 A;  4G7Z A;  3GTP A;  3N0C A;  1EH1 A;  3GDZ A;  2CFA A;  4KMA A;  1VGX A;  5IOS A;  4Y7N C;  1O2F B;  5M3F K;  1TWC A;  4MEX A;  3FKI C;  3CQZ A;  4X6A C;  3S1M K;  3GEI A;  3I4M C;  2R92 C;  1O2A A; 
#chains in the Genus database with same CATH homology
 3GEH A;  1XZP A;  1WOR A;  1WOS A;  1WOO A;  3A8K A;  1XZQ B;  3AD8 C;  1WOP A;  3AD7 C;  1VRQ C;  3TFJ A;  1XZP B;  3TFH A;  3A8J A;  3TTG A;  3GEE A;  4P9S A;  1WSV A;  1XZQ A;  4PAB A;  4PAA A;  1VLO A;  3A8I A;  3ADA C;  1X31 C;  1YX2 A;  1PJ5 A;  2GAG C;  3TFI A;  3GIR A;  1PJ6 A;  3AD9 C;  3GEI A;  1PJ7 A;  1V5V A;  1WSR A;  5L46 A;  3GSI A;  2GAH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...