3TTGA

Crystal structure of putative aminomethyltransferase from leptospirillum rubarum
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
337
Chain Sequence
NLYFQGMLTEVSDTRIAHKKFGLFYPSVSRPSIFVEGEDRKNFLQGIASQDILKQDEKSLSYSFFLNPKARILFDAWCGNFEDKIALFPPAGTREEFVNHLKKYLFFRTKAKITDMSDHFREIRLVGPETISVLLSLFDNNFSGSSFRMLKNGGYVLIHPTSFQHNLDVGLQADLFIPIDQFETTQKSLEDFTSNKGGVLLDESSYLAYLTEKGIPLFPSELNDSFFPAEAGLDSVGVSYNKGCYVGQEPVTRLKFQGHLNRSLAGFRLEGPKMEFPVTLFNPKDGNEAGILTRTSSSDILGSGIGLGYIKRNFSENGTELLLPDAQLVRVHSLPFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative aminomethyltransferase from Leptospirillum rubarum
rcsb
source organism Leptospirillum rubarum
molecule tags Transferase
molecule keywords Putative aminomethyltransferase
total genus 95
structure length 337
sequence length 340
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ttgA00
3GIRA 1VLOA 3GEHA 3AD7C 1WORA 1WSVA 3TTGA 2GAGC 1WOPA 1WOSA 1WSRA 1XZPA 3AD8C 3TFJA 1V5VA 3TFIA 1YX2A 3TFHA 3GEIA 3GSIA 3A8IA 3AD9C 1PJ6A 1XZQA 1PJ7A 1XZPB 1XZQB 3A8KA 4PABA 3GEEA 3A8JA 4P9SA 1WOOA 1PJ5A 4PAAA 5L46A 1VRQC 2GAHC 1X31C 3ADAC
chains in the Genus database with same CATH superfamily
4A3GK 4QIWD 1I3QC 5M3MK 1VLOA 4GZYA 3M3YC 4BXXK 4KM8A 4LQYA 4C3JK 3LPXA 3LAPA 4Q5SA 2WB1D 4BBRC 3TFHA 1TWGC 4GT9A 4G7OA 5TMCA 5FLMC 4LLGA 3VA7A 1R9TK 2JA5C 1WCMC 1YCLA 2PA8L 1XZQB 1Y1WK 4WILA 1EH1A 2XCOA 3A8JA 3FKIK 3K7AC 2GAHC 3LAJA 1TWFK 1BS2A 1R9TA 5IYCC 4GTAA 1XXCA 2GSUA 1Y1VC 4G7ZA 2A6EA 4XCHA 3S17K 1JQWA 3GTQC 3N3YA 1O2AA 4C2MC 3PO2C 1XXAA 3G4AA 4BKWA 3S1QC 2YU9C 1GE9A 4X6AK 1XZQA 5C4JK 3PO3C 1EI6A 2BE5A 3S1RK 4KMUA 3S1QK 4Y52K 1DD5A 3ADAC 4Q4ZA 2E2IK 4DDQA 3H0GK 2V6SA 3GTQK 2R7ZK 5CJ9A 3H3VD 3S17C 5IP9K 2JA6K 3GTMA 1O24A 3RZDC 1V5VA 4KN7A 3AQPA 3N0CA 3S16K 1TWGA 4KN4A 2R92C 1WCMA 3K7AK 1PJ6A 4KATA 4XSXA 2VUMA 2PPBA 3HOVK 3GEEA 1TWCC 4AYBL 1IW7A 2KWAA 2B63K 4BBRK 1DCOA 1VJEA 4A3MC 2P8TA 4KC6A 2FQOA 4MEXA 2GAGC 5HL8A 2R7ZA 4LOWA 1WSRA 4A3JK 3AH5A 1VH2A 2NVQC 2XCQA 2RH6A 3S2DC 2JA8K 1BJTA 5E68A 1USOA 5C3EK 2JA6C 4NOIA 2E2HA 1IS1A 4A3KK 3FOEA 1K83C 4OIRA 3GTKA 2WAQL 5EGHA 4JK1A 1X31C 1IQ0A 5C4XC 4Y52C 3S14C 4GTBA 3HOXK 3GTPK 1O26A 1I3QA 1J6WA 2NVYK 1RU0A 1J98A 4YFXA 3T02A 4A3MK 3S1NK 4OINA 3S2HK 3PO2K 1B4AA 3Q3QA 1SFOK 3HOVC 3GTLK 4ILDA 2R92K 2CW0A 1TWFC 3CQZC 5IP7K 3I4MC 3GIRA 3OPFA 3FKIC 3GTQA 4YFNA 1O25A 1TWAC 3OEPA 4AYBD 5IYBC 3H0GC 2JA7A 3V4GA 3NUHA 3S2HC 1I6HK 3S1RC 4A3DC 1BGWA 1J6VA 2YU9A 3PO3K 1IBAA 1G51A 2ZUFA 5TMFA 4X6AC 2O5JA 2FQTA 4RMFA 3HOWC 3S1MC 4BY7K 1VRQC 3GTKC 4QJVA 4KB2A 2PMZD 1HQMA 1O28A 1BDFA 5FJ8K 2XCRB 2NVTK 2PA8D 1JOEA 3HOZC 4C3HC 1WQFA 4C3IC 3TFIA 4XSZA 1WIHA 1ZYRA 3BP3A 2RGRA 3CQZK 3ERED 2VUMC 4GTEA 1O27A 2R92A 1SFOC 1TWCA 1I50A 1WOOA 4M1XA 1EFWA 2B63A 3GEHA 5FLMK 2W7VA 3CQZA 4KMHA 1TWCK 3RZOK 2E2JK 5TJ3A 1Y1VA 1DCHA 3GTPA 1I3QK 4GTDA 1UV7A 3GEIA 3FOFA 2R93A 5C4XK 2GSOA 1DCPA 3GSIA 1B4BA 4Y7NK 3A8IA 3EQLA 4OIQA 3AD9C 3SZYA 4PABA 2JA6A 3S0XA 4Y7NC 2JA8C 1YX2A 1USMA 4OIOA 2NVQK 4QJVB 3GTOC 3AD7C 3I4NC 3IPJA 3GTMC 4LK0A 1WQGA 3T00A 1WOPA 4MQ9A 4KARA 2YU9K 5IOSA 3TFJA 2JH3A 1JVIA 5M5YK 2CFAB 5IORA 3RZOC 4A3IK 2PMZL 4C2MK 5JFEA 4LJZA 2A6HA 4QIWL 3GTGA 4BLAA 4GFQA 2GSNA 1SFOA 2VUMK 4PAAA 1I50C 3HKZD 3GTGK 5IP7C 3I4MK 4A3BK 3FKIA 4KMDA 4GTFA 3JSTA 4BBSK 4J3NA 2CFAA 2JA5K 4GTCA 1ISEA 3WODA 3SZZA 2WAQD 4ZH4A 2E2IA 5C44C 3S1NC 3H3VL 2NVYC 4C3JC 5C4JC 1VGXA 4A3LC 2A69A 4G0UA 4GTLA 4O2DA 3HOXC 3S14K 4XLNA 3BUEA 4KMAA 1I6HC 1XPPA 3M4OK 2R93K 3HOUC 1WORA 3TTGA 1SMYA 2V6TA 1Y1VK 3CAGA 3GTJK 3S2DK 2ZFZA 1F93A 4YG2A 1WQHA 3S15C 3HOYC 4C45A 1Y1WA 2JA5A 5D4DA 2NVXK 4A3FK 1IL2A 1ZBSA 4KAWX 1HI9A 4LK1A 1XXBA 2B63C 1WCMK 1O29A 3N0BA 4A3IC 1TWGK 4FZBA 1O2FB 2A68A 4P5AA 3GTMK 3AD8C 2JA7C 3HOYK 3S15K 3GTPC 2O5IA 4WJ3M 3FHZA 4G0VA 4C3IK 1K83K 4KDDA 1YNNA 1KQ4A 1ZQ1C 4A3KC 5IYDK 2Y3PA 4P9SA 4A93K 3G4CA 5C3EC 3M4OC 4P5BA 4BLBA 1O2BA 3GTOA 4A3CC 3L4KA 3HXAA 4KM9A 1XZPA 4LR2A 2V6UA 1YNJA 5IYBK 3MMLB 4YFKA 4BBSC 1ZXOA 2P5MA 1F7VA 1PJ5A 2ZUEA 1I6VA 5IYCK 5L46A 3S16C 1I50K 3RZDK 3AQOA 4XLPA 3GTLC 2NVXA 3HOZK 5EGEA 2NVTC 1F9NA 5IP9C 1TWHC 4KB4A 2R7ZC 2R93C 1F7UA 2E2IC 5JVOA 3GTJA 3GTKK 5M3FK 3HOWK 3S1MK 4BY7C 5M5WK 2E2HK 2Y0SD 4A3LK 2E2HC 5M5XK 3GTOK 1L0WA 3I4NK 3M3YK 4BXXC 4A3DK 4A3CK 5C44K 4KASA 2WB1L 5CHPA 4MEYA 3QX3A 4A93C 1TWAK 2PHCB 1TWHK 2Y0SL 1J6XA 1EQRA 4OIPA 3GDZA 5IOTA 4G7HA 4A3EC 4BY1K 3HKZL 3GTGC 4A3JC 4A3BC 2JA7K 3BP8C 1PJ7A 1Y1WC 1XZPB 2EBBA 3OREA 2E2JC 1R9TC 1EK8A 3L4JA 1C0AA 1TWFA 4G0WA 5IOQA 2D6FC 1WSVA 4A3FC 2NVXC 1WOSA 1IE0A 1INNA 3GTLA 1TWHA 1TWAA 4A3EK 4BY1C 4A3GC 3H0GA 1AB4A 3GTJC 2NVYA 4C3HK 1ZVUA 3T01A 4WJ4A 3DXJA 5IYDC 3A8KA 1K83A 4FM9A 3HOUK 4AH6A
chains in the Genus database with same CATH topology
3GIRA 1VLOA 3GEHA 3AD7C 1WORA 1WSVA 3TTGA 2GAGC 1WOPA 1WOSA 1WSRA 1XZPA 3AD8C 3TFJA 1V5VA 3TFIA 1YX2A 3TFHA 3GEIA 3GSIA 3A8IA 3AD9C 1PJ6A 1XZQA 1PJ7A 1XZPB 1XZQB 3A8KA 4PABA 3GEEA 3A8JA 4P9SA 1WOOA 1PJ5A 4PAAA 5L46A 1VRQC 2GAHC 1X31C 3ADAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIR A;  1VLO A;  3GEH A;  3AD7 C;  1WOR A;  1WSV A;  3TTG A;  2GAG C;  1WOP A;  1WOS A;  1WSR A;  1XZP A;  3AD8 C;  3TFJ A;  1V5V A;  3TFI A;  1YX2 A;  3TFH A;  3GEI A;  3GSI A;  3A8I A;  3AD9 C;  1PJ6 A;  1XZQ A;  1PJ7 A;  1XZP B;  1XZQ B;  3A8K A;  4PAB A;  3GEE A;  3A8J A;  4P9S A;  1WOO A;  1PJ5 A;  4PAA A;  5L46 A;  1VRQ C;  2GAH C;  1X31 C;  3ADA C; 
#chains in the Genus database with same CATH topology
 4A3G K;  4QIW D;  1I3Q C;  5M3M K;  1VLO A;  4GZY A;  3M3Y C;  4BXX K;  4KM8 A;  4LQY A;  4C3J K;  3LPX A;  3LAP A;  4Q5S A;  2WB1 D;  4BBR C;  3TFH A;  1TWG C;  4GT9 A;  4G7O A;  5TMC A;  5FLM C;  4LLG A;  3VA7 A;  1R9T K;  2JA5 C;  1WCM C;  1YCL A;  2PA8 L;  1XZQ B;  1Y1W K;  4WIL A;  1EH1 A;  2XCO A;  3A8J A;  3FKI K;  3K7A C;  2GAH C;  3LAJ A;  1TWF K;  1BS2 A;  1R9T A;  5IYC C;  4GTA A;  1XXC A;  2GSU A;  1Y1V C;  4G7Z A;  2A6E A;  4XCH A;  3S17 K;  1JQW A;  3GTQ C;  3N3Y A;  1O2A A;  4C2M C;  3PO2 C;  1XXA A;  3G4A A;  4BKW A;  3S1Q C;  2YU9 C;  1GE9 A;  4X6A K;  1XZQ A;  5C4J K;  3PO3 C;  1EI6 A;  2BE5 A;  3S1R K;  4KMU A;  3S1Q K;  4Y52 K;  1DD5 A;  3ADA C;  4Q4Z A;  2E2I K;  4DDQ A;  3H0G K;  2V6S A;  3GTQ K;  2R7Z K;  5CJ9 A;  3H3V D;  3S17 C;  5IP9 K;  2JA6 K;  3GTM A;  1O24 A;  3RZD C;  1V5V A;  4KN7 A;  3AQP A;  3N0C A;  3S16 K;  1TWG A;  4KN4 A;  2R92 C;  1WCM A;  3K7A K;  1PJ6 A;  4KAT A;  4XSX A;  2VUM A;  2PPB A;  3HOV K;  3GEE A;  1TWC C;  4AYB L;  1IW7 A;  2KWA A;  2B63 K;  4BBR K;  1DCO A;  1VJE A;  4A3M C;  2P8T A;  4KC6 A;  2FQO A;  4MEX A;  2GAG C;  5HL8 A;  2R7Z A;  4LOW A;  1WSR A;  4A3J K;  3AH5 A;  1VH2 A;  2NVQ C;  2XCQ A;  2RH6 A;  3S2D C;  2JA8 K;  1BJT A;  5E68 A;  1USO A;  5C3E K;  2JA6 C;  4NOI A;  2E2H A;  1IS1 A;  4A3K K;  3FOE A;  1K83 C;  4OIR A;  3GTK A;  2WAQ L;  5EGH A;  4JK1 A;  1X31 C;  1IQ0 A;  5C4X C;  4Y52 C;  3S14 C;  4GTB A;  3HOX K;  3GTP K;  1O26 A;  1I3Q A;  1J6W A;  2NVY K;  1RU0 A;  1J98 A;  4YFX A;  3T02 A;  4A3M K;  3S1N K;  4OIN A;  3S2H K;  3PO2 K;  1B4A A;  3Q3Q A;  1SFO K;  3HOV C;  3GTL K;  4ILD A;  2R92 K;  2CW0 A;  1TWF C;  3CQZ C;  5IP7 K;  3I4M C;  3GIR A;  3OPF A;  3FKI C;  3GTQ A;  4YFN A;  1O25 A;  1TWA C;  3OEP A;  4AYB D;  5IYB C;  3H0G C;  2JA7 A;  3V4G A;  3NUH A;  3S2H C;  1I6H K;  3S1R C;  4A3D C;  1BGW A;  1J6V A;  2YU9 A;  3PO3 K;  1IBA A;  1G51 A;  2ZUF A;  5TMF A;  4X6A C;  2O5J A;  2FQT A;  4RMF A;  3HOW C;  3S1M C;  4BY7 K;  1VRQ C;  3GTK C;  4QJV A;  4KB2 A;  2PMZ D;  1HQM A;  1O28 A;  1BDF A;  5FJ8 K;  2XCR B;  2NVT K;  2PA8 D;  1JOE A;  3HOZ C;  4C3H C;  1WQF A;  4C3I C;  3TFI A;  4XSZ A;  1WIH A;  1ZYR A;  3BP3 A;  2RGR A;  3CQZ K;  3ERE D;  2VUM C;  4GTE A;  1O27 A;  2R92 A;  1SFO C;  1TWC A;  1I50 A;  1WOO A;  4M1X A;  1EFW A;  2B63 A;  3GEH A;  5FLM K;  2W7V A;  3CQZ A;  4KMH A;  1TWC K;  3RZO K;  2E2J K;  5TJ3 A;  1Y1V A;  1DCH A;  3GTP A;  1I3Q K;  4GTD A;  1UV7 A;  3GEI A;  3FOF A;  2R93 A;  5C4X K;  2GSO A;  1DCP A;  3GSI A;  1B4B A;  4Y7N K;  3A8I A;  3EQL A;  4OIQ A;  3AD9 C;  3SZY A;  4PAB A;  2JA6 A;  3S0X A;  4Y7N C;  2JA8 C;  1YX2 A;  1USM A;  4OIO A;  2NVQ K;  4QJV B;  3GTO C;  3AD7 C;  3I4N C;  3IPJ A;  3GTM C;  4LK0 A;  1WQG A;  3T00 A;  1WOP A;  4MQ9 A;  4KAR A;  2YU9 K;  5IOS A;  3TFJ A;  2JH3 A;  1JVI A;  5M5Y K;  2CFA B;  5IOR A;  3RZO C;  4A3I K;  2PMZ L;  4C2M K;  5JFE A;  4LJZ A;  2A6H A;  4QIW L;  3GTG A;  4BLA A;  4GFQ A;  2GSN A;  1SFO A;  2VUM K;  4PAA A;  1I50 C;  3HKZ D;  3GTG K;  5IP7 C;  3I4M K;  4A3B K;  3FKI A;  4KMD A;  4GTF A;  3JST A;  4BBS K;  4J3N A;  2CFA A;  2JA5 K;  4GTC A;  1ISE A;  3WOD A;  3SZZ A;  2WAQ D;  4ZH4 A;  2E2I A;  5C44 C;  3S1N C;  3H3V L;  2NVY C;  4C3J C;  5C4J C;  1VGX A;  4A3L C;  2A69 A;  4G0U A;  4GTL A;  4O2D A;  3HOX C;  3S14 K;  4XLN A;  3BUE A;  4KMA A;  1I6H C;  1XPP A;  3M4O K;  2R93 K;  3HOU C;  1WOR A;  3TTG A;  1SMY A;  2V6T A;  1Y1V K;  3CAG A;  3GTJ K;  3S2D K;  2ZFZ A;  1F93 A;  4YG2 A;  1WQH A;  3S15 C;  3HOY C;  4C45 A;  1Y1W A;  2JA5 A;  5D4D A;  2NVX K;  4A3F K;  1IL2 A;  1ZBS A;  4KAW X;  1HI9 A;  4LK1 A;  1XXB A;  2B63 C;  1WCM K;  1O29 A;  3N0B A;  4A3I C;  1TWG K;  4FZB A;  1O2F B;  2A68 A;  4P5A A;  3GTM K;  3AD8 C;  2JA7 C;  3HOY K;  3S15 K;  3GTP C;  2O5I A;  4WJ3 M;  3FHZ A;  4G0V A;  4C3I K;  1K83 K;  4KDD A;  1YNN A;  1KQ4 A;  1ZQ1 C;  4A3K C;  5IYD K;  2Y3P A;  4P9S A;  4A93 K;  3G4C A;  5C3E C;  3M4O C;  4P5B A;  4BLB A;  1O2B A;  3GTO A;  4A3C C;  3L4K A;  3HXA A;  4KM9 A;  1XZP A;  4LR2 A;  2V6U A;  1YNJ A;  5IYB K;  3MML B;  4YFK A;  4BBS C;  1ZXO A;  2P5M A;  1F7V A;  1PJ5 A;  2ZUE A;  1I6V A;  5IYC K;  5L46 A;  3S16 C;  1I50 K;  3RZD K;  3AQO A;  4XLP A;  3GTL C;  2NVX A;  3HOZ K;  5EGE A;  2NVT C;  1F9N A;  5IP9 C;  1TWH C;  4KB4 A;  2R7Z C;  2R93 C;  1F7U A;  2E2I C;  5JVO A;  3GTJ A;  3GTK K;  5M3F K;  3HOW K;  3S1M K;  4BY7 C;  5M5W K;  2E2H K;  2Y0S D;  4A3L K;  2E2H C;  5M5X K;  3GTO K;  1L0W A;  3I4N K;  3M3Y K;  4BXX C;  4A3D K;  4A3C K;  5C44 K;  4KAS A;  2WB1 L;  5CHP A;  4MEY A;  3QX3 A;  4A93 C;  1TWA K;  2PHC B;  1TWH K;  2Y0S L;  1J6X A;  1EQR A;  4OIP A;  3GDZ A;  5IOT A;  4G7H A;  4A3E C;  4BY1 K;  3HKZ L;  3GTG C;  4A3J C;  4A3B C;  2JA7 K;  3BP8 C;  1PJ7 A;  1Y1W C;  1XZP B;  2EBB A;  3ORE A;  2E2J C;  1R9T C;  1EK8 A;  3L4J A;  1C0A A;  1TWF A;  4G0W A;  5IOQ A;  2D6F C;  1WSV A;  4A3F C;  2NVX C;  1WOS A;  1IE0 A;  1INN A;  3GTL A;  1TWH A;  1TWA A;  4A3E K;  4BY1 C;  4A3G C;  3H0G A;  1AB4 A;  3GTJ C;  2NVY A;  4C3H K;  1ZVU A;  3T01 A;  4WJ4 A;  3DXJ A;  5IYD C;  3A8K A;  1K83 A;  4FM9 A;  3HOU K;  4AH6 A; 
#chains in the Genus database with same CATH homology
 3GIR A;  1VLO A;  3GEH A;  3AD7 C;  1WOR A;  1WSV A;  3TTG A;  2GAG C;  1WOP A;  1WOS A;  1WSR A;  1XZP A;  3AD8 C;  3TFJ A;  1V5V A;  3TFI A;  1YX2 A;  3TFH A;  3GEI A;  3GSI A;  3A8I A;  3AD9 C;  1PJ6 A;  1XZQ A;  1PJ7 A;  1XZP B;  1XZQ B;  3A8K A;  4PAB A;  3GEE A;  3A8J A;  4P9S A;  1WOO A;  1PJ5 A;  4PAA A;  5L46 A;  1VRQ C;  2GAH C;  1X31 C;  3ADA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...