3TTGA

Crystal structure of putative aminomethyltransferase from leptospirillum rubarum
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
337
Chain Sequence
NLYFQGMLTEVSDTRIAHKKFGLFYPSVSRPSIFVEGEDRKNFLQGIASQDILKQDEKSLSYSFFLNPKARILFDAWCGNFEDKIALFPPAGTREEFVNHLKKYLFFRTKAKITDMSDHFREIRLVGPETISVLLSLFDNNFSGSSFRMLKNGGYVLIHPTSFQHNLDVGLQADLFIPIDQFETTQKSLEDFTSNKGGVLLDESSYLAYLTEKGIPLFPSELNDSFFPAEAGLDSVGVSYNKGCYVGQEPVTRLKFQGHLNRSLAGFRLEGPKMEFPVTLFNPKDGNEAGILTRTSSSDILGSGIGLGYIKRNFSENGTELLLPDAQLVRVHSLPFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative aminomethyltransferase
publication title Crystal structure of putative aminomethyltransferase from Leptospirillum rubarum
rcsb
source organism Leptospirillum rubarum
total genus 95
structure length 337
sequence length 340
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ttgA00
1WOSA 1PJ6A 1YX2A 3GIRA 1XZPA 5L46A 3GEHA 3ADAC 1VRQC 1PJ7A 1XZQA 3TFJA 4PAAA 4P9SA 3AD8C 1WORA 1WSRA 4PABA 1WOOA 1XZPB 3AD7C 1V5VA 3A8IA 3AD9C 1WSVA 1X31C 3A8JA 2GAHC 1WOPA 3TFIA 3GEIA 1XZQB 3GEEA 3TTGA 3A8KA 1VLOA 1PJ5A 3GSIA 3TFHA 2GAGC
chains in the Genus database with same CATH superfamily
3H0GC 3N3YA 1XZPA 3GTOK 3S1QK 3S14K 3GTMC 1F9NA 3FHZA 3HXAA 1I3QA 3I4NC 5IYCC 3S17K 1ZBSA 1WORA 2FQOA 3GTKC 3A8IA 1VJEA 3HOVC 4A3MK 2E2HC 3DXJA 1ZVUA 4BLBA 4BY1C 3LAPA 1WCMA 3OPFA 4KN7A 4BLAA 4KMAA 4KARA 3S1RK 1G51A 1IS1A 3H3VD 3PO2K 4BBRK 1EK8A 2E2JC 3BUEA 4J3NA 5FJ8K 5C4JC 4O2DA 4LK0A 2A6EA 3S1MC 2ZFZA 3TFIA 1IL2A 2NVQC 3GTOC 2E2IK 1L0WA 3S1QC 3GEEA 3A8KA 4P5BA 4C45A 3BP3A 4OIRA 4DDQA 5IP9K 2JA6K 2E2IA 5E68A 4A3MC 1XXBA 2B63K 3HOWK 1VRQC 1J98A 1DCOA 3Q3QA 4G7HA 4KMUA 4G7ZA 1R9TK 4Y7NK 1O2BA 3FKIK 1O27A 4YFNA 1I6VA 3N0CA 3M4OC 3S1RC 1R9TA 1I50K 5IORA 3PO2C 2PPBA 3S2DC 1IQ0A 4GZYA 2JH3A 2WB1L 1SFOA 3S1NK 3I4MK 1F93A 1HI9A 2Y0SD 4OIQA 4C3IC 4G0UA 4FZBA 3TFJA 1VGXA 2R93K 3GTGA 5EGHA 4WJ3M 4A3DK 2JA7K 2A6HA 3T02A 2JA6C 3JSTA 2R93A 2B63C 3HOWC 1USMA 3S16K 2NVYK 2RGRA 3LAJA 4Y7NC 2JA5C 2JA8K 3T00A 1RU0A 3L4JA 1I50C 4C3HK 2NVTK 2WB1D 4P9SA 2CW0A 1TWGC 3GTQA 1SMYA 1XZPB 3AD7C 3OEPA 4KMHA 3HOUK 4X6AK 1IE0A 2NVXK 4QJVA 3I4MC 1DCHA 2RH6A 3L4KA 3AQPA 3K7AK 5IYBK 2O5JA 5IOQA 3H3VL 2R7ZC 1TWCC 3ERED 3FOFA 1ISEA 5C3EC 5M3MK 4KATA 4KASA 3GTJA 1I3QK 4G0VA 1EFWA 2JA7C 2E2HA 4GTCA 1BDFA 5C4XK 5M5YK 4XSZA 4BKWA 3EQLA 3M3YK 1WSRA 1TWHA 2NVYC 3HOYC 1VH2A 1USOA 3RZDC 3LPXA 4A93C 4QIWL 1BGWA 1WCMK 5D4DA 1O2AA 3HOZK 3GEIA 1Y1WA 3PO3C 4WILA 4C3HC 2NVTC 3SZZA 1XXCA 4OIPA 1O25A 4ILDA 3RZOK 3GEHA 4YG2A 2O5IA 4KDDA 4Y52C 5JVOA 2XCRB 1Y1VA 4GFQA 4C3JC 4PAAA 5IYBC 1HQMA 4BXXC 1TWFA 2Y3PA 2VUMC 1WQGA 2W7VA 4XLPA 1TWAK 3AD9C 1X31C 2GSUA 3A8JA 1I3QC 2R92A 3MMLB 5TMCA 3S14C 3QX3A 4MQ9A 2Y0SL 1TWAA 3HOXK 3NUHA 3AH5A 4QIWD 2CFAB 4C2MK 4A3EK 3M3YC 3S17C 4BBSK 4JK1A 4P5AA 1WCMC 4Q5SA 1YNNA 5FLMK 1J6WA 4A3FK 1J6XA 1WOOA 4GTBA 1O24A 3CQZA 1AB4A 3GTPA 4A3IK 1WOPA 5HL8A 5M5XK 2KWAA 1SFOK 4OINA 3GTLA 1WIHA 1I6HK 4BBRC 3GSIA 2GAGC 5CHPA 4LK1A 5EGEA 1PJ6A 2YU9K 5IP7K 4AH6A 3GTGK 4YFXA 3CAGA 2YU9A 2E2IC 3N0BA 1V5VA 3HKZL 4C2MC 2XCQA 5C44K 2PA8L 1K83A 2JA5A 4RMFA 5IP9C 4BBSC 1XZQB 2V6SA 4KM8A 4LLGA 4ZH4A 5TMFA 5FLMC 1R9TC 1DCPA 3AQOA 4LR2A 1TWGA 3FKIC 4GTLA 3GTQK 3T01A 3S15K 4A3IC 4GT9A 4A3GK 1ZYRA 4BY7K 3H0GK 5M3FK 2R7ZA 1TWCA 3GTMK 1YNJA 3S1NC 3GTGC 3H0GA 5TJ3A 1BS2A 5IYCK 3GTJK 1PJ5A 1F7VA 3TFHA 3HKZD 3GTMA 2PA8D 2E2HK 1WOSA 3VA7A 1YX2A 2R93C 4NOIA 1ZQ1C 5L46A 1TWHK 4MEXA 4A3DC 5IYDK 3GTKA 1EH1A 1IW7A 4KM9A 1WQHA 1Y1WK 3S16C 4A3JK 1XXAA 4GTEA 4A3KK 1F7UA 2JA8C 1EI6A 4GTAA 2PMZD 5C4JK 5CJ9A 1VLOA 3S1MK 1O28A 1Y1VK 3GIRA 1UV7A 2NVQK 2VUMA 1TWFK 4X6AC 1IBAA 3HOUC 2V6TA 1YCLA 2NVXC 4LQYA 3GTJC 3K7AC 2R92K 3V4GA 3GTOA 2WAQD 4KMDA 1INNA 1TWHC 2A69A 5IYDC 1B4AA 2PHCB 5C4XC 3M4OK 5JFEA 1Y1WC 3S2HK 4A3JC 3G4CA 3S2DK 2GSOA 4A3LK 4A3KC 3CQZK 3HOZC 3GTPK 5IOSA 4M1XA 4KC6A 1EQRA 3GTLK 1O2FB 4OIOA 1Y1VC 1WSVA 3WODA 4C3IK 1TWFC 4KN4A 3RZOC 4GTDA 2BE5A 4WJ4A 4KB4A 4Q4ZA 2R92C 2XCOA 4LOWA 1DD5A 2V6UA 2D6FC 3ADAC 1TWAC 4AYBL 1J6VA 1K83K 2JA6A 2JA5K 3GDZA 5IOTA 2B63A 3IPJA 2CFAA 3HOXC 2EBBA 4A3EC 2GAHC 3S2HC 4KB2A 4FM9A 3FKIA 4KAWX 4A3LC 1TWGK 4XCHA 1XPPA 3CQZC 1BJTA 4A3BK 3GTPC 4A3FC 4GTFA 1I50A 4G7OA 4LJZA 4QJVB 3GTLC 2R7ZK 1TWCK 2FQTA 1SFOC 2ZUFA 4MEYA 5C3EK 4A3CK 1WQFA 3FOEA 2PMZL 1I6HC 4PABA 2P8TA 1KQ4A 1C0AA 4AYBD 2YU9C 2A68A 1B4BA 3S0XA 3OREA 4XLNA 3BP8C 5IP7C 3TTGA 3I4NK 1GE9A 3HOYK 3RZDK 2JA7A 1JVIA 4A93K 1K83C 3GTKK 2GSNA 3HOVK 1JQWA 3SZYA 3G4AA 5C44C 2ZUEA 2NVYA 4XSXA 1ZXOA 3PO3K 2WAQL 4BY1K 1PJ7A 1XZQA 1O26A 3AD8C 1JOEA 4A3BC 5M5WK 4G0WA 4Y52K 4C3JK 2E2JK 4BXXK 1O29A 4YFKA 2VUMK 3GTQC 3S15C 2NVXA 2P5MA 4A3CC 4A3GC 4BY7C
chains in the Genus database with same CATH topology
1WOSA 1PJ6A 1YX2A 3GIRA 1XZPA 5L46A 3GEHA 3ADAC 1VRQC 1PJ7A 1XZQA 3TFJA 4PAAA 4P9SA 3AD8C 1WORA 1WSRA 4PABA 1WOOA 1XZPB 3AD7C 1V5VA 3A8IA 3AD9C 1WSVA 1X31C 3A8JA 2GAHC 1WOPA 3TFIA 3GEIA 1XZQB 3GEEA 3TTGA 3A8KA 1VLOA 1PJ5A 3GSIA 3TFHA 2GAGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOS A;  1PJ6 A;  1YX2 A;  3GIR A;  1XZP A;  5L46 A;  3GEH A;  3ADA C;  1VRQ C;  1PJ7 A;  1XZQ A;  3TFJ A;  4PAA A;  4P9S A;  3AD8 C;  1WOR A;  1WSR A;  4PAB A;  1WOO A;  1XZP B;  3AD7 C;  1V5V A;  3A8I A;  3AD9 C;  1WSV A;  1X31 C;  3A8J A;  2GAH C;  1WOP A;  3TFI A;  3GEI A;  1XZQ B;  3GEE A;  3TTG A;  3A8K A;  1VLO A;  1PJ5 A;  3GSI A;  3TFH A;  2GAG C; 
#chains in the Genus database with same CATH topology
 3H0G C;  3N3Y A;  1XZP A;  3GTO K;  3S1Q K;  3S14 K;  3GTM C;  1F9N A;  3FHZ A;  3HXA A;  1I3Q A;  3I4N C;  5IYC C;  3S17 K;  1ZBS A;  1WOR A;  2FQO A;  3GTK C;  3A8I A;  1VJE A;  3HOV C;  4A3M K;  2E2H C;  3DXJ A;  1ZVU A;  4BLB A;  4BY1 C;  3LAP A;  1WCM A;  3OPF A;  4KN7 A;  4BLA A;  4KMA A;  4KAR A;  3S1R K;  1G51 A;  1IS1 A;  3H3V D;  3PO2 K;  4BBR K;  1EK8 A;  2E2J C;  3BUE A;  4J3N A;  5FJ8 K;  5C4J C;  4O2D A;  4LK0 A;  2A6E A;  3S1M C;  2ZFZ A;  3TFI A;  1IL2 A;  2NVQ C;  3GTO C;  2E2I K;  1L0W A;  3S1Q C;  3GEE A;  3A8K A;  4P5B A;  4C45 A;  3BP3 A;  4OIR A;  4DDQ A;  5IP9 K;  2JA6 K;  2E2I A;  5E68 A;  4A3M C;  1XXB A;  2B63 K;  3HOW K;  1VRQ C;  1J98 A;  1DCO A;  3Q3Q A;  4G7H A;  4KMU A;  4G7Z A;  1R9T K;  4Y7N K;  1O2B A;  3FKI K;  1O27 A;  4YFN A;  1I6V A;  3N0C A;  3M4O C;  3S1R C;  1R9T A;  1I50 K;  5IOR A;  3PO2 C;  2PPB A;  3S2D C;  1IQ0 A;  4GZY A;  2JH3 A;  2WB1 L;  1SFO A;  3S1N K;  3I4M K;  1F93 A;  1HI9 A;  2Y0S D;  4OIQ A;  4C3I C;  4G0U A;  4FZB A;  3TFJ A;  1VGX A;  2R93 K;  3GTG A;  5EGH A;  4WJ3 M;  4A3D K;  2JA7 K;  2A6H A;  3T02 A;  2JA6 C;  3JST A;  2R93 A;  2B63 C;  3HOW C;  1USM A;  3S16 K;  2NVY K;  2RGR A;  3LAJ A;  4Y7N C;  2JA5 C;  2JA8 K;  3T00 A;  1RU0 A;  3L4J A;  1I50 C;  4C3H K;  2NVT K;  2WB1 D;  4P9S A;  2CW0 A;  1TWG C;  3GTQ A;  1SMY A;  1XZP B;  3AD7 C;  3OEP A;  4KMH A;  3HOU K;  4X6A K;  1IE0 A;  2NVX K;  4QJV A;  3I4M C;  1DCH A;  2RH6 A;  3L4K A;  3AQP A;  3K7A K;  5IYB K;  2O5J A;  5IOQ A;  3H3V L;  2R7Z C;  1TWC C;  3ERE D;  3FOF A;  1ISE A;  5C3E C;  5M3M K;  4KAT A;  4KAS A;  3GTJ A;  1I3Q K;  4G0V A;  1EFW A;  2JA7 C;  2E2H A;  4GTC A;  1BDF A;  5C4X K;  5M5Y K;  4XSZ A;  4BKW A;  3EQL A;  3M3Y K;  1WSR A;  1TWH A;  2NVY C;  3HOY C;  1VH2 A;  1USO A;  3RZD C;  3LPX A;  4A93 C;  4QIW L;  1BGW A;  1WCM K;  5D4D A;  1O2A A;  3HOZ K;  3GEI A;  1Y1W A;  3PO3 C;  4WIL A;  4C3H C;  2NVT C;  3SZZ A;  1XXC A;  4OIP A;  1O25 A;  4ILD A;  3RZO K;  3GEH A;  4YG2 A;  2O5I A;  4KDD A;  4Y52 C;  5JVO A;  2XCR B;  1Y1V A;  4GFQ A;  4C3J C;  4PAA A;  5IYB C;  1HQM A;  4BXX C;  1TWF A;  2Y3P A;  2VUM C;  1WQG A;  2W7V A;  4XLP A;  1TWA K;  3AD9 C;  1X31 C;  2GSU A;  3A8J A;  1I3Q C;  2R92 A;  3MML B;  5TMC A;  3S14 C;  3QX3 A;  4MQ9 A;  2Y0S L;  1TWA A;  3HOX K;  3NUH A;  3AH5 A;  4QIW D;  2CFA B;  4C2M K;  4A3E K;  3M3Y C;  3S17 C;  4BBS K;  4JK1 A;  4P5A A;  1WCM C;  4Q5S A;  1YNN A;  5FLM K;  1J6W A;  4A3F K;  1J6X A;  1WOO A;  4GTB A;  1O24 A;  3CQZ A;  1AB4 A;  3GTP A;  4A3I K;  1WOP A;  5HL8 A;  5M5X K;  2KWA A;  1SFO K;  4OIN A;  3GTL A;  1WIH A;  1I6H K;  4BBR C;  3GSI A;  2GAG C;  5CHP A;  4LK1 A;  5EGE A;  1PJ6 A;  2YU9 K;  5IP7 K;  4AH6 A;  3GTG K;  4YFX A;  3CAG A;  2YU9 A;  2E2I C;  3N0B A;  1V5V A;  3HKZ L;  4C2M C;  2XCQ A;  5C44 K;  2PA8 L;  1K83 A;  2JA5 A;  4RMF A;  5IP9 C;  4BBS C;  1XZQ B;  2V6S A;  4KM8 A;  4LLG A;  4ZH4 A;  5TMF A;  5FLM C;  1R9T C;  1DCP A;  3AQO A;  4LR2 A;  1TWG A;  3FKI C;  4GTL A;  3GTQ K;  3T01 A;  3S15 K;  4A3I C;  4GT9 A;  4A3G K;  1ZYR A;  4BY7 K;  3H0G K;  5M3F K;  2R7Z A;  1TWC A;  3GTM K;  1YNJ A;  3S1N C;  3GTG C;  3H0G A;  5TJ3 A;  1BS2 A;  5IYC K;  3GTJ K;  1PJ5 A;  1F7V A;  3TFH A;  3HKZ D;  3GTM A;  2PA8 D;  2E2H K;  1WOS A;  3VA7 A;  1YX2 A;  2R93 C;  4NOI A;  1ZQ1 C;  5L46 A;  1TWH K;  4MEX A;  4A3D C;  5IYD K;  3GTK A;  1EH1 A;  1IW7 A;  4KM9 A;  1WQH A;  1Y1W K;  3S16 C;  4A3J K;  1XXA A;  4GTE A;  4A3K K;  1F7U A;  2JA8 C;  1EI6 A;  4GTA A;  2PMZ D;  5C4J K;  5CJ9 A;  1VLO A;  3S1M K;  1O28 A;  1Y1V K;  3GIR A;  1UV7 A;  2NVQ K;  2VUM A;  1TWF K;  4X6A C;  1IBA A;  3HOU C;  2V6T A;  1YCL A;  2NVX C;  4LQY A;  3GTJ C;  3K7A C;  2R92 K;  3V4G A;  3GTO A;  2WAQ D;  4KMD A;  1INN A;  1TWH C;  2A69 A;  5IYD C;  1B4A A;  2PHC B;  5C4X C;  3M4O K;  5JFE A;  1Y1W C;  3S2H K;  4A3J C;  3G4C A;  3S2D K;  2GSO A;  4A3L K;  4A3K C;  3CQZ K;  3HOZ C;  3GTP K;  5IOS A;  4M1X A;  4KC6 A;  1EQR A;  3GTL K;  1O2F B;  4OIO A;  1Y1V C;  1WSV A;  3WOD A;  4C3I K;  1TWF C;  4KN4 A;  3RZO C;  4GTD A;  2BE5 A;  4WJ4 A;  4KB4 A;  4Q4Z A;  2R92 C;  2XCO A;  4LOW A;  1DD5 A;  2V6U A;  2D6F C;  3ADA C;  1TWA C;  4AYB L;  1J6V A;  1K83 K;  2JA6 A;  2JA5 K;  3GDZ A;  5IOT A;  2B63 A;  3IPJ A;  2CFA A;  3HOX C;  2EBB A;  4A3E C;  2GAH C;  3S2H C;  4KB2 A;  4FM9 A;  3FKI A;  4KAW X;  4A3L C;  1TWG K;  4XCH A;  1XPP A;  3CQZ C;  1BJT A;  4A3B K;  3GTP C;  4A3F C;  4GTF A;  1I50 A;  4G7O A;  4LJZ A;  4QJV B;  3GTL C;  2R7Z K;  1TWC K;  2FQT A;  1SFO C;  2ZUF A;  4MEY A;  5C3E K;  4A3C K;  1WQF A;  3FOE A;  2PMZ L;  1I6H C;  4PAB A;  2P8T A;  1KQ4 A;  1C0A A;  4AYB D;  2YU9 C;  2A68 A;  1B4B A;  3S0X A;  3ORE A;  4XLN A;  3BP8 C;  5IP7 C;  3TTG A;  3I4N K;  1GE9 A;  3HOY K;  3RZD K;  2JA7 A;  1JVI A;  4A93 K;  1K83 C;  3GTK K;  2GSN A;  3HOV K;  1JQW A;  3SZY A;  3G4A A;  5C44 C;  2ZUE A;  2NVY A;  4XSX A;  1ZXO A;  3PO3 K;  2WAQ L;  4BY1 K;  1PJ7 A;  1XZQ A;  1O26 A;  3AD8 C;  1JOE A;  4A3B C;  5M5W K;  4G0W A;  4Y52 K;  4C3J K;  2E2J K;  4BXX K;  1O29 A;  4YFK A;  2VUM K;  3GTQ C;  3S15 C;  2NVX A;  2P5M A;  4A3C C;  4A3G C;  4BY7 C; 
#chains in the Genus database with same CATH homology
 1WOS A;  1PJ6 A;  1YX2 A;  3GIR A;  1XZP A;  5L46 A;  3GEH A;  3ADA C;  1VRQ C;  1PJ7 A;  1XZQ A;  3TFJ A;  4PAA A;  4P9S A;  3AD8 C;  1WOR A;  1WSR A;  4PAB A;  1WOO A;  1XZP B;  3AD7 C;  1V5V A;  3A8I A;  3AD9 C;  1WSV A;  1X31 C;  3A8J A;  2GAH C;  1WOP A;  3TFI A;  3GEI A;  1XZQ B;  3GEE A;  3TTG A;  3A8K A;  1VLO A;  1PJ5 A;  3GSI A;  3TFH A;  2GAG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...