3S2HK

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2hK00
2A68A 5C3EC 3HOZC 1I6HK 5IYCC 1R9TC 4BBRC 3HOXC 4A3DC 1Y1VK 3GTQC 2NVTK 5IP9C 3GTJC 3GTGK 3GTPC 3GTOC 4A3BC 3S14C 3HOYK 4A3MK 4Y7NK 3GTKC 3HOWC 2NVYK 5M5XK 4A3FK 3S15K 1TWGC 2E2IK 5FJ8K 2E2JK 2A6EA 2YU9C 3RZOC 4KMUA 4G7OA 4BBSC 4C3HK 1XPPA 4Y52C 5IYDC 3HOUC 2R93C 4YFKA 5M5YK 2O5IA 3EQLA 5C44K 4GZYA 2WB1D 2PA8D 3CQZK 4A3IC 1WCMK 2VUMC 4A3KC 3GTLK 5IYBK 2JA7K 2JA8C 4A3CC 4OINA 3GTMK 3I4MC 1TWAC 2JA6K 4BXXK 1SFOC 3S2DC 4A93K 2Y0SL 2BE5A 4YG2A 5FLMK 5C4JK 3RZOK 3RZDC 3HOZK 5IYCK 1TWFC 3HKZD 4BBRK 4C3IK 3HOXK 4C3JK 4A3DK 4X6AC 3K7AC 4XLPA 4A3BK 3S14K 4QIWD 4G7ZA 3S1RC 4A93C 4A3LC 2PMZL 4AYBL 4MQ9A 3PO3C 3S1NK 3S17C 3S1QC 1TWGK 2R7ZC 3M4OK 4ZH4A 5D4DA 2YU9K 4Q5SA 2PPBA 1YNJA 3S2HC 4BBSK 1TWHK 3HOVC 5IYDK 2R93K 3HOUK 1YNNA 2WAQD 4OIOA 3S1MK 1Y1WC 3M3YC 4BY1C 4OIRA 2B63C 2JA5C 4A3CK 2NVXC 2R92C 5IP7C 1TWAK 3H3VL 3I4NC 4A3EC 5M5WK 1K83K 5C4XC 4OIPA 4XSZA 1HQMA 3RZDK 2E2HC 2NVTC 5C3EK 4QJVA 4C2MK 4MEXA 1R9TK 2CW0A 3GTGC 3GTQK 3K7AK 4KN4A 4MEYA 5IP9K 3GTJK 2NVQC 4Y7NC 3GTPK 3GTOK 4NOIA 2NVYC 3S15C 4A3LK 4BY7C 3GTKK 1I50C 2E2IC 2E2JC 3HOWK 4XSXA 2R7ZK 3PO2C 4JK1A 1I3QC 3HOVK 4A3JC 1TWCC 5M3FK 4Y52K 5C44C 1ZYRA 1IW7A 1WCMC 1I6VA 3H0GC 4YFNA 2WB1L 2PA8L 5M3MK 1Y1WK 4BY1K 4OIQA 3M3YK 4A3IK 2VUMK 2JA5K 4A3KK 4LLGA 3FKIC 4BXXC 2NVXK 2JA8K 5IP7K 2R92K 4XLNA 3I4NK 4A3EK 3I4MK 1SFOK 3S2DK 4A3GC 2Y0SD 5C4XK 5TMCA 4QJVB 1I6HC 4G7HA 2E2HK 1Y1VC 3HKZL 2O5JA 1TWFK 1SMYA 3HOYC 3S16K 4QIWL 3S2HK 4KN7A 4A3MC 2NVQK 4X6AK 3S1NC 4LK1A 4LK0A 2PMZD 3S1RK 4BY7K 4AYBD 4A3FC 3M4OC 1I50K 3PO3K 3PO2K 3S17K 3S1QK 1TWHC 1I3QK 3S16C 4YFXA 4A3JK 4LJZA 1TWCK 3S1MC 5TMFA 2WAQL 1BDFA 2A6HA 3H0GK 4Q4ZA 3CQZC 3GTLC 5IYBC 2JA7C 3WODA 2B63K 3GTMC 3FKIK 3H3VD 2JA6C 1K83C 4A3GK 3DXJA 5C4JC 2A69A 5FLMC
chains in the Genus database with same CATH superfamily
2A68A 5C3EC 3HOZC 1I6HK 1VRQC 5IYCC 3T00A 4BBRC 3MMLB 4P9SA 2NVTK 2V6UA 1YCLA 5IP9C 3GTJC 3GTGK 3GTPC 1BJTA 1XZPA 5CHPA 3CAGA 1O25A 3GTKC 4G0UA 2NVYK 4KAWX 2VUMA 2JA5A 3OREA 3GEHA 5FJ8K 4G7OA 3RZOC 1SFOA 4BBSC 1F7VA 5C44K 1TWFA 2CFAA 3BP8C 3HXAA 4A3IC 5IYBK 2JA8C 4A3CC 2JA6K 4WJ3M 1XZQB 1JQWA 4KDDA 4KARA 4A93K 2BE5A 2Y0SL 1XZPB 4C3JK 4DDQA 4MQ9A 3PO3C 3S17C 2RGRA 1DD5A 1TWGK 3FKIA 1ZBSA 4Q5SA 1TWHK 3HOUK 4BKWA 2CFAB 3S1MK 1ZXOA 4BY1C 2JA5C 5M5WK 1K83K 2JH3A 1ZVUA 2E2IA 4M1XA 3AQPA 4GFQA 3G4CA 4XSZA 2E2HC 4QJVA 3K7AK 3S16C 3S2HC 4A3LK 4GTFA 4Y7NC 2NVQC 3GTOK 4NOIA 3S15C 3GTLA 4KMAA 4C3HC 2GAGC 4BLAA 4GT9A 4GTDA 3A8KA 1IW7A 1WCMC 1Y1WK 4YFNA 3M3YK 2PA8L 1PJ5A 5IOTA 3FKIC 3I4NK 4A3EK 3I4MK 4P5BA 3S2DK 4QJVB 4QIWL 4KN7A 4KMHA 3S1NC 1XXAA 2PMZD 4A3FC 4GTEA 3TFIA 4YFXA 3SZYA 4A3JK 5JFEA 5HL8A 3GTLC 1G51A 3GTJA 3GTPA 3FHZA 3GTMC 3H3VD 1WSVA 2P5MA 3GTKA 4A3GK 5C4JC 2GSNA 4P5AA 1R9TC 4C3IC 3HOXC 3GTQC 4GTBA 3HOYK 1INNA 1YX2A 4A3MK 5CJ9A 1USOA 2NVXA 1GE9A 2E2JK 2A6EA 2YU9C 3G4AA 4Y52C 3Q3QA 3TFHA 3EQLA 4GZYA 4A3KC 1WOPA 1UV7A 4YG2A 5FLMK 3RZOK 2P8TA 1I3QA 3HOZK 5IYCK 4C2MC 3HKZD 4BBRK 1EI6A 1DCOA 4XLPA 3S1RC 4KB4A 3V4GA 1IBAA 5IOSA 3SZZA 4KM9A 1PJ7A 2R7ZC 3GEIA 1YNJA 4BBSK 1X31C 2FQTA 1Y1VA 1BS2A 2E2HA 2PHCB 1EK8A 4OIRA 2B63C 4A3CK 2NVXC 2XCQA 4O2DA 2EBBA 5C4XC 3AQOA 2NVTC 3GTGC 2NVYC 3CQZA 1WCMA 2GSUA 2JA7A 3HOWK 3PO2C 4JK1A 1I3QC 4KASA 3T01A 5C44C 1I6VA 3H0GC 5M3MK 2WB1L 4BY1K 1VLOA 2VUMK 2JA5K 4LLGA 4LR2A 3BUEA 1SFOK 2Y0SD 3N3YA 2E2HK 1Y1VC 3QX3A 2R93A 1TWFK 1EQRA 1SMYA 3S16K 3S2HK 4X6AK 2NVQK 3GDZA 1B4BA 1HI9A 4KATA 1TWAA 3S1QK 3GTMA 2RH6A 1TWHC 3OEPA 3JSTA 3S1MC 4J3NA 2WAQL 1R9TA 3CQZC 3GTQA 3TTGA 2JA7C 3WODA 3FKIK 3FOEA 1K83C 3DXJA 1WOSA 2YU9A 5EGEA 4A3DC 1XXCA 3GTOC 4A3BC 3S14C 1F7UA 1IL2A 1J6XA 5M5XK 4A3FK 1O29A 2R92A 2E2IK 4KMUA 5IYDC 2R93C 1EFWA 4GTLA 5M5YK 5E68A 4LQYA 4RMFA 2PA8D 4KMDA 3GTLK 2ZFZA 3LPXA 4OINA 3GTMK 3I4MC 1TWAC 1V5VA 4BXXK 3S2DC 3ADAC 1ZQ1C 5C4JK 3RZDC 2R7ZA 4C3IK 3HOXK 1TWCA 2FQOA 3N0BA 3VA7A 4WJ4A 4QIWD 1AB4A 1O2FB 3A8JA 4AYBL 2B63A 3M4OK 2XCRB 2YU9K 5D4DA 1XXBA 2ZUEA 3HOVC 3T02A 4OIOA 2KWAA 4FM9A 3GTGA 2V6TA 1F9NA 3BP3A 2R92C 5IP7C 2NVYA 1USMA 1WQFA 1VH2A 3AH5A 5C3EK 4C2MK 4MEXA 2CW0A 4MEYA 3GTPK 1F93A 5IP9K 3GTJK 4BY7C 3H0GA 3NUHA 1I50C 3GTKK 2E2JC 2JA6A 2R7ZK 1O24A 3OPFA 2XCOA 1TWCC 5M3FK 1ZYRA 5IORA 4ILDA 4OIQA 4A3IK 2NVXK 2JA8K 4XLNA 1TWGA 1J98A 3GEEA 5C4XK 1JOEA 1O27A 1I6HC 3IPJA 1TWHA 2O5JA 3AD7C 5TJ3A 3PO3K 3PO2K 3S17K 1I3QK 1K83A 4KB2A 1IS1A 4G0VA 5TMFA 4GTAA 3H0GK 2V6SA 4Q4ZA 5IYBC 3GTOA 2JA6C 1J6VA 1WSRA 1O2AA 2W7VA 1O2BA 4A93C 2A69A 4AH6A 1Y1VK 4C3JC 1KQ4A 3L4KA 1Y1WA 1O28A 4Y7NK 3HOWC 1WQGA 3S15K 1TWGC 3N0CA 5IOQA 5JVOA 1WIHA 3GIRA 4C3HK 1XPPA 3HOUC 4YFKA 2O5IA 1C0AA 2WB1D 3AD8C 3CQZK 1WCMK 2VUMC 1DCPA 2JA7K 1IQ0A 1BGWA 1SFOC 1EH1A 1VGXA 3AD9C 1TWFC 4A3DK 4X6AC 1J6WA 4WILA 3K7AC 4A3BK 3S14K 1WQHA 4G7ZA 4A3LC 2PMZL 3S1NK 3S1QC 1RU0A 3GSIA 2Y3PA 4ZH4A 3A8IA 3S0XA 2PPBA 1ISEA 1JVIA 5IYDK 2R93K 1YNNA 2WAQD 4XCHA 1Y1WC 3M3YC 4FZBA 4PABA 1WORA 3H3VL 3ERED 1VJEA 1TWAK 3I4NC 4A3EC 4PAAA 2GSOA 3FOFA 1I50A 4OIPA 2D6FC 1HQMA 3RZDK 1R9TK 4C45A 3GTQK 4KM8A 1B4AA 4KN4A 1DCHA 2E2IC 1O26A 4XSXA 4LOWA 3HOVK 4A3JC 4Y52K 2GAHC 1L0WA 2ZUFA 3LAPA 3L4JA 4A3KK 4BXXC 1PJ6A 4GTCA 2R92K 5IP7K 5L46A 4G0WA 3TFJA 4A3GC 5TMCA 4G7HA 3HKZL 3HOYC 4A3MC 4LK1A 4LK0A 3S1RK 4BY7K 4AYBD 3M4OC 3LAJA 1I50K 5EGHA 4LJZA 1TWCK 4KC6A 1BDFA 2A6HA 1IE0A 1WOOA 2B63K 4BLBA 1XZQA 5FLMC
chains in the Genus database with same CATH topology
2A68A 5C3EC 3HOZC 1I6HK 5IYCC 1R9TC 4BBRC 3HOXC 4A3DC 1Y1VK 3GTQC 2NVTK 5IP9C 3GTJC 3GTGK 3GTPC 3GTOC 4A3BC 3S14C 3HOYK 4A3MK 4Y7NK 3GTKC 3HOWC 2NVYK 5M5XK 4A3FK 3S15K 1TWGC 2E2IK 5FJ8K 2E2JK 2A6EA 2YU9C 3RZOC 4KMUA 4G7OA 4BBSC 4C3HK 1XPPA 4Y52C 5IYDC 3HOUC 2R93C 4YFKA 5M5YK 2O5IA 3EQLA 5C44K 4GZYA 2WB1D 2PA8D 3CQZK 4A3IC 1WCMK 2VUMC 4A3KC 3GTLK 5IYBK 2JA7K 2JA8C 4A3CC 4OINA 3GTMK 3I4MC 1TWAC 2JA6K 4BXXK 1SFOC 3S2DC 4A93K 2Y0SL 2BE5A 4YG2A 5FLMK 5C4JK 3RZOK 3RZDC 3HOZK 5IYCK 1TWFC 3HKZD 4BBRK 4C3IK 3HOXK 4C3JK 4A3DK 4X6AC 3K7AC 4XLPA 4A3BK 3S14K 4QIWD 4G7ZA 3S1RC 4A93C 4A3LC 2PMZL 4AYBL 4MQ9A 3PO3C 3S1NK 3S17C 3S1QC 1TWGK 2R7ZC 3M4OK 4ZH4A 5D4DA 2YU9K 4Q5SA 2PPBA 1YNJA 3S2HC 4BBSK 1TWHK 3HOVC 5IYDK 2R93K 3HOUK 1YNNA 2WAQD 4OIOA 3S1MK 1Y1WC 3M3YC 4BY1C 4OIRA 2B63C 2JA5C 4A3CK 2NVXC 2R92C 5IP7C 1TWAK 3H3VL 3I4NC 4A3EC 5M5WK 1K83K 5C4XC 4OIPA 4XSZA 1HQMA 3RZDK 2E2HC 2NVTC 5C3EK 4QJVA 4C2MK 4MEXA 1R9TK 2CW0A 3GTGC 3GTQK 3K7AK 4KN4A 4MEYA 5IP9K 3GTJK 2NVQC 4Y7NC 3GTPK 3GTOK 4NOIA 2NVYC 3S15C 4A3LK 4BY7C 3GTKK 1I50C 2E2IC 2E2JC 3HOWK 4XSXA 2R7ZK 3PO2C 4JK1A 1I3QC 3HOVK 4A3JC 1TWCC 5M3FK 4Y52K 5C44C 1ZYRA 1IW7A 1WCMC 1I6VA 3H0GC 4YFNA 2WB1L 2PA8L 5M3MK 1Y1WK 4BY1K 4OIQA 3M3YK 4A3IK 2VUMK 2JA5K 4A3KK 4LLGA 3FKIC 4BXXC 2NVXK 2JA8K 5IP7K 2R92K 4XLNA 3I4NK 4A3EK 3I4MK 1SFOK 3S2DK 4A3GC 2Y0SD 5C4XK 5TMCA 4QJVB 1I6HC 4G7HA 2E2HK 1Y1VC 3HKZL 2O5JA 1TWFK 1SMYA 3HOYC 3S16K 4QIWL 3S2HK 4KN7A 4A3MC 2NVQK 4X6AK 3S1NC 4LK1A 4LK0A 2PMZD 3S1RK 4BY7K 4AYBD 4A3FC 3M4OC 1I50K 3PO3K 3PO2K 3S17K 3S1QK 1TWHC 1I3QK 3S16C 4YFXA 4A3JK 4LJZA 1TWCK 3S1MC 5TMFA 2WAQL 1BDFA 2A6HA 3H0GK 4Q4ZA 3CQZC 3GTLC 5IYBC 2JA7C 3WODA 2B63K 3GTMC 3FKIK 3H3VD 2JA6C 1K83C 4A3GK 3DXJA 5C4JC 2A69A 5FLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 A;  5C3E C;  3HOZ C;  1I6H K;  5IYC C;  1R9T C;  4BBR C;  3HOX C;  4A3D C;  1Y1V K;  3GTQ C;  2NVT K;  5IP9 C;  3GTJ C;  3GTG K;  3GTP C;  3GTO C;  4A3B C;  3S14 C;  3HOY K;  4A3M K;  4Y7N K;  3GTK C;  3HOW C;  2NVY K;  5M5X K;  4A3F K;  3S15 K;  1TWG C;  2E2I K;  5FJ8 K;  2E2J K;  2A6E A;  2YU9 C;  3RZO C;  4KMU A;  4G7O A;  4BBS C;  4C3H K;  1XPP A;  4Y52 C;  5IYD C;  3HOU C;  2R93 C;  4YFK A;  5M5Y K;  2O5I A;  3EQL A;  5C44 K;  4GZY A;  2WB1 D;  2PA8 D;  3CQZ K;  4A3I C;  1WCM K;  2VUM C;  4A3K C;  3GTL K;  5IYB K;  2JA7 K;  2JA8 C;  4A3C C;  4OIN A;  3GTM K;  3I4M C;  1TWA C;  2JA6 K;  4BXX K;  1SFO C;  3S2D C;  4A93 K;  2Y0S L;  2BE5 A;  4YG2 A;  5FLM K;  5C4J K;  3RZO K;  3RZD C;  3HOZ K;  5IYC K;  1TWF C;  3HKZ D;  4BBR K;  4C3I K;  3HOX K;  4C3J K;  4A3D K;  4X6A C;  3K7A C;  4XLP A;  4A3B K;  3S14 K;  4QIW D;  4G7Z A;  3S1R C;  4A93 C;  4A3L C;  2PMZ L;  4AYB L;  4MQ9 A;  3PO3 C;  3S1N K;  3S17 C;  3S1Q C;  1TWG K;  2R7Z C;  3M4O K;  4ZH4 A;  5D4D A;  2YU9 K;  4Q5S A;  2PPB A;  1YNJ A;  3S2H C;  4BBS K;  1TWH K;  3HOV C;  5IYD K;  2R93 K;  3HOU K;  1YNN A;  2WAQ D;  4OIO A;  3S1M K;  1Y1W C;  3M3Y C;  4BY1 C;  4OIR A;  2B63 C;  2JA5 C;  4A3C K;  2NVX C;  2R92 C;  5IP7 C;  1TWA K;  3H3V L;  3I4N C;  4A3E C;  5M5W K;  1K83 K;  5C4X C;  4OIP A;  4XSZ A;  1HQM A;  3RZD K;  2E2H C;  2NVT C;  5C3E K;  4QJV A;  4C2M K;  4MEX A;  1R9T K;  2CW0 A;  3GTG C;  3GTQ K;  3K7A K;  4KN4 A;  4MEY A;  5IP9 K;  3GTJ K;  2NVQ C;  4Y7N C;  3GTP K;  3GTO K;  4NOI A;  2NVY C;  3S15 C;  4A3L K;  4BY7 C;  3GTK K;  1I50 C;  2E2I C;  2E2J C;  3HOW K;  4XSX A;  2R7Z K;  3PO2 C;  4JK1 A;  1I3Q C;  3HOV K;  4A3J C;  1TWC C;  5M3F K;  4Y52 K;  5C44 C;  1ZYR A;  1IW7 A;  1WCM C;  1I6V A;  3H0G C;  4YFN A;  2WB1 L;  2PA8 L;  5M3M K;  1Y1W K;  4BY1 K;  4OIQ A;  3M3Y K;  4A3I K;  2VUM K;  2JA5 K;  4A3K K;  4LLG A;  3FKI C;  4BXX C;  2NVX K;  2JA8 K;  5IP7 K;  2R92 K;  4XLN A;  3I4N K;  4A3E K;  3I4M K;  1SFO K;  3S2D K;  4A3G C;  2Y0S D;  5C4X K;  5TMC A;  4QJV B;  1I6H C;  4G7H A;  2E2H K;  1Y1V C;  3HKZ L;  2O5J A;  1TWF K;  1SMY A;  3HOY C;  3S16 K;  4QIW L;  3S2H K;  4KN7 A;  4A3M C;  2NVQ K;  4X6A K;  3S1N C;  4LK1 A;  4LK0 A;  2PMZ D;  3S1R K;  4BY7 K;  4AYB D;  4A3F C;  3M4O C;  1I50 K;  3PO3 K;  3PO2 K;  3S17 K;  3S1Q K;  1TWH C;  1I3Q K;  3S16 C;  4YFX A;  4A3J K;  4LJZ A;  1TWC K;  3S1M C;  5TMF A;  2WAQ L;  1BDF A;  2A6H A;  3H0G K;  4Q4Z A;  3CQZ C;  3GTL C;  5IYB C;  2JA7 C;  3WOD A;  2B63 K;  3GTM C;  3FKI K;  3H3V D;  2JA6 C;  1K83 C;  4A3G K;  3DXJ A;  5C4J C;  2A69 A;  5FLM C; 
#chains in the Genus database with same CATH topology
 2A68 A;  5C3E C;  3HOZ C;  1I6H K;  1VRQ C;  5IYC C;  3T00 A;  4BBR C;  3MML B;  4P9S A;  2NVT K;  2V6U A;  1YCL A;  5IP9 C;  3GTJ C;  3GTG K;  3GTP C;  1BJT A;  1XZP A;  5CHP A;  3CAG A;  1O25 A;  3GTK C;  4G0U A;  2NVY K;  4KAW X;  2VUM A;  2JA5 A;  3ORE A;  3GEH A;  5FJ8 K;  4G7O A;  3RZO C;  1SFO A;  4BBS C;  1F7V A;  5C44 K;  1TWF A;  2CFA A;  3BP8 C;  3HXA A;  4A3I C;  5IYB K;  2JA8 C;  4A3C C;  2JA6 K;  4WJ3 M;  1XZQ B;  1JQW A;  4KDD A;  4KAR A;  4A93 K;  2BE5 A;  2Y0S L;  1XZP B;  4C3J K;  4DDQ A;  4MQ9 A;  3PO3 C;  3S17 C;  2RGR A;  1DD5 A;  1TWG K;  3FKI A;  1ZBS A;  4Q5S A;  1TWH K;  3HOU K;  4BKW A;  2CFA B;  3S1M K;  1ZXO A;  4BY1 C;  2JA5 C;  5M5W K;  1K83 K;  2JH3 A;  1ZVU A;  2E2I A;  4M1X A;  3AQP A;  4GFQ A;  3G4C A;  4XSZ A;  2E2H C;  4QJV A;  3K7A K;  3S16 C;  3S2H C;  4A3L K;  4GTF A;  4Y7N C;  2NVQ C;  3GTO K;  4NOI A;  3S15 C;  3GTL A;  4KMA A;  4C3H C;  2GAG C;  4BLA A;  4GT9 A;  4GTD A;  3A8K A;  1IW7 A;  1WCM C;  1Y1W K;  4YFN A;  3M3Y K;  2PA8 L;  1PJ5 A;  5IOT A;  3FKI C;  3I4N K;  4A3E K;  3I4M K;  4P5B A;  3S2D K;  4QJV B;  4QIW L;  4KN7 A;  4KMH A;  3S1N C;  1XXA A;  2PMZ D;  4A3F C;  4GTE A;  3TFI A;  4YFX A;  3SZY A;  4A3J K;  5JFE A;  5HL8 A;  3GTL C;  1G51 A;  3GTJ A;  3GTP A;  3FHZ A;  3GTM C;  3H3V D;  1WSV A;  2P5M A;  3GTK A;  4A3G K;  5C4J C;  2GSN A;  4P5A A;  1R9T C;  4C3I C;  3HOX C;  3GTQ C;  4GTB A;  3HOY K;  1INN A;  1YX2 A;  4A3M K;  5CJ9 A;  1USO A;  2NVX A;  1GE9 A;  2E2J K;  2A6E A;  2YU9 C;  3G4A A;  4Y52 C;  3Q3Q A;  3TFH A;  3EQL A;  4GZY A;  4A3K C;  1WOP A;  1UV7 A;  4YG2 A;  5FLM K;  3RZO K;  2P8T A;  1I3Q A;  3HOZ K;  5IYC K;  4C2M C;  3HKZ D;  4BBR K;  1EI6 A;  1DCO A;  4XLP A;  3S1R C;  4KB4 A;  3V4G A;  1IBA A;  5IOS A;  3SZZ A;  4KM9 A;  1PJ7 A;  2R7Z C;  3GEI A;  1YNJ A;  4BBS K;  1X31 C;  2FQT A;  1Y1V A;  1BS2 A;  2E2H A;  2PHC B;  1EK8 A;  4OIR A;  2B63 C;  4A3C K;  2NVX C;  2XCQ A;  4O2D A;  2EBB A;  5C4X C;  3AQO A;  2NVT C;  3GTG C;  2NVY C;  3CQZ A;  1WCM A;  2GSU A;  2JA7 A;  3HOW K;  3PO2 C;  4JK1 A;  1I3Q C;  4KAS A;  3T01 A;  5C44 C;  1I6V A;  3H0G C;  5M3M K;  2WB1 L;  4BY1 K;  1VLO A;  2VUM K;  2JA5 K;  4LLG A;  4LR2 A;  3BUE A;  1SFO K;  2Y0S D;  3N3Y A;  2E2H K;  1Y1V C;  3QX3 A;  2R93 A;  1TWF K;  1EQR A;  1SMY A;  3S16 K;  3S2H K;  4X6A K;  2NVQ K;  3GDZ A;  1B4B A;  1HI9 A;  4KAT A;  1TWA A;  3S1Q K;  3GTM A;  2RH6 A;  1TWH C;  3OEP A;  3JST A;  3S1M C;  4J3N A;  2WAQ L;  1R9T A;  3CQZ C;  3GTQ A;  3TTG A;  2JA7 C;  3WOD A;  3FKI K;  3FOE A;  1K83 C;  3DXJ A;  1WOS A;  2YU9 A;  5EGE A;  4A3D C;  1XXC A;  3GTO C;  4A3B C;  3S14 C;  1F7U A;  1IL2 A;  1J6X A;  5M5X K;  4A3F K;  1O29 A;  2R92 A;  2E2I K;  4KMU A;  5IYD C;  2R93 C;  1EFW A;  4GTL A;  5M5Y K;  5E68 A;  4LQY A;  4RMF A;  2PA8 D;  4KMD A;  3GTL K;  2ZFZ A;  3LPX A;  4OIN A;  3GTM K;  3I4M C;  1TWA C;  1V5V A;  4BXX K;  3S2D C;  3ADA C;  1ZQ1 C;  5C4J K;  3RZD C;  2R7Z A;  4C3I K;  3HOX K;  1TWC A;  2FQO A;  3N0B A;  3VA7 A;  4WJ4 A;  4QIW D;  1AB4 A;  1O2F B;  3A8J A;  4AYB L;  2B63 A;  3M4O K;  2XCR B;  2YU9 K;  5D4D A;  1XXB A;  2ZUE A;  3HOV C;  3T02 A;  4OIO A;  2KWA A;  4FM9 A;  3GTG A;  2V6T A;  1F9N A;  3BP3 A;  2R92 C;  5IP7 C;  2NVY A;  1USM A;  1WQF A;  1VH2 A;  3AH5 A;  5C3E K;  4C2M K;  4MEX A;  2CW0 A;  4MEY A;  3GTP K;  1F93 A;  5IP9 K;  3GTJ K;  4BY7 C;  3H0G A;  3NUH A;  1I50 C;  3GTK K;  2E2J C;  2JA6 A;  2R7Z K;  1O24 A;  3OPF A;  2XCO A;  1TWC C;  5M3F K;  1ZYR A;  5IOR A;  4ILD A;  4OIQ A;  4A3I K;  2NVX K;  2JA8 K;  4XLN A;  1TWG A;  1J98 A;  3GEE A;  5C4X K;  1JOE A;  1O27 A;  1I6H C;  3IPJ A;  1TWH A;  2O5J A;  3AD7 C;  5TJ3 A;  3PO3 K;  3PO2 K;  3S17 K;  1I3Q K;  1K83 A;  4KB2 A;  1IS1 A;  4G0V A;  5TMF A;  4GTA A;  3H0G K;  2V6S A;  4Q4Z A;  5IYB C;  3GTO A;  2JA6 C;  1J6V A;  1WSR A;  1O2A A;  2W7V A;  1O2B A;  4A93 C;  2A69 A;  4AH6 A;  1Y1V K;  4C3J C;  1KQ4 A;  3L4K A;  1Y1W A;  1O28 A;  4Y7N K;  3HOW C;  1WQG A;  3S15 K;  1TWG C;  3N0C A;  5IOQ A;  5JVO A;  1WIH A;  3GIR A;  4C3H K;  1XPP A;  3HOU C;  4YFK A;  2O5I A;  1C0A A;  2WB1 D;  3AD8 C;  3CQZ K;  1WCM K;  2VUM C;  1DCP A;  2JA7 K;  1IQ0 A;  1BGW A;  1SFO C;  1EH1 A;  1VGX A;  3AD9 C;  1TWF C;  4A3D K;  4X6A C;  1J6W A;  4WIL A;  3K7A C;  4A3B K;  3S14 K;  1WQH A;  4G7Z A;  4A3L C;  2PMZ L;  3S1N K;  3S1Q C;  1RU0 A;  3GSI A;  2Y3P A;  4ZH4 A;  3A8I A;  3S0X A;  2PPB A;  1ISE A;  1JVI A;  5IYD K;  2R93 K;  1YNN A;  2WAQ D;  4XCH A;  1Y1W C;  3M3Y C;  4FZB A;  4PAB A;  1WOR A;  3H3V L;  3ERE D;  1VJE A;  1TWA K;  3I4N C;  4A3E C;  4PAA A;  2GSO A;  3FOF A;  1I50 A;  4OIP A;  2D6F C;  1HQM A;  3RZD K;  1R9T K;  4C45 A;  3GTQ K;  4KM8 A;  1B4A A;  4KN4 A;  1DCH A;  2E2I C;  1O26 A;  4XSX A;  4LOW A;  3HOV K;  4A3J C;  4Y52 K;  2GAH C;  1L0W A;  2ZUF A;  3LAP A;  3L4J A;  4A3K K;  4BXX C;  1PJ6 A;  4GTC A;  2R92 K;  5IP7 K;  5L46 A;  4G0W A;  3TFJ A;  4A3G C;  5TMC A;  4G7H A;  3HKZ L;  3HOY C;  4A3M C;  4LK1 A;  4LK0 A;  3S1R K;  4BY7 K;  4AYB D;  3M4O C;  3LAJ A;  1I50 K;  5EGH A;  4LJZ A;  1TWC K;  4KC6 A;  1BDF A;  2A6H A;  1IE0 A;  1WOO A;  2B63 K;  4BLB A;  1XZQ A;  5FLM C; 
#chains in the Genus database with same CATH homology
 2A68 A;  5C3E C;  3HOZ C;  1I6H K;  5IYC C;  1R9T C;  4BBR C;  3HOX C;  4A3D C;  1Y1V K;  3GTQ C;  2NVT K;  5IP9 C;  3GTJ C;  3GTG K;  3GTP C;  3GTO C;  4A3B C;  3S14 C;  3HOY K;  4A3M K;  4Y7N K;  3GTK C;  3HOW C;  2NVY K;  5M5X K;  4A3F K;  3S15 K;  1TWG C;  2E2I K;  5FJ8 K;  2E2J K;  2A6E A;  2YU9 C;  3RZO C;  4KMU A;  4G7O A;  4BBS C;  4C3H K;  1XPP A;  4Y52 C;  5IYD C;  3HOU C;  2R93 C;  4YFK A;  5M5Y K;  2O5I A;  3EQL A;  5C44 K;  4GZY A;  2WB1 D;  2PA8 D;  3CQZ K;  4A3I C;  1WCM K;  2VUM C;  4A3K C;  3GTL K;  5IYB K;  2JA7 K;  2JA8 C;  4A3C C;  4OIN A;  3GTM K;  3I4M C;  1TWA C;  2JA6 K;  4BXX K;  1SFO C;  3S2D C;  4A93 K;  2Y0S L;  2BE5 A;  4YG2 A;  5FLM K;  5C4J K;  3RZO K;  3RZD C;  3HOZ K;  5IYC K;  1TWF C;  3HKZ D;  4BBR K;  4C3I K;  3HOX K;  4C3J K;  4A3D K;  4X6A C;  3K7A C;  4XLP A;  4A3B K;  3S14 K;  4QIW D;  4G7Z A;  3S1R C;  4A93 C;  4A3L C;  2PMZ L;  4AYB L;  4MQ9 A;  3PO3 C;  3S1N K;  3S17 C;  3S1Q C;  1TWG K;  2R7Z C;  3M4O K;  4ZH4 A;  5D4D A;  2YU9 K;  4Q5S A;  2PPB A;  1YNJ A;  3S2H C;  4BBS K;  1TWH K;  3HOV C;  5IYD K;  2R93 K;  3HOU K;  1YNN A;  2WAQ D;  4OIO A;  3S1M K;  1Y1W C;  3M3Y C;  4BY1 C;  4OIR A;  2B63 C;  2JA5 C;  4A3C K;  2NVX C;  2R92 C;  5IP7 C;  1TWA K;  3H3V L;  3I4N C;  4A3E C;  5M5W K;  1K83 K;  5C4X C;  4OIP A;  4XSZ A;  1HQM A;  3RZD K;  2E2H C;  2NVT C;  5C3E K;  4QJV A;  4C2M K;  4MEX A;  1R9T K;  2CW0 A;  3GTG C;  3GTQ K;  3K7A K;  4KN4 A;  4MEY A;  5IP9 K;  3GTJ K;  2NVQ C;  4Y7N C;  3GTP K;  3GTO K;  4NOI A;  2NVY C;  3S15 C;  4A3L K;  4BY7 C;  3GTK K;  1I50 C;  2E2I C;  2E2J C;  3HOW K;  4XSX A;  2R7Z K;  3PO2 C;  4JK1 A;  1I3Q C;  3HOV K;  4A3J C;  1TWC C;  5M3F K;  4Y52 K;  5C44 C;  1ZYR A;  1IW7 A;  1WCM C;  1I6V A;  3H0G C;  4YFN A;  2WB1 L;  2PA8 L;  5M3M K;  1Y1W K;  4BY1 K;  4OIQ A;  3M3Y K;  4A3I K;  2VUM K;  2JA5 K;  4A3K K;  4LLG A;  3FKI C;  4BXX C;  2NVX K;  2JA8 K;  5IP7 K;  2R92 K;  4XLN A;  3I4N K;  4A3E K;  3I4M K;  1SFO K;  3S2D K;  4A3G C;  2Y0S D;  5C4X K;  5TMC A;  4QJV B;  1I6H C;  4G7H A;  2E2H K;  1Y1V C;  3HKZ L;  2O5J A;  1TWF K;  1SMY A;  3HOY C;  3S16 K;  4QIW L;  3S2H K;  4KN7 A;  4A3M C;  2NVQ K;  4X6A K;  3S1N C;  4LK1 A;  4LK0 A;  2PMZ D;  3S1R K;  4BY7 K;  4AYB D;  4A3F C;  3M4O C;  1I50 K;  3PO3 K;  3PO2 K;  3S17 K;  3S1Q K;  1TWH C;  1I3Q K;  3S16 C;  4YFX A;  4A3J K;  4LJZ A;  1TWC K;  3S1M C;  5TMF A;  2WAQ L;  1BDF A;  2A6H A;  3H0G K;  4Q4Z A;  3CQZ C;  3GTL C;  5IYB C;  2JA7 C;  3WOD A;  2B63 K;  3GTM C;  3FKI K;  3H3V D;  2JA6 C;  1K83 C;  4A3G K;  3DXJ A;  5C4J C;  2A69 A;  5FLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...