3S2HK

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2hK00
2B63K 2PMZD 3H3VL 4OIQA 3I4NK 3H0GC 4X6AC 3S17C 2NVTC 1YNJA 3S14C 4YFKA 3CQZK 3K7AK 3HOVC 4QJVB 3RZOK 3M4OK 1TWGK 5IYDC 3GTOC 4A3LK 5C4XC 4BBRK 3I4MC 4LK1A 3S1NC 5M5XK 3GTPC 3S1MC 1WCMC 4C3JK 1IW7A 3GTMK 1TWCK 3RZDC 5FLMK 1ZYRA 4OIRA 1Y1WC 4A3GC 1K83K 3GTGK 5IYCC 3S2HC 4LLGA 2A6HA 3GTQK 2PPBA 4OINA 2NVQK 4G7OA 5IP7K 3S15C 1TWAK 4C3HK 3M3YC 2NVXK 3H3VD 4Q5SA 5C3EC 4A3BK 2BE5A 4A3DK 2A69A 1R9TK 3GTJC 2R7ZC 4A3EK 4YG2A 4AYBL 4YFXA 4A3IK 4A3CC 4BBSK 4A3FK 2JA5C 2WAQL 1SMYA 3CQZC 1TWHK 3S1RK 3PO3C 2E2HK 3M4OC 3HOXK 4KN4A 3HOWC 1I3QC 1TWGC 2JA7C 2NVYK 1TWFC 4A3KK 4A3LC 4BBRC 4BY1K 2WB1L 2JA6K 2E2IK 2YU9K 3S2DK 2R93C 3GTMC 1Y1VC 5D4DA 5M3FK 4Y7NC 3FKIC 5TMFA 4A3MK 1I6HK 2PA8L 4XSXA 3GTQC 5C44K 2NVQC 4A93K 4OIOA 4BY7C 1BDFA 4YFNA 1SFOK 2E2JC 4XLNA 1I50K 4A3BC 2JA8C 4AYBD 2R92K 4C2MK 4KMUA 4JK1A 4BXXK 2VUMK 2WAQD 3DXJA 4A3JK 2B63C 5C4JK 3PO2K 4Y52K 3I4NC 4OIPA 5IP9K 2WB1D 3S17K 4A3KC 4XLPA 3K7AC 3RZOC 4G7ZA 3S14K 3HOYK 4MEYA 3HOVK 4KN7A 2Y0SL 3HOZK 3S1QK 5IYDK 4G7HA 5C4XK 3I4MK 1TWCC 3WODA 3S16K 5FLMC 3S1MK 1WCMK 4LK0A 1K83C 3GTGC 1XPPA 3RZDK 3GTLK 1I50C 1Y1WK 4A3GK 2A68A 5IYCK 1YNNA 5IP7C 4MEXA 3S2HK 1TWAC 3S1QC 2NVXC 4A3JC 3M3YK 4A3DC 4MQ9A 1R9TC 5TMCA 5IP9C 5C3EK 1I6VA 5IYBK 4A3EC 4LJZA 3GTKK 4A3IC 3HOUK 4BBSC 2O5JA 4A3FC 3GTJK 2R7ZK 2CW0A 1TWHC 3S1RC 4QIWL 2Y0SD 2E2HC 4A3CK 3HKZL 3HOXC 2JA5K 3HOYC 3PO3K 3H0GK 2NVYC 4Q4ZA 4X6AK 2NVTK 2PMZL 3EQLA 4BY1C 3HOWK 1I3QK 4C3IK 2JA6C 2E2IC 2JA7K 2YU9C 3HOZC 1TWFK 5M5YK 3S2DC 2O5IA 3S16C 4A3MC 1I6HC 2PA8D 5M5WK 2R93K 4QJVA 4ZH4A 1Y1VK 3GTLC 4Y7NK 3FKIK 3GTOK 4GZYA 5C44C 1HQMA 3S1NK 3GTPK 5M3MK 4A93C 1SFOC 2A6EA 4BY7K 2E2JK 2R92C 4NOIA 4BXXC 2VUMC 5IYBC 5FJ8K 2JA8K 3GTKC 3HOUC 4QIWD 3S15K 3HKZD 5C4JC 3PO2C 4Y52C 4XSZA
chains in the Genus database with same CATH superfamily
2B63K 2KWAA 3H3VL 3GTPA 3I4NK 2NVTC 4C3IC 1INNA 3BUEA 5IYDC 4A3LK 4BBRK 2B63A 4C3JK 1IW7A 3GTMK 3RZDC 5IOQA 3T02A 1Y1WC 1K83K 3GTGK 5IYCC 4LLGA 5TJ3A 2A6HA 3GTQK 4G7OA 5IP7K 5HL8A 1TWAK 1I3QA 2NVXK 4G0WA 1G51A 2A69A 1JQWA 1R9TK 1WOPA 3GTJC 3GTMA 4A3EK 4AYBL 1WOOA 1K83A 4C45A 3GTGA 4O2DA 1J6XA 4ILDA 1WQFA 3M4OC 3GTQA 1TWGC 1TWAA 4G0VA 2RGRA 1R9TA 1L0WA 1BS2A 2GAHC 1IL2A 3BP3A 5C44K 3FHZA 1ZVUA 1HI9A 2E2JC 4A3BC 2JA8C 4C2MK 3GEIA 4JK1A 2WAQD 2XCRB 4AH6A 3L4KA 1TWCA 1EFWA 3K7AC 1J6VA 4KN7A 3S1QK 4LOWA 5IYDK 3RZDK 1Y1WK 4GTCA 2A68A 5IYCK 4C3HC 3N0CA 2JA6A 2E2IA 3LAPA 1I6VA 2GSNA 4GTAA 3SZYA 2ZUEA 2O5JA 4A3FC 3GTJK 2E2HC 1Y1WA 3HKZL 3HOXC 1O26A 2NVYC 3EQLA 3HOZC 5JFEA 2YU9C 3S2DC 2O5IA 4A3MC 1I6HC 1WIHA 2D6FC 4XCHA 1J98A 3IPJA 1HQMA 4A93C 1SFOC 4BLBA 2E2JK 2R92C 4NOIA 2JA8K 4KASA 5EGEA 4Y52C 3ERED 4XSZA 3G4AA 3A8JA 2FQOA 2PMZD 4GTFA 3H0GC 2P5MA 5IORA 1YNJA 3GIRA 4WILA 3K7AK 3SZZA 4GTLA 3GTOC 5C4XC 3I4MC 3GSIA 4LK1A 5M5XK 4KB4A 5CHPA 4A3GC 1VJEA 3S15C 4C3HK 3M3YC 1GE9A 3AQPA 5C3EC 1YCLA 4KM9A 1O28A 4YG2A 4YFXA 1DCHA 4A3FK 3AD7C 1SMYA 3CQZC 4PAAA 2E2HK 3HOXK 4WJ3M 1JOEA 3HOWC 2JA7C 2NVYK 1TWFC 2WB1L 4KMDA 2YU9K 3S2DK 2R93C 5M3FK 3FKIC 4A3MK 1I6HK 1F93A 2NVQC 4A93K 1BDFA 1SFOK 2NVYA 1ISEA 2R92K 3DXJA 4A3JK 3AD9C 4Y52K 1XZQA 1PJ7A 4KAWX 5IP9K 1O29A 2CFAA 1O27A 4FZBA 4A3KC 1O24A 4G7ZA 1O2BA 1XXCA 3HOYK 4KC6A 1C0AA 2NVXA 4G7HA 1USMA 5C4XK 3I4MK 1WQGA 2V6SA 3WODA 3FOFA 5FLMC 4M1XA 1I50C 4A3GK 3GEHA 1YNNA 3TFJA 4MEXA 1KQ4A 2V6TA 1XZQB 3M3YK 4DDQA 1EH1A 3Q3QA 5C3EK 5IYBK 3GTKK 1XZPA 2CFAB 3HOUK 4BBSC 2W7VA 2CW0A 2Y0SD 1VGXA 1WOSA 2V6UA 3T00A 2NVTK 3OPFA 4C3IK 3HOWK 4PABA 2JA7K 1TWFK 5CJ9A 3S16C 4FM9A 3GTKA 2R93K 4KMHA 3TTGA 3GTLC 3FKIK 4KATA 4KMAA 5IOSA 1J6WA 1XZPB 5FJ8K 4QIWD 2R93A 3TFHA 1VRQC 4P5AA 3G4CA 4P9SA 3FKIA 1DCPA 4OIQA 4BKWA 4X6AC 4GTBA 1EK8A 3S14C 3M4OK 3MMLB 3BP8C 1TWGK 3S1NC 3GTPC 3S1MC 1IBAA 3GTJA 5FLMK 1ZYRA 4KARA 2PPBA 4OINA 1IE0A 1O25A 1TWGA 3H3VD 4A3BK 1XXAA 4GTEA 4BBSK 2WAQL 2XCQA 4KN4A 1I3QC 1PJ6A 1EQRA 4A3LC 4BBRC 1F7VA 4C3JC 3GTMC 4Y7NC 5TMFA 4RMFA 3GTQC 1X31C 4XSXA 3NUHA 4OIOA 3HXAA 1O2FB 4XLNA 4AYBD 2ZUFA 1YX2A 2EBBA 2ZFZA 1B4AA 3AQOA 3N0BA 1USOA 3T01A 1WSRA 3A8IA 2FQTA 3RZOC 3ADAC 3S14K 2Y3PA 3HOZK 1PJ5A 1TWCC 4LR2A 5IOTA 3S1MK 3JSTA 3FOEA 1XPPA 2E2HA 3OEPA 4J3NA 1WQHA 4KDDA 4A3DC 2YU9A 4MQ9A 1IS1A 4BLAA 5TMCA 3TFIA 4A3IC 3S1RC 1TWHC 1EI6A 2JH3A 3H0GK 1SFOA 1ZBSA 2PMZL 4BY1C 3S1QC 1I3QK 2JA6C 2E2IC 1XXBA 2R92A 2PA8D 2PHCB 5M5WK 4QJVA 1WSVA 4Y7NK 3GTOK 3LAJA 1V5VA 5M3MK 1AB4A 2A6EA 3H0GA 4BXXC 2VUMC 5EGHA 3S15K 3HKZD 3AH5A 5C4JC 3PO2C 3GTOA 1DD5A 1WORA 3S17C 5E68A 4YFKA 3CQZK 3HOVC 1F9NA 3OREA 4QJVB 3VA7A 3RZOK 1WCMC 4WJ4A 1IQ0A 1TWCK 4OIRA 3S2HC 3A8KA 3CQZA 4GT9A 4LQYA 2NVQK 3GDZA 2JA7A 1TWFA 3CAGA 4GTDA 2BE5A 3GEEA 4A3DK 1BGWA 2R7ZC 4A3IK 1F7UA 4A3CC 4G0UA 2JA5C 3S1RK 1TWHK 3PO3C 2P8TA 2GSUA 1RU0A 2XCOA 3L4JA 4A3KK 4BY1K 2JA6K 2E2IK 1Y1VC 5D4DA 2RH6A 2PA8L 1TWHA 4BY7C 4YFNA 1I50K 1VH2A 4KMUA 2GAGC 1BJTA 2VUMK 1VLOA 4BXXK 3LPXA 2B63C 5C4JK 3PO2K 3I4NC 4OIPA 1JVIA 3V4GA 2WB1D 4GFQA 3S17K 4XLPA 3QX3A 1I50A 1UV7A 4MEYA 3HOVK 2VUMA 2Y0SL 2GSOA 1ZXOA 5JVOA 3S16K 1WCMK 4LK0A 1K83C 3GTGC 1B4BA 3GTLK 4KM8A 5IP7C 3S2HK 1TWAC 1ZQ1C 2NVXC 4A3JC 1R9TC 3S0XA 5IP9C 3N3YA 4A3EC 4LJZA 1WCMA 2R7ZK 3GTLA 4QIWL 4A3CK 2JA5K 3HOYC 1DCOA 3PO3K 4Q4ZA 4X6AK 4Q5SA 5M5YK 4P5BA 5L46A 4ZH4A 3AD8C 1Y1VK 2R7ZA 4GZYA 5C44C 3S1NK 3GTPK 2JA5A 4BY7K 4C2MC 5IYBC 3GTKC 3HOUC 1O2AA 1Y1VA 4KB2A
chains in the Genus database with same CATH topology
2B63K 2PMZD 3H3VL 4OIQA 3I4NK 3H0GC 4X6AC 3S17C 2NVTC 1YNJA 3S14C 4YFKA 3CQZK 3K7AK 3HOVC 4QJVB 3RZOK 3M4OK 1TWGK 5IYDC 3GTOC 4A3LK 5C4XC 4BBRK 3I4MC 4LK1A 3S1NC 5M5XK 3GTPC 3S1MC 1WCMC 4C3JK 1IW7A 3GTMK 1TWCK 3RZDC 5FLMK 1ZYRA 4OIRA 1Y1WC 4A3GC 1K83K 3GTGK 5IYCC 3S2HC 4LLGA 2A6HA 3GTQK 2PPBA 4OINA 2NVQK 4G7OA 5IP7K 3S15C 1TWAK 4C3HK 3M3YC 2NVXK 3H3VD 4Q5SA 5C3EC 4A3BK 2BE5A 4A3DK 2A69A 1R9TK 3GTJC 2R7ZC 4A3EK 4YG2A 4AYBL 4YFXA 4A3IK 4A3CC 4BBSK 4A3FK 2JA5C 2WAQL 1SMYA 3CQZC 1TWHK 3S1RK 3PO3C 2E2HK 3M4OC 3HOXK 4KN4A 3HOWC 1I3QC 1TWGC 2JA7C 2NVYK 1TWFC 4A3KK 4A3LC 4BBRC 4BY1K 2WB1L 2JA6K 2E2IK 2YU9K 3S2DK 2R93C 3GTMC 1Y1VC 5D4DA 5M3FK 4Y7NC 3FKIC 5TMFA 4A3MK 1I6HK 2PA8L 4XSXA 3GTQC 5C44K 2NVQC 4A93K 4OIOA 4BY7C 1BDFA 4YFNA 1SFOK 2E2JC 4XLNA 1I50K 4A3BC 2JA8C 4AYBD 2R92K 4C2MK 4KMUA 4JK1A 4BXXK 2VUMK 2WAQD 3DXJA 4A3JK 2B63C 5C4JK 3PO2K 4Y52K 3I4NC 4OIPA 5IP9K 2WB1D 3S17K 4A3KC 4XLPA 3K7AC 3RZOC 4G7ZA 3S14K 3HOYK 4MEYA 3HOVK 4KN7A 2Y0SL 3HOZK 3S1QK 5IYDK 4G7HA 5C4XK 3I4MK 1TWCC 3WODA 3S16K 5FLMC 3S1MK 1WCMK 4LK0A 1K83C 3GTGC 1XPPA 3RZDK 3GTLK 1I50C 1Y1WK 4A3GK 2A68A 5IYCK 1YNNA 5IP7C 4MEXA 3S2HK 1TWAC 3S1QC 2NVXC 4A3JC 3M3YK 4A3DC 4MQ9A 1R9TC 5TMCA 5IP9C 5C3EK 1I6VA 5IYBK 4A3EC 4LJZA 3GTKK 4A3IC 3HOUK 4BBSC 2O5JA 4A3FC 3GTJK 2R7ZK 2CW0A 1TWHC 3S1RC 4QIWL 2Y0SD 2E2HC 4A3CK 3HKZL 3HOXC 2JA5K 3HOYC 3PO3K 3H0GK 2NVYC 4Q4ZA 4X6AK 2NVTK 2PMZL 3EQLA 4BY1C 3HOWK 1I3QK 4C3IK 2JA6C 2E2IC 2JA7K 2YU9C 3HOZC 1TWFK 5M5YK 3S2DC 2O5IA 3S16C 4A3MC 1I6HC 2PA8D 5M5WK 2R93K 4QJVA 4ZH4A 1Y1VK 3GTLC 4Y7NK 3FKIK 3GTOK 4GZYA 5C44C 1HQMA 3S1NK 3GTPK 5M3MK 4A93C 1SFOC 2A6EA 4BY7K 2E2JK 2R92C 4NOIA 4BXXC 2VUMC 5IYBC 5FJ8K 2JA8K 3GTKC 3HOUC 4QIWD 3S15K 3HKZD 5C4JC 3PO2C 4Y52C 4XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 K;  2PMZ D;  3H3V L;  4OIQ A;  3I4N K;  3H0G C;  4X6A C;  3S17 C;  2NVT C;  1YNJ A;  3S14 C;  4YFK A;  3CQZ K;  3K7A K;  3HOV C;  4QJV B;  3RZO K;  3M4O K;  1TWG K;  5IYD C;  3GTO C;  4A3L K;  5C4X C;  4BBR K;  3I4M C;  4LK1 A;  3S1N C;  5M5X K;  3GTP C;  3S1M C;  1WCM C;  4C3J K;  1IW7 A;  3GTM K;  1TWC K;  3RZD C;  5FLM K;  1ZYR A;  4OIR A;  1Y1W C;  4A3G C;  1K83 K;  3GTG K;  5IYC C;  3S2H C;  4LLG A;  2A6H A;  3GTQ K;  2PPB A;  4OIN A;  2NVQ K;  4G7O A;  5IP7 K;  3S15 C;  1TWA K;  4C3H K;  3M3Y C;  2NVX K;  3H3V D;  4Q5S A;  5C3E C;  4A3B K;  2BE5 A;  4A3D K;  2A69 A;  1R9T K;  3GTJ C;  2R7Z C;  4A3E K;  4YG2 A;  4AYB L;  4YFX A;  4A3I K;  4A3C C;  4BBS K;  4A3F K;  2JA5 C;  2WAQ L;  1SMY A;  3CQZ C;  1TWH K;  3S1R K;  3PO3 C;  2E2H K;  3M4O C;  3HOX K;  4KN4 A;  3HOW C;  1I3Q C;  1TWG C;  2JA7 C;  2NVY K;  1TWF C;  4A3K K;  4A3L C;  4BBR C;  4BY1 K;  2WB1 L;  2JA6 K;  2E2I K;  2YU9 K;  3S2D K;  2R93 C;  3GTM C;  1Y1V C;  5D4D A;  5M3F K;  4Y7N C;  3FKI C;  5TMF A;  4A3M K;  1I6H K;  2PA8 L;  4XSX A;  3GTQ C;  5C44 K;  2NVQ C;  4A93 K;  4OIO A;  4BY7 C;  1BDF A;  4YFN A;  1SFO K;  2E2J C;  4XLN A;  1I50 K;  4A3B C;  2JA8 C;  4AYB D;  2R92 K;  4C2M K;  4KMU A;  4JK1 A;  4BXX K;  2VUM K;  2WAQ D;  3DXJ A;  4A3J K;  2B63 C;  5C4J K;  3PO2 K;  4Y52 K;  3I4N C;  4OIP A;  5IP9 K;  2WB1 D;  3S17 K;  4A3K C;  4XLP A;  3K7A C;  3RZO C;  4G7Z A;  3S14 K;  3HOY K;  4MEY A;  3HOV K;  4KN7 A;  2Y0S L;  3HOZ K;  3S1Q K;  5IYD K;  4G7H A;  5C4X K;  3I4M K;  1TWC C;  3WOD A;  3S16 K;  5FLM C;  3S1M K;  1WCM K;  4LK0 A;  1K83 C;  3GTG C;  1XPP A;  3RZD K;  3GTL K;  1I50 C;  1Y1W K;  4A3G K;  2A68 A;  5IYC K;  1YNN A;  5IP7 C;  4MEX A;  3S2H K;  1TWA C;  3S1Q C;  2NVX C;  4A3J C;  3M3Y K;  4A3D C;  4MQ9 A;  1R9T C;  5TMC A;  5IP9 C;  5C3E K;  1I6V A;  5IYB K;  4A3E C;  4LJZ A;  3GTK K;  4A3I C;  3HOU K;  4BBS C;  2O5J A;  4A3F C;  3GTJ K;  2R7Z K;  2CW0 A;  1TWH C;  3S1R C;  4QIW L;  2Y0S D;  2E2H C;  4A3C K;  3HKZ L;  3HOX C;  2JA5 K;  3HOY C;  3PO3 K;  3H0G K;  2NVY C;  4Q4Z A;  4X6A K;  2NVT K;  2PMZ L;  3EQL A;  4BY1 C;  3HOW K;  1I3Q K;  4C3I K;  2JA6 C;  2E2I C;  2JA7 K;  2YU9 C;  3HOZ C;  1TWF K;  5M5Y K;  3S2D C;  2O5I A;  3S16 C;  4A3M C;  1I6H C;  2PA8 D;  5M5W K;  2R93 K;  4QJV A;  4ZH4 A;  1Y1V K;  3GTL C;  4Y7N K;  3FKI K;  3GTO K;  4GZY A;  5C44 C;  1HQM A;  3S1N K;  3GTP K;  5M3M K;  4A93 C;  1SFO C;  2A6E A;  4BY7 K;  2E2J K;  2R92 C;  4NOI A;  4BXX C;  2VUM C;  5IYB C;  5FJ8 K;  2JA8 K;  3GTK C;  3HOU C;  4QIW D;  3S15 K;  3HKZ D;  5C4J C;  3PO2 C;  4Y52 C;  4XSZ A; 
#chains in the Genus database with same CATH topology
 2B63 K;  2KWA A;  3H3V L;  3GTP A;  3I4N K;  2NVT C;  4C3I C;  1INN A;  3BUE A;  5IYD C;  4A3L K;  4BBR K;  2B63 A;  4C3J K;  1IW7 A;  3GTM K;  3RZD C;  5IOQ A;  3T02 A;  1Y1W C;  1K83 K;  3GTG K;  5IYC C;  4LLG A;  5TJ3 A;  2A6H A;  3GTQ K;  4G7O A;  5IP7 K;  5HL8 A;  1TWA K;  1I3Q A;  2NVX K;  4G0W A;  1G51 A;  2A69 A;  1JQW A;  1R9T K;  1WOP A;  3GTJ C;  3GTM A;  4A3E K;  4AYB L;  1WOO A;  1K83 A;  4C45 A;  3GTG A;  4O2D A;  1J6X A;  4ILD A;  1WQF A;  3M4O C;  3GTQ A;  1TWG C;  1TWA A;  4G0V A;  2RGR A;  1R9T A;  1L0W A;  1BS2 A;  2GAH C;  1IL2 A;  3BP3 A;  5C44 K;  3FHZ A;  1ZVU A;  1HI9 A;  2E2J C;  4A3B C;  2JA8 C;  4C2M K;  3GEI A;  4JK1 A;  2WAQ D;  2XCR B;  4AH6 A;  3L4K A;  1TWC A;  1EFW A;  3K7A C;  1J6V A;  4KN7 A;  3S1Q K;  4LOW A;  5IYD K;  3RZD K;  1Y1W K;  4GTC A;  2A68 A;  5IYC K;  4C3H C;  3N0C A;  2JA6 A;  2E2I A;  3LAP A;  1I6V A;  2GSN A;  4GTA A;  3SZY A;  2ZUE A;  2O5J A;  4A3F C;  3GTJ K;  2E2H C;  1Y1W A;  3HKZ L;  3HOX C;  1O26 A;  2NVY C;  3EQL A;  3HOZ C;  5JFE A;  2YU9 C;  3S2D C;  2O5I A;  4A3M C;  1I6H C;  1WIH A;  2D6F C;  4XCH A;  1J98 A;  3IPJ A;  1HQM A;  4A93 C;  1SFO C;  4BLB A;  2E2J K;  2R92 C;  4NOI A;  2JA8 K;  4KAS A;  5EGE A;  4Y52 C;  3ERE D;  4XSZ A;  3G4A A;  3A8J A;  2FQO A;  2PMZ D;  4GTF A;  3H0G C;  2P5M A;  5IOR A;  1YNJ A;  3GIR A;  4WIL A;  3K7A K;  3SZZ A;  4GTL A;  3GTO C;  5C4X C;  3I4M C;  3GSI A;  4LK1 A;  5M5X K;  4KB4 A;  5CHP A;  4A3G C;  1VJE A;  3S15 C;  4C3H K;  3M3Y C;  1GE9 A;  3AQP A;  5C3E C;  1YCL A;  4KM9 A;  1O28 A;  4YG2 A;  4YFX A;  1DCH A;  4A3F K;  3AD7 C;  1SMY A;  3CQZ C;  4PAA A;  2E2H K;  3HOX K;  4WJ3 M;  1JOE A;  3HOW C;  2JA7 C;  2NVY K;  1TWF C;  2WB1 L;  4KMD A;  2YU9 K;  3S2D K;  2R93 C;  5M3F K;  3FKI C;  4A3M K;  1I6H K;  1F93 A;  2NVQ C;  4A93 K;  1BDF A;  1SFO K;  2NVY A;  1ISE A;  2R92 K;  3DXJ A;  4A3J K;  3AD9 C;  4Y52 K;  1XZQ A;  1PJ7 A;  4KAW X;  5IP9 K;  1O29 A;  2CFA A;  1O27 A;  4FZB A;  4A3K C;  1O24 A;  4G7Z A;  1O2B A;  1XXC A;  3HOY K;  4KC6 A;  1C0A A;  2NVX A;  4G7H A;  1USM A;  5C4X K;  3I4M K;  1WQG A;  2V6S A;  3WOD A;  3FOF A;  5FLM C;  4M1X A;  1I50 C;  4A3G K;  3GEH A;  1YNN A;  3TFJ A;  4MEX A;  1KQ4 A;  2V6T A;  1XZQ B;  3M3Y K;  4DDQ A;  1EH1 A;  3Q3Q A;  5C3E K;  5IYB K;  3GTK K;  1XZP A;  2CFA B;  3HOU K;  4BBS C;  2W7V A;  2CW0 A;  2Y0S D;  1VGX A;  1WOS A;  2V6U A;  3T00 A;  2NVT K;  3OPF A;  4C3I K;  3HOW K;  4PAB A;  2JA7 K;  1TWF K;  5CJ9 A;  3S16 C;  4FM9 A;  3GTK A;  2R93 K;  4KMH A;  3TTG A;  3GTL C;  3FKI K;  4KAT A;  4KMA A;  5IOS A;  1J6W A;  1XZP B;  5FJ8 K;  4QIW D;  2R93 A;  3TFH A;  1VRQ C;  4P5A A;  3G4C A;  4P9S A;  3FKI A;  1DCP A;  4OIQ A;  4BKW A;  4X6A C;  4GTB A;  1EK8 A;  3S14 C;  3M4O K;  3MML B;  3BP8 C;  1TWG K;  3S1N C;  3GTP C;  3S1M C;  1IBA A;  3GTJ A;  5FLM K;  1ZYR A;  4KAR A;  2PPB A;  4OIN A;  1IE0 A;  1O25 A;  1TWG A;  3H3V D;  4A3B K;  1XXA A;  4GTE A;  4BBS K;  2WAQ L;  2XCQ A;  4KN4 A;  1I3Q C;  1PJ6 A;  1EQR A;  4A3L C;  4BBR C;  1F7V A;  4C3J C;  3GTM C;  4Y7N C;  5TMF A;  4RMF A;  3GTQ C;  1X31 C;  4XSX A;  3NUH A;  4OIO A;  3HXA A;  1O2F B;  4XLN A;  4AYB D;  2ZUF A;  1YX2 A;  2EBB A;  2ZFZ A;  1B4A A;  3AQO A;  3N0B A;  1USO A;  3T01 A;  1WSR A;  3A8I A;  2FQT A;  3RZO C;  3ADA C;  3S14 K;  2Y3P A;  3HOZ K;  1PJ5 A;  1TWC C;  4LR2 A;  5IOT A;  3S1M K;  3JST A;  3FOE A;  1XPP A;  2E2H A;  3OEP A;  4J3N A;  1WQH A;  4KDD A;  4A3D C;  2YU9 A;  4MQ9 A;  1IS1 A;  4BLA A;  5TMC A;  3TFI A;  4A3I C;  3S1R C;  1TWH C;  1EI6 A;  2JH3 A;  3H0G K;  1SFO A;  1ZBS A;  2PMZ L;  4BY1 C;  3S1Q C;  1I3Q K;  2JA6 C;  2E2I C;  1XXB A;  2R92 A;  2PA8 D;  2PHC B;  5M5W K;  4QJV A;  1WSV A;  4Y7N K;  3GTO K;  3LAJ A;  1V5V A;  5M3M K;  1AB4 A;  2A6E A;  3H0G A;  4BXX C;  2VUM C;  5EGH A;  3S15 K;  3HKZ D;  3AH5 A;  5C4J C;  3PO2 C;  3GTO A;  1DD5 A;  1WOR A;  3S17 C;  5E68 A;  4YFK A;  3CQZ K;  3HOV C;  1F9N A;  3ORE A;  4QJV B;  3VA7 A;  3RZO K;  1WCM C;  4WJ4 A;  1IQ0 A;  1TWC K;  4OIR A;  3S2H C;  3A8K A;  3CQZ A;  4GT9 A;  4LQY A;  2NVQ K;  3GDZ A;  2JA7 A;  1TWF A;  3CAG A;  4GTD A;  2BE5 A;  3GEE A;  4A3D K;  1BGW A;  2R7Z C;  4A3I K;  1F7U A;  4A3C C;  4G0U A;  2JA5 C;  3S1R K;  1TWH K;  3PO3 C;  2P8T A;  2GSU A;  1RU0 A;  2XCO A;  3L4J A;  4A3K K;  4BY1 K;  2JA6 K;  2E2I K;  1Y1V C;  5D4D A;  2RH6 A;  2PA8 L;  1TWH A;  4BY7 C;  4YFN A;  1I50 K;  1VH2 A;  4KMU A;  2GAG C;  1BJT A;  2VUM K;  1VLO A;  4BXX K;  3LPX A;  2B63 C;  5C4J K;  3PO2 K;  3I4N C;  4OIP A;  1JVI A;  3V4G A;  2WB1 D;  4GFQ A;  3S17 K;  4XLP A;  3QX3 A;  1I50 A;  1UV7 A;  4MEY A;  3HOV K;  2VUM A;  2Y0S L;  2GSO A;  1ZXO A;  5JVO A;  3S16 K;  1WCM K;  4LK0 A;  1K83 C;  3GTG C;  1B4B A;  3GTL K;  4KM8 A;  5IP7 C;  3S2H K;  1TWA C;  1ZQ1 C;  2NVX C;  4A3J C;  1R9T C;  3S0X A;  5IP9 C;  3N3Y A;  4A3E C;  4LJZ A;  1WCM A;  2R7Z K;  3GTL A;  4QIW L;  4A3C K;  2JA5 K;  3HOY C;  1DCO A;  3PO3 K;  4Q4Z A;  4X6A K;  4Q5S A;  5M5Y K;  4P5B A;  5L46 A;  4ZH4 A;  3AD8 C;  1Y1V K;  2R7Z A;  4GZY A;  5C44 C;  3S1N K;  3GTP K;  2JA5 A;  4BY7 K;  4C2M C;  5IYB C;  3GTK C;  3HOU C;  1O2A A;  1Y1V A;  4KB2 A; 
#chains in the Genus database with same CATH homology
 2B63 K;  2PMZ D;  3H3V L;  4OIQ A;  3I4N K;  3H0G C;  4X6A C;  3S17 C;  2NVT C;  1YNJ A;  3S14 C;  4YFK A;  3CQZ K;  3K7A K;  3HOV C;  4QJV B;  3RZO K;  3M4O K;  1TWG K;  5IYD C;  3GTO C;  4A3L K;  5C4X C;  4BBR K;  3I4M C;  4LK1 A;  3S1N C;  5M5X K;  3GTP C;  3S1M C;  1WCM C;  4C3J K;  1IW7 A;  3GTM K;  1TWC K;  3RZD C;  5FLM K;  1ZYR A;  4OIR A;  1Y1W C;  4A3G C;  1K83 K;  3GTG K;  5IYC C;  3S2H C;  4LLG A;  2A6H A;  3GTQ K;  2PPB A;  4OIN A;  2NVQ K;  4G7O A;  5IP7 K;  3S15 C;  1TWA K;  4C3H K;  3M3Y C;  2NVX K;  3H3V D;  4Q5S A;  5C3E C;  4A3B K;  2BE5 A;  4A3D K;  2A69 A;  1R9T K;  3GTJ C;  2R7Z C;  4A3E K;  4YG2 A;  4AYB L;  4YFX A;  4A3I K;  4A3C C;  4BBS K;  4A3F K;  2JA5 C;  2WAQ L;  1SMY A;  3CQZ C;  1TWH K;  3S1R K;  3PO3 C;  2E2H K;  3M4O C;  3HOX K;  4KN4 A;  3HOW C;  1I3Q C;  1TWG C;  2JA7 C;  2NVY K;  1TWF C;  4A3K K;  4A3L C;  4BBR C;  4BY1 K;  2WB1 L;  2JA6 K;  2E2I K;  2YU9 K;  3S2D K;  2R93 C;  3GTM C;  1Y1V C;  5D4D A;  5M3F K;  4Y7N C;  3FKI C;  5TMF A;  4A3M K;  1I6H K;  2PA8 L;  4XSX A;  3GTQ C;  5C44 K;  2NVQ C;  4A93 K;  4OIO A;  4BY7 C;  1BDF A;  4YFN A;  1SFO K;  2E2J C;  4XLN A;  1I50 K;  4A3B C;  2JA8 C;  4AYB D;  2R92 K;  4C2M K;  4KMU A;  4JK1 A;  4BXX K;  2VUM K;  2WAQ D;  3DXJ A;  4A3J K;  2B63 C;  5C4J K;  3PO2 K;  4Y52 K;  3I4N C;  4OIP A;  5IP9 K;  2WB1 D;  3S17 K;  4A3K C;  4XLP A;  3K7A C;  3RZO C;  4G7Z A;  3S14 K;  3HOY K;  4MEY A;  3HOV K;  4KN7 A;  2Y0S L;  3HOZ K;  3S1Q K;  5IYD K;  4G7H A;  5C4X K;  3I4M K;  1TWC C;  3WOD A;  3S16 K;  5FLM C;  3S1M K;  1WCM K;  4LK0 A;  1K83 C;  3GTG C;  1XPP A;  3RZD K;  3GTL K;  1I50 C;  1Y1W K;  4A3G K;  2A68 A;  5IYC K;  1YNN A;  5IP7 C;  4MEX A;  3S2H K;  1TWA C;  3S1Q C;  2NVX C;  4A3J C;  3M3Y K;  4A3D C;  4MQ9 A;  1R9T C;  5TMC A;  5IP9 C;  5C3E K;  1I6V A;  5IYB K;  4A3E C;  4LJZ A;  3GTK K;  4A3I C;  3HOU K;  4BBS C;  2O5J A;  4A3F C;  3GTJ K;  2R7Z K;  2CW0 A;  1TWH C;  3S1R C;  4QIW L;  2Y0S D;  2E2H C;  4A3C K;  3HKZ L;  3HOX C;  2JA5 K;  3HOY C;  3PO3 K;  3H0G K;  2NVY C;  4Q4Z A;  4X6A K;  2NVT K;  2PMZ L;  3EQL A;  4BY1 C;  3HOW K;  1I3Q K;  4C3I K;  2JA6 C;  2E2I C;  2JA7 K;  2YU9 C;  3HOZ C;  1TWF K;  5M5Y K;  3S2D C;  2O5I A;  3S16 C;  4A3M C;  1I6H C;  2PA8 D;  5M5W K;  2R93 K;  4QJV A;  4ZH4 A;  1Y1V K;  3GTL C;  4Y7N K;  3FKI K;  3GTO K;  4GZY A;  5C44 C;  1HQM A;  3S1N K;  3GTP K;  5M3M K;  4A93 C;  1SFO C;  2A6E A;  4BY7 K;  2E2J K;  2R92 C;  4NOI A;  4BXX C;  2VUM C;  5IYB C;  5FJ8 K;  2JA8 K;  3GTK C;  3HOU C;  4QIW D;  3S15 K;  3HKZ D;  5C4J C;  3PO2 C;  4Y52 C;  4XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...