3S2HK

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2hK00
4XLPA 2O5JA 2PMZL 2NVTC 3H3VL 4A93C 1SFOK 3S16K 1TWCC 4Y52C 3HOUK 4C2MK 4Y7NK 2E2JK 3S2DK 4BY1K 5D4DA 5TMCA 3GTKK 3S2HK 4A3JC 2JA5K 1XPPA 4YFKA 4Y52K 4Y7NC 2E2JC 1TWHC 5TMFA 3PO2K 4A3LC 3HOZC 4BY7K 2Y0SD 1I50C 3RZDC 4A3KC 4G7HA 4BBRK 4OIPA 5M5YK 3S1RC 4A3LK 4A3IC 4BXXK 3GTJK 4BBRC 5IYCK 2R92K 1I6HK 5M3FK 4BBSK 5IYDK 3K7AC 1Y1VK 3HOXC 1YNJA 3H3VD 4XSXA 1IW7A 3I4MC 4A3DC 2PMZD 3GTLK 4X6AC 2VUMC 2E2IC 3WODA 5FLMK 3DXJA 4OINA 5IP7K 2A69A 3HOXK 2NVXC 3I4MK 3PO3C 1I6VA 1TWGK 4QJVA 5C3EC 3GTLC 2R7ZC 4OIQA 2E2HK 4A3GC 2PA8D 1BDFA 3GTQC 1WCMC 2NVXK 1TWAK 4KN7A 4NOIA 3PO3K 3M3YC 1TWGC 5C3EK 3M4OK 5C4XK 4QJVB 4C3HK 1Y1WK 1K83C 2WAQL 4A3MC 2R7ZK 5FJ8K 1YNNA 2WB1L 3S1MC 3S1QK 3GTQK 3HOYC 1TWAC 5IYBK 2JA6K 2JA7K 2NVQC 2NVTK 3HOVK 3M3YK 4A3EK 3GTGK 3GTPK 4YG2A 1TWFC 1SFOC 3HKZD 5M5WK 2B63K 4A93K 4GZYA 1TWCK 4QIWL 1R9TK 3S1QC 4MQ9A 4G7ZA 3HOYK 4OIOA 5IYBC 4OIRA 3HOVC 3S2DC 3S2HC 1I3QK 3H0GK 4AYBL 3RZOC 4ZH4A 4A3FC 2JA8K 5C44C 1HQMA 2YU9K 3PO2C 4A3BK 3S1NC 3S15C 3HOZK 3H0GC 4C3JK 4BY7C 1I50K 3RZDK 4YFXA 3GTMK 4A3KK 4A3FK 3HOUC 3M4OC 4KN4A 5C44K 3S1RK 2YU9C 3S1NK 3FKIC 4BY1C 4A3BC 3S15K 3GTKC 2WAQD 4A3JK 2JA5C 2A68A 3GTMC 3GTJC 4BXXC 1TWHK 3I4NC 3FKIK 1I6HC 5IP9C 4BBSC 4MEYA 5IYDC 2PA8L 4Q4ZA 3S17K 4LK0A 4LK1A 1SMYA 4YFNA 4LJZA 2O5IA 5M5XK 3GTOK 4X6AK 4JK1A 2E2IK 3I4NK 5IP9K 4KMUA 3HOWC 4A3IK 3S17C 4AYBD 4XLNA 5IP7C 5IYCC 3GTOC 2R92C 4XSZA 4QIWD 2A6EA 2E2HC 3HOWK 2R93C 4G7OA 3HKZL 3K7AK 1Y1VC 3S14C 4A3DK 5M3MK 3CQZC 2VUMK 2NVYC 1Y1WC 4A3MK 1ZYRA 4Q5SA 2WB1D 2CW0A 5FLMC 2R93K 2PPBA 3EQLA 3S14K 2NVQK 2JA6C 2JA7C 3CQZK 4A3EC 2NVYK 2BE5A 3GTPC 1TWFK 2Y0SL 2B63C 4A3GK 4C3IK 4A3CK 1R9TC 4LLGA 5C4JC 3GTGC 1WCMK 4MEXA 5C4XC 1K83K 1I3QC 3S16C 3S1MK 4A3CC 3RZOK 2JA8C 5C4JK 2A6HA
chains in the Genus database with same CATH superfamily
3CAGA 1TWHA 3H3VL 1VRQC 1VJEA 1I50A 1ZBSA 5TMCA 3GIRA 3NUHA 4YFKA 3OEPA 4Y52K 4C2MC 4Y7NC 1TWHC 1I3QA 4A3KC 4BBRK 3S1RC 1B4BA 5IOTA 4A3IC 3TFJA 4BXXK 2B63A 1IQ0A 1XXAA 1INNA 4WJ4A 1I6HK 2GAGC 1EI6A 3HOXC 4A3DC 3GTLK 2VUMC 1J6XA 1XZPA 3WODA 5FLMK 3DXJA 3GTPA 1DD5A 4AH6A 3PO3C 3V4GA 1IS1A 1XZQA 2FQOA 1I6VA 1YX2A 4LQYA 1KQ4A 1O24A 4C3HC 4OIQA 3T02A 2E2HK 1Y1WA 3BUEA 1TWAK 5C3EK 3A8KA 4P5AA 1O2FB 1K83C 4A3MC 2WB1L 1BS2A 4G0WA 2Y3PA 2JA7K 3M3YK 3GTGK 3GTJA 5M5WK 3TTGA 4G7ZA 5IYBC 3HOVC 1VLOA 1O28A 3N0CA 1I3QK 4AYBL 1XXCA 3A8JA 4A3BK 3H0GC 4GTLA 3GTMK 4A3FK 3G4AA 1WOSA 2YU9C 3S1RK 3MMLB 3FKIC 1O29A 3S15K 1O27A 4A3JK 1SFOA 2W7VA 1EH1A 1I6HC 5IP9C 4BBSC 4LJZA 2RH6A 4X6AK 2V6TA 3GTQA 3S17C 3BP8C 4QIWD 1WOOA 3HKZL 1Y1VC 5E68A 1PJ6A 5M3MK 4RMFA 1Y1WC 4A3MK 1J98A 2CW0A 4PAAA 3S14K 4A3EC 3GTPC 2BE5A 3OREA 4A3GK 3I4MK 2VUMA 1R9TC 4MEXA 3ADAC 2GSUA 3S1MK 2O5JA 1PJ7A 1SFOK 3S16K 1TWCC 2GSNA 3HOUK 2E2JK 3OPFA 3AQOA 4GFQA 3GTKK 4G0UA 2JA5K 1XPPA 3AD7C 5TMFA 3PO2K 3T01A 4XCHA 4G0VA 2Y0SD 3RZDC 5M5YK 1DCPA 3JSTA 1R9TA 5C4JK 3GTJK 4BBRC 5IYCK 4WILA 3IPJA 1GE9A 1YNJA 1IW7A 1C0AA 1L0WA 3GEEA 3AQPA 1Y1VA 3FOFA 3HOXK 2JA6A 2NVXC 3GEIA 4QJVA 2R7ZC 5IOSA 2PA8D 1PJ5A 2V6UA 4KN7A 1TWGC 3M4OK 4C3HK 2R93A 5FJ8K 2E2HA 4J3NA 3GTQK 1TWAC 1O2AA 4G7OA 4P5BA 4YG2A 1SFOC 1UV7A 1TWCK 4QIWL 3A8IA 3S1QC 4MQ9A 4P9SA 3G4CA 4OIOA 4OIRA 5IORA 1EFWA 1WQFA 2P5MA 3TFIA 2PHCB 1O25A 3RZOC 4ZH4A 3LAJA 3PO2C 3TFHA 3S1NC 2JA5A 1WOPA 3QX3A 3RZDK 4KATA 4A3KK 3SZYA 1XZPB 4KMDA 4BY1C 2WAQD 4BXXC 3GTJC 4M1XA 3FKIK 4KB2A 2PA8L 4LK0A 4LK1A 1SMYA 3GTOK 1RU0A 4AYBD 3GSIA 3S0XA 4PABA 3GTLA 3GDZA 2E2HC 2R93C 3K7AK 4GTBA 3SZZA 3GEHA 2XCQA 1WCMA 3CQZC 2WB1D 2NVXA 2JA7C 4DDQA 1F7VA 2NVYK 1J6VA 1ISEA 2E2IA 1WCMK 1I3QC 3L4KA 3T00A 4A3CC 4BKWA 2A6HA 4XLPA 2PMZL 2NVTC 4A93C 5EGHA 4Y52C 3S2DK 4BY1K 2KWAA 5L46A 3S2HK 5EGEA 4A3JC 1USOA 5IOQA 4A3LC 4FZBA 3HOZC 4BY7K 4G7HA 4OIPA 1TWCA 5JVOA 1XXBA 3K7AC 1Y1VK 3H3VD 2V6SA 2NVYA 3I4MC 2PMZD 3GTGA 1IE0A 2GAHC 2ZFZA 5IP7K 2A69A 5C3EC 1F7UA 3GTLC 4A3GC 1BDFA 2GSOA 4LR2A 3PO3K 2RGRA 4NOIA 3M3YC 4QJVB 2R7ZK 5HL8A 2FQTA 3S1MC 3Q3QA 2ZUEA 3HOYC 4KMHA 5IYBK 2JA6K 2NVQC 3HOVK 3M4OC 1TWFC 3BP3A 1BJTA 1G51A 3S2HC 3H0GK 2JA8K 5C44C 2D6FC 4C3JK 2YU9A 1ZQ1C 4KN4A 4A3BC 3H0GA 4ILDA 5JFEA 1YCLA 3GTMC 3VA7A 1X31C 1TWHK 1TWAA 3I4NC 4MEYA 4Q4ZA 3S17K 4GTDA 2O5IA 4YFNA 4GTCA 1O26A 5IP9K 4KMUA 3HOWC 4A3IK 4XLNA 5IP7C 1JVIA 2R7ZA 2R92C 2A6EA 3S14C 4GTEA 4GT9A 2VUMK 4Q5SA 2R93K 5FLMC 2PPBA 3EQLA 3AD9C 3CQZK 1TWFK 1WQHA 5C4JC 3GTGC 5C4XC 1K83K 1DCOA 1V5VA 1DCHA 3RZOK 4GTFA 2JA8C 1F93A 1JQWA 4O2DA 4C2MK 3LPXA 1J6WA 4Y7NK 1USMA 5TJ3A 2XCRB 5D4DA 4LOWA 2E2JC 1WORA 1ZVUA 2ZUFA 3LAPA 1I50C 3N0BA 3L4JA 5CJ9A 4A3LK 2EBBA 3HXAA 1EQRA 4KM8A 1WSVA 4KASA 2CFAA 4KM9A 2R92K 5M3FK 4KARA 4BBSK 5IYDK 4XSXA 4X6AC 2E2IC 4OINA 2JA7A 1ZXOA 2R92A 1TWGK 1WIHA 3CQZA 3GTQC 1O2BA 1WCMC 4KC6A 2NVXK 1XZQB 1HI9A 5C4XK 1Y1WK 2WAQL 1YNNA 3GTOA 3S1QK 3AH5A 1BGWA 2NVTK 4A3EK 3GTPK 4A93K 2B63K 4GZYA 3HKZD 3GTMA 1F9NA 4C3IC 1R9TK 3FKIA 3ERED 3HOYK 1JOEA 3S2DC 1WSRA 4BLAA 1AB4A 1IL2A 4A3FC 5CHPA 1EK8A 2YU9K 1HQMA 3S15C 3HOZK 3GTKA 4BY7C 1B4AA 1I50K 4YFXA 3HOUC 5C44K 2XCOA 4BLBA 3S1NK 3GTKC 1VGXA 4C3JC 2JA5C 2A68A 1TWFA 1VH2A 1IBAA 4KDDA 5IYDC 4KMAA 1K83A 4KB4A 5M5XK 4JK1A 2E2IK 3I4NK 3FOEA 5IYCC 3GTOC 4XSZA 3HOWK 2JH3A 1TWGA 4A3DK 4WJ3M 2NVYC 1ZYRA 4FM9A 2NVQK 2JA6C 2P8TA 3N3YA 2B63C 2Y0SL 2CFAB 4C3IK 4KAWX 4A3CK 3AD8C 4LLGA 4C45A 4GTAA 3S16C 1WQGA 3FHZA
chains in the Genus database with same CATH topology
4XLPA 2O5JA 2PMZL 2NVTC 3H3VL 4A93C 1SFOK 3S16K 1TWCC 4Y52C 3HOUK 4C2MK 4Y7NK 2E2JK 3S2DK 4BY1K 5D4DA 5TMCA 3GTKK 3S2HK 4A3JC 2JA5K 1XPPA 4YFKA 4Y52K 4Y7NC 2E2JC 1TWHC 5TMFA 3PO2K 4A3LC 3HOZC 4BY7K 2Y0SD 1I50C 3RZDC 4A3KC 4G7HA 4BBRK 4OIPA 5M5YK 3S1RC 4A3LK 4A3IC 4BXXK 3GTJK 4BBRC 5IYCK 2R92K 1I6HK 5M3FK 4BBSK 5IYDK 3K7AC 1Y1VK 3HOXC 1YNJA 3H3VD 4XSXA 1IW7A 3I4MC 4A3DC 2PMZD 3GTLK 4X6AC 2VUMC 2E2IC 3WODA 5FLMK 3DXJA 4OINA 5IP7K 2A69A 3HOXK 2NVXC 3I4MK 3PO3C 1I6VA 1TWGK 4QJVA 5C3EC 3GTLC 2R7ZC 4OIQA 2E2HK 4A3GC 2PA8D 1BDFA 3GTQC 1WCMC 2NVXK 1TWAK 4KN7A 4NOIA 3PO3K 3M3YC 1TWGC 5C3EK 3M4OK 5C4XK 4QJVB 4C3HK 1Y1WK 1K83C 2WAQL 4A3MC 2R7ZK 5FJ8K 1YNNA 2WB1L 3S1MC 3S1QK 3GTQK 3HOYC 1TWAC 5IYBK 2JA6K 2JA7K 2NVQC 2NVTK 3HOVK 3M3YK 4A3EK 3GTGK 3GTPK 4YG2A 1TWFC 1SFOC 3HKZD 5M5WK 2B63K 4A93K 4GZYA 1TWCK 4QIWL 1R9TK 3S1QC 4MQ9A 4G7ZA 3HOYK 4OIOA 5IYBC 4OIRA 3HOVC 3S2DC 3S2HC 1I3QK 3H0GK 4AYBL 3RZOC 4ZH4A 4A3FC 2JA8K 5C44C 1HQMA 2YU9K 3PO2C 4A3BK 3S1NC 3S15C 3HOZK 3H0GC 4C3JK 4BY7C 1I50K 3RZDK 4YFXA 3GTMK 4A3KK 4A3FK 3HOUC 3M4OC 4KN4A 5C44K 3S1RK 2YU9C 3S1NK 3FKIC 4BY1C 4A3BC 3S15K 3GTKC 2WAQD 4A3JK 2JA5C 2A68A 3GTMC 3GTJC 4BXXC 1TWHK 3I4NC 3FKIK 1I6HC 5IP9C 4BBSC 4MEYA 5IYDC 2PA8L 4Q4ZA 3S17K 4LK0A 4LK1A 1SMYA 4YFNA 4LJZA 2O5IA 5M5XK 3GTOK 4X6AK 4JK1A 2E2IK 3I4NK 5IP9K 4KMUA 3HOWC 4A3IK 3S17C 4AYBD 4XLNA 5IP7C 5IYCC 3GTOC 2R92C 4XSZA 4QIWD 2A6EA 2E2HC 3HOWK 2R93C 4G7OA 3HKZL 3K7AK 1Y1VC 3S14C 4A3DK 5M3MK 3CQZC 2VUMK 2NVYC 1Y1WC 4A3MK 1ZYRA 4Q5SA 2WB1D 2CW0A 5FLMC 2R93K 2PPBA 3EQLA 3S14K 2NVQK 2JA6C 2JA7C 3CQZK 4A3EC 2NVYK 2BE5A 3GTPC 1TWFK 2Y0SL 2B63C 4A3GK 4C3IK 4A3CK 1R9TC 4LLGA 5C4JC 3GTGC 1WCMK 4MEXA 5C4XC 1K83K 1I3QC 3S16C 3S1MK 4A3CC 3RZOK 2JA8C 5C4JK 2A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP A;  2O5J A;  2PMZ L;  2NVT C;  3H3V L;  4A93 C;  1SFO K;  3S16 K;  1TWC C;  4Y52 C;  3HOU K;  4C2M K;  4Y7N K;  2E2J K;  3S2D K;  4BY1 K;  5D4D A;  5TMC A;  3GTK K;  3S2H K;  4A3J C;  2JA5 K;  1XPP A;  4YFK A;  4Y52 K;  4Y7N C;  2E2J C;  1TWH C;  5TMF A;  3PO2 K;  4A3L C;  3HOZ C;  4BY7 K;  2Y0S D;  1I50 C;  3RZD C;  4A3K C;  4G7H A;  4BBR K;  4OIP A;  5M5Y K;  3S1R C;  4A3L K;  4A3I C;  4BXX K;  3GTJ K;  4BBR C;  5IYC K;  2R92 K;  1I6H K;  5M3F K;  4BBS K;  5IYD K;  3K7A C;  1Y1V K;  3HOX C;  1YNJ A;  3H3V D;  4XSX A;  1IW7 A;  3I4M C;  4A3D C;  2PMZ D;  3GTL K;  4X6A C;  2VUM C;  2E2I C;  3WOD A;  5FLM K;  3DXJ A;  4OIN A;  5IP7 K;  2A69 A;  3HOX K;  2NVX C;  3I4M K;  3PO3 C;  1I6V A;  1TWG K;  4QJV A;  5C3E C;  3GTL C;  2R7Z C;  4OIQ A;  2E2H K;  4A3G C;  2PA8 D;  1BDF A;  3GTQ C;  1WCM C;  2NVX K;  1TWA K;  4KN7 A;  4NOI A;  3PO3 K;  3M3Y C;  1TWG C;  5C3E K;  3M4O K;  5C4X K;  4QJV B;  4C3H K;  1Y1W K;  1K83 C;  2WAQ L;  4A3M C;  2R7Z K;  5FJ8 K;  1YNN A;  2WB1 L;  3S1M C;  3S1Q K;  3GTQ K;  3HOY C;  1TWA C;  5IYB K;  2JA6 K;  2JA7 K;  2NVQ C;  2NVT K;  3HOV K;  3M3Y K;  4A3E K;  3GTG K;  3GTP K;  4YG2 A;  1TWF C;  1SFO C;  3HKZ D;  5M5W K;  2B63 K;  4A93 K;  4GZY A;  1TWC K;  4QIW L;  1R9T K;  3S1Q C;  4MQ9 A;  4G7Z A;  3HOY K;  4OIO A;  5IYB C;  4OIR A;  3HOV C;  3S2D C;  3S2H C;  1I3Q K;  3H0G K;  4AYB L;  3RZO C;  4ZH4 A;  4A3F C;  2JA8 K;  5C44 C;  1HQM A;  2YU9 K;  3PO2 C;  4A3B K;  3S1N C;  3S15 C;  3HOZ K;  3H0G C;  4C3J K;  4BY7 C;  1I50 K;  3RZD K;  4YFX A;  3GTM K;  4A3K K;  4A3F K;  3HOU C;  3M4O C;  4KN4 A;  5C44 K;  3S1R K;  2YU9 C;  3S1N K;  3FKI C;  4BY1 C;  4A3B C;  3S15 K;  3GTK C;  2WAQ D;  4A3J K;  2JA5 C;  2A68 A;  3GTM C;  3GTJ C;  4BXX C;  1TWH K;  3I4N C;  3FKI K;  1I6H C;  5IP9 C;  4BBS C;  4MEY A;  5IYD C;  2PA8 L;  4Q4Z A;  3S17 K;  4LK0 A;  4LK1 A;  1SMY A;  4YFN A;  4LJZ A;  2O5I A;  5M5X K;  3GTO K;  4X6A K;  4JK1 A;  2E2I K;  3I4N K;  5IP9 K;  4KMU A;  3HOW C;  4A3I K;  3S17 C;  4AYB D;  4XLN A;  5IP7 C;  5IYC C;  3GTO C;  2R92 C;  4XSZ A;  4QIW D;  2A6E A;  2E2H C;  3HOW K;  2R93 C;  4G7O A;  3HKZ L;  3K7A K;  1Y1V C;  3S14 C;  4A3D K;  5M3M K;  3CQZ C;  2VUM K;  2NVY C;  1Y1W C;  4A3M K;  1ZYR A;  4Q5S A;  2WB1 D;  2CW0 A;  5FLM C;  2R93 K;  2PPB A;  3EQL A;  3S14 K;  2NVQ K;  2JA6 C;  2JA7 C;  3CQZ K;  4A3E C;  2NVY K;  2BE5 A;  3GTP C;  1TWF K;  2Y0S L;  2B63 C;  4A3G K;  4C3I K;  4A3C K;  1R9T C;  4LLG A;  5C4J C;  3GTG C;  1WCM K;  4MEX A;  5C4X C;  1K83 K;  1I3Q C;  3S16 C;  3S1M K;  4A3C C;  3RZO K;  2JA8 C;  5C4J K;  2A6H A; 
#chains in the Genus database with same CATH topology
 3CAG A;  1TWH A;  3H3V L;  1VRQ C;  1VJE A;  1I50 A;  1ZBS A;  5TMC A;  3GIR A;  3NUH A;  4YFK A;  3OEP A;  4Y52 K;  4C2M C;  4Y7N C;  1TWH C;  1I3Q A;  4A3K C;  4BBR K;  3S1R C;  1B4B A;  5IOT A;  4A3I C;  3TFJ A;  4BXX K;  2B63 A;  1IQ0 A;  1XXA A;  1INN A;  4WJ4 A;  1I6H K;  2GAG C;  1EI6 A;  3HOX C;  4A3D C;  3GTL K;  2VUM C;  1J6X A;  1XZP A;  3WOD A;  5FLM K;  3DXJ A;  3GTP A;  1DD5 A;  4AH6 A;  3PO3 C;  3V4G A;  1IS1 A;  1XZQ A;  2FQO A;  1I6V A;  1YX2 A;  4LQY A;  1KQ4 A;  1O24 A;  4C3H C;  4OIQ A;  3T02 A;  2E2H K;  1Y1W A;  3BUE A;  1TWA K;  5C3E K;  3A8K A;  4P5A A;  1O2F B;  1K83 C;  4A3M C;  2WB1 L;  1BS2 A;  4G0W A;  2Y3P A;  2JA7 K;  3M3Y K;  3GTG K;  3GTJ A;  5M5W K;  3TTG A;  4G7Z A;  5IYB C;  3HOV C;  1VLO A;  1O28 A;  3N0C A;  1I3Q K;  4AYB L;  1XXC A;  3A8J A;  4A3B K;  3H0G C;  4GTL A;  3GTM K;  4A3F K;  3G4A A;  1WOS A;  2YU9 C;  3S1R K;  3MML B;  3FKI C;  1O29 A;  3S15 K;  1O27 A;  4A3J K;  1SFO A;  2W7V A;  1EH1 A;  1I6H C;  5IP9 C;  4BBS C;  4LJZ A;  2RH6 A;  4X6A K;  2V6T A;  3GTQ A;  3S17 C;  3BP8 C;  4QIW D;  1WOO A;  3HKZ L;  1Y1V C;  5E68 A;  1PJ6 A;  5M3M K;  4RMF A;  1Y1W C;  4A3M K;  1J98 A;  2CW0 A;  4PAA A;  3S14 K;  4A3E C;  3GTP C;  2BE5 A;  3ORE A;  4A3G K;  3I4M K;  2VUM A;  1R9T C;  4MEX A;  3ADA C;  2GSU A;  3S1M K;  2O5J A;  1PJ7 A;  1SFO K;  3S16 K;  1TWC C;  2GSN A;  3HOU K;  2E2J K;  3OPF A;  3AQO A;  4GFQ A;  3GTK K;  4G0U A;  2JA5 K;  1XPP A;  3AD7 C;  5TMF A;  3PO2 K;  3T01 A;  4XCH A;  4G0V A;  2Y0S D;  3RZD C;  5M5Y K;  1DCP A;  3JST A;  1R9T A;  5C4J K;  3GTJ K;  4BBR C;  5IYC K;  4WIL A;  3IPJ A;  1GE9 A;  1YNJ A;  1IW7 A;  1C0A A;  1L0W A;  3GEE A;  3AQP A;  1Y1V A;  3FOF A;  3HOX K;  2JA6 A;  2NVX C;  3GEI A;  4QJV A;  2R7Z C;  5IOS A;  2PA8 D;  1PJ5 A;  2V6U A;  4KN7 A;  1TWG C;  3M4O K;  4C3H K;  2R93 A;  5FJ8 K;  2E2H A;  4J3N A;  3GTQ K;  1TWA C;  1O2A A;  4G7O A;  4P5B A;  4YG2 A;  1SFO C;  1UV7 A;  1TWC K;  4QIW L;  3A8I A;  3S1Q C;  4MQ9 A;  4P9S A;  3G4C A;  4OIO A;  4OIR A;  5IOR A;  1EFW A;  1WQF A;  2P5M A;  3TFI A;  2PHC B;  1O25 A;  3RZO C;  4ZH4 A;  3LAJ A;  3PO2 C;  3TFH A;  3S1N C;  2JA5 A;  1WOP A;  3QX3 A;  3RZD K;  4KAT A;  4A3K K;  3SZY A;  1XZP B;  4KMD A;  4BY1 C;  2WAQ D;  4BXX C;  3GTJ C;  4M1X A;  3FKI K;  4KB2 A;  2PA8 L;  4LK0 A;  4LK1 A;  1SMY A;  3GTO K;  1RU0 A;  4AYB D;  3GSI A;  3S0X A;  4PAB A;  3GTL A;  3GDZ A;  2E2H C;  2R93 C;  3K7A K;  4GTB A;  3SZZ A;  3GEH A;  2XCQ A;  1WCM A;  3CQZ C;  2WB1 D;  2NVX A;  2JA7 C;  4DDQ A;  1F7V A;  2NVY K;  1J6V A;  1ISE A;  2E2I A;  1WCM K;  1I3Q C;  3L4K A;  3T00 A;  4A3C C;  4BKW A;  2A6H A;  4XLP A;  2PMZ L;  2NVT C;  4A93 C;  5EGH A;  4Y52 C;  3S2D K;  4BY1 K;  2KWA A;  5L46 A;  3S2H K;  5EGE A;  4A3J C;  1USO A;  5IOQ A;  4A3L C;  4FZB A;  3HOZ C;  4BY7 K;  4G7H A;  4OIP A;  1TWC A;  5JVO A;  1XXB A;  3K7A C;  1Y1V K;  3H3V D;  2V6S A;  2NVY A;  3I4M C;  2PMZ D;  3GTG A;  1IE0 A;  2GAH C;  2ZFZ A;  5IP7 K;  2A69 A;  5C3E C;  1F7U A;  3GTL C;  4A3G C;  1BDF A;  2GSO A;  4LR2 A;  3PO3 K;  2RGR A;  4NOI A;  3M3Y C;  4QJV B;  2R7Z K;  5HL8 A;  2FQT A;  3S1M C;  3Q3Q A;  2ZUE A;  3HOY C;  4KMH A;  5IYB K;  2JA6 K;  2NVQ C;  3HOV K;  3M4O C;  1TWF C;  3BP3 A;  1BJT A;  1G51 A;  3S2H C;  3H0G K;  2JA8 K;  5C44 C;  2D6F C;  4C3J K;  2YU9 A;  1ZQ1 C;  4KN4 A;  4A3B C;  3H0G A;  4ILD A;  5JFE A;  1YCL A;  3GTM C;  3VA7 A;  1X31 C;  1TWH K;  1TWA A;  3I4N C;  4MEY A;  4Q4Z A;  3S17 K;  4GTD A;  2O5I A;  4YFN A;  4GTC A;  1O26 A;  5IP9 K;  4KMU A;  3HOW C;  4A3I K;  4XLN A;  5IP7 C;  1JVI A;  2R7Z A;  2R92 C;  2A6E A;  3S14 C;  4GTE A;  4GT9 A;  2VUM K;  4Q5S A;  2R93 K;  5FLM C;  2PPB A;  3EQL A;  3AD9 C;  3CQZ K;  1TWF K;  1WQH A;  5C4J C;  3GTG C;  5C4X C;  1K83 K;  1DCO A;  1V5V A;  1DCH A;  3RZO K;  4GTF A;  2JA8 C;  1F93 A;  1JQW A;  4O2D A;  4C2M K;  3LPX A;  1J6W A;  4Y7N K;  1USM A;  5TJ3 A;  2XCR B;  5D4D A;  4LOW A;  2E2J C;  1WOR A;  1ZVU A;  2ZUF A;  3LAP A;  1I50 C;  3N0B A;  3L4J A;  5CJ9 A;  4A3L K;  2EBB A;  3HXA A;  1EQR A;  4KM8 A;  1WSV A;  4KAS A;  2CFA A;  4KM9 A;  2R92 K;  5M3F K;  4KAR A;  4BBS K;  5IYD K;  4XSX A;  4X6A C;  2E2I C;  4OIN A;  2JA7 A;  1ZXO A;  2R92 A;  1TWG K;  1WIH A;  3CQZ A;  3GTQ C;  1O2B A;  1WCM C;  4KC6 A;  2NVX K;  1XZQ B;  1HI9 A;  5C4X K;  1Y1W K;  2WAQ L;  1YNN A;  3GTO A;  3S1Q K;  3AH5 A;  1BGW A;  2NVT K;  4A3E K;  3GTP K;  4A93 K;  2B63 K;  4GZY A;  3HKZ D;  3GTM A;  1F9N A;  4C3I C;  1R9T K;  3FKI A;  3ERE D;  3HOY K;  1JOE A;  3S2D C;  1WSR A;  4BLA A;  1AB4 A;  1IL2 A;  4A3F C;  5CHP A;  1EK8 A;  2YU9 K;  1HQM A;  3S15 C;  3HOZ K;  3GTK A;  4BY7 C;  1B4A A;  1I50 K;  4YFX A;  3HOU C;  5C44 K;  2XCO A;  4BLB A;  3S1N K;  3GTK C;  1VGX A;  4C3J C;  2JA5 C;  2A68 A;  1TWF A;  1VH2 A;  1IBA A;  4KDD A;  5IYD C;  4KMA A;  1K83 A;  4KB4 A;  5M5X K;  4JK1 A;  2E2I K;  3I4N K;  3FOE A;  5IYC C;  3GTO C;  4XSZ A;  3HOW K;  2JH3 A;  1TWG A;  4A3D K;  4WJ3 M;  2NVY C;  1ZYR A;  4FM9 A;  2NVQ K;  2JA6 C;  2P8T A;  3N3Y A;  2B63 C;  2Y0S L;  2CFA B;  4C3I K;  4KAW X;  4A3C K;  3AD8 C;  4LLG A;  4C45 A;  4GTA A;  3S16 C;  1WQG A;  3FHZ A; 
#chains in the Genus database with same CATH homology
 4XLP A;  2O5J A;  2PMZ L;  2NVT C;  3H3V L;  4A93 C;  1SFO K;  3S16 K;  1TWC C;  4Y52 C;  3HOU K;  4C2M K;  4Y7N K;  2E2J K;  3S2D K;  4BY1 K;  5D4D A;  5TMC A;  3GTK K;  3S2H K;  4A3J C;  2JA5 K;  1XPP A;  4YFK A;  4Y52 K;  4Y7N C;  2E2J C;  1TWH C;  5TMF A;  3PO2 K;  4A3L C;  3HOZ C;  4BY7 K;  2Y0S D;  1I50 C;  3RZD C;  4A3K C;  4G7H A;  4BBR K;  4OIP A;  5M5Y K;  3S1R C;  4A3L K;  4A3I C;  4BXX K;  3GTJ K;  4BBR C;  5IYC K;  2R92 K;  1I6H K;  5M3F K;  4BBS K;  5IYD K;  3K7A C;  1Y1V K;  3HOX C;  1YNJ A;  3H3V D;  4XSX A;  1IW7 A;  3I4M C;  4A3D C;  2PMZ D;  3GTL K;  4X6A C;  2VUM C;  2E2I C;  3WOD A;  5FLM K;  3DXJ A;  4OIN A;  5IP7 K;  2A69 A;  3HOX K;  2NVX C;  3I4M K;  3PO3 C;  1I6V A;  1TWG K;  4QJV A;  5C3E C;  3GTL C;  2R7Z C;  4OIQ A;  2E2H K;  4A3G C;  2PA8 D;  1BDF A;  3GTQ C;  1WCM C;  2NVX K;  1TWA K;  4KN7 A;  4NOI A;  3PO3 K;  3M3Y C;  1TWG C;  5C3E K;  3M4O K;  5C4X K;  4QJV B;  4C3H K;  1Y1W K;  1K83 C;  2WAQ L;  4A3M C;  2R7Z K;  5FJ8 K;  1YNN A;  2WB1 L;  3S1M C;  3S1Q K;  3GTQ K;  3HOY C;  1TWA C;  5IYB K;  2JA6 K;  2JA7 K;  2NVQ C;  2NVT K;  3HOV K;  3M3Y K;  4A3E K;  3GTG K;  3GTP K;  4YG2 A;  1TWF C;  1SFO C;  3HKZ D;  5M5W K;  2B63 K;  4A93 K;  4GZY A;  1TWC K;  4QIW L;  1R9T K;  3S1Q C;  4MQ9 A;  4G7Z A;  3HOY K;  4OIO A;  5IYB C;  4OIR A;  3HOV C;  3S2D C;  3S2H C;  1I3Q K;  3H0G K;  4AYB L;  3RZO C;  4ZH4 A;  4A3F C;  2JA8 K;  5C44 C;  1HQM A;  2YU9 K;  3PO2 C;  4A3B K;  3S1N C;  3S15 C;  3HOZ K;  3H0G C;  4C3J K;  4BY7 C;  1I50 K;  3RZD K;  4YFX A;  3GTM K;  4A3K K;  4A3F K;  3HOU C;  3M4O C;  4KN4 A;  5C44 K;  3S1R K;  2YU9 C;  3S1N K;  3FKI C;  4BY1 C;  4A3B C;  3S15 K;  3GTK C;  2WAQ D;  4A3J K;  2JA5 C;  2A68 A;  3GTM C;  3GTJ C;  4BXX C;  1TWH K;  3I4N C;  3FKI K;  1I6H C;  5IP9 C;  4BBS C;  4MEY A;  5IYD C;  2PA8 L;  4Q4Z A;  3S17 K;  4LK0 A;  4LK1 A;  1SMY A;  4YFN A;  4LJZ A;  2O5I A;  5M5X K;  3GTO K;  4X6A K;  4JK1 A;  2E2I K;  3I4N K;  5IP9 K;  4KMU A;  3HOW C;  4A3I K;  3S17 C;  4AYB D;  4XLN A;  5IP7 C;  5IYC C;  3GTO C;  2R92 C;  4XSZ A;  4QIW D;  2A6E A;  2E2H C;  3HOW K;  2R93 C;  4G7O A;  3HKZ L;  3K7A K;  1Y1V C;  3S14 C;  4A3D K;  5M3M K;  3CQZ C;  2VUM K;  2NVY C;  1Y1W C;  4A3M K;  1ZYR A;  4Q5S A;  2WB1 D;  2CW0 A;  5FLM C;  2R93 K;  2PPB A;  3EQL A;  3S14 K;  2NVQ K;  2JA6 C;  2JA7 C;  3CQZ K;  4A3E C;  2NVY K;  2BE5 A;  3GTP C;  1TWF K;  2Y0S L;  2B63 C;  4A3G K;  4C3I K;  4A3C K;  1R9T C;  4LLG A;  5C4J C;  3GTG C;  1WCM K;  4MEX A;  5C4X C;  1K83 K;  1I3Q C;  3S16 C;  3S1M K;  4A3C C;  3RZO K;  2JA8 C;  5C4J K;  2A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...