3S2HK

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2hK00
2WAQL 1IW7A 2E2JC 1ZYRA 3K7AK 4A3GC 4BY7K 2JA6K 2JA8K 5IP7K 1TWGK 2BE5A 4BBRC 1I6HC 5M5XK 5D4DA 3RZOK 3CQZC 2R92C 3HOUK 1R9TK 3S1RK 4AYBD 3GTJK 1K83K 3GTPC 4OIPA 3M4OK 4BBSC 1TWAC 4YFKA 3S17K 3CQZK 5M5YK 2R92K 2A68A 3S15K 2Y0SD 5C44K 3HOXK 3GTJC 4BBSK 3M4OC 4LJZA 4C3HK 5IP9K 1BDFA 3S15C 3GTMK 2PMZD 3I4MK 5FJ8K 4A3CK 3S1QC 2R7ZK 2NVYK 3H0GK 3PO3C 3S1NK 4QIWL 4A3MK 1TWHC 2WB1D 4A3IK 2NVYC 3HOVK 2NVQC 3GTOC 2JA7C 4YFXA 4MEYA 3H0GC 5C4JK 3PO2C 3PO3K 1SFOK 1I50K 2JA5C 2PPBA 3RZDK 1TWHK 1YNJA 1WCMK 4A3KK 1Y1WC 5TMFA 3HOVC 2JA7K 2NVXC 3M3YC 4A93C 4NOIA 3PO2K 4A3DC 3H3VL 3S16C 1SFOC 5TMCA 2E2IC 3RZDC 3FKIC 2R93K 3GTQC 4OIRA 4YFNA 4A3EK 1WCMC 5C4XK 5IYCC 4A3KC 1Y1WK 4A93K 4GZYA 4AYBL 2PMZL 3S14C 5IYBC 3FKIK 5FLMC 5M3FK 4BY1K 3GTQK 4BXXK 2R93C 2VUMK 5C4XC 3K7AC 2YU9C 3S2HC 3HKZD 4BY7C 3GTKC 4A3GK 4XSZA 3S1MK 2JA8C 5M5WK 4XSXA 4Q5SA 5IYBK 5FLMK 4BY1C 2B63C 4C3IK 5IYDK 1Y1VC 2VUMC 3HOUC 4LK1A 3S2HK 4A3LC 3S1MC 3S1RC 3HOWC 3GTPK 1I6VA 5IYDC 2B63K 1I3QC 1Y1VK 2CW0A 2NVTK 2O5IA 1HQMA 4QIWD 4OINA 2PA8L 3H3VD 3HOWK 4Q4ZA 4C2MK 3WODA 4KMUA 1TWGC 4BBRK 3I4NC 1I6HK 3RZOC 2NVTC 4G7ZA 1R9TC 3I4MC 3S1QK 1K83C 3DXJA 2R7ZC 3I4NK 4OIOA 1TWAK 3S17C 4LLGA 2WAQD 3S2DC 4KN4A 3S1NC 4QJVB 3HOYK 1XPPA 5C44C 3HOXC 3GTLK 3GTGK 5IP9C 3HOZC 3S2DK 1TWFC 3GTMC 4X6AK 3HOYC 1I50C 2JA5K 4A3CC 3GTLC 3HKZL 4A3BC 1YNNA 4LK0A 3HOZK 3M3YK 1TWCC 1TWFK 4JK1A 4X6AC 3S16K 4KN7A 2E2IK 4A3MC 2A6EA 2Y0SL 4Y7NK 4XLPA 4YG2A 4A3EC 4A3IC 4Y52K 4A3BK 5IYCK 2NVQK 3GTOK 3EQLA 1TWCK 2A6HA 5C4JC 4OIQA 4MQ9A 3S14K 4MEXA 2O5JA 4QJVA 4Y7NC 5C3EK 4Y52C 2E2HK 4A3DK 2YU9K 4A3JK 2PA8D 2NVXK 3GTKK 4A3FC 3GTGC 5M3MK 4C3JK 2A69A 4XLNA 2WB1L 5C3EC 2E2HC 2E2JK 4A3JC 4A3LK 4ZH4A 4G7HA 2JA6C 1SMYA 5IP7C 4A3FK 4G7OA 4BXXC 1I3QK
chains in the Genus database with same CATH superfamily
2FQOA 1IW7A 1WSVA 2RGRA 4C2MC 4BBRC 1WOSA 2BE5A 3AQOA 5EGHA 2NVXA 1WOOA 4YFKA 3FOEA 3S17K 4LQYA 4RMFA 3GTJC 4BBSK 2R93A 4C3HK 2VUMA 2CFAB 2PHCB 1XZPB 4FZBA 1JQWA 3I4MK 1USMA 2NVYK 1VRQC 1TWFA 4G0WA 4XCHA 4QIWL 1ZBSA 2NVQC 2EBBA 1X31C 3H0GC 3PO3K 4KASA 1SFOK 2PPBA 4KMHA 5IOQA 1WCMK 3M3YC 3NUHA 1EQRA 5IOTA 4GT9A 1TWAA 3HXAA 4KB4A 2ZFZA 3BUEA 1BGWA 5IYBC 4C3IC 1ISEA 1O2AA 1DD5A 3GTKC 4XSZA 4XSXA 4BY1C 4LR2A 3S2HK 3MMLB 3S1RC 1XXCA 5IYDC 4KM8A 4QIWD 1JVIA 4Q4ZA 4C2MK 3I4NC 2NVTC 4G7ZA 1IE0A 2R7ZC 1TWAK 4LLGA 2WAQD 4WILA 3FKIA 2E2IA 4J3NA 3LPXA 3S2DK 1TWFC 4X6AK 4A3BC 1YNNA 2JA7A 1XZQA 1TWFK 4X6AC 4P5BA 4YG2A 1Y1WA 5C4JC 1O26A 1G51A 4QJVA 3LAPA 2O5JA 4LOWA 2YU9K 4A3JK 1TWHA 5C3EC 4A3JC 3QX3A 4G7HA 2JA6C 3GTGK 5JVOA 4BXXC 2WAQL 2E2JC 4A3GC 4BY7K 3CQZA 2R92A 1SFOA 5IP7K 2GAHC 2RH6A 5TJ3A 5M5XK 3RZOK 3HOUK 4GTAA 4AYBD 2GSUA 4OIPA 3M4OK 1IQ0A 1PJ5A 1WOPA 5M5YK 1WIHA 3Q3QA 4GFQA 5IORA 1VJEA 5C44K 5IP9K 1USOA 3S15C 3GEEA 1XXAA 3GTMK 1EH1A 1VH2A 3S1QC 2R7ZK 3SZZA 3T02A 3H0GK 3PO3C 2JA7C 2E2HA 2JA5C 1TWGA 1YNJA 4A3KK 1Y1WC 3HOVC 5TMFA 4A93C 3VA7A 1R9TA 3OREA 3H3VL 1EK8A 3RZDC 2GSOA 4DDQA 4OIRA 4O2DA 1WSRA 4AYBL 2W7VA 3GSIA 3GIRA 4BY1K 2JA5A 5C4XC 3K7AC 3S2HC 1BS2A 5IYBK 2B63C 2P8TA 2V6UA 3S1MC 1J6XA 4ILDA 3GTPK 1I6VA 2B63K 1O29A 2CW0A 2NVTK 4OINA 2PA8L 1B4AA 5CJ9A 3WODA 4KMUA 1KQ4A 4BBRK 3G4AA 1V5VA 1K83C 1HI9A 4KN4A 1F93A 3GTLK 4AH6A 2YU9A 3HOZC 1WORA 3TFJA 4KARA 3GTMC 1I50C 4A3CC 3GTLC 3M3YK 3HOZK 2KWAA 3GEHA 4KN7A 5L46A 4PAAA 4A3IC 2NVQK 1TWCK 3AD7C 4MEXA 4Y7NC 1XXBA 1L0WA 3A8IA 2PA8D 4A3FC 4C3JK 1WQFA 1EI6A 4A3LK 4BLAA 4ZH4A 1SMYA 4GTLA 4G7OA 3GTPA 3BP8C 1I3QK 1ZYRA 3K7AK 3A8KA 1TWGK 1O27A 5D4DA 1YCLA 3S1RK 3GTJK 4BBSC 3CAGA 1TWAC 2A68A 1TWCA 4G0UA 3HOXK 3M4OC 1BDFA 4BLBA 3BP3A 3GTKA 3GTJA 2PMZD 5FJ8K 5HL8A 1WQGA 3T00A 3N0CA 3GTGA 3N3YA 1TWHC 4A3IK 2NVYC 3HOVK 1WCMA 3GTOC 4YFXA 3PO2C 1TWHK 2XCRB 1O2BA 4NOIA 3S16C 1PJ6A 1DCOA 3FKIC 3FHZA 4YFNA 4A3EK 4A3KC 1Y1WK 5IYCC 2NVYA 3AQPA 4A93K 4GTBA 2V6TA 2R93C 1I3QA 2VUMK 4A3GK 2Y3PA 2YU9C 3HKZD 1WQHA 3S1MK 1INNA 1RU0A 1I50A 5FLMK 5IYDK 4C3IK 1PJ7A 1Y1VC 2VUMC 3IPJA 1ZVUA 2ZUFA 4A3LC 1J98A 3HOWC 3FOFA 3AH5A 3SZYA 1Y1VK 2O5IA 3H3VD 2CFAA 2B63A 2GSNA 4C3HC 1I6HK 3OEPA 2ZUEA 1ZQ1C 3RZOC 3DXJA 4OIOA 3S17C 2JH3A 3AD9C 4QJVB 1XPPA 5C44C 3HOXC 1EFWA 1F9NA 1ZXOA 4BKWA 4KMAA 4G0VA 3HOYC 1VGXA 3HKZL 3TFHA 1DCPA 4WJ3M 1J6VA 1O25A 3S16K 2E2IK 4A3MC 2Y0SL 4XLPA 5IOSA 4A3EC 4A3BK 1F7VA 4MQ9A 3S14K 4KM9A 5C3EK 4A3DK 3N0BA 5M3MK 2JA6A 2R7ZA 2A69A 4XLNA 2WB1L 1XZPA 3AD8C 4A3FK 1DCHA 1K83A 2GAGC 1IBAA 3S0XA 2JA6K 2JA8K 1YX2A 2XCQA 1I6HC 3CQZC 2R92C 2FQTA 1R9TK 3V4GA 3LAJA 3GTMA 1K83K 3GTPC 4WJ4A 1IL2A 4GTCA 1BJTA 3CQZK 1VLOA 2R92K 3S15K 2Y0SD 4LJZA 4FM9A 3H0GA 4A3CK 1Y1VA 4M1XA 3S1NK 4C45A 4A3MK 1GE9A 3GTQA 2WB1D 3ADAC 4MEYA 5C4JK 1I50K 3RZDK 3A8JA 4GTEA 2P5MA 4A3DC 2JA7K 1B4BA 2NVXC 3PO2K 1SFOC 5TMCA 2E2IC 2R93K 1JOEA 3GTQC 1WCMC 5C4XK 3GTOA 4GZYA 4P5AA 1F7UA 2PMZL 3S14C 5FLMC 3FKIK 3G4CA 5M3FK 4BXXK 3GTQK 3JSTA 4BY7C 4Q5SA 2JA8C 5M5WK 3GTLA 3T01A 5CHPA 3HOUC 4LK1A 1J6WA 1XZQB 3GDZA 5EGEA 3TTGA 1I3QC 2D6FC 4KMDA 3L4KA 1HQMA 3HOWK 3L4JA 1TWGC 1R9TC 2XCOA 3I4MC 1IS1A 3S1QK 1O2FB 3I4NK 4KC6A 3S2DC 3S1NC 3HOYK 4PABA 3GEIA 1O28A 5IP9C 4KDDA 2JA5K 5E68A 4LK0A 1TWCC 4JK1A 3ERED 2V6SA 1AB4A 1C0AA 2A6EA 3OPFA 4Y7NK 3TFIA 5JFEA 4Y52K 5IYCK 3GTOK 3EQLA 2A6HA 4KB2A 4OIQA 4GTDA 1UV7A 1O24A 2E2HK 4Y52C 4KATA 2NVXK 3GTKK 3GTGC 4GTFA 4P9SA 2E2HC 2E2JK 4KAWX 5IP7C 4C3JC
chains in the Genus database with same CATH topology
2WAQL 1IW7A 2E2JC 1ZYRA 3K7AK 4A3GC 4BY7K 2JA6K 2JA8K 5IP7K 1TWGK 2BE5A 4BBRC 1I6HC 5M5XK 5D4DA 3RZOK 3CQZC 2R92C 3HOUK 1R9TK 3S1RK 4AYBD 3GTJK 1K83K 3GTPC 4OIPA 3M4OK 4BBSC 1TWAC 4YFKA 3S17K 3CQZK 5M5YK 2R92K 2A68A 3S15K 2Y0SD 5C44K 3HOXK 3GTJC 4BBSK 3M4OC 4LJZA 4C3HK 5IP9K 1BDFA 3S15C 3GTMK 2PMZD 3I4MK 5FJ8K 4A3CK 3S1QC 2R7ZK 2NVYK 3H0GK 3PO3C 3S1NK 4QIWL 4A3MK 1TWHC 2WB1D 4A3IK 2NVYC 3HOVK 2NVQC 3GTOC 2JA7C 4YFXA 4MEYA 3H0GC 5C4JK 3PO2C 3PO3K 1SFOK 1I50K 2JA5C 2PPBA 3RZDK 1TWHK 1YNJA 1WCMK 4A3KK 1Y1WC 5TMFA 3HOVC 2JA7K 2NVXC 3M3YC 4A93C 4NOIA 3PO2K 4A3DC 3H3VL 3S16C 1SFOC 5TMCA 2E2IC 3RZDC 3FKIC 2R93K 3GTQC 4OIRA 4YFNA 4A3EK 1WCMC 5C4XK 5IYCC 4A3KC 1Y1WK 4A93K 4GZYA 4AYBL 2PMZL 3S14C 5IYBC 3FKIK 5FLMC 5M3FK 4BY1K 3GTQK 4BXXK 2R93C 2VUMK 5C4XC 3K7AC 2YU9C 3S2HC 3HKZD 4BY7C 3GTKC 4A3GK 4XSZA 3S1MK 2JA8C 5M5WK 4XSXA 4Q5SA 5IYBK 5FLMK 4BY1C 2B63C 4C3IK 5IYDK 1Y1VC 2VUMC 3HOUC 4LK1A 3S2HK 4A3LC 3S1MC 3S1RC 3HOWC 3GTPK 1I6VA 5IYDC 2B63K 1I3QC 1Y1VK 2CW0A 2NVTK 2O5IA 1HQMA 4QIWD 4OINA 2PA8L 3H3VD 3HOWK 4Q4ZA 4C2MK 3WODA 4KMUA 1TWGC 4BBRK 3I4NC 1I6HK 3RZOC 2NVTC 4G7ZA 1R9TC 3I4MC 3S1QK 1K83C 3DXJA 2R7ZC 3I4NK 4OIOA 1TWAK 3S17C 4LLGA 2WAQD 3S2DC 4KN4A 3S1NC 4QJVB 3HOYK 1XPPA 5C44C 3HOXC 3GTLK 3GTGK 5IP9C 3HOZC 3S2DK 1TWFC 3GTMC 4X6AK 3HOYC 1I50C 2JA5K 4A3CC 3GTLC 3HKZL 4A3BC 1YNNA 4LK0A 3HOZK 3M3YK 1TWCC 1TWFK 4JK1A 4X6AC 3S16K 4KN7A 2E2IK 4A3MC 2A6EA 2Y0SL 4Y7NK 4XLPA 4YG2A 4A3EC 4A3IC 4Y52K 4A3BK 5IYCK 2NVQK 3GTOK 3EQLA 1TWCK 2A6HA 5C4JC 4OIQA 4MQ9A 3S14K 4MEXA 2O5JA 4QJVA 4Y7NC 5C3EK 4Y52C 2E2HK 4A3DK 2YU9K 4A3JK 2PA8D 2NVXK 3GTKK 4A3FC 3GTGC 5M3MK 4C3JK 2A69A 4XLNA 2WB1L 5C3EC 2E2HC 2E2JK 4A3JC 4A3LK 4ZH4A 4G7HA 2JA6C 1SMYA 5IP7C 4A3FK 4G7OA 4BXXC 1I3QK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ L;  1IW7 A;  2E2J C;  1ZYR A;  3K7A K;  4A3G C;  4BY7 K;  2JA6 K;  2JA8 K;  5IP7 K;  1TWG K;  2BE5 A;  4BBR C;  1I6H C;  5M5X K;  5D4D A;  3RZO K;  3CQZ C;  2R92 C;  3HOU K;  1R9T K;  3S1R K;  4AYB D;  3GTJ K;  1K83 K;  3GTP C;  4OIP A;  3M4O K;  4BBS C;  1TWA C;  4YFK A;  3S17 K;  3CQZ K;  5M5Y K;  2R92 K;  2A68 A;  3S15 K;  2Y0S D;  5C44 K;  3HOX K;  3GTJ C;  4BBS K;  3M4O C;  4LJZ A;  4C3H K;  5IP9 K;  1BDF A;  3S15 C;  3GTM K;  2PMZ D;  3I4M K;  5FJ8 K;  4A3C K;  3S1Q C;  2R7Z K;  2NVY K;  3H0G K;  3PO3 C;  3S1N K;  4QIW L;  4A3M K;  1TWH C;  2WB1 D;  4A3I K;  2NVY C;  3HOV K;  2NVQ C;  3GTO C;  2JA7 C;  4YFX A;  4MEY A;  3H0G C;  5C4J K;  3PO2 C;  3PO3 K;  1SFO K;  1I50 K;  2JA5 C;  2PPB A;  3RZD K;  1TWH K;  1YNJ A;  1WCM K;  4A3K K;  1Y1W C;  5TMF A;  3HOV C;  2JA7 K;  2NVX C;  3M3Y C;  4A93 C;  4NOI A;  3PO2 K;  4A3D C;  3H3V L;  3S16 C;  1SFO C;  5TMC A;  2E2I C;  3RZD C;  3FKI C;  2R93 K;  3GTQ C;  4OIR A;  4YFN A;  4A3E K;  1WCM C;  5C4X K;  5IYC C;  4A3K C;  1Y1W K;  4A93 K;  4GZY A;  4AYB L;  2PMZ L;  3S14 C;  5IYB C;  3FKI K;  5FLM C;  5M3F K;  4BY1 K;  3GTQ K;  4BXX K;  2R93 C;  2VUM K;  5C4X C;  3K7A C;  2YU9 C;  3S2H C;  3HKZ D;  4BY7 C;  3GTK C;  4A3G K;  4XSZ A;  3S1M K;  2JA8 C;  5M5W K;  4XSX A;  4Q5S A;  5IYB K;  5FLM K;  4BY1 C;  2B63 C;  4C3I K;  5IYD K;  1Y1V C;  2VUM C;  3HOU C;  4LK1 A;  3S2H K;  4A3L C;  3S1M C;  3S1R C;  3HOW C;  3GTP K;  1I6V A;  5IYD C;  2B63 K;  1I3Q C;  1Y1V K;  2CW0 A;  2NVT K;  2O5I A;  1HQM A;  4QIW D;  4OIN A;  2PA8 L;  3H3V D;  3HOW K;  4Q4Z A;  4C2M K;  3WOD A;  4KMU A;  1TWG C;  4BBR K;  3I4N C;  1I6H K;  3RZO C;  2NVT C;  4G7Z A;  1R9T C;  3I4M C;  3S1Q K;  1K83 C;  3DXJ A;  2R7Z C;  3I4N K;  4OIO A;  1TWA K;  3S17 C;  4LLG A;  2WAQ D;  3S2D C;  4KN4 A;  3S1N C;  4QJV B;  3HOY K;  1XPP A;  5C44 C;  3HOX C;  3GTL K;  3GTG K;  5IP9 C;  3HOZ C;  3S2D K;  1TWF C;  3GTM C;  4X6A K;  3HOY C;  1I50 C;  2JA5 K;  4A3C C;  3GTL C;  3HKZ L;  4A3B C;  1YNN A;  4LK0 A;  3HOZ K;  3M3Y K;  1TWC C;  1TWF K;  4JK1 A;  4X6A C;  3S16 K;  4KN7 A;  2E2I K;  4A3M C;  2A6E A;  2Y0S L;  4Y7N K;  4XLP A;  4YG2 A;  4A3E C;  4A3I C;  4Y52 K;  4A3B K;  5IYC K;  2NVQ K;  3GTO K;  3EQL A;  1TWC K;  2A6H A;  5C4J C;  4OIQ A;  4MQ9 A;  3S14 K;  4MEX A;  2O5J A;  4QJV A;  4Y7N C;  5C3E K;  4Y52 C;  2E2H K;  4A3D K;  2YU9 K;  4A3J K;  2PA8 D;  2NVX K;  3GTK K;  4A3F C;  3GTG C;  5M3M K;  4C3J K;  2A69 A;  4XLN A;  2WB1 L;  5C3E C;  2E2H C;  2E2J K;  4A3J C;  4A3L K;  4ZH4 A;  4G7H A;  2JA6 C;  1SMY A;  5IP7 C;  4A3F K;  4G7O A;  4BXX C;  1I3Q K; 
#chains in the Genus database with same CATH topology
 2FQO A;  1IW7 A;  1WSV A;  2RGR A;  4C2M C;  4BBR C;  1WOS A;  2BE5 A;  3AQO A;  5EGH A;  2NVX A;  1WOO A;  4YFK A;  3FOE A;  3S17 K;  4LQY A;  4RMF A;  3GTJ C;  4BBS K;  2R93 A;  4C3H K;  2VUM A;  2CFA B;  2PHC B;  1XZP B;  4FZB A;  1JQW A;  3I4M K;  1USM A;  2NVY K;  1VRQ C;  1TWF A;  4G0W A;  4XCH A;  4QIW L;  1ZBS A;  2NVQ C;  2EBB A;  1X31 C;  3H0G C;  3PO3 K;  4KAS A;  1SFO K;  2PPB A;  4KMH A;  5IOQ A;  1WCM K;  3M3Y C;  3NUH A;  1EQR A;  5IOT A;  4GT9 A;  1TWA A;  3HXA A;  4KB4 A;  2ZFZ A;  3BUE A;  1BGW A;  5IYB C;  4C3I C;  1ISE A;  1O2A A;  1DD5 A;  3GTK C;  4XSZ A;  4XSX A;  4BY1 C;  4LR2 A;  3S2H K;  3MML B;  3S1R C;  1XXC A;  5IYD C;  4KM8 A;  4QIW D;  1JVI A;  4Q4Z A;  4C2M K;  3I4N C;  2NVT C;  4G7Z A;  1IE0 A;  2R7Z C;  1TWA K;  4LLG A;  2WAQ D;  4WIL A;  3FKI A;  2E2I A;  4J3N A;  3LPX A;  3S2D K;  1TWF C;  4X6A K;  4A3B C;  1YNN A;  2JA7 A;  1XZQ A;  1TWF K;  4X6A C;  4P5B A;  4YG2 A;  1Y1W A;  5C4J C;  1O26 A;  1G51 A;  4QJV A;  3LAP A;  2O5J A;  4LOW A;  2YU9 K;  4A3J K;  1TWH A;  5C3E C;  4A3J C;  3QX3 A;  4G7H A;  2JA6 C;  3GTG K;  5JVO A;  4BXX C;  2WAQ L;  2E2J C;  4A3G C;  4BY7 K;  3CQZ A;  2R92 A;  1SFO A;  5IP7 K;  2GAH C;  2RH6 A;  5TJ3 A;  5M5X K;  3RZO K;  3HOU K;  4GTA A;  4AYB D;  2GSU A;  4OIP A;  3M4O K;  1IQ0 A;  1PJ5 A;  1WOP A;  5M5Y K;  1WIH A;  3Q3Q A;  4GFQ A;  5IOR A;  1VJE A;  5C44 K;  5IP9 K;  1USO A;  3S15 C;  3GEE A;  1XXA A;  3GTM K;  1EH1 A;  1VH2 A;  3S1Q C;  2R7Z K;  3SZZ A;  3T02 A;  3H0G K;  3PO3 C;  2JA7 C;  2E2H A;  2JA5 C;  1TWG A;  1YNJ A;  4A3K K;  1Y1W C;  3HOV C;  5TMF A;  4A93 C;  3VA7 A;  1R9T A;  3ORE A;  3H3V L;  1EK8 A;  3RZD C;  2GSO A;  4DDQ A;  4OIR A;  4O2D A;  1WSR A;  4AYB L;  2W7V A;  3GSI A;  3GIR A;  4BY1 K;  2JA5 A;  5C4X C;  3K7A C;  3S2H C;  1BS2 A;  5IYB K;  2B63 C;  2P8T A;  2V6U A;  3S1M C;  1J6X A;  4ILD A;  3GTP K;  1I6V A;  2B63 K;  1O29 A;  2CW0 A;  2NVT K;  4OIN A;  2PA8 L;  1B4A A;  5CJ9 A;  3WOD A;  4KMU A;  1KQ4 A;  4BBR K;  3G4A A;  1V5V A;  1K83 C;  1HI9 A;  4KN4 A;  1F93 A;  3GTL K;  4AH6 A;  2YU9 A;  3HOZ C;  1WOR A;  3TFJ A;  4KAR A;  3GTM C;  1I50 C;  4A3C C;  3GTL C;  3M3Y K;  3HOZ K;  2KWA A;  3GEH A;  4KN7 A;  5L46 A;  4PAA A;  4A3I C;  2NVQ K;  1TWC K;  3AD7 C;  4MEX A;  4Y7N C;  1XXB A;  1L0W A;  3A8I A;  2PA8 D;  4A3F C;  4C3J K;  1WQF A;  1EI6 A;  4A3L K;  4BLA A;  4ZH4 A;  1SMY A;  4GTL A;  4G7O A;  3GTP A;  3BP8 C;  1I3Q K;  1ZYR A;  3K7A K;  3A8K A;  1TWG K;  1O27 A;  5D4D A;  1YCL A;  3S1R K;  3GTJ K;  4BBS C;  3CAG A;  1TWA C;  2A68 A;  1TWC A;  4G0U A;  3HOX K;  3M4O C;  1BDF A;  4BLB A;  3BP3 A;  3GTK A;  3GTJ A;  2PMZ D;  5FJ8 K;  5HL8 A;  1WQG A;  3T00 A;  3N0C A;  3GTG A;  3N3Y A;  1TWH C;  4A3I K;  2NVY C;  3HOV K;  1WCM A;  3GTO C;  4YFX A;  3PO2 C;  1TWH K;  2XCR B;  1O2B A;  4NOI A;  3S16 C;  1PJ6 A;  1DCO A;  3FKI C;  3FHZ A;  4YFN A;  4A3E K;  4A3K C;  1Y1W K;  5IYC C;  2NVY A;  3AQP A;  4A93 K;  4GTB A;  2V6T A;  2R93 C;  1I3Q A;  2VUM K;  4A3G K;  2Y3P A;  2YU9 C;  3HKZ D;  1WQH A;  3S1M K;  1INN A;  1RU0 A;  1I50 A;  5FLM K;  5IYD K;  4C3I K;  1PJ7 A;  1Y1V C;  2VUM C;  3IPJ A;  1ZVU A;  2ZUF A;  4A3L C;  1J98 A;  3HOW C;  3FOF A;  3AH5 A;  3SZY A;  1Y1V K;  2O5I A;  3H3V D;  2CFA A;  2B63 A;  2GSN A;  4C3H C;  1I6H K;  3OEP A;  2ZUE A;  1ZQ1 C;  3RZO C;  3DXJ A;  4OIO A;  3S17 C;  2JH3 A;  3AD9 C;  4QJV B;  1XPP A;  5C44 C;  3HOX C;  1EFW A;  1F9N A;  1ZXO A;  4BKW A;  4KMA A;  4G0V A;  3HOY C;  1VGX A;  3HKZ L;  3TFH A;  1DCP A;  4WJ3 M;  1J6V A;  1O25 A;  3S16 K;  2E2I K;  4A3M C;  2Y0S L;  4XLP A;  5IOS A;  4A3E C;  4A3B K;  1F7V A;  4MQ9 A;  3S14 K;  4KM9 A;  5C3E K;  4A3D K;  3N0B A;  5M3M K;  2JA6 A;  2R7Z A;  2A69 A;  4XLN A;  2WB1 L;  1XZP A;  3AD8 C;  4A3F K;  1DCH A;  1K83 A;  2GAG C;  1IBA A;  3S0X A;  2JA6 K;  2JA8 K;  1YX2 A;  2XCQ A;  1I6H C;  3CQZ C;  2R92 C;  2FQT A;  1R9T K;  3V4G A;  3LAJ A;  3GTM A;  1K83 K;  3GTP C;  4WJ4 A;  1IL2 A;  4GTC A;  1BJT A;  3CQZ K;  1VLO A;  2R92 K;  3S15 K;  2Y0S D;  4LJZ A;  4FM9 A;  3H0G A;  4A3C K;  1Y1V A;  4M1X A;  3S1N K;  4C45 A;  4A3M K;  1GE9 A;  3GTQ A;  2WB1 D;  3ADA C;  4MEY A;  5C4J K;  1I50 K;  3RZD K;  3A8J A;  4GTE A;  2P5M A;  4A3D C;  2JA7 K;  1B4B A;  2NVX C;  3PO2 K;  1SFO C;  5TMC A;  2E2I C;  2R93 K;  1JOE A;  3GTQ C;  1WCM C;  5C4X K;  3GTO A;  4GZY A;  4P5A A;  1F7U A;  2PMZ L;  3S14 C;  5FLM C;  3FKI K;  3G4C A;  5M3F K;  4BXX K;  3GTQ K;  3JST A;  4BY7 C;  4Q5S A;  2JA8 C;  5M5W K;  3GTL A;  3T01 A;  5CHP A;  3HOU C;  4LK1 A;  1J6W A;  1XZQ B;  3GDZ A;  5EGE A;  3TTG A;  1I3Q C;  2D6F C;  4KMD A;  3L4K A;  1HQM A;  3HOW K;  3L4J A;  1TWG C;  1R9T C;  2XCO A;  3I4M C;  1IS1 A;  3S1Q K;  1O2F B;  3I4N K;  4KC6 A;  3S2D C;  3S1N C;  3HOY K;  4PAB A;  3GEI A;  1O28 A;  5IP9 C;  4KDD A;  2JA5 K;  5E68 A;  4LK0 A;  1TWC C;  4JK1 A;  3ERE D;  2V6S A;  1AB4 A;  1C0A A;  2A6E A;  3OPF A;  4Y7N K;  3TFI A;  5JFE A;  4Y52 K;  5IYC K;  3GTO K;  3EQL A;  2A6H A;  4KB2 A;  4OIQ A;  4GTD A;  1UV7 A;  1O24 A;  2E2H K;  4Y52 C;  4KAT A;  2NVX K;  3GTK K;  3GTG C;  4GTF A;  4P9S A;  2E2H C;  2E2J K;  4KAW X;  5IP7 C;  4C3J C; 
#chains in the Genus database with same CATH homology
 2WAQ L;  1IW7 A;  2E2J C;  1ZYR A;  3K7A K;  4A3G C;  4BY7 K;  2JA6 K;  2JA8 K;  5IP7 K;  1TWG K;  2BE5 A;  4BBR C;  1I6H C;  5M5X K;  5D4D A;  3RZO K;  3CQZ C;  2R92 C;  3HOU K;  1R9T K;  3S1R K;  4AYB D;  3GTJ K;  1K83 K;  3GTP C;  4OIP A;  3M4O K;  4BBS C;  1TWA C;  4YFK A;  3S17 K;  3CQZ K;  5M5Y K;  2R92 K;  2A68 A;  3S15 K;  2Y0S D;  5C44 K;  3HOX K;  3GTJ C;  4BBS K;  3M4O C;  4LJZ A;  4C3H K;  5IP9 K;  1BDF A;  3S15 C;  3GTM K;  2PMZ D;  3I4M K;  5FJ8 K;  4A3C K;  3S1Q C;  2R7Z K;  2NVY K;  3H0G K;  3PO3 C;  3S1N K;  4QIW L;  4A3M K;  1TWH C;  2WB1 D;  4A3I K;  2NVY C;  3HOV K;  2NVQ C;  3GTO C;  2JA7 C;  4YFX A;  4MEY A;  3H0G C;  5C4J K;  3PO2 C;  3PO3 K;  1SFO K;  1I50 K;  2JA5 C;  2PPB A;  3RZD K;  1TWH K;  1YNJ A;  1WCM K;  4A3K K;  1Y1W C;  5TMF A;  3HOV C;  2JA7 K;  2NVX C;  3M3Y C;  4A93 C;  4NOI A;  3PO2 K;  4A3D C;  3H3V L;  3S16 C;  1SFO C;  5TMC A;  2E2I C;  3RZD C;  3FKI C;  2R93 K;  3GTQ C;  4OIR A;  4YFN A;  4A3E K;  1WCM C;  5C4X K;  5IYC C;  4A3K C;  1Y1W K;  4A93 K;  4GZY A;  4AYB L;  2PMZ L;  3S14 C;  5IYB C;  3FKI K;  5FLM C;  5M3F K;  4BY1 K;  3GTQ K;  4BXX K;  2R93 C;  2VUM K;  5C4X C;  3K7A C;  2YU9 C;  3S2H C;  3HKZ D;  4BY7 C;  3GTK C;  4A3G K;  4XSZ A;  3S1M K;  2JA8 C;  5M5W K;  4XSX A;  4Q5S A;  5IYB K;  5FLM K;  4BY1 C;  2B63 C;  4C3I K;  5IYD K;  1Y1V C;  2VUM C;  3HOU C;  4LK1 A;  3S2H K;  4A3L C;  3S1M C;  3S1R C;  3HOW C;  3GTP K;  1I6V A;  5IYD C;  2B63 K;  1I3Q C;  1Y1V K;  2CW0 A;  2NVT K;  2O5I A;  1HQM A;  4QIW D;  4OIN A;  2PA8 L;  3H3V D;  3HOW K;  4Q4Z A;  4C2M K;  3WOD A;  4KMU A;  1TWG C;  4BBR K;  3I4N C;  1I6H K;  3RZO C;  2NVT C;  4G7Z A;  1R9T C;  3I4M C;  3S1Q K;  1K83 C;  3DXJ A;  2R7Z C;  3I4N K;  4OIO A;  1TWA K;  3S17 C;  4LLG A;  2WAQ D;  3S2D C;  4KN4 A;  3S1N C;  4QJV B;  3HOY K;  1XPP A;  5C44 C;  3HOX C;  3GTL K;  3GTG K;  5IP9 C;  3HOZ C;  3S2D K;  1TWF C;  3GTM C;  4X6A K;  3HOY C;  1I50 C;  2JA5 K;  4A3C C;  3GTL C;  3HKZ L;  4A3B C;  1YNN A;  4LK0 A;  3HOZ K;  3M3Y K;  1TWC C;  1TWF K;  4JK1 A;  4X6A C;  3S16 K;  4KN7 A;  2E2I K;  4A3M C;  2A6E A;  2Y0S L;  4Y7N K;  4XLP A;  4YG2 A;  4A3E C;  4A3I C;  4Y52 K;  4A3B K;  5IYC K;  2NVQ K;  3GTO K;  3EQL A;  1TWC K;  2A6H A;  5C4J C;  4OIQ A;  4MQ9 A;  3S14 K;  4MEX A;  2O5J A;  4QJV A;  4Y7N C;  5C3E K;  4Y52 C;  2E2H K;  4A3D K;  2YU9 K;  4A3J K;  2PA8 D;  2NVX K;  3GTK K;  4A3F C;  3GTG C;  5M3M K;  4C3J K;  2A69 A;  4XLN A;  2WB1 L;  5C3E C;  2E2H C;  2E2J K;  4A3J C;  4A3L K;  4ZH4 A;  4G7H A;  2JA6 C;  1SMY A;  5IP7 C;  4A3F K;  4G7O A;  4BXX C;  1I3Q K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...