3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
4AYBL 1SFOK 1TWCC 3S2DK 4LK1A 4A3BC 2R93K 2NVYK 3H3VD 3RZOC 1YNNA 1ZYRA 2JA6C 3RZDK 5D4DA 4A93K 2PA8D 5IYBC 5IP7K 5C44K 3GTMK 4GZYA 4Q4ZA 3S2DC 4Y52K 2E2IK 2JA8K 2NVYC 5IYCK 1I50K 3HKZD 3S1QK 3GTKK 4YFXA 4A3IK 3GTOK 3K7AC 4JK1A 4A3FK 2A6HA 3RZDC 3H3VL 2PPBA 1TWGC 3S14C 1I6VA 4XLPA 2A6EA 5IP7C 5C44C 5IP9K 5TMCA 3S1MK 2PA8L 4Y52C 2E2HK 1TWHK 3HOXK 2JA8C 4MEYA 5IYCC 1I50C 4QIWD 1R9TK 3GTKC 5M5XK 4A3IC 3GTOC 4KMUA 1WCMC 4MQ9A 4A3FC 4A3GK 3I4MK 4A3JC 3HKZL 1K83K 2NVTK 4A3CK 2CW0A 2NVQC 3GTQK 2E2JC 4MEXA 3S15C 5IP9C 4X6AK 3EQLA 3S1MC 1Y1VK 4OIOA 1TWHC 3S1NK 3PO3K 1R9TC 2BE5A 3PO2K 3S1QC 3S1RK 1Y1WK 4A3KK 1SFOC 4QJVA 2R93C 4A3GC 3HOZK 1TWFK 3I4MC 2NVTC 3GTLK 2WAQD 4A3CC 4QJVB 3GTQC 4Y7NK 3CQZK 3M4OK 3H0GK 4XSZA 5FLMK 4A93C 3M3YK 1XPPA 3PO3C 4OIRA 3S1NC 5C4JK 3PO2C 1TWAK 3S1RC 1Y1WC 4A3KC 3GTMC 3HOUK 2NVXK 4BY1K 4XLNA 2JA7K 2E2IC 3HOZC 1TWFC 5TMFA 4BBRK 4C3HK 3GTLC 1SMYA 5FJ8K 4OIPA 2B63K 2JA5K 4A3LK 4Y7NC 3CQZC 5M5WK 3M4OC 3H0GC 1BDFA 2Y0SD 5IYDK 5FLMC 2WAQL 4BY7K 5C4XK 4C3IK 2O5IA 3HOVK 1TWAC 3HOUC 2A69A 3HOWK 4LJZA 2NVXC 4BXXK 2E2HC 2JA7C 3GTPK 3HOXC 4XSXA 4BBRC 4C3JK 4G7ZA 3GTGK 4OINA 2B63C 2JA5C 4A3BK 4A3LC 3S16K 4LLGA 3GTJK 3RZOK 4BBSK 5M5YK 5IYDC 4YG2A 1K83C 4QIWL 1YNJA 2JA6K 4YFKA 3FKIK 4C2MK 3HOYK 3S17K 4BY7C 4A3DK 3HOWC 2Y0SL 4BXXC 1HQMA 4X6AC 1Y1VC 2PMZD 1IW7A 3GTPC 2WB1D 3GTGC 3S2HK 4Q5SA 3S16C 1I6HK 4KN4A 3GTJC 4BBSC 3S17C 3FKIC 4OIQA 4LK0A 3K7AK 3HOYC 4A3DC 1I3QK 2O5JA 1TWGK 3S14K 4YFNA 4G7OA 4A3EK 3M3YC 3DXJA 5C4JC 3I4NK 5C3EK 3S2HC 4A3MK 4AYBD 4NOIA 5M3FK 2R92K 2VUMK 2R7ZK 1I6HC 2PMZL 2YU9K 4BY1C 2WB1L 5IYBK 1TWCK 1WCMK 4KN7A 1I3QC 4A3JK 4A3EC 2NVQK 5C4XC 3WODA 3HOVC 4ZH4A 2E2JK 3I4NC 5C3EC 3S15K 4A3MC 4G7HA 2R92C 2R7ZC 2VUMC 2A68A 2YU9C 5M3MK
chains in the Genus database with same CATH superfamily
5EGEA 1TWCC 3T02A 4P9SA 2NVYK 1TWAA 1JVIA 3AD9C 3RZDK 1IS1A 2ZUFA 2PA8D 3FOEA 5C44K 4P5BA 3GTMK 4Y52K 4KC6A 2JA8K 5IYCK 1IQ0A 4KMDA 1B4AA 3K7AC 4PABA 3GEEA 1TWGC 4KM8A 2EBBA 1EI6A 3JSTA 2PA8L 2E2HK 1TWHK 4A3IC 4MQ9A 3VA7A 1F7VA 1K83K 3A8IA 5EGHA 4MEXA 3S15C 4BLAA 4KASA 3PO3K 2FQOA 2BE5A 1R9TC 3QX3A 3S1RK 4A3GC 3OEPA 4A3CC 1EFWA 2R92A 2R7ZA 3GTQC 3T00A 2YU9A 3GTKA 3GDZA 3S1NC 3TFIA 1WCMA 3GTMC 4J3NA 4WJ3M 1PJ6A 3GTLC 2B63K 2P8TA 3S0XA 5M5WK 1XZQA 5FLMC 2O5IA 2R93A 4KMHA 1TWAC 1WSVA 1ZBSA 2E2HC 1PJ7A 4KMAA 3AD7C 4A3BK 1JOEA 1Y1WA 4RMFA 4QIWL 1K83C 2JA6K 4BY7C 4C2MK 2E2IA 3HOWC 4KATA 4BXXC 1IW7A 3CQZA 1YX2A 4C3JC 2V6TA 1O29A 1J6WA 3S16C 3S17C 3FKIC 1WQGA 2O5JA 4A3EK 3I4NK 3S2HC 3A8KA 3SZYA 4AYBD 5HL8A 3N0BA 1TWCK 3GTPA 2NVQK 4GTCA 5L46A 5C3EC 4BKWA 1TWFA 3GTJA 2R92C 2R7ZC 2YU9C 2D6FC 1BGWA 2P5MA 4AYBL 4GTLA 1SFOK 4LK1A 4A3BC 4G0UA 3H3VD 1YNNA 2GAGC 4KARA 2JA6C 3T01A 2JA7A 1F9NA 1VLOA 4GTAA 5IYBC 4GZYA 4Q4ZA 3G4AA 3S2DC 3AH5A 1XZPB 4YFXA 1IE0A 4A3IK 3N0CA 3H3VL 1PJ5A 2PPBA 2GAHC 5IP7C 1O2BA 5TMCA 2V6SA 4GTDA 1R9TK 1I50C 3GTOC 4A3GK 4A3CK 2NVQC 3GTQK 2NVYA 1DCPA 3ADAC 3EQLA 3S1NK 3S1QC 4LR2A 3ERED 1I3QA 1USMA 1SFOC 2ZUEA 3I4MC 3GTLK 1O2AA 4QJVB 4O2DA 5IOSA 4P5AA 5FLMK 5C4JK 3PO2C 1TWAK 4A3KC 1L0WA 1O24A 1YCLA 4BY1K 1G51A 1BJTA 3HOZC 1TWFC 2ZFZA 5TMFA 1SMYA 5FJ8K 1TWHA 3M4OC 3H0GC 1XXCA 2Y0SD 4FZBA 4BY7K 3HOUC 2A69A 3HOWK 4BXXK 2JA7C 1VH2A 4C3JK 4BLBA 2PHCB 2JA5C 4A3LC 3S16K 3RZOK 5M5YK 5IYDC 3BUEA 2XCOA 3OREA 3S17K 4YFKA 3FKIK 3LPXA 2Y0SL 1INNA 3L4KA 2PMZD 4GT9A 3FOFA 2WB1D 3S2HK 2JH3A 4Q5SA 4M1XA 5IORA 4BBSC 1EH1A 3HOYC 2CFAA 3DXJA 1V5VA 5C4JC 3BP3A 5C3EK 4XCHA 2R92K 2R7ZK 2PMZL 3AQOA 2YU9K 4BY1C 2WB1L 2GSNA 1Y1VA 1WCMK 3NUHA 1I3QC 1WOOA 3WODA 2RGRA 2E2JK 1UV7A 4KB2A 3MMLB 4KM9A 5M3MK 5IYBK 3S2DK 2R93K 3RZOC 1ZYRA 2NVXA 1F93A 5IP7K 3BP8C 2E2IK 1WOPA 1I50K 3GTOK 4ILDA 3A8JA 4JK1A 3GTGA 1EQRA 1I6VA 4XLPA 2A6EA 1WIHA 5TJ3A 5E68A 3S1QK 3HOXK 4MEYA 5IOQA 3GTKC 4FM9A 1O27A 3V4GA 4KMUA 1WCMC 3OPFA 4KAWX 3FHZA 4A3FC 3I4MK 4GFQA 2E2JC 5IP9C 1X31C 3AD8C 3S1MC 4X6AK 4G0WA 1XXAA 3PO2K 4A3KK 1TWGA 2R93C 1IBAA 3HOZK 1TWFK 2NVTC 2WAQD 2VUMA 1XXBA 3M4OK 3H0GK 4XSZA 1XPPA 4OIRA 1Y1WC 3HOUK 1O28A 2JA7K 4XLNA 2E2IC 4C3HK 2JA5K 4A3LK 4Y7NC 3CQZC 1R9TA 5IYDK 2WAQL 4C3IK 3HOVK 3GEHA 1XZQB 4LJZA 2NVXC 1VJEA 3HOXC 4XSXA 4BBRC 4G7ZA 4OINA 3Q3QA 4LLGA 4G0VA 5IOTA 3GTMA 4BBSK 4YG2A 2KWAA 4GTEA 3HOYK 4KB4A 3GTLA 4GTBA 4X6AC 1HQMA 3GSIA 3GTPC 1WQFA 1AB4A 4GTFA 3GTGC 5JFEA 3L4JA 3GTJC 4LK0A 2E2HA 4A3DC 1I3QK 3S14K 4YFNA 2GSUA 3TFJA 1HI9A 3TFHA 1K83A 1I6HC 1O26A 1ZXOA 4C3HC 1GE9A 4KN7A 4A3JK 3HXAA 4C3IC 3HOVC 4ZH4A 1DCHA 1JQWA 5CJ9A 1J6XA 4A3MC 2XCQA 2VUMC 3FKIA 4WJ4A 1J6VA 1O2FB 4LQYA 1DD5A 5D4DA 4A93K 2B63A 1C0AA 1XZPA 4PAAA 4KDDA 2NVYC 4C45A 3HKZD 3GTKK 1F7UA 4A3FK 2A6HA 3RZDC 2V6UA 3S14C 4LOWA 5C44C 1IL2A 5JVOA 5IP9K 3S1MK 2JA6A 4Y52C 2XCRB 2JA8C 4G7OA 5IYCC 4QIWD 5M5XK 4WILA 1WSRA 4A3JC 3HKZL 2NVTK 2CW0A 3GIRA 1J98A 1O25A 1EK8A 1Y1VK 4OIOA 1TWHC 1Y1WK 4QJVA 2GSOA 1WORA 1VRQC 2W7VA 4Y7NK 3CQZK 3LAPA 1I50A 3GTOA 4DDQA 4A93C 2FQTA 3M3YK 3PO3C 1TWCA 3LAJA 3S1RC 3SZZA 2NVXK 1WOSA 4BBRK 4OIPA 3TTGA 1BDFA 5C4XK 1SFOA 1RU0A 1ISEA 3G4CA 3GTPK 3GTGK 1B4BA 2B63C 3GTJK 1YNJA 2Y3PA 3GEIA 4A3DK 1Y1VC 4AH6A 3H0GA 1ZVUA 3CAGA 3N3YA 1I6HK 4KN4A 1USOA 1KQ4A 4C2MC 4OIQA 3IPJA 3K7AK 1DCOA 1TWGK 3M3YC 2JA5A 3AQPA 4A3MK 2CFAB 4NOIA 2RH6A 5M3FK 2VUMK 3GTQA 5CHPA 1WQHA 4A3EC 5C4XC 3I4NC 3S15K 4G7HA 1VGXA 2A68A 1ZQ1C 1BS2A
chains in the Genus database with same CATH topology
4AYBL 1SFOK 1TWCC 3S2DK 4LK1A 4A3BC 2R93K 2NVYK 3H3VD 3RZOC 1YNNA 1ZYRA 2JA6C 3RZDK 5D4DA 4A93K 2PA8D 5IYBC 5IP7K 5C44K 3GTMK 4GZYA 4Q4ZA 3S2DC 4Y52K 2E2IK 2JA8K 2NVYC 5IYCK 1I50K 3HKZD 3S1QK 3GTKK 4YFXA 4A3IK 3GTOK 3K7AC 4JK1A 4A3FK 2A6HA 3RZDC 3H3VL 2PPBA 1TWGC 3S14C 1I6VA 4XLPA 2A6EA 5IP7C 5C44C 5IP9K 5TMCA 3S1MK 2PA8L 4Y52C 2E2HK 1TWHK 3HOXK 2JA8C 4MEYA 5IYCC 1I50C 4QIWD 1R9TK 3GTKC 5M5XK 4A3IC 3GTOC 4KMUA 1WCMC 4MQ9A 4A3FC 4A3GK 3I4MK 4A3JC 3HKZL 1K83K 2NVTK 4A3CK 2CW0A 2NVQC 3GTQK 2E2JC 4MEXA 3S15C 5IP9C 4X6AK 3EQLA 3S1MC 1Y1VK 4OIOA 1TWHC 3S1NK 3PO3K 1R9TC 2BE5A 3PO2K 3S1QC 3S1RK 1Y1WK 4A3KK 1SFOC 4QJVA 2R93C 4A3GC 3HOZK 1TWFK 3I4MC 2NVTC 3GTLK 2WAQD 4A3CC 4QJVB 3GTQC 4Y7NK 3CQZK 3M4OK 3H0GK 4XSZA 5FLMK 4A93C 3M3YK 1XPPA 3PO3C 4OIRA 3S1NC 5C4JK 3PO2C 1TWAK 3S1RC 1Y1WC 4A3KC 3GTMC 3HOUK 2NVXK 4BY1K 4XLNA 2JA7K 2E2IC 3HOZC 1TWFC 5TMFA 4BBRK 4C3HK 3GTLC 1SMYA 5FJ8K 4OIPA 2B63K 2JA5K 4A3LK 4Y7NC 3CQZC 5M5WK 3M4OC 3H0GC 1BDFA 2Y0SD 5IYDK 5FLMC 2WAQL 4BY7K 5C4XK 4C3IK 2O5IA 3HOVK 1TWAC 3HOUC 2A69A 3HOWK 4LJZA 2NVXC 4BXXK 2E2HC 2JA7C 3GTPK 3HOXC 4XSXA 4BBRC 4C3JK 4G7ZA 3GTGK 4OINA 2B63C 2JA5C 4A3BK 4A3LC 3S16K 4LLGA 3GTJK 3RZOK 4BBSK 5M5YK 5IYDC 4YG2A 1K83C 4QIWL 1YNJA 2JA6K 4YFKA 3FKIK 4C2MK 3HOYK 3S17K 4BY7C 4A3DK 3HOWC 2Y0SL 4BXXC 1HQMA 4X6AC 1Y1VC 2PMZD 1IW7A 3GTPC 2WB1D 3GTGC 3S2HK 4Q5SA 3S16C 1I6HK 4KN4A 3GTJC 4BBSC 3S17C 3FKIC 4OIQA 4LK0A 3K7AK 3HOYC 4A3DC 1I3QK 2O5JA 1TWGK 3S14K 4YFNA 4G7OA 4A3EK 3M3YC 3DXJA 5C4JC 3I4NK 5C3EK 3S2HC 4A3MK 4AYBD 4NOIA 5M3FK 2R92K 2VUMK 2R7ZK 1I6HC 2PMZL 2YU9K 4BY1C 2WB1L 5IYBK 1TWCK 1WCMK 4KN7A 1I3QC 4A3JK 4A3EC 2NVQK 5C4XC 3WODA 3HOVC 4ZH4A 2E2JK 3I4NC 5C3EC 3S15K 4A3MC 4G7HA 2R92C 2R7ZC 2VUMC 2A68A 2YU9C 5M3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB L;  1SFO K;  1TWC C;  3S2D K;  4LK1 A;  4A3B C;  2R93 K;  2NVY K;  3H3V D;  3RZO C;  1YNN A;  1ZYR A;  2JA6 C;  3RZD K;  5D4D A;  4A93 K;  2PA8 D;  5IYB C;  5IP7 K;  5C44 K;  3GTM K;  4GZY A;  4Q4Z A;  3S2D C;  4Y52 K;  2E2I K;  2JA8 K;  2NVY C;  5IYC K;  1I50 K;  3HKZ D;  3S1Q K;  3GTK K;  4YFX A;  4A3I K;  3GTO K;  3K7A C;  4JK1 A;  4A3F K;  2A6H A;  3RZD C;  3H3V L;  2PPB A;  1TWG C;  3S14 C;  1I6V A;  4XLP A;  2A6E A;  5IP7 C;  5C44 C;  5IP9 K;  5TMC A;  3S1M K;  2PA8 L;  4Y52 C;  2E2H K;  1TWH K;  3HOX K;  2JA8 C;  4MEY A;  5IYC C;  1I50 C;  4QIW D;  1R9T K;  3GTK C;  5M5X K;  4A3I C;  3GTO C;  4KMU A;  1WCM C;  4MQ9 A;  4A3F C;  4A3G K;  3I4M K;  4A3J C;  3HKZ L;  1K83 K;  2NVT K;  4A3C K;  2CW0 A;  2NVQ C;  3GTQ K;  2E2J C;  4MEX A;  3S15 C;  5IP9 C;  4X6A K;  3EQL A;  3S1M C;  1Y1V K;  4OIO A;  1TWH C;  3S1N K;  3PO3 K;  1R9T C;  2BE5 A;  3PO2 K;  3S1Q C;  3S1R K;  1Y1W K;  4A3K K;  1SFO C;  4QJV A;  2R93 C;  4A3G C;  3HOZ K;  1TWF K;  3I4M C;  2NVT C;  3GTL K;  2WAQ D;  4A3C C;  4QJV B;  3GTQ C;  4Y7N K;  3CQZ K;  3M4O K;  3H0G K;  4XSZ A;  5FLM K;  4A93 C;  3M3Y K;  1XPP A;  3PO3 C;  4OIR A;  3S1N C;  5C4J K;  3PO2 C;  1TWA K;  3S1R C;  1Y1W C;  4A3K C;  3GTM C;  3HOU K;  2NVX K;  4BY1 K;  4XLN A;  2JA7 K;  2E2I C;  3HOZ C;  1TWF C;  5TMF A;  4BBR K;  4C3H K;  3GTL C;  1SMY A;  5FJ8 K;  4OIP A;  2B63 K;  2JA5 K;  4A3L K;  4Y7N C;  3CQZ C;  5M5W K;  3M4O C;  3H0G C;  1BDF A;  2Y0S D;  5IYD K;  5FLM C;  2WAQ L;  4BY7 K;  5C4X K;  4C3I K;  2O5I A;  3HOV K;  1TWA C;  3HOU C;  2A69 A;  3HOW K;  4LJZ A;  2NVX C;  4BXX K;  2E2H C;  2JA7 C;  3GTP K;  3HOX C;  4XSX A;  4BBR C;  4C3J K;  4G7Z A;  3GTG K;  4OIN A;  2B63 C;  2JA5 C;  4A3B K;  4A3L C;  3S16 K;  4LLG A;  3GTJ K;  3RZO K;  4BBS K;  5M5Y K;  5IYD C;  4YG2 A;  1K83 C;  4QIW L;  1YNJ A;  2JA6 K;  4YFK A;  3FKI K;  4C2M K;  3HOY K;  3S17 K;  4BY7 C;  4A3D K;  3HOW C;  2Y0S L;  4BXX C;  1HQM A;  4X6A C;  1Y1V C;  2PMZ D;  1IW7 A;  3GTP C;  2WB1 D;  3GTG C;  3S2H K;  4Q5S A;  3S16 C;  1I6H K;  4KN4 A;  3GTJ C;  4BBS C;  3S17 C;  3FKI C;  4OIQ A;  4LK0 A;  3K7A K;  3HOY C;  4A3D C;  1I3Q K;  2O5J A;  1TWG K;  3S14 K;  4YFN A;  4G7O A;  4A3E K;  3M3Y C;  3DXJ A;  5C4J C;  3I4N K;  5C3E K;  3S2H C;  4A3M K;  4AYB D;  4NOI A;  5M3F K;  2R92 K;  2VUM K;  2R7Z K;  1I6H C;  2PMZ L;  2YU9 K;  4BY1 C;  2WB1 L;  5IYB K;  1TWC K;  1WCM K;  4KN7 A;  1I3Q C;  4A3J K;  4A3E C;  2NVQ K;  5C4X C;  3WOD A;  3HOV C;  4ZH4 A;  2E2J K;  3I4N C;  5C3E C;  3S15 K;  4A3M C;  4G7H A;  2R92 C;  2R7Z C;  2VUM C;  2A68 A;  2YU9 C;  5M3M K; 
#chains in the Genus database with same CATH topology
 5EGE A;  1TWC C;  3T02 A;  4P9S A;  2NVY K;  1TWA A;  1JVI A;  3AD9 C;  3RZD K;  1IS1 A;  2ZUF A;  2PA8 D;  3FOE A;  5C44 K;  4P5B A;  3GTM K;  4Y52 K;  4KC6 A;  2JA8 K;  5IYC K;  1IQ0 A;  4KMD A;  1B4A A;  3K7A C;  4PAB A;  3GEE A;  1TWG C;  4KM8 A;  2EBB A;  1EI6 A;  3JST A;  2PA8 L;  2E2H K;  1TWH K;  4A3I C;  4MQ9 A;  3VA7 A;  1F7V A;  1K83 K;  3A8I A;  5EGH A;  4MEX A;  3S15 C;  4BLA A;  4KAS A;  3PO3 K;  2FQO A;  2BE5 A;  1R9T C;  3QX3 A;  3S1R K;  4A3G C;  3OEP A;  4A3C C;  1EFW A;  2R92 A;  2R7Z A;  3GTQ C;  3T00 A;  2YU9 A;  3GTK A;  3GDZ A;  3S1N C;  3TFI A;  1WCM A;  3GTM C;  4J3N A;  4WJ3 M;  1PJ6 A;  3GTL C;  2B63 K;  2P8T A;  3S0X A;  5M5W K;  1XZQ A;  5FLM C;  2O5I A;  2R93 A;  4KMH A;  1TWA C;  1WSV A;  1ZBS A;  2E2H C;  1PJ7 A;  4KMA A;  3AD7 C;  4A3B K;  1JOE A;  1Y1W A;  4RMF A;  4QIW L;  1K83 C;  2JA6 K;  4BY7 C;  4C2M K;  2E2I A;  3HOW C;  4KAT A;  4BXX C;  1IW7 A;  3CQZ A;  1YX2 A;  4C3J C;  2V6T A;  1O29 A;  1J6W A;  3S16 C;  3S17 C;  3FKI C;  1WQG A;  2O5J A;  4A3E K;  3I4N K;  3S2H C;  3A8K A;  3SZY A;  4AYB D;  5HL8 A;  3N0B A;  1TWC K;  3GTP A;  2NVQ K;  4GTC A;  5L46 A;  5C3E C;  4BKW A;  1TWF A;  3GTJ A;  2R92 C;  2R7Z C;  2YU9 C;  2D6F C;  1BGW A;  2P5M A;  4AYB L;  4GTL A;  1SFO K;  4LK1 A;  4A3B C;  4G0U A;  3H3V D;  1YNN A;  2GAG C;  4KAR A;  2JA6 C;  3T01 A;  2JA7 A;  1F9N A;  1VLO A;  4GTA A;  5IYB C;  4GZY A;  4Q4Z A;  3G4A A;  3S2D C;  3AH5 A;  1XZP B;  4YFX A;  1IE0 A;  4A3I K;  3N0C A;  3H3V L;  1PJ5 A;  2PPB A;  2GAH C;  5IP7 C;  1O2B A;  5TMC A;  2V6S A;  4GTD A;  1R9T K;  1I50 C;  3GTO C;  4A3G K;  4A3C K;  2NVQ C;  3GTQ K;  2NVY A;  1DCP A;  3ADA C;  3EQL A;  3S1N K;  3S1Q C;  4LR2 A;  3ERE D;  1I3Q A;  1USM A;  1SFO C;  2ZUE A;  3I4M C;  3GTL K;  1O2A A;  4QJV B;  4O2D A;  5IOS A;  4P5A A;  5FLM K;  5C4J K;  3PO2 C;  1TWA K;  4A3K C;  1L0W A;  1O24 A;  1YCL A;  4BY1 K;  1G51 A;  1BJT A;  3HOZ C;  1TWF C;  2ZFZ A;  5TMF A;  1SMY A;  5FJ8 K;  1TWH A;  3M4O C;  3H0G C;  1XXC A;  2Y0S D;  4FZB A;  4BY7 K;  3HOU C;  2A69 A;  3HOW K;  4BXX K;  2JA7 C;  1VH2 A;  4C3J K;  4BLB A;  2PHC B;  2JA5 C;  4A3L C;  3S16 K;  3RZO K;  5M5Y K;  5IYD C;  3BUE A;  2XCO A;  3ORE A;  3S17 K;  4YFK A;  3FKI K;  3LPX A;  2Y0S L;  1INN A;  3L4K A;  2PMZ D;  4GT9 A;  3FOF A;  2WB1 D;  3S2H K;  2JH3 A;  4Q5S A;  4M1X A;  5IOR A;  4BBS C;  1EH1 A;  3HOY C;  2CFA A;  3DXJ A;  1V5V A;  5C4J C;  3BP3 A;  5C3E K;  4XCH A;  2R92 K;  2R7Z K;  2PMZ L;  3AQO A;  2YU9 K;  4BY1 C;  2WB1 L;  2GSN A;  1Y1V A;  1WCM K;  3NUH A;  1I3Q C;  1WOO A;  3WOD A;  2RGR A;  2E2J K;  1UV7 A;  4KB2 A;  3MML B;  4KM9 A;  5M3M K;  5IYB K;  3S2D K;  2R93 K;  3RZO C;  1ZYR A;  2NVX A;  1F93 A;  5IP7 K;  3BP8 C;  2E2I K;  1WOP A;  1I50 K;  3GTO K;  4ILD A;  3A8J A;  4JK1 A;  3GTG A;  1EQR A;  1I6V A;  4XLP A;  2A6E A;  1WIH A;  5TJ3 A;  5E68 A;  3S1Q K;  3HOX K;  4MEY A;  5IOQ A;  3GTK C;  4FM9 A;  1O27 A;  3V4G A;  4KMU A;  1WCM C;  3OPF A;  4KAW X;  3FHZ A;  4A3F C;  3I4M K;  4GFQ A;  2E2J C;  5IP9 C;  1X31 C;  3AD8 C;  3S1M C;  4X6A K;  4G0W A;  1XXA A;  3PO2 K;  4A3K K;  1TWG A;  2R93 C;  1IBA A;  3HOZ K;  1TWF K;  2NVT C;  2WAQ D;  2VUM A;  1XXB A;  3M4O K;  3H0G K;  4XSZ A;  1XPP A;  4OIR A;  1Y1W C;  3HOU K;  1O28 A;  2JA7 K;  4XLN A;  2E2I C;  4C3H K;  2JA5 K;  4A3L K;  4Y7N C;  3CQZ C;  1R9T A;  5IYD K;  2WAQ L;  4C3I K;  3HOV K;  3GEH A;  1XZQ B;  4LJZ A;  2NVX C;  1VJE A;  3HOX C;  4XSX A;  4BBR C;  4G7Z A;  4OIN A;  3Q3Q A;  4LLG A;  4G0V A;  5IOT A;  3GTM A;  4BBS K;  4YG2 A;  2KWA A;  4GTE A;  3HOY K;  4KB4 A;  3GTL A;  4GTB A;  4X6A C;  1HQM A;  3GSI A;  3GTP C;  1WQF A;  1AB4 A;  4GTF A;  3GTG C;  5JFE A;  3L4J A;  3GTJ C;  4LK0 A;  2E2H A;  4A3D C;  1I3Q K;  3S14 K;  4YFN A;  2GSU A;  3TFJ A;  1HI9 A;  3TFH A;  1K83 A;  1I6H C;  1O26 A;  1ZXO A;  4C3H C;  1GE9 A;  4KN7 A;  4A3J K;  3HXA A;  4C3I C;  3HOV C;  4ZH4 A;  1DCH A;  1JQW A;  5CJ9 A;  1J6X A;  4A3M C;  2XCQ A;  2VUM C;  3FKI A;  4WJ4 A;  1J6V A;  1O2F B;  4LQY A;  1DD5 A;  5D4D A;  4A93 K;  2B63 A;  1C0A A;  1XZP A;  4PAA A;  4KDD A;  2NVY C;  4C45 A;  3HKZ D;  3GTK K;  1F7U A;  4A3F K;  2A6H A;  3RZD C;  2V6U A;  3S14 C;  4LOW A;  5C44 C;  1IL2 A;  5JVO A;  5IP9 K;  3S1M K;  2JA6 A;  4Y52 C;  2XCR B;  2JA8 C;  4G7O A;  5IYC C;  4QIW D;  5M5X K;  4WIL A;  1WSR A;  4A3J C;  3HKZ L;  2NVT K;  2CW0 A;  3GIR A;  1J98 A;  1O25 A;  1EK8 A;  1Y1V K;  4OIO A;  1TWH C;  1Y1W K;  4QJV A;  2GSO A;  1WOR A;  1VRQ C;  2W7V A;  4Y7N K;  3CQZ K;  3LAP A;  1I50 A;  3GTO A;  4DDQ A;  4A93 C;  2FQT A;  3M3Y K;  3PO3 C;  1TWC A;  3LAJ A;  3S1R C;  3SZZ A;  2NVX K;  1WOS A;  4BBR K;  4OIP A;  3TTG A;  1BDF A;  5C4X K;  1SFO A;  1RU0 A;  1ISE A;  3G4C A;  3GTP K;  3GTG K;  1B4B A;  2B63 C;  3GTJ K;  1YNJ A;  2Y3P A;  3GEI A;  4A3D K;  1Y1V C;  4AH6 A;  3H0G A;  1ZVU A;  3CAG A;  3N3Y A;  1I6H K;  4KN4 A;  1USO A;  1KQ4 A;  4C2M C;  4OIQ A;  3IPJ A;  3K7A K;  1DCO A;  1TWG K;  3M3Y C;  2JA5 A;  3AQP A;  4A3M K;  2CFA B;  4NOI A;  2RH6 A;  5M3F K;  2VUM K;  3GTQ A;  5CHP A;  1WQH A;  4A3E C;  5C4X C;  3I4N C;  3S15 K;  4G7H A;  1VGX A;  2A68 A;  1ZQ1 C;  1BS2 A; 
#chains in the Genus database with same CATH homology
 4AYB L;  1SFO K;  1TWC C;  3S2D K;  4LK1 A;  4A3B C;  2R93 K;  2NVY K;  3H3V D;  3RZO C;  1YNN A;  1ZYR A;  2JA6 C;  3RZD K;  5D4D A;  4A93 K;  2PA8 D;  5IYB C;  5IP7 K;  5C44 K;  3GTM K;  4GZY A;  4Q4Z A;  3S2D C;  4Y52 K;  2E2I K;  2JA8 K;  2NVY C;  5IYC K;  1I50 K;  3HKZ D;  3S1Q K;  3GTK K;  4YFX A;  4A3I K;  3GTO K;  3K7A C;  4JK1 A;  4A3F K;  2A6H A;  3RZD C;  3H3V L;  2PPB A;  1TWG C;  3S14 C;  1I6V A;  4XLP A;  2A6E A;  5IP7 C;  5C44 C;  5IP9 K;  5TMC A;  3S1M K;  2PA8 L;  4Y52 C;  2E2H K;  1TWH K;  3HOX K;  2JA8 C;  4MEY A;  5IYC C;  1I50 C;  4QIW D;  1R9T K;  3GTK C;  5M5X K;  4A3I C;  3GTO C;  4KMU A;  1WCM C;  4MQ9 A;  4A3F C;  4A3G K;  3I4M K;  4A3J C;  3HKZ L;  1K83 K;  2NVT K;  4A3C K;  2CW0 A;  2NVQ C;  3GTQ K;  2E2J C;  4MEX A;  3S15 C;  5IP9 C;  4X6A K;  3EQL A;  3S1M C;  1Y1V K;  4OIO A;  1TWH C;  3S1N K;  3PO3 K;  1R9T C;  2BE5 A;  3PO2 K;  3S1Q C;  3S1R K;  1Y1W K;  4A3K K;  1SFO C;  4QJV A;  2R93 C;  4A3G C;  3HOZ K;  1TWF K;  3I4M C;  2NVT C;  3GTL K;  2WAQ D;  4A3C C;  4QJV B;  3GTQ C;  4Y7N K;  3CQZ K;  3M4O K;  3H0G K;  4XSZ A;  5FLM K;  4A93 C;  3M3Y K;  1XPP A;  3PO3 C;  4OIR A;  3S1N C;  5C4J K;  3PO2 C;  1TWA K;  3S1R C;  1Y1W C;  4A3K C;  3GTM C;  3HOU K;  2NVX K;  4BY1 K;  4XLN A;  2JA7 K;  2E2I C;  3HOZ C;  1TWF C;  5TMF A;  4BBR K;  4C3H K;  3GTL C;  1SMY A;  5FJ8 K;  4OIP A;  2B63 K;  2JA5 K;  4A3L K;  4Y7N C;  3CQZ C;  5M5W K;  3M4O C;  3H0G C;  1BDF A;  2Y0S D;  5IYD K;  5FLM C;  2WAQ L;  4BY7 K;  5C4X K;  4C3I K;  2O5I A;  3HOV K;  1TWA C;  3HOU C;  2A69 A;  3HOW K;  4LJZ A;  2NVX C;  4BXX K;  2E2H C;  2JA7 C;  3GTP K;  3HOX C;  4XSX A;  4BBR C;  4C3J K;  4G7Z A;  3GTG K;  4OIN A;  2B63 C;  2JA5 C;  4A3B K;  4A3L C;  3S16 K;  4LLG A;  3GTJ K;  3RZO K;  4BBS K;  5M5Y K;  5IYD C;  4YG2 A;  1K83 C;  4QIW L;  1YNJ A;  2JA6 K;  4YFK A;  3FKI K;  4C2M K;  3HOY K;  3S17 K;  4BY7 C;  4A3D K;  3HOW C;  2Y0S L;  4BXX C;  1HQM A;  4X6A C;  1Y1V C;  2PMZ D;  1IW7 A;  3GTP C;  2WB1 D;  3GTG C;  3S2H K;  4Q5S A;  3S16 C;  1I6H K;  4KN4 A;  3GTJ C;  4BBS C;  3S17 C;  3FKI C;  4OIQ A;  4LK0 A;  3K7A K;  3HOY C;  4A3D C;  1I3Q K;  2O5J A;  1TWG K;  3S14 K;  4YFN A;  4G7O A;  4A3E K;  3M3Y C;  3DXJ A;  5C4J C;  3I4N K;  5C3E K;  3S2H C;  4A3M K;  4AYB D;  4NOI A;  5M3F K;  2R92 K;  2VUM K;  2R7Z K;  1I6H C;  2PMZ L;  2YU9 K;  4BY1 C;  2WB1 L;  5IYB K;  1TWC K;  1WCM K;  4KN7 A;  1I3Q C;  4A3J K;  4A3E C;  2NVQ K;  5C4X C;  3WOD A;  3HOV C;  4ZH4 A;  2E2J K;  3I4N C;  5C3E C;  3S15 K;  4A3M C;  4G7H A;  2R92 C;  2R7Z C;  2VUM C;  2A68 A;  2YU9 C;  5M3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...