3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
3GTLK 1ZYRA 2PA8D 5IYCC 3PO2C 2B63C 1SFOK 1I3QK 3EQLA 4JK1A 4AYBD 5M5WK 3H3VL 4Y52C 1I6HK 1Y1WK 5IYDC 4OIQA 3GTKC 3GTJK 4A3IK 2A6HA 3S2HK 4A3CK 1SMYA 2NVQK 2PPBA 4MEYA 3HOVK 1SFOC 4OIRA 4G7ZA 4X6AK 4A3EC 1I6HC 1Y1WC 5IP9C 2A6EA 4QIWL 5TMCA 3DXJA 3HKZL 4A3CC 3H3VD 4MEXA 1K83C 3CQZK 3HOVC 4X6AC 3FKIC 1I50K 3HOUK 4LK0A 5FLMK 1R9TK 4ZH4A 3HOXK 2YU9C 5TMFA 3CQZC 4A3MK 2NVXC 4QIWD 2O5JA 3HKZD 3I4MK 1I50C 3HOUC 3S14C 5FLMC 2R92C 1YNNA 4GZYA 1R9TC 3GTOK 4A93K 3HOXC 3RZDK 4G7HA 4LK1A 4A3MC 3H0GC 1TWGK 4A3EK 4YFXA 2E2JK 4A3JK 3M3YC 5IP9K 4KMUA 3I4MC 4BBSK 2NVYC 4KN7A 5C3EK 4XSZA 1TWHC 1XPPA 4MQ9A 4Y7NK 3GTOC 1K83K 4YFNA 3RZDC 3RZOC 3S1NC 4A93C 1TWGC 2E2JC 4A3JC 3FKIK 4LJZA 1IW7A 4BBSC 5C3EC 3GTPC 1Y1VK 2WB1L 4Y7NC 2YU9K 2NVXK 4YFKA 4A3GC 4BY1C 3S14K 2R92K 5D4DA 3HOZK 5C4XK 1TWFK 1Y1VC 4BXXK 4C3HK 3H0GK 5M5XK 4KN4A 2VUMC 3M3YK 5M3FK 4LLGA 2R7ZC 2NVYK 3HOZC 2WB1D 3S17C 2PMZL 1TWHK 5C44K 3GTGK 3RZOK 1TWFC 5C4XC 4BXXC 5C4JC 3S15K 3S1RK 4XSXA 2R93C 4Q4ZA 4A3KC 3HOYK 3I4NC 2CW0A 2NVTK 2E2HK 3GTPK 5C44C 3GTGC 4A3FC 4Q5SA 3GTQK 2JA7K 4A3GK 2Y0SL 3S15C 3S1RC 4BY1K 4OIPA 2PMZD 3HOYC 2E2IK 4A3DK 2NVTC 4XLPA 2E2HC 3S1NK 3PO3K 3S1QK 5M5YK 4XLNA 3GTQC 5IP7K 3WODA 2O5IA 5IYBK 2JA7C 3S1QC 3M4OK 2VUMK 2R7ZK 2A69A 4C3IK 4A3DC 2E2IC 3S17K 3S1MK 1BDFA 4BBRC 4QJVB 3PO3C 4A3BC 5C4JK 2Y0SD 5FJ8K 5IP7C 3GTMK 1TWAK 4YG2A 4C2MK 1YNJA 5IYBC 3M4OC 3S16K 2JA5C 2R93K 4A3KK 3I4NK 1WCMC 2JA6K 3GTLC 2WAQD 4A3FK 3S1MC 3GTMC 1TWAC 1I3QC 5M3MK 4NOIA 4OIOA 3S16C 1I6VA 1TWCK 2A68A 2JA8K 3S2DK 3GTJC 2JA6C 4A3IC 4A3LK 4BY7K 3S2HC 3K7AK 4C3JK 4OINA 3HOWK 2NVQC 2PA8L 2BE5A 1HQMA 4AYBL 1TWCC 3S2DC 2JA8C 4BY7C 4A3LC 4BBRK 3K7AC 5IYCK 4QJVA 2WAQL 3HOWC 2B63K 3PO2K 4A3BK 4G7OA 2JA5K 4Y52K 5IYDK 3GTKK 1WCMK
chains in the Genus database with same CATH superfamily
1SFOK 1I3QK 1YX2A 1XXAA 1Y1WK 2A6HA 4A3CK 1SMYA 2NVQK 2PPBA 1BGWA 1EK8A 1O28A 1XZQA 4G7ZA 4KATA 3FOFA 3OPFA 3H3VD 3HOVC 3L4KA 4X6AC 3TFHA 3AQOA 1R9TK 2YU9C 2NVXC 3I4MK 2R92C 4GZYA 1O24A 3HXAA 4A3MC 3H0GC 2E2JK 4KMUA 2YU9A 5C3EK 2NVXA 1TWHC 1XPPA 3JSTA 4Y7NK 3GTOC 1WQHA 2W7VA 1O25A 2V6UA 2R92A 3FKIK 3H0GA 1X31C 4BY1C 2Y3PA 4LR2A 1TWHA 1Y1VC 4C3HK 3M3YK 3HOZC 2WB1D 3S17C 3T01A 3GTGK 4KC6A 1TWFC 4XSXA 3FOEA 3HOYK 4GFQA 1Y1VA 1GE9A 1WOSA 4BLBA 5HL8A 2E2HK 3GTPK 4Q5SA 3GTQK 1B4AA 2JA7K 4KMAA 4A3GK 1VRQC 4OIPA 1TWFA 3S1NK 4C3JC 4C45A 3OEPA 4P9SA 4PAAA 2A69A 3BP3A 3S1MK 1DD5A 2Y0SD 5C4JK 1YNJA 3M4OC 4A3KK 4ILDA 2WAQD 1JVIA 4WJ4A 1O29A 1C0AA 3SZYA 4NOIA 3S16C 2JA8K 2JA6C 4A3IC 3K7AK 1ZXOA 3LAPA 1TWCC 4A3LC 2WAQL 3HOWC 1F7UA 2JA5K 2JA6A 1INNA 1ZYRA 5IYCC 1PJ5A 2B63C 1J6XA 1XZPB 4Y52C 1J98A 3G4CA 4KMHA 3S2HK 3LAJA 1USMA 3AD7C 3HOVK 4X6AK 4A3EC 5IOQA 1I6HC 2A6EA 4QIWL 5TMCA 2B63A 3HKZL 4PABA 3GSIA 5EGEA 2EBBA 4LK0A 5E68A 4WJ3M 1JOEA 2V6TA 1WOPA 1TWGA 5TMFA 4A3MK 1O27A 3BP8C 1XXBA 3GIRA 3VA7A 1I50C 5FLMC 1VJEA 3GTOK 3HOXC 3GDZA 2V6SA 4LK1A 1PJ7A 1BJTA 5IP9K 4GTLA 4KN7A 1YCLA 4MQ9A 3RZOC 4A93C 1K83K 3L4JA 1I50A 4A3JC 4LJZA 4BBSC 4GTCA 1Y1VK 3ERED 3S14K 3AH5A 2FQOA 3HOZK 1TWFK 4O2DA 1XZPA 1WSRA 3CAGA 4P5AA 5M5XK 1ISEA 4KN4A 1ZVUA 2NVYK 3BUEA 2PMZL 2D6FC 3A8IA 5IOSA 5JFEA 2R93C 1WIHA 4Q4ZA 3I4NC 1WQFA 3SZZA 2CW0A 4A3FC 1DCOA 3S15C 1WORA 2NVTC 2XCQA 2JH3A 2R93A 4G0VA 3M4OK 2XCRB 2VUMK 2R7ZK 3S0XA 4A3DC 1IE0A 2FQTA 4BBRC 3TFJA 3PO3C 4A3BC 3S1QC 5CHPA 3S16K 4RMFA 1WCMC 4C3IC 2JA6K 5JVOA 1VLOA 1IS1A 3GTMC 1I3QC 4C2MC 5L46A 2CFAB 4OIOA 3TFIA 1TWCK 1J6VA 4A3LK 3HOWK 2NVQC 1O26A 2PA8L 2BE5A 1WCMA 3T02A 4AYBL 4BLAA 1IL2A 4BY7C 3GTMA 5IYCK 1I3QA 4QJVA 2B63K 4G7OA 4Y52K 3GTLK 1O2BA 4FM9A 3PO2C 1VGXA 1ZBSA 3EQLA 4JK1A 4GTAA 1I6HK 3T00A 3FHZA 3GTJK 3GTKC 5EGHA 1KQ4A 1O2AA 4MEYA 2ZUEA 2P5MA 3DXJA 1EI6A 3A8JA 1ZQ1C 1JQWA 4MEXA 3GTKA 4DDQA 3Q3QA 3FKIC 1I50K 3ADAC 5FLMK 1F9NA 1EQRA 4ZH4A 3HOXK 2RGRA 3CQZC 4QIWD 3HKZD 3HOUC 1YNNA 4A93K 4KDDA 1J6WA 1G51A 3FKIA 4C3HC 2CFAA 4YFXA 4A3JK 3M3YC 4BBSK 5IOTA 3CQZA 4XSZA 3RZDC 1DCHA 2RH6A 1TWGC 4KASA 1IW7A 3GTPC 4KM9A 2YU9K 2NVXK 4A3GC 3AQPA 1UV7A 3GTGA 3N3YA 2R92K 5D4DA 1B4BA 1USOA 3H0GK 5M3FK 4LLGA 2KWAA 3GTPA 2E2HA 5IORA 5C4XC 1TWHK 2JA7A 1VH2A 4BXXC 5C4JC 3S15K 4A3KC 4G0UA 2NVTK 3GEHA 5C44C 3S1RC 4BY1K 4GTEA 2PMZD 4A3DK 4BKWA 3PO3K 3V4GA 3S1QK 2O5IA 3WODA 3N0BA 4KM8A 2GSUA 4C3IK 2E2IC 3S17K 1IBAA 1BDFA 4QJVB 3GTMK 5IP7C 5IYBC 4GTDA 4C2MK 4AH6A 2JA5C 1WSVA 1TWAC 2E2IA 1I6VA 1BS2A 4BY7K 3S2HC 4C3JK 1HI9A 4OINA 2JA5A 4KMDA 3S2DC 1IQ0A 3AD9C 3N0CA 4GTBA 1TWAA 3PO2K 4KB2A 3GTKK 1RU0A 2PHCB 2PA8D 3NUHA 4AYBD 5M5WK 3H3VL 4M1XA 5IYDC 4OIQA 4FZBA 3IPJA 4J3NA 4A3IK 1EFWA 3GEIA 1SFOC 2ZFZA 4OIRA 1XXCA 3G4AA 1PJ6A 1Y1WC 5IP9C 1DCPA 2ZUFA 3AD8C 2GAHC 4A3CC 1K83C 3CQZK 5CJ9A 2GSNA 4WILA 3HOUK 3GTOA 1SFOA 4KARA 1Y1WA 2P8TA 2O5JA 3S14C 1K83A 1R9TC 3RZDK 4G7HA 4A3EK 1TWGK 3I4MC 2NVYC 4P5BA 1EH1A 4YFNA 2GAGC 2E2JC 1R9TA 5C3EC 4Y7NC 2WB1L 4YFKA 2NVYA 1V5VA 1WOOA 5C4XK 2GSOA 4BXXK 4LQYA 2VUMC 1O2FB 2R7ZC 4GTFA 5C44K 3RZOK 3S1RK 4GT9A 3GTGC 1AB4A 2VUMA 5TJ3A 1XZQB 2R7ZA 2Y0SL 1WQGA 4KB4A 3HOYC 3OREA 2E2IK 3GEEA 4XLPA 2E2HC 3TTGA 5M5YK 4XLNA 5IP7K 2XCOA 3GTQC 5IYBK 2JA7C 1L0WA 3QX3A 4LOWA 1F93A 3S1NC 4G0WA 5FJ8K 3A8KA 1TWAK 4YG2A 1TWCA 2R93K 3I4NK 3MMLB 3GTLC 3GTQA 3S1MC 4A3FK 5M3MK 2A68A 3S2DK 1F7VA 3LPXA 3GTJC 1HQMA 3GTLA 2JA8C 4KAWX 4BBRK 3K7AC 4A3BK 4XCHA 3GTJA 5IYDK 1WCMK
chains in the Genus database with same CATH topology
3GTLK 1ZYRA 2PA8D 5IYCC 3PO2C 2B63C 1SFOK 1I3QK 3EQLA 4JK1A 4AYBD 5M5WK 3H3VL 4Y52C 1I6HK 1Y1WK 5IYDC 4OIQA 3GTKC 3GTJK 4A3IK 2A6HA 3S2HK 4A3CK 1SMYA 2NVQK 2PPBA 4MEYA 3HOVK 1SFOC 4OIRA 4G7ZA 4X6AK 4A3EC 1I6HC 1Y1WC 5IP9C 2A6EA 4QIWL 5TMCA 3DXJA 3HKZL 4A3CC 3H3VD 4MEXA 1K83C 3CQZK 3HOVC 4X6AC 3FKIC 1I50K 3HOUK 4LK0A 5FLMK 1R9TK 4ZH4A 3HOXK 2YU9C 5TMFA 3CQZC 4A3MK 2NVXC 4QIWD 2O5JA 3HKZD 3I4MK 1I50C 3HOUC 3S14C 5FLMC 2R92C 1YNNA 4GZYA 1R9TC 3GTOK 4A93K 3HOXC 3RZDK 4G7HA 4LK1A 4A3MC 3H0GC 1TWGK 4A3EK 4YFXA 2E2JK 4A3JK 3M3YC 5IP9K 4KMUA 3I4MC 4BBSK 2NVYC 4KN7A 5C3EK 4XSZA 1TWHC 1XPPA 4MQ9A 4Y7NK 3GTOC 1K83K 4YFNA 3RZDC 3RZOC 3S1NC 4A93C 1TWGC 2E2JC 4A3JC 3FKIK 4LJZA 1IW7A 4BBSC 5C3EC 3GTPC 1Y1VK 2WB1L 4Y7NC 2YU9K 2NVXK 4YFKA 4A3GC 4BY1C 3S14K 2R92K 5D4DA 3HOZK 5C4XK 1TWFK 1Y1VC 4BXXK 4C3HK 3H0GK 5M5XK 4KN4A 2VUMC 3M3YK 5M3FK 4LLGA 2R7ZC 2NVYK 3HOZC 2WB1D 3S17C 2PMZL 1TWHK 5C44K 3GTGK 3RZOK 1TWFC 5C4XC 4BXXC 5C4JC 3S15K 3S1RK 4XSXA 2R93C 4Q4ZA 4A3KC 3HOYK 3I4NC 2CW0A 2NVTK 2E2HK 3GTPK 5C44C 3GTGC 4A3FC 4Q5SA 3GTQK 2JA7K 4A3GK 2Y0SL 3S15C 3S1RC 4BY1K 4OIPA 2PMZD 3HOYC 2E2IK 4A3DK 2NVTC 4XLPA 2E2HC 3S1NK 3PO3K 3S1QK 5M5YK 4XLNA 3GTQC 5IP7K 3WODA 2O5IA 5IYBK 2JA7C 3S1QC 3M4OK 2VUMK 2R7ZK 2A69A 4C3IK 4A3DC 2E2IC 3S17K 3S1MK 1BDFA 4BBRC 4QJVB 3PO3C 4A3BC 5C4JK 2Y0SD 5FJ8K 5IP7C 3GTMK 1TWAK 4YG2A 4C2MK 1YNJA 5IYBC 3M4OC 3S16K 2JA5C 2R93K 4A3KK 3I4NK 1WCMC 2JA6K 3GTLC 2WAQD 4A3FK 3S1MC 3GTMC 1TWAC 1I3QC 5M3MK 4NOIA 4OIOA 3S16C 1I6VA 1TWCK 2A68A 2JA8K 3S2DK 3GTJC 2JA6C 4A3IC 4A3LK 4BY7K 3S2HC 3K7AK 4C3JK 4OINA 3HOWK 2NVQC 2PA8L 2BE5A 1HQMA 4AYBL 1TWCC 3S2DC 2JA8C 4BY7C 4A3LC 4BBRK 3K7AC 5IYCK 4QJVA 2WAQL 3HOWC 2B63K 3PO2K 4A3BK 4G7OA 2JA5K 4Y52K 5IYDK 3GTKK 1WCMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL K;  1ZYR A;  2PA8 D;  5IYC C;  3PO2 C;  2B63 C;  1SFO K;  1I3Q K;  3EQL A;  4JK1 A;  4AYB D;  5M5W K;  3H3V L;  4Y52 C;  1I6H K;  1Y1W K;  5IYD C;  4OIQ A;  3GTK C;  3GTJ K;  4A3I K;  2A6H A;  3S2H K;  4A3C K;  1SMY A;  2NVQ K;  2PPB A;  4MEY A;  3HOV K;  1SFO C;  4OIR A;  4G7Z A;  4X6A K;  4A3E C;  1I6H C;  1Y1W C;  5IP9 C;  2A6E A;  4QIW L;  5TMC A;  3DXJ A;  3HKZ L;  4A3C C;  3H3V D;  4MEX A;  1K83 C;  3CQZ K;  3HOV C;  4X6A C;  3FKI C;  1I50 K;  3HOU K;  4LK0 A;  5FLM K;  1R9T K;  4ZH4 A;  3HOX K;  2YU9 C;  5TMF A;  3CQZ C;  4A3M K;  2NVX C;  4QIW D;  2O5J A;  3HKZ D;  3I4M K;  1I50 C;  3HOU C;  3S14 C;  5FLM C;  2R92 C;  1YNN A;  4GZY A;  1R9T C;  3GTO K;  4A93 K;  3HOX C;  3RZD K;  4G7H A;  4LK1 A;  4A3M C;  3H0G C;  1TWG K;  4A3E K;  4YFX A;  2E2J K;  4A3J K;  3M3Y C;  5IP9 K;  4KMU A;  3I4M C;  4BBS K;  2NVY C;  4KN7 A;  5C3E K;  4XSZ A;  1TWH C;  1XPP A;  4MQ9 A;  4Y7N K;  3GTO C;  1K83 K;  4YFN A;  3RZD C;  3RZO C;  3S1N C;  4A93 C;  1TWG C;  2E2J C;  4A3J C;  3FKI K;  4LJZ A;  1IW7 A;  4BBS C;  5C3E C;  3GTP C;  1Y1V K;  2WB1 L;  4Y7N C;  2YU9 K;  2NVX K;  4YFK A;  4A3G C;  4BY1 C;  3S14 K;  2R92 K;  5D4D A;  3HOZ K;  5C4X K;  1TWF K;  1Y1V C;  4BXX K;  4C3H K;  3H0G K;  5M5X K;  4KN4 A;  2VUM C;  3M3Y K;  5M3F K;  4LLG A;  2R7Z C;  2NVY K;  3HOZ C;  2WB1 D;  3S17 C;  2PMZ L;  1TWH K;  5C44 K;  3GTG K;  3RZO K;  1TWF C;  5C4X C;  4BXX C;  5C4J C;  3S15 K;  3S1R K;  4XSX A;  2R93 C;  4Q4Z A;  4A3K C;  3HOY K;  3I4N C;  2CW0 A;  2NVT K;  2E2H K;  3GTP K;  5C44 C;  3GTG C;  4A3F C;  4Q5S A;  3GTQ K;  2JA7 K;  4A3G K;  2Y0S L;  3S15 C;  3S1R C;  4BY1 K;  4OIP A;  2PMZ D;  3HOY C;  2E2I K;  4A3D K;  2NVT C;  4XLP A;  2E2H C;  3S1N K;  3PO3 K;  3S1Q K;  5M5Y K;  4XLN A;  3GTQ C;  5IP7 K;  3WOD A;  2O5I A;  5IYB K;  2JA7 C;  3S1Q C;  3M4O K;  2VUM K;  2R7Z K;  2A69 A;  4C3I K;  4A3D C;  2E2I C;  3S17 K;  3S1M K;  1BDF A;  4BBR C;  4QJV B;  3PO3 C;  4A3B C;  5C4J K;  2Y0S D;  5FJ8 K;  5IP7 C;  3GTM K;  1TWA K;  4YG2 A;  4C2M K;  1YNJ A;  5IYB C;  3M4O C;  3S16 K;  2JA5 C;  2R93 K;  4A3K K;  3I4N K;  1WCM C;  2JA6 K;  3GTL C;  2WAQ D;  4A3F K;  3S1M C;  3GTM C;  1TWA C;  1I3Q C;  5M3M K;  4NOI A;  4OIO A;  3S16 C;  1I6V A;  1TWC K;  2A68 A;  2JA8 K;  3S2D K;  3GTJ C;  2JA6 C;  4A3I C;  4A3L K;  4BY7 K;  3S2H C;  3K7A K;  4C3J K;  4OIN A;  3HOW K;  2NVQ C;  2PA8 L;  2BE5 A;  1HQM A;  4AYB L;  1TWC C;  3S2D C;  2JA8 C;  4BY7 C;  4A3L C;  4BBR K;  3K7A C;  5IYC K;  4QJV A;  2WAQ L;  3HOW C;  2B63 K;  3PO2 K;  4A3B K;  4G7O A;  2JA5 K;  4Y52 K;  5IYD K;  3GTK K;  1WCM K; 
#chains in the Genus database with same CATH topology
 1SFO K;  1I3Q K;  1YX2 A;  1XXA A;  1Y1W K;  2A6H A;  4A3C K;  1SMY A;  2NVQ K;  2PPB A;  1BGW A;  1EK8 A;  1O28 A;  1XZQ A;  4G7Z A;  4KAT A;  3FOF A;  3OPF A;  3H3V D;  3HOV C;  3L4K A;  4X6A C;  3TFH A;  3AQO A;  1R9T K;  2YU9 C;  2NVX C;  3I4M K;  2R92 C;  4GZY A;  1O24 A;  3HXA A;  4A3M C;  3H0G C;  2E2J K;  4KMU A;  2YU9 A;  5C3E K;  2NVX A;  1TWH C;  1XPP A;  3JST A;  4Y7N K;  3GTO C;  1WQH A;  2W7V A;  1O25 A;  2V6U A;  2R92 A;  3FKI K;  3H0G A;  1X31 C;  4BY1 C;  2Y3P A;  4LR2 A;  1TWH A;  1Y1V C;  4C3H K;  3M3Y K;  3HOZ C;  2WB1 D;  3S17 C;  3T01 A;  3GTG K;  4KC6 A;  1TWF C;  4XSX A;  3FOE A;  3HOY K;  4GFQ A;  1Y1V A;  1GE9 A;  1WOS A;  4BLB A;  5HL8 A;  2E2H K;  3GTP K;  4Q5S A;  3GTQ K;  1B4A A;  2JA7 K;  4KMA A;  4A3G K;  1VRQ C;  4OIP A;  1TWF A;  3S1N K;  4C3J C;  4C45 A;  3OEP A;  4P9S A;  4PAA A;  2A69 A;  3BP3 A;  3S1M K;  1DD5 A;  2Y0S D;  5C4J K;  1YNJ A;  3M4O C;  4A3K K;  4ILD A;  2WAQ D;  1JVI A;  4WJ4 A;  1O29 A;  1C0A A;  3SZY A;  4NOI A;  3S16 C;  2JA8 K;  2JA6 C;  4A3I C;  3K7A K;  1ZXO A;  3LAP A;  1TWC C;  4A3L C;  2WAQ L;  3HOW C;  1F7U A;  2JA5 K;  2JA6 A;  1INN A;  1ZYR A;  5IYC C;  1PJ5 A;  2B63 C;  1J6X A;  1XZP B;  4Y52 C;  1J98 A;  3G4C A;  4KMH A;  3S2H K;  3LAJ A;  1USM A;  3AD7 C;  3HOV K;  4X6A K;  4A3E C;  5IOQ A;  1I6H C;  2A6E A;  4QIW L;  5TMC A;  2B63 A;  3HKZ L;  4PAB A;  3GSI A;  5EGE A;  2EBB A;  4LK0 A;  5E68 A;  4WJ3 M;  1JOE A;  2V6T A;  1WOP A;  1TWG A;  5TMF A;  4A3M K;  1O27 A;  3BP8 C;  1XXB A;  3GIR A;  3VA7 A;  1I50 C;  5FLM C;  1VJE A;  3GTO K;  3HOX C;  3GDZ A;  2V6S A;  4LK1 A;  1PJ7 A;  1BJT A;  5IP9 K;  4GTL A;  4KN7 A;  1YCL A;  4MQ9 A;  3RZO C;  4A93 C;  1K83 K;  3L4J A;  1I50 A;  4A3J C;  4LJZ A;  4BBS C;  4GTC A;  1Y1V K;  3ERE D;  3S14 K;  3AH5 A;  2FQO A;  3HOZ K;  1TWF K;  4O2D A;  1XZP A;  1WSR A;  3CAG A;  4P5A A;  5M5X K;  1ISE A;  4KN4 A;  1ZVU A;  2NVY K;  3BUE A;  2PMZ L;  2D6F C;  3A8I A;  5IOS A;  5JFE A;  2R93 C;  1WIH A;  4Q4Z A;  3I4N C;  1WQF A;  3SZZ A;  2CW0 A;  4A3F C;  1DCO A;  3S15 C;  1WOR A;  2NVT C;  2XCQ A;  2JH3 A;  2R93 A;  4G0V A;  3M4O K;  2XCR B;  2VUM K;  2R7Z K;  3S0X A;  4A3D C;  1IE0 A;  2FQT A;  4BBR C;  3TFJ A;  3PO3 C;  4A3B C;  3S1Q C;  5CHP A;  3S16 K;  4RMF A;  1WCM C;  4C3I C;  2JA6 K;  5JVO A;  1VLO A;  1IS1 A;  3GTM C;  1I3Q C;  4C2M C;  5L46 A;  2CFA B;  4OIO A;  3TFI A;  1TWC K;  1J6V A;  4A3L K;  3HOW K;  2NVQ C;  1O26 A;  2PA8 L;  2BE5 A;  1WCM A;  3T02 A;  4AYB L;  4BLA A;  1IL2 A;  4BY7 C;  3GTM A;  5IYC K;  1I3Q A;  4QJV A;  2B63 K;  4G7O A;  4Y52 K;  3GTL K;  1O2B A;  4FM9 A;  3PO2 C;  1VGX A;  1ZBS A;  3EQL A;  4JK1 A;  4GTA A;  1I6H K;  3T00 A;  3FHZ A;  3GTJ K;  3GTK C;  5EGH A;  1KQ4 A;  1O2A A;  4MEY A;  2ZUE A;  2P5M A;  3DXJ A;  1EI6 A;  3A8J A;  1ZQ1 C;  1JQW A;  4MEX A;  3GTK A;  4DDQ A;  3Q3Q A;  3FKI C;  1I50 K;  3ADA C;  5FLM K;  1F9N A;  1EQR A;  4ZH4 A;  3HOX K;  2RGR A;  3CQZ C;  4QIW D;  3HKZ D;  3HOU C;  1YNN A;  4A93 K;  4KDD A;  1J6W A;  1G51 A;  3FKI A;  4C3H C;  2CFA A;  4YFX A;  4A3J K;  3M3Y C;  4BBS K;  5IOT A;  3CQZ A;  4XSZ A;  3RZD C;  1DCH A;  2RH6 A;  1TWG C;  4KAS A;  1IW7 A;  3GTP C;  4KM9 A;  2YU9 K;  2NVX K;  4A3G C;  3AQP A;  1UV7 A;  3GTG A;  3N3Y A;  2R92 K;  5D4D A;  1B4B A;  1USO A;  3H0G K;  5M3F K;  4LLG A;  2KWA A;  3GTP A;  2E2H A;  5IOR A;  5C4X C;  1TWH K;  2JA7 A;  1VH2 A;  4BXX C;  5C4J C;  3S15 K;  4A3K C;  4G0U A;  2NVT K;  3GEH A;  5C44 C;  3S1R C;  4BY1 K;  4GTE A;  2PMZ D;  4A3D K;  4BKW A;  3PO3 K;  3V4G A;  3S1Q K;  2O5I A;  3WOD A;  3N0B A;  4KM8 A;  2GSU A;  4C3I K;  2E2I C;  3S17 K;  1IBA A;  1BDF A;  4QJV B;  3GTM K;  5IP7 C;  5IYB C;  4GTD A;  4C2M K;  4AH6 A;  2JA5 C;  1WSV A;  1TWA C;  2E2I A;  1I6V A;  1BS2 A;  4BY7 K;  3S2H C;  4C3J K;  1HI9 A;  4OIN A;  2JA5 A;  4KMD A;  3S2D C;  1IQ0 A;  3AD9 C;  3N0C A;  4GTB A;  1TWA A;  3PO2 K;  4KB2 A;  3GTK K;  1RU0 A;  2PHC B;  2PA8 D;  3NUH A;  4AYB D;  5M5W K;  3H3V L;  4M1X A;  5IYD C;  4OIQ A;  4FZB A;  3IPJ A;  4J3N A;  4A3I K;  1EFW A;  3GEI A;  1SFO C;  2ZFZ A;  4OIR A;  1XXC A;  3G4A A;  1PJ6 A;  1Y1W C;  5IP9 C;  1DCP A;  2ZUF A;  3AD8 C;  2GAH C;  4A3C C;  1K83 C;  3CQZ K;  5CJ9 A;  2GSN A;  4WIL A;  3HOU K;  3GTO A;  1SFO A;  4KAR A;  1Y1W A;  2P8T A;  2O5J A;  3S14 C;  1K83 A;  1R9T C;  3RZD K;  4G7H A;  4A3E K;  1TWG K;  3I4M C;  2NVY C;  4P5B A;  1EH1 A;  4YFN A;  2GAG C;  2E2J C;  1R9T A;  5C3E C;  4Y7N C;  2WB1 L;  4YFK A;  2NVY A;  1V5V A;  1WOO A;  5C4X K;  2GSO A;  4BXX K;  4LQY A;  2VUM C;  1O2F B;  2R7Z C;  4GTF A;  5C44 K;  3RZO K;  3S1R K;  4GT9 A;  3GTG C;  1AB4 A;  2VUM A;  5TJ3 A;  1XZQ B;  2R7Z A;  2Y0S L;  1WQG A;  4KB4 A;  3HOY C;  3ORE A;  2E2I K;  3GEE A;  4XLP A;  2E2H C;  3TTG A;  5M5Y K;  4XLN A;  5IP7 K;  2XCO A;  3GTQ C;  5IYB K;  2JA7 C;  1L0W A;  3QX3 A;  4LOW A;  1F93 A;  3S1N C;  4G0W A;  5FJ8 K;  3A8K A;  1TWA K;  4YG2 A;  1TWC A;  2R93 K;  3I4N K;  3MML B;  3GTL C;  3GTQ A;  3S1M C;  4A3F K;  5M3M K;  2A68 A;  3S2D K;  1F7V A;  3LPX A;  3GTJ C;  1HQM A;  3GTL A;  2JA8 C;  4KAW X;  4BBR K;  3K7A C;  4A3B K;  4XCH A;  3GTJ A;  5IYD K;  1WCM K; 
#chains in the Genus database with same CATH homology
 3GTL K;  1ZYR A;  2PA8 D;  5IYC C;  3PO2 C;  2B63 C;  1SFO K;  1I3Q K;  3EQL A;  4JK1 A;  4AYB D;  5M5W K;  3H3V L;  4Y52 C;  1I6H K;  1Y1W K;  5IYD C;  4OIQ A;  3GTK C;  3GTJ K;  4A3I K;  2A6H A;  3S2H K;  4A3C K;  1SMY A;  2NVQ K;  2PPB A;  4MEY A;  3HOV K;  1SFO C;  4OIR A;  4G7Z A;  4X6A K;  4A3E C;  1I6H C;  1Y1W C;  5IP9 C;  2A6E A;  4QIW L;  5TMC A;  3DXJ A;  3HKZ L;  4A3C C;  3H3V D;  4MEX A;  1K83 C;  3CQZ K;  3HOV C;  4X6A C;  3FKI C;  1I50 K;  3HOU K;  4LK0 A;  5FLM K;  1R9T K;  4ZH4 A;  3HOX K;  2YU9 C;  5TMF A;  3CQZ C;  4A3M K;  2NVX C;  4QIW D;  2O5J A;  3HKZ D;  3I4M K;  1I50 C;  3HOU C;  3S14 C;  5FLM C;  2R92 C;  1YNN A;  4GZY A;  1R9T C;  3GTO K;  4A93 K;  3HOX C;  3RZD K;  4G7H A;  4LK1 A;  4A3M C;  3H0G C;  1TWG K;  4A3E K;  4YFX A;  2E2J K;  4A3J K;  3M3Y C;  5IP9 K;  4KMU A;  3I4M C;  4BBS K;  2NVY C;  4KN7 A;  5C3E K;  4XSZ A;  1TWH C;  1XPP A;  4MQ9 A;  4Y7N K;  3GTO C;  1K83 K;  4YFN A;  3RZD C;  3RZO C;  3S1N C;  4A93 C;  1TWG C;  2E2J C;  4A3J C;  3FKI K;  4LJZ A;  1IW7 A;  4BBS C;  5C3E C;  3GTP C;  1Y1V K;  2WB1 L;  4Y7N C;  2YU9 K;  2NVX K;  4YFK A;  4A3G C;  4BY1 C;  3S14 K;  2R92 K;  5D4D A;  3HOZ K;  5C4X K;  1TWF K;  1Y1V C;  4BXX K;  4C3H K;  3H0G K;  5M5X K;  4KN4 A;  2VUM C;  3M3Y K;  5M3F K;  4LLG A;  2R7Z C;  2NVY K;  3HOZ C;  2WB1 D;  3S17 C;  2PMZ L;  1TWH K;  5C44 K;  3GTG K;  3RZO K;  1TWF C;  5C4X C;  4BXX C;  5C4J C;  3S15 K;  3S1R K;  4XSX A;  2R93 C;  4Q4Z A;  4A3K C;  3HOY K;  3I4N C;  2CW0 A;  2NVT K;  2E2H K;  3GTP K;  5C44 C;  3GTG C;  4A3F C;  4Q5S A;  3GTQ K;  2JA7 K;  4A3G K;  2Y0S L;  3S15 C;  3S1R C;  4BY1 K;  4OIP A;  2PMZ D;  3HOY C;  2E2I K;  4A3D K;  2NVT C;  4XLP A;  2E2H C;  3S1N K;  3PO3 K;  3S1Q K;  5M5Y K;  4XLN A;  3GTQ C;  5IP7 K;  3WOD A;  2O5I A;  5IYB K;  2JA7 C;  3S1Q C;  3M4O K;  2VUM K;  2R7Z K;  2A69 A;  4C3I K;  4A3D C;  2E2I C;  3S17 K;  3S1M K;  1BDF A;  4BBR C;  4QJV B;  3PO3 C;  4A3B C;  5C4J K;  2Y0S D;  5FJ8 K;  5IP7 C;  3GTM K;  1TWA K;  4YG2 A;  4C2M K;  1YNJ A;  5IYB C;  3M4O C;  3S16 K;  2JA5 C;  2R93 K;  4A3K K;  3I4N K;  1WCM C;  2JA6 K;  3GTL C;  2WAQ D;  4A3F K;  3S1M C;  3GTM C;  1TWA C;  1I3Q C;  5M3M K;  4NOI A;  4OIO A;  3S16 C;  1I6V A;  1TWC K;  2A68 A;  2JA8 K;  3S2D K;  3GTJ C;  2JA6 C;  4A3I C;  4A3L K;  4BY7 K;  3S2H C;  3K7A K;  4C3J K;  4OIN A;  3HOW K;  2NVQ C;  2PA8 L;  2BE5 A;  1HQM A;  4AYB L;  1TWC C;  3S2D C;  2JA8 C;  4BY7 C;  4A3L C;  4BBR K;  3K7A C;  5IYC K;  4QJV A;  2WAQ L;  3HOW C;  2B63 K;  3PO2 K;  4A3B K;  4G7O A;  2JA5 K;  4Y52 K;  5IYD K;  3GTK K;  1WCM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...