3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
4KN7A 5C4JK 1Y1VK 3EQLA 3H0GK 1Y1WK 1IW7A 1TWFK 3GTMC 4BBRC 3GTLC 1R9TC 1TWGC 2JA5C 5C44K 4G7HA 5C4XK 5C44C 4MQ9A 3S16K 2PMZL 3S2DK 3S15K 4BBSK 1TWCK 2O5IA 3GTOC 3HKZD 3S2HK 3S14K 5FJ8K 3HKZL 2Y0SD 3DXJA 2BE5A 3H3VL 3S1NK 2R93K 1K83K 3K7AK 2A68A 2JA6K 4YG2A 1SMYA 4KMUA 1I50C 3GTPK 1K83C 3K7AC 4A3DK 3HOVC 1TWHC 4A3KK 4OIRA 3HOZK 3GTJK 4QJVA 4NOIA 5IYCK 2WB1D 1I6HC 2PA8D 4KN4A 2WAQL 3S17K 5IP7C 3GTKC 5M5WK 3GTQC 2NVTC 4YFNA 1R9TK 3HOWK 2CW0A 4BY1C 2PMZD 4Y52K 1I6VA 4Q4ZA 4A3EC 1Y1VC 3GTMK 3H0GC 1Y1WC 4A3EK 4OINA 2A6HA 5C3EK 4XSXA 3I4MC 3S1RK 5C3EC 2WAQD 4QJVB 3PO2C 3S1MC 2NVYK 3S1RC 2JA7K 4YFKA 3HOYC 3S1NC 1YNJA 2JA7C 2E2JC 3HOYK 3I4NC 5IYBK 5TMCA 3S14C 1BDFA 2NVXK 3HOZC 3M4OC 3M3YC 3M4OK 1SFOC 2NVXC 5TMFA 2JA8C 2VUMC 4MEYA 4A3BC 5IYDC 3PO3C 3HOVK 4AYBD 4Y7NC 2A69A 4C2MK 3GTGK 2NVTK 2R7ZC 3HOWC 4A3BK 4BXXK 4BY7K 4A3GK 5C4JC 4QIWL 5FLMK 1WCMK 2NVQK 4A3GC 4LJZA 2E2IC 5FLMC 5C4XC 4XSZA 1TWGK 4C3JK 2JA5K 2B63C 4BBRK 5IP9C 4A3CK 4JK1A 5IP9K 4A3CC 4XLNA 3PO2K 4A3LC 4C3IK 2E2HK 3GTOK 3CQZC 4A3IC 5M5XK 3S15C 1HQMA 2O5JA 2WB1L 4LK0A 4LK1A 4LLGA 2Y0SL 2E2HC 5IYBC 1I3QK 3HOUK 3S1QK 3H3VD 3RZDK 3I4NK 5D4DA 4A3JC 1XPPA 4A3FC 2PPBA 3HOUC 4OIPA 5M3FK 3RZDC 2JA8K 4A93C 1SFOK 4A3MC 3HOXK 4QIWD 5M5YK 2YU9C 3M3YK 1I6HK 4OIOA 4OIQA 3GTJC 3GTGC 4YFXA 2R7ZK 4BY1K 4BY7C 3PO3K 3WODA 4Y52C 4Y7NK 5IYDK 2B63K 3GTQK 2E2IK 3GTKK 3GTLK 2NVQC 3I4MK 1WCMC 3CQZK 4A3IK 4XLPA 3S2HC 4A3LK 1TWCC 4C3HK 4X6AK 2E2JK 3S16C 3S2DC 2NVYC 4BBSC 4G7OA 4X6AC 4A3JK 3S1MK 1I3QC 4GZYA 2JA6C 3S1QC 2R93C 1TWAK 4ZH4A 4A3MK 4MEXA 2R92C 1YNNA 2PA8L 1ZYRA 5IYCC 2R92K 1TWHK 4A3KC 4Q5SA 1TWAC 4BXXC 4A3FK 2YU9K 3HOXC 1I50K 3FKIC 4G7ZA 3GTPC 3RZOK 4A93K 4A3DC 3FKIK 2VUMK 5M3MK 3RZOC 4AYBL 5IP7K 3S17C 2A6EA 1TWFC
chains in the Genus database with same CATH superfamily
3EQLA 4KC6A 1IW7A 2E2IA 1R9TC 1DCPA 3S2DK 3GTOC 3HKZL 3DXJA 4FZBA 3H3VL 3S1NK 1EI6A 3GTLA 2P8TA 4KMAA 3HOZK 1TWHA 2WB1D 3LAPA 1XXCA 3GTOA 5CHPA 1IBAA 2PHCB 2PMZD 3T02A 2V6TA 5IOQA 1Y1WC 1GE9A 4BLBA 4XSXA 3S1RK 2WAQD 1F93A 1RU0A 4G0WA 3T00A 4GTDA 3HOYC 2CFAA 4KMDA 3HOYK 3AH5A 5IYBK 2B63A 1VH2A 5TMFA 4MEYA 4A3BK 4BXXK 3GTGK 1O26A 2R7ZC 4A3GK 3TFIA 2NVQK 1WCMA 4LJZA 1BGWA 4XSZA 1J6XA 4BBRK 4JK1A 4XLNA 3CQZC 4A3IC 3S15C 2O5JA 1PJ6A 3G4AA 3AQOA 5HL8A 3I4NK 3H0GA 1O2FB 1B4BA 3BP8C 4A3MC 2EBBA 3HOXK 3LAJA 1WQFA 3GTJC 4BY7C 3IPJA 4M1XA 3FOEA 1EFWA 2E2IK 5JFEA 1EK8A 3Q3QA 3GDZA 1WQHA 3S2HC 4BBSC 1C0AA 1DCHA 1I3QC 2JA6C 1UV7A 1YNNA 1ZYRA 3BUEA 4KM8A 4BXXC 2YU9K 3FKIC 3GEHA 2A6EA 2P5MA 4KN7A 1WOOA 1Y1VK 1EH1A 4LOWA 1Y1VA 1VGXA 1XZPA 3CAGA 1TWCK 2O5IA 3HKZD 3TFHA 5FJ8K 2R93A 4GFQA 3MMLB 1XZQB 1K83K 3K7AK 2A68A 3ERED 4YG2A 2R93K 2GSNA 4KMUA 1I50C 3GTPK 1K83C 3K7AC 4RMFA 1TWHC 2GAGC 4NOIA 2PA8D 2JH3A 3S17K 5IP7C 2JA6A 1I3QA 2JA5A 1WOSA 3GTMK 2R92A 4A3EC 2ZFZA 1WORA 4KB4A 3S1MC 4P5AA 3FOFA 2JA7K 3S1NC 4GTAA 3I4NC 5TMCA 3S14C 1BDFA 1O28A 3M4OK 1IQ0A 2NVXC 3PO3C 4Y7NC 3GSIA 3OEPA 2KWAA 4GTCA 5C4JC 2D6FC 5C4XC 5FLMC 1XXAA 3CQZA 2JA5K 5IP9K 4A3CC 1G51A 3PO2K 4C3IK 2E2HK 4KAWX 5M5XK 3LPXA 5IYBC 3HOUK 3RZDK 2PPBA 3HOUC 3RZDC 4KM9A 4A93C 3SZZA 2YU9C 2NVYA 5JVOA 4YFXA 1BJTA 5IYDK 3WODA 4Y7NK 1O24A 2NVXA 4BKWA 3GTLK 2NVQC 4P9SA 3GTPA 3CQZK 4A3IK 1ZBSA 1PJ7A 1O25A 1TWCC 2W7VA 1PJ5A 2NVYC 3TFJA 4A3JK 4G0VA 3SZYA 1VLOA 3S1QC 1J6WA 3AD7C 2R92C 2PA8L 5IYCC 4DDQA 2R92K 3GTMA 4Q5SA 4C2MC 3HOXC 2XCRB 2ZUFA 4G7ZA 3RZOK 4PAAA 3RZOC 4AYBL 5IP7K 4PABA 1Y1WK 1K83A 3GTMC 1ZVUA 1TWGC 4C3JC 5C44K 5C44C 4BBSK 1INNA 1JOEA 1TWCA 2Y0SD 1F7VA 3GTQA 2JA6K 3QX3A 2Y3PA 4A3DK 3OREA 4A3KK 4KATA 4QJVA 2XCQA 1VRQC 5IYCK 1IS1A 2WAQL 3FKIA 5M5WK 1TWGA 2CW0A 1VJEA 1JQWA 4Y52K 1I6VA 4AH6A 4OINA 3JSTA 3I4MC 4QJVB 4GT9A 3PO2C 3S1RC 4YFKA 1YNJA 2JA7A 1O2BA 3S0XA 3A8JA 3M3YC 1SFOC 3GEEA 2JA8C 3AD9C 5CJ9A 4A3BC 3GTJA 5IOTA 1O2AA 2NVTK 3HOWC 4QIWL 3ADAC 2GSUA 1HI9A 4A3GC 4P5BA 4LQYA 2V6UA 1TWGK 4C3JK 3BP3A 1USMA 4A3LC 3GTOK 3N0BA 1HQMA 2WB1L 4LK1A 3S1QK 4LLGA 2Y0SL 4GTFA 3H3VD 5D4DA 4A3JC 2GSOA 1J98A 2FQOA 5M5YK 2VUMA 3M3YK 4KMHA 4OIOA 4OIQA 3NUHA 4Y52C 1AB4A 2B63K 3GTQK 3GTKK 4KARA 3I4MK 1KQ4A 4O2DA 3V4GA 3S2DC 5IOSA 4G7OA 1WSRA 3S1MK 3GTKA 4ZH4A 3A8IA 4KDDA 1L0WA 1ISEA 1WOPA 1F9NA 3FHZA 4A3KC 4A3DC 3FKIK 2VUMK 5M3MK 1TWFC 4XCHA 5C4JK 1DCOA 3H0GK 3AQPA 1TWFK 4BBRC 3GTLC 2JA5C 4G7HA 5C4XK 4KASA 4MQ9A 3GEIA 1F7UA 3S16K 2PMZL 3S15K 4C3HC 3S2HK 3S14K 1V5VA 2BE5A 1TWFA 1SMYA 3HOVC 4OIRA 1BS2A 3GTJK 1JVIA 1YX2A 1XZPB 2RGRA 3AD8C 1I6HC 4KN4A 3TTGA 3GTKC 3GTQC 5L46A 2NVTC 1TWAA 2CFAB 4YFNA 1R9TK 3HOWK 4BY1C 3HXAA 2ZUEA 4Q4ZA 1Y1VC 1YCLA 1ZXOA 3H0GC 4A3EK 2YU9A 2A6HA 4WILA 5C3EK 5C3EC 4KB2A 2RH6A 2NVYK 2GAHC 2JA7C 2E2JC 5IORA 1XXBA 2NVXK 2V6SA 3HOZC 3M4OC 2VUMC 3G4CA 2FQTA 5IYDC 3HOVK 4AYBD 2R7ZA 2A69A 4C2MK 4BY7K 5E68A 5FLMK 1WCMK 2E2IC 1O27A 1X31C 1IE0A 2B63C 5IP9C 4A3CK 3L4JA 5EGHA 4LR2A 3N3YA 1O29A 3T01A 1J6VA 4LK0A 4C3IC 2E2HC 1I3QK 4FM9A 4GTLA 1XPPA 4GTEA 4A3FC 1XZQA 1ZQ1C 4J3NA 1Y1WA 1USOA 5TJ3A 4OIPA 5M3FK 1WSVA 2JA8K 4WJ4A 1SFOK 4QIWD 3GIRA 4ILDA 1SFOA 1I6HK 1EQRA 3L4KA 3GTGC 4WJ3M 2R7ZK 4BY1K 3PO3K 1B4AA 4C45A 1WCMC 1WQGA 4XLPA 4A3LK 4C3HK 4GTBA 3GTGA 1I50A 2E2JK 3S16C 4X6AK 4X6AC 1DD5A 5EGEA 3OPFA 4GZYA 2R93C 1TWAK 1R9TA 4A3MK 4MEXA 4BLAA 3VA7A 1TWHK 3N0CA 1TWAC 4A3FK 2XCOA 1IL2A 2E2HA 1I50K 3GTPC 4A93K 4G0UA 3S17C 3A8KA 1WIHA
chains in the Genus database with same CATH topology
4KN7A 5C4JK 1Y1VK 3EQLA 3H0GK 1Y1WK 1IW7A 1TWFK 3GTMC 4BBRC 3GTLC 1R9TC 1TWGC 2JA5C 5C44K 4G7HA 5C4XK 5C44C 4MQ9A 3S16K 2PMZL 3S2DK 3S15K 4BBSK 1TWCK 2O5IA 3GTOC 3HKZD 3S2HK 3S14K 5FJ8K 3HKZL 2Y0SD 3DXJA 2BE5A 3H3VL 3S1NK 2R93K 1K83K 3K7AK 2A68A 2JA6K 4YG2A 1SMYA 4KMUA 1I50C 3GTPK 1K83C 3K7AC 4A3DK 3HOVC 1TWHC 4A3KK 4OIRA 3HOZK 3GTJK 4QJVA 4NOIA 5IYCK 2WB1D 1I6HC 2PA8D 4KN4A 2WAQL 3S17K 5IP7C 3GTKC 5M5WK 3GTQC 2NVTC 4YFNA 1R9TK 3HOWK 2CW0A 4BY1C 2PMZD 4Y52K 1I6VA 4Q4ZA 4A3EC 1Y1VC 3GTMK 3H0GC 1Y1WC 4A3EK 4OINA 2A6HA 5C3EK 4XSXA 3I4MC 3S1RK 5C3EC 2WAQD 4QJVB 3PO2C 3S1MC 2NVYK 3S1RC 2JA7K 4YFKA 3HOYC 3S1NC 1YNJA 2JA7C 2E2JC 3HOYK 3I4NC 5IYBK 5TMCA 3S14C 1BDFA 2NVXK 3HOZC 3M4OC 3M3YC 3M4OK 1SFOC 2NVXC 5TMFA 2JA8C 2VUMC 4MEYA 4A3BC 5IYDC 3PO3C 3HOVK 4AYBD 4Y7NC 2A69A 4C2MK 3GTGK 2NVTK 2R7ZC 3HOWC 4A3BK 4BXXK 4BY7K 4A3GK 5C4JC 4QIWL 5FLMK 1WCMK 2NVQK 4A3GC 4LJZA 2E2IC 5FLMC 5C4XC 4XSZA 1TWGK 4C3JK 2JA5K 2B63C 4BBRK 5IP9C 4A3CK 4JK1A 5IP9K 4A3CC 4XLNA 3PO2K 4A3LC 4C3IK 2E2HK 3GTOK 3CQZC 4A3IC 5M5XK 3S15C 1HQMA 2O5JA 2WB1L 4LK0A 4LK1A 4LLGA 2Y0SL 2E2HC 5IYBC 1I3QK 3HOUK 3S1QK 3H3VD 3RZDK 3I4NK 5D4DA 4A3JC 1XPPA 4A3FC 2PPBA 3HOUC 4OIPA 5M3FK 3RZDC 2JA8K 4A93C 1SFOK 4A3MC 3HOXK 4QIWD 5M5YK 2YU9C 3M3YK 1I6HK 4OIOA 4OIQA 3GTJC 3GTGC 4YFXA 2R7ZK 4BY1K 4BY7C 3PO3K 3WODA 4Y52C 4Y7NK 5IYDK 2B63K 3GTQK 2E2IK 3GTKK 3GTLK 2NVQC 3I4MK 1WCMC 3CQZK 4A3IK 4XLPA 3S2HC 4A3LK 1TWCC 4C3HK 4X6AK 2E2JK 3S16C 3S2DC 2NVYC 4BBSC 4G7OA 4X6AC 4A3JK 3S1MK 1I3QC 4GZYA 2JA6C 3S1QC 2R93C 1TWAK 4ZH4A 4A3MK 4MEXA 2R92C 1YNNA 2PA8L 1ZYRA 5IYCC 2R92K 1TWHK 4A3KC 4Q5SA 1TWAC 4BXXC 4A3FK 2YU9K 3HOXC 1I50K 3FKIC 4G7ZA 3GTPC 3RZOK 4A93K 4A3DC 3FKIK 2VUMK 5M3MK 3RZOC 4AYBL 5IP7K 3S17C 2A6EA 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 A;  5C4J K;  1Y1V K;  3EQL A;  3H0G K;  1Y1W K;  1IW7 A;  1TWF K;  3GTM C;  4BBR C;  3GTL C;  1R9T C;  1TWG C;  2JA5 C;  5C44 K;  4G7H A;  5C4X K;  5C44 C;  4MQ9 A;  3S16 K;  2PMZ L;  3S2D K;  3S15 K;  4BBS K;  1TWC K;  2O5I A;  3GTO C;  3HKZ D;  3S2H K;  3S14 K;  5FJ8 K;  3HKZ L;  2Y0S D;  3DXJ A;  2BE5 A;  3H3V L;  3S1N K;  2R93 K;  1K83 K;  3K7A K;  2A68 A;  2JA6 K;  4YG2 A;  1SMY A;  4KMU A;  1I50 C;  3GTP K;  1K83 C;  3K7A C;  4A3D K;  3HOV C;  1TWH C;  4A3K K;  4OIR A;  3HOZ K;  3GTJ K;  4QJV A;  4NOI A;  5IYC K;  2WB1 D;  1I6H C;  2PA8 D;  4KN4 A;  2WAQ L;  3S17 K;  5IP7 C;  3GTK C;  5M5W K;  3GTQ C;  2NVT C;  4YFN A;  1R9T K;  3HOW K;  2CW0 A;  4BY1 C;  2PMZ D;  4Y52 K;  1I6V A;  4Q4Z A;  4A3E C;  1Y1V C;  3GTM K;  3H0G C;  1Y1W C;  4A3E K;  4OIN A;  2A6H A;  5C3E K;  4XSX A;  3I4M C;  3S1R K;  5C3E C;  2WAQ D;  4QJV B;  3PO2 C;  3S1M C;  2NVY K;  3S1R C;  2JA7 K;  4YFK A;  3HOY C;  3S1N C;  1YNJ A;  2JA7 C;  2E2J C;  3HOY K;  3I4N C;  5IYB K;  5TMC A;  3S14 C;  1BDF A;  2NVX K;  3HOZ C;  3M4O C;  3M3Y C;  3M4O K;  1SFO C;  2NVX C;  5TMF A;  2JA8 C;  2VUM C;  4MEY A;  4A3B C;  5IYD C;  3PO3 C;  3HOV K;  4AYB D;  4Y7N C;  2A69 A;  4C2M K;  3GTG K;  2NVT K;  2R7Z C;  3HOW C;  4A3B K;  4BXX K;  4BY7 K;  4A3G K;  5C4J C;  4QIW L;  5FLM K;  1WCM K;  2NVQ K;  4A3G C;  4LJZ A;  2E2I C;  5FLM C;  5C4X C;  4XSZ A;  1TWG K;  4C3J K;  2JA5 K;  2B63 C;  4BBR K;  5IP9 C;  4A3C K;  4JK1 A;  5IP9 K;  4A3C C;  4XLN A;  3PO2 K;  4A3L C;  4C3I K;  2E2H K;  3GTO K;  3CQZ C;  4A3I C;  5M5X K;  3S15 C;  1HQM A;  2O5J A;  2WB1 L;  4LK0 A;  4LK1 A;  4LLG A;  2Y0S L;  2E2H C;  5IYB C;  1I3Q K;  3HOU K;  3S1Q K;  3H3V D;  3RZD K;  3I4N K;  5D4D A;  4A3J C;  1XPP A;  4A3F C;  2PPB A;  3HOU C;  4OIP A;  5M3F K;  3RZD C;  2JA8 K;  4A93 C;  1SFO K;  4A3M C;  3HOX K;  4QIW D;  5M5Y K;  2YU9 C;  3M3Y K;  1I6H K;  4OIO A;  4OIQ A;  3GTJ C;  3GTG C;  4YFX A;  2R7Z K;  4BY1 K;  4BY7 C;  3PO3 K;  3WOD A;  4Y52 C;  4Y7N K;  5IYD K;  2B63 K;  3GTQ K;  2E2I K;  3GTK K;  3GTL K;  2NVQ C;  3I4M K;  1WCM C;  3CQZ K;  4A3I K;  4XLP A;  3S2H C;  4A3L K;  1TWC C;  4C3H K;  4X6A K;  2E2J K;  3S16 C;  3S2D C;  2NVY C;  4BBS C;  4G7O A;  4X6A C;  4A3J K;  3S1M K;  1I3Q C;  4GZY A;  2JA6 C;  3S1Q C;  2R93 C;  1TWA K;  4ZH4 A;  4A3M K;  4MEX A;  2R92 C;  1YNN A;  2PA8 L;  1ZYR A;  5IYC C;  2R92 K;  1TWH K;  4A3K C;  4Q5S A;  1TWA C;  4BXX C;  4A3F K;  2YU9 K;  3HOX C;  1I50 K;  3FKI C;  4G7Z A;  3GTP C;  3RZO K;  4A93 K;  4A3D C;  3FKI K;  2VUM K;  5M3M K;  3RZO C;  4AYB L;  5IP7 K;  3S17 C;  2A6E A;  1TWF C; 
#chains in the Genus database with same CATH topology
 3EQL A;  4KC6 A;  1IW7 A;  2E2I A;  1R9T C;  1DCP A;  3S2D K;  3GTO C;  3HKZ L;  3DXJ A;  4FZB A;  3H3V L;  3S1N K;  1EI6 A;  3GTL A;  2P8T A;  4KMA A;  3HOZ K;  1TWH A;  2WB1 D;  3LAP A;  1XXC A;  3GTO A;  5CHP A;  1IBA A;  2PHC B;  2PMZ D;  3T02 A;  2V6T A;  5IOQ A;  1Y1W C;  1GE9 A;  4BLB A;  4XSX A;  3S1R K;  2WAQ D;  1F93 A;  1RU0 A;  4G0W A;  3T00 A;  4GTD A;  3HOY C;  2CFA A;  4KMD A;  3HOY K;  3AH5 A;  5IYB K;  2B63 A;  1VH2 A;  5TMF A;  4MEY A;  4A3B K;  4BXX K;  3GTG K;  1O26 A;  2R7Z C;  4A3G K;  3TFI A;  2NVQ K;  1WCM A;  4LJZ A;  1BGW A;  4XSZ A;  1J6X A;  4BBR K;  4JK1 A;  4XLN A;  3CQZ C;  4A3I C;  3S15 C;  2O5J A;  1PJ6 A;  3G4A A;  3AQO A;  5HL8 A;  3I4N K;  3H0G A;  1O2F B;  1B4B A;  3BP8 C;  4A3M C;  2EBB A;  3HOX K;  3LAJ A;  1WQF A;  3GTJ C;  4BY7 C;  3IPJ A;  4M1X A;  3FOE A;  1EFW A;  2E2I K;  5JFE A;  1EK8 A;  3Q3Q A;  3GDZ A;  1WQH A;  3S2H C;  4BBS C;  1C0A A;  1DCH A;  1I3Q C;  2JA6 C;  1UV7 A;  1YNN A;  1ZYR A;  3BUE A;  4KM8 A;  4BXX C;  2YU9 K;  3FKI C;  3GEH A;  2A6E A;  2P5M A;  4KN7 A;  1WOO A;  1Y1V K;  1EH1 A;  4LOW A;  1Y1V A;  1VGX A;  1XZP A;  3CAG A;  1TWC K;  2O5I A;  3HKZ D;  3TFH A;  5FJ8 K;  2R93 A;  4GFQ A;  3MML B;  1XZQ B;  1K83 K;  3K7A K;  2A68 A;  3ERE D;  4YG2 A;  2R93 K;  2GSN A;  4KMU A;  1I50 C;  3GTP K;  1K83 C;  3K7A C;  4RMF A;  1TWH C;  2GAG C;  4NOI A;  2PA8 D;  2JH3 A;  3S17 K;  5IP7 C;  2JA6 A;  1I3Q A;  2JA5 A;  1WOS A;  3GTM K;  2R92 A;  4A3E C;  2ZFZ A;  1WOR A;  4KB4 A;  3S1M C;  4P5A A;  3FOF A;  2JA7 K;  3S1N C;  4GTA A;  3I4N C;  5TMC A;  3S14 C;  1BDF A;  1O28 A;  3M4O K;  1IQ0 A;  2NVX C;  3PO3 C;  4Y7N C;  3GSI A;  3OEP A;  2KWA A;  4GTC A;  5C4J C;  2D6F C;  5C4X C;  5FLM C;  1XXA A;  3CQZ A;  2JA5 K;  5IP9 K;  4A3C C;  1G51 A;  3PO2 K;  4C3I K;  2E2H K;  4KAW X;  5M5X K;  3LPX A;  5IYB C;  3HOU K;  3RZD K;  2PPB A;  3HOU C;  3RZD C;  4KM9 A;  4A93 C;  3SZZ A;  2YU9 C;  2NVY A;  5JVO A;  4YFX A;  1BJT A;  5IYD K;  3WOD A;  4Y7N K;  1O24 A;  2NVX A;  4BKW A;  3GTL K;  2NVQ C;  4P9S A;  3GTP A;  3CQZ K;  4A3I K;  1ZBS A;  1PJ7 A;  1O25 A;  1TWC C;  2W7V A;  1PJ5 A;  2NVY C;  3TFJ A;  4A3J K;  4G0V A;  3SZY A;  1VLO A;  3S1Q C;  1J6W A;  3AD7 C;  2R92 C;  2PA8 L;  5IYC C;  4DDQ A;  2R92 K;  3GTM A;  4Q5S A;  4C2M C;  3HOX C;  2XCR B;  2ZUF A;  4G7Z A;  3RZO K;  4PAA A;  3RZO C;  4AYB L;  5IP7 K;  4PAB A;  1Y1W K;  1K83 A;  3GTM C;  1ZVU A;  1TWG C;  4C3J C;  5C44 K;  5C44 C;  4BBS K;  1INN A;  1JOE A;  1TWC A;  2Y0S D;  1F7V A;  3GTQ A;  2JA6 K;  3QX3 A;  2Y3P A;  4A3D K;  3ORE A;  4A3K K;  4KAT A;  4QJV A;  2XCQ A;  1VRQ C;  5IYC K;  1IS1 A;  2WAQ L;  3FKI A;  5M5W K;  1TWG A;  2CW0 A;  1VJE A;  1JQW A;  4Y52 K;  1I6V A;  4AH6 A;  4OIN A;  3JST A;  3I4M C;  4QJV B;  4GT9 A;  3PO2 C;  3S1R C;  4YFK A;  1YNJ A;  2JA7 A;  1O2B A;  3S0X A;  3A8J A;  3M3Y C;  1SFO C;  3GEE A;  2JA8 C;  3AD9 C;  5CJ9 A;  4A3B C;  3GTJ A;  5IOT A;  1O2A A;  2NVT K;  3HOW C;  4QIW L;  3ADA C;  2GSU A;  1HI9 A;  4A3G C;  4P5B A;  4LQY A;  2V6U A;  1TWG K;  4C3J K;  3BP3 A;  1USM A;  4A3L C;  3GTO K;  3N0B A;  1HQM A;  2WB1 L;  4LK1 A;  3S1Q K;  4LLG A;  2Y0S L;  4GTF A;  3H3V D;  5D4D A;  4A3J C;  2GSO A;  1J98 A;  2FQO A;  5M5Y K;  2VUM A;  3M3Y K;  4KMH A;  4OIO A;  4OIQ A;  3NUH A;  4Y52 C;  1AB4 A;  2B63 K;  3GTQ K;  3GTK K;  4KAR A;  3I4M K;  1KQ4 A;  4O2D A;  3V4G A;  3S2D C;  5IOS A;  4G7O A;  1WSR A;  3S1M K;  3GTK A;  4ZH4 A;  3A8I A;  4KDD A;  1L0W A;  1ISE A;  1WOP A;  1F9N A;  3FHZ A;  4A3K C;  4A3D C;  3FKI K;  2VUM K;  5M3M K;  1TWF C;  4XCH A;  5C4J K;  1DCO A;  3H0G K;  3AQP A;  1TWF K;  4BBR C;  3GTL C;  2JA5 C;  4G7H A;  5C4X K;  4KAS A;  4MQ9 A;  3GEI A;  1F7U A;  3S16 K;  2PMZ L;  3S15 K;  4C3H C;  3S2H K;  3S14 K;  1V5V A;  2BE5 A;  1TWF A;  1SMY A;  3HOV C;  4OIR A;  1BS2 A;  3GTJ K;  1JVI A;  1YX2 A;  1XZP B;  2RGR A;  3AD8 C;  1I6H C;  4KN4 A;  3TTG A;  3GTK C;  3GTQ C;  5L46 A;  2NVT C;  1TWA A;  2CFA B;  4YFN A;  1R9T K;  3HOW K;  4BY1 C;  3HXA A;  2ZUE A;  4Q4Z A;  1Y1V C;  1YCL A;  1ZXO A;  3H0G C;  4A3E K;  2YU9 A;  2A6H A;  4WIL A;  5C3E K;  5C3E C;  4KB2 A;  2RH6 A;  2NVY K;  2GAH C;  2JA7 C;  2E2J C;  5IOR A;  1XXB A;  2NVX K;  2V6S A;  3HOZ C;  3M4O C;  2VUM C;  3G4C A;  2FQT A;  5IYD C;  3HOV K;  4AYB D;  2R7Z A;  2A69 A;  4C2M K;  4BY7 K;  5E68 A;  5FLM K;  1WCM K;  2E2I C;  1O27 A;  1X31 C;  1IE0 A;  2B63 C;  5IP9 C;  4A3C K;  3L4J A;  5EGH A;  4LR2 A;  3N3Y A;  1O29 A;  3T01 A;  1J6V A;  4LK0 A;  4C3I C;  2E2H C;  1I3Q K;  4FM9 A;  4GTL A;  1XPP A;  4GTE A;  4A3F C;  1XZQ A;  1ZQ1 C;  4J3N A;  1Y1W A;  1USO A;  5TJ3 A;  4OIP A;  5M3F K;  1WSV A;  2JA8 K;  4WJ4 A;  1SFO K;  4QIW D;  3GIR A;  4ILD A;  1SFO A;  1I6H K;  1EQR A;  3L4K A;  3GTG C;  4WJ3 M;  2R7Z K;  4BY1 K;  3PO3 K;  1B4A A;  4C45 A;  1WCM C;  1WQG A;  4XLP A;  4A3L K;  4C3H K;  4GTB A;  3GTG A;  1I50 A;  2E2J K;  3S16 C;  4X6A K;  4X6A C;  1DD5 A;  5EGE A;  3OPF A;  4GZY A;  2R93 C;  1TWA K;  1R9T A;  4A3M K;  4MEX A;  4BLA A;  3VA7 A;  1TWH K;  3N0C A;  1TWA C;  4A3F K;  2XCO A;  1IL2 A;  2E2H A;  1I50 K;  3GTP C;  4A93 K;  4G0U A;  3S17 C;  3A8K A;  1WIH A; 
#chains in the Genus database with same CATH homology
 4KN7 A;  5C4J K;  1Y1V K;  3EQL A;  3H0G K;  1Y1W K;  1IW7 A;  1TWF K;  3GTM C;  4BBR C;  3GTL C;  1R9T C;  1TWG C;  2JA5 C;  5C44 K;  4G7H A;  5C4X K;  5C44 C;  4MQ9 A;  3S16 K;  2PMZ L;  3S2D K;  3S15 K;  4BBS K;  1TWC K;  2O5I A;  3GTO C;  3HKZ D;  3S2H K;  3S14 K;  5FJ8 K;  3HKZ L;  2Y0S D;  3DXJ A;  2BE5 A;  3H3V L;  3S1N K;  2R93 K;  1K83 K;  3K7A K;  2A68 A;  2JA6 K;  4YG2 A;  1SMY A;  4KMU A;  1I50 C;  3GTP K;  1K83 C;  3K7A C;  4A3D K;  3HOV C;  1TWH C;  4A3K K;  4OIR A;  3HOZ K;  3GTJ K;  4QJV A;  4NOI A;  5IYC K;  2WB1 D;  1I6H C;  2PA8 D;  4KN4 A;  2WAQ L;  3S17 K;  5IP7 C;  3GTK C;  5M5W K;  3GTQ C;  2NVT C;  4YFN A;  1R9T K;  3HOW K;  2CW0 A;  4BY1 C;  2PMZ D;  4Y52 K;  1I6V A;  4Q4Z A;  4A3E C;  1Y1V C;  3GTM K;  3H0G C;  1Y1W C;  4A3E K;  4OIN A;  2A6H A;  5C3E K;  4XSX A;  3I4M C;  3S1R K;  5C3E C;  2WAQ D;  4QJV B;  3PO2 C;  3S1M C;  2NVY K;  3S1R C;  2JA7 K;  4YFK A;  3HOY C;  3S1N C;  1YNJ A;  2JA7 C;  2E2J C;  3HOY K;  3I4N C;  5IYB K;  5TMC A;  3S14 C;  1BDF A;  2NVX K;  3HOZ C;  3M4O C;  3M3Y C;  3M4O K;  1SFO C;  2NVX C;  5TMF A;  2JA8 C;  2VUM C;  4MEY A;  4A3B C;  5IYD C;  3PO3 C;  3HOV K;  4AYB D;  4Y7N C;  2A69 A;  4C2M K;  3GTG K;  2NVT K;  2R7Z C;  3HOW C;  4A3B K;  4BXX K;  4BY7 K;  4A3G K;  5C4J C;  4QIW L;  5FLM K;  1WCM K;  2NVQ K;  4A3G C;  4LJZ A;  2E2I C;  5FLM C;  5C4X C;  4XSZ A;  1TWG K;  4C3J K;  2JA5 K;  2B63 C;  4BBR K;  5IP9 C;  4A3C K;  4JK1 A;  5IP9 K;  4A3C C;  4XLN A;  3PO2 K;  4A3L C;  4C3I K;  2E2H K;  3GTO K;  3CQZ C;  4A3I C;  5M5X K;  3S15 C;  1HQM A;  2O5J A;  2WB1 L;  4LK0 A;  4LK1 A;  4LLG A;  2Y0S L;  2E2H C;  5IYB C;  1I3Q K;  3HOU K;  3S1Q K;  3H3V D;  3RZD K;  3I4N K;  5D4D A;  4A3J C;  1XPP A;  4A3F C;  2PPB A;  3HOU C;  4OIP A;  5M3F K;  3RZD C;  2JA8 K;  4A93 C;  1SFO K;  4A3M C;  3HOX K;  4QIW D;  5M5Y K;  2YU9 C;  3M3Y K;  1I6H K;  4OIO A;  4OIQ A;  3GTJ C;  3GTG C;  4YFX A;  2R7Z K;  4BY1 K;  4BY7 C;  3PO3 K;  3WOD A;  4Y52 C;  4Y7N K;  5IYD K;  2B63 K;  3GTQ K;  2E2I K;  3GTK K;  3GTL K;  2NVQ C;  3I4M K;  1WCM C;  3CQZ K;  4A3I K;  4XLP A;  3S2H C;  4A3L K;  1TWC C;  4C3H K;  4X6A K;  2E2J K;  3S16 C;  3S2D C;  2NVY C;  4BBS C;  4G7O A;  4X6A C;  4A3J K;  3S1M K;  1I3Q C;  4GZY A;  2JA6 C;  3S1Q C;  2R93 C;  1TWA K;  4ZH4 A;  4A3M K;  4MEX A;  2R92 C;  1YNN A;  2PA8 L;  1ZYR A;  5IYC C;  2R92 K;  1TWH K;  4A3K C;  4Q5S A;  1TWA C;  4BXX C;  4A3F K;  2YU9 K;  3HOX C;  1I50 K;  3FKI C;  4G7Z A;  3GTP C;  3RZO K;  4A93 K;  4A3D C;  3FKI K;  2VUM K;  5M3M K;  3RZO C;  4AYB L;  5IP7 K;  3S17 C;  2A6E A;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...