3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
3S14C 4G7ZA 3I4MK 2E2IC 2A69A 2YU9K 5TMFA 3S1NK 4YG2A 3GTJK 3I4NC 3GTMC 2A6HA 5FLMK 4X6AK 2A68A 4BXXC 3S15C 4OINA 4YFKA 1TWAC 4Y52C 2NVQK 3HOUK 3I4MC 3GTPK 3S2HC 3GTJC 5FLMC 4X6AC 2PA8D 3M3YK 4AYBD 5M3FK 4A3DK 4A3CK 1YNNA 3HOUC 3S2DK 1R9TC 3GTPC 3RZOK 4KN4A 5IYDC 1WCMK 3HOXK 4A3EK 1Y1WK 5M5YK 2E2HK 4OIQA 2R7ZC 4A3CC 4NOIA 1YNJA 2PMZD 5IYCK 4Q4ZA 4A3MK 4OIRA 3S2DC 4BBSK 2WB1D 3RZOC 2NVXK 3HOXC 5M5XK 1Y1WC 2E2HC 4Q5SA 5IYCC 4BXXK 4A3MC 3S15K 4BBSC 4BY7K 1TWAK 4Y52K 2NVXC 4XSZA 3S2HK 2R92C 3K7AK 5C4JC 4QIWD 4KMUA 4C2MK 2JA7K 3GTOK 1BDFA 4LK1A 4BY7C 2PPBA 2O5JA 1R9TK 1ZYRA 2NVTK 3S1RK 5IYDK 3K7AC 2JA7C 3S1MK 4GZYA 3GTOC 1HQMA 3PO2K 2PA8L 2R7ZK 3PO3C 4C3IK 4AYBL 2Y0SD 4YFXA 4LJZA 2R93K 4XSXA 2NVTC 1TWCK 3S1RC 1SFOK 5D4DA 3S1MC 3HOYK 5TMCA 3PO2C 2R93C 2A6EA 2PMZL 4QJVB 1XPPA 3CQZK 1I3QK 5IP9C 4MEXA 1TWCC 4A3GK 2WB1L 5C44K 1SFOC 3S17K 4JK1A 2R92K 3FKIC 3GTLK 3HOYC 1I50C 3H0GK 5C4JK 3DXJA 3WODA 2VUMK 2WAQD 3GTGC 5FJ8K 3CQZC 1I3QC 2BE5A 2JA5C 4A3GC 1TWFC 4A3IC 5C44C 3S17C 3GTLC 4Y7NC 1SMYA 4A93C 3H0GC 4C3JK 2VUMC 1I6VA 4QIWL 4A3FK 3PO3K 4LLGA 1I6HC 4G7HA 3H3VD 4A3KC 3GTKK 2JA6K 3HKZD 2O5IA 3EQLA 4A3BK 4XLPA 4A3FC 3S16C 3RZDC 4A3JC 4OIOA 3GTKC 5IP9K 5M3MK 2JA6C 4A3DC 1TWGK 4BBRK 3HOVK 4A3BC 3FKIK 4BY1K 1I50K 4XLNA 4C3HK 3GTGK 4QJVA 2JA5K 1TWFK 1TWGC 1K83K 4BBRC 4A3IK 3HOVC 5C4XK 3GTQC 4BY1C 4Y7NK 2CW0A 4A93K 3M4OK 1TWHC 2E2JK 4ZH4A 4KN7A 1IW7A 5IP7K 2WAQL 3HOWK 4A3LK 4G7OA 1I6HK 1K83C 2YU9C 2NVYK 4A3KK 3S1NC 4LK0A 5C4XC 4YFNA 3HOZK 2JA8K 3M4OC 2E2JC 5IP7C 3HOWC 3S16K 3S1QK 4A3LC 2NVQC 3RZDK 4A3JK 2B63K 2NVYC 3H3VL 3HOZC 2JA8C 3HKZL 1Y1VK 5C3EK 5IYBK 3M3YC 3S1QC 4MEYA 2Y0SL 2B63C 3S14K 4OIPA 5M5WK 2E2IK 1WCMC 1Y1VC 5IYBC 5C3EC 3GTQK 4A3EC 3I4NK 3GTMK 1TWHK 4MQ9A
chains in the Genus database with same CATH superfamily
3S14C 2XCOA 2A69A 2YU9K 1WORA 3I4NC 2A6HA 5FLMK 3ERED 2A68A 4BXXC 1TWCA 1WQHA 4YFKA 1TWAC 5FLMC 4GTEA 1WQGA 4A3CK 1YNNA 1JVIA 4LQYA 4BLAA 2VUMA 5IYDC 4A3CC 4OIRA 1YNJA 3GDZA 5EGEA 3FOEA 1XXCA 4GFQA 4PAAA 4Q5SA 3T02A 3SZYA 3AH5A 2R92C 2PHCB 2GAGC 3L4KA 3GTOK 5IOTA 3GTQA 2P5MA 1DCOA 3GTOC 2R7ZK 3PO3C 2Y0SD 4LJZA 4XSXA 1F9NA 4BLBA 1TWCK 1XZPB 3HOYK 5CHPA 3AD7C 2NVYA 1TWCC 1INNA 3Q3QA 3HOYC 3DXJA 3WODA 2VUMK 4KARA 1C0AA 2ZUEA 4AH6A 2GAHC 1SMYA 2VUMC 4G7HA 1O29A 1IS1A 4A3KC 2CFAA 2O5IA 4XLPA 1WOPA 1YX2A 3RZDC 1PJ7A 1R9TA 4C3HK 1TWFK 3AD8C 3GTQC 4C3HC 5EGHA 3LPXA 2NVYK 4KATA 4J3NA 3HOZK 1O2BA 2JA8K 5CJ9A 1O26A 2NVQC 2NVYC 1XZQB 3HOZC 2JA8C 3BP3A 5IYBK 3BP8C 4KMAA 4RMFA 5M5WK 4PABA 3VA7A 5IYBC 2XCQA 1JQWA 5JFEA 5TMFA 4X6AK 5IOQA 3GIRA 4Y52C 4FZBA 1L0WA 1I50A 5JVOA 4KB4A 4X6AC 2PA8D 2JA5A 4AYBD 3LAJA 1ZVUA 1R9TC 3RZOK 1WCMK 2P8TA 4A3EK 4OIQA 3LAPA 2PMZD 1DCHA 5IYCK 1DCPA 3RZOC 2EBBA 4O2DA 4BKWA 5TJ3A 5IYCC 3JSTA 3GTKA 4BXXK 4BY7K 1O2AA 3A8JA 2ZFZA 1TWAK 1WSRA 3K7AK 4QIWD 1BDFA 4LK1A 4BY7C 1ZXOA 2PPBA 2O5JA 3TFIA 2GSUA 1TWHA 2NVTK 1JOEA 5IYDK 3K7AC 4GZYA 3S1MK 1WSVA 3N3YA 5IORA 1O2FB 2PA8L 4AYBL 2NVTC 3S1MC 4GTAA 5TMCA 1HI9A 2A6EA 1EK8A 2PMZL 4QJVB 5IP9C 4MEXA 4A3GK 3S17K 4JK1A 4C45A 2R92K 1I50C 5E68A 3S0XA 3QX3A 2JA5C 4A3GC 4A3IC 3S17C 1IQ0A 4QIWL 4A3FK 3PO3K 4KMHA 1I6HC 1XXBA 2CFAB 3GTKK 3HKZD 1IBAA 4A3FC 1VJEA 4A3JC 4OIOA 3GTKC 5M3MK 3TFHA 4QJVA 3M4OK 1TWHC 2E2JK 4ZH4A 1YCLA 5IP7K 4GTDA 1VH2A 4G0VA 3S1NC 4A3KK 2E2HA 1USMA 4YFNA 3M4OC 2E2JC 1AB4A 1DD5A 5IP7C 3RZDK 1J6WA 3HKZL 1EI6A 3G4AA 3M3YC 2Y0SL 3OREA 2JA7A 4KDDA 3T01A 3GTQK 4MQ9A 3N0BA 1GE9A 3I4MK 2R93A 2V6TA 3S15C 4GTCA 3G4CA 1SFOA 2NVQK 3FKIA 3HOUK 3I4MC 3L4JA 3S2HC 3GTGA 1I3QA 5M3FK 3GTLA 3HOUC 3H0GA 3CAGA 3HOXK 5IOSA 5M5YK 2E2HK 4Q4ZA 4KB2A 2WB1D 4P9SA 4GTFA 4G0UA 3HOXC 5M5XK 1B4AA 2E2HC 2JA6A 3A8KA 2RH6A 4Y52K 2JA7K 4LR2A 5C4JC 1WQFA 4KMUA 4WJ3M 1R9TK 1B4BA 4KC6A 3S1RK 1EFWA 2JA7C 1HQMA 3TFJA 2YU9A 2R93K 4YFXA 1ZBSA 4DDQA 3S1RC 4GT9A 1SFOK 5D4DA 2JH3A 3AQOA 2R93C 1XPPA 3V4GA 1I3QK 2WB1L 5C44K 1SFOC 3GTLK 3AD9C 3FKIC 4KASA 3H0GK 2WAQD 3GTGC 3GEEA 5FJ8K 1I3QC 5C44C 3GTLC 4Y7NC 4A93C 3H0GC 4C3JK 1IL2A 2E2IA 4LLGA 3H3VD 3GTMA 2JA6K 4C3JC 3IPJA 1PJ6A 3EQLA 4GTLA 1G51A 4WILA 3S16C 1WIHA 1KQ4A 3GTJA 5IP9K 2JA6C 1WOOA 1I50K 5L46A 4XLNA 3GTPA 3TTGA 1ZQ1C 2JA5K 1ISEA 1J98A 4GTBA 4A3IK 1IE0A 5C4XK 2R7ZA 3A8IA 2CW0A 2Y3PA 2KWAA 4KN7A 3HOWK 4A3LK 1VRQC 2WAQL 4G7OA 1I6HK 1Y1WA 2YU9C 4KMDA 5C4XC 4LK0A 2RGRA 1EQRA 1EH1A 3HOWC 4A3LC 2NVXA 4A3JK 3H3VL 4WJ4A 1F7UA 5C3EK 4KM9A 1J6XA 1O27A 4KM8A 4OIPA 2FQTA 3ADAC 2E2IK 1VLOA 3MMLB 5C3EC 4G0WA 3GTMK 1TWHK 4NOIA 1J6VA 1USOA 4G7ZA 2E2IC 3S1NK 4YG2A 3GTJK 3GTMC 4KAWX 2ZUFA 4OINA 1F7VA 1UV7A 3AQPA 3GTPK 3GTJC 3CQZA 3M3YK 1TWFA 4A3DK 1RU0A 3S2DK 3GTPC 4KN4A 1XXAA 1Y1WK 4A3DC 2R7ZC 4P5AA 4A3MK 1V5VA 3S2DC 4XCHA 1PJ5A 3GEHA 4BBSK 2NVXK 1Y1WC 2GSNA 4A3MC 3S15K 4BBSC 2NVXC 4XSZA 1BGWA 3S2HK 4ILDA 4C2MK 3NUHA 1TWGA 1BJTA 3SZZA 2V6UA 3FOFA 3BUEA 4C2MC 3PO2K 1K83A 4C3IK 1BS2A 2V6SA 1XZPA 3PO2C 4C3IC 1O24A 1VGXA 3CQZK 5C4JK 2B63A 1WCMA 1Y1VA 2BE5A 3CQZC 3HXAA 4LOWA 1TWFC 4FM9A 3GSIA 1I6VA 4M1XA 4P5BA 4A3BK 1TWAA 3OEPA 1WOSA 1TWGK 4BBRK 3HOVK 4A3BC 3FKIK 3FHZA 4BY1K 2W7VA 5HL8A 2XCRB 3GTGK 1TWGC 1O28A 1K83K 4BBRC 3HOVC 4BY1C 4Y7NK 4A93K 2FQOA 1IW7A 1F93A 1K83C 1X31C 3S16K 3S1QK 2R92A 2D6FC 2B63K 3OPFA 1XZQA 1Y1VK 2GSOA 3S1QC 4MEYA 2B63C 3S14K 3GTOA 1O25A 3GEIA 1WCMC 1Y1VC 4A3EC 3I4NK 3N0CA 3T00A 1ZYRA
chains in the Genus database with same CATH topology
3S14C 4G7ZA 3I4MK 2E2IC 2A69A 2YU9K 5TMFA 3S1NK 4YG2A 3GTJK 3I4NC 3GTMC 2A6HA 5FLMK 4X6AK 2A68A 4BXXC 3S15C 4OINA 4YFKA 1TWAC 4Y52C 2NVQK 3HOUK 3I4MC 3GTPK 3S2HC 3GTJC 5FLMC 4X6AC 2PA8D 3M3YK 4AYBD 5M3FK 4A3DK 4A3CK 1YNNA 3HOUC 3S2DK 1R9TC 3GTPC 3RZOK 4KN4A 5IYDC 1WCMK 3HOXK 4A3EK 1Y1WK 5M5YK 2E2HK 4OIQA 2R7ZC 4A3CC 4NOIA 1YNJA 2PMZD 5IYCK 4Q4ZA 4A3MK 4OIRA 3S2DC 4BBSK 2WB1D 3RZOC 2NVXK 3HOXC 5M5XK 1Y1WC 2E2HC 4Q5SA 5IYCC 4BXXK 4A3MC 3S15K 4BBSC 4BY7K 1TWAK 4Y52K 2NVXC 4XSZA 3S2HK 2R92C 3K7AK 5C4JC 4QIWD 4KMUA 4C2MK 2JA7K 3GTOK 1BDFA 4LK1A 4BY7C 2PPBA 2O5JA 1R9TK 1ZYRA 2NVTK 3S1RK 5IYDK 3K7AC 2JA7C 3S1MK 4GZYA 3GTOC 1HQMA 3PO2K 2PA8L 2R7ZK 3PO3C 4C3IK 4AYBL 2Y0SD 4YFXA 4LJZA 2R93K 4XSXA 2NVTC 1TWCK 3S1RC 1SFOK 5D4DA 3S1MC 3HOYK 5TMCA 3PO2C 2R93C 2A6EA 2PMZL 4QJVB 1XPPA 3CQZK 1I3QK 5IP9C 4MEXA 1TWCC 4A3GK 2WB1L 5C44K 1SFOC 3S17K 4JK1A 2R92K 3FKIC 3GTLK 3HOYC 1I50C 3H0GK 5C4JK 3DXJA 3WODA 2VUMK 2WAQD 3GTGC 5FJ8K 3CQZC 1I3QC 2BE5A 2JA5C 4A3GC 1TWFC 4A3IC 5C44C 3S17C 3GTLC 4Y7NC 1SMYA 4A93C 3H0GC 4C3JK 2VUMC 1I6VA 4QIWL 4A3FK 3PO3K 4LLGA 1I6HC 4G7HA 3H3VD 4A3KC 3GTKK 2JA6K 3HKZD 2O5IA 3EQLA 4A3BK 4XLPA 4A3FC 3S16C 3RZDC 4A3JC 4OIOA 3GTKC 5IP9K 5M3MK 2JA6C 4A3DC 1TWGK 4BBRK 3HOVK 4A3BC 3FKIK 4BY1K 1I50K 4XLNA 4C3HK 3GTGK 4QJVA 2JA5K 1TWFK 1TWGC 1K83K 4BBRC 4A3IK 3HOVC 5C4XK 3GTQC 4BY1C 4Y7NK 2CW0A 4A93K 3M4OK 1TWHC 2E2JK 4ZH4A 4KN7A 1IW7A 5IP7K 2WAQL 3HOWK 4A3LK 4G7OA 1I6HK 1K83C 2YU9C 2NVYK 4A3KK 3S1NC 4LK0A 5C4XC 4YFNA 3HOZK 2JA8K 3M4OC 2E2JC 5IP7C 3HOWC 3S16K 3S1QK 4A3LC 2NVQC 3RZDK 4A3JK 2B63K 2NVYC 3H3VL 3HOZC 2JA8C 3HKZL 1Y1VK 5C3EK 5IYBK 3M3YC 3S1QC 4MEYA 2Y0SL 2B63C 3S14K 4OIPA 5M5WK 2E2IK 1WCMC 1Y1VC 5IYBC 5C3EC 3GTQK 4A3EC 3I4NK 3GTMK 1TWHK 4MQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 C;  4G7Z A;  3I4M K;  2E2I C;  2A69 A;  2YU9 K;  5TMF A;  3S1N K;  4YG2 A;  3GTJ K;  3I4N C;  3GTM C;  2A6H A;  5FLM K;  4X6A K;  2A68 A;  4BXX C;  3S15 C;  4OIN A;  4YFK A;  1TWA C;  4Y52 C;  2NVQ K;  3HOU K;  3I4M C;  3GTP K;  3S2H C;  3GTJ C;  5FLM C;  4X6A C;  2PA8 D;  3M3Y K;  4AYB D;  5M3F K;  4A3D K;  4A3C K;  1YNN A;  3HOU C;  3S2D K;  1R9T C;  3GTP C;  3RZO K;  4KN4 A;  5IYD C;  1WCM K;  3HOX K;  4A3E K;  1Y1W K;  5M5Y K;  2E2H K;  4OIQ A;  2R7Z C;  4A3C C;  4NOI A;  1YNJ A;  2PMZ D;  5IYC K;  4Q4Z A;  4A3M K;  4OIR A;  3S2D C;  4BBS K;  2WB1 D;  3RZO C;  2NVX K;  3HOX C;  5M5X K;  1Y1W C;  2E2H C;  4Q5S A;  5IYC C;  4BXX K;  4A3M C;  3S15 K;  4BBS C;  4BY7 K;  1TWA K;  4Y52 K;  2NVX C;  4XSZ A;  3S2H K;  2R92 C;  3K7A K;  5C4J C;  4QIW D;  4KMU A;  4C2M K;  2JA7 K;  3GTO K;  1BDF A;  4LK1 A;  4BY7 C;  2PPB A;  2O5J A;  1R9T K;  1ZYR A;  2NVT K;  3S1R K;  5IYD K;  3K7A C;  2JA7 C;  3S1M K;  4GZY A;  3GTO C;  1HQM A;  3PO2 K;  2PA8 L;  2R7Z K;  3PO3 C;  4C3I K;  4AYB L;  2Y0S D;  4YFX A;  4LJZ A;  2R93 K;  4XSX A;  2NVT C;  1TWC K;  3S1R C;  1SFO K;  5D4D A;  3S1M C;  3HOY K;  5TMC A;  3PO2 C;  2R93 C;  2A6E A;  2PMZ L;  4QJV B;  1XPP A;  3CQZ K;  1I3Q K;  5IP9 C;  4MEX A;  1TWC C;  4A3G K;  2WB1 L;  5C44 K;  1SFO C;  3S17 K;  4JK1 A;  2R92 K;  3FKI C;  3GTL K;  3HOY C;  1I50 C;  3H0G K;  5C4J K;  3DXJ A;  3WOD A;  2VUM K;  2WAQ D;  3GTG C;  5FJ8 K;  3CQZ C;  1I3Q C;  2BE5 A;  2JA5 C;  4A3G C;  1TWF C;  4A3I C;  5C44 C;  3S17 C;  3GTL C;  4Y7N C;  1SMY A;  4A93 C;  3H0G C;  4C3J K;  2VUM C;  1I6V A;  4QIW L;  4A3F K;  3PO3 K;  4LLG A;  1I6H C;  4G7H A;  3H3V D;  4A3K C;  3GTK K;  2JA6 K;  3HKZ D;  2O5I A;  3EQL A;  4A3B K;  4XLP A;  4A3F C;  3S16 C;  3RZD C;  4A3J C;  4OIO A;  3GTK C;  5IP9 K;  5M3M K;  2JA6 C;  4A3D C;  1TWG K;  4BBR K;  3HOV K;  4A3B C;  3FKI K;  4BY1 K;  1I50 K;  4XLN A;  4C3H K;  3GTG K;  4QJV A;  2JA5 K;  1TWF K;  1TWG C;  1K83 K;  4BBR C;  4A3I K;  3HOV C;  5C4X K;  3GTQ C;  4BY1 C;  4Y7N K;  2CW0 A;  4A93 K;  3M4O K;  1TWH C;  2E2J K;  4ZH4 A;  4KN7 A;  1IW7 A;  5IP7 K;  2WAQ L;  3HOW K;  4A3L K;  4G7O A;  1I6H K;  1K83 C;  2YU9 C;  2NVY K;  4A3K K;  3S1N C;  4LK0 A;  5C4X C;  4YFN A;  3HOZ K;  2JA8 K;  3M4O C;  2E2J C;  5IP7 C;  3HOW C;  3S16 K;  3S1Q K;  4A3L C;  2NVQ C;  3RZD K;  4A3J K;  2B63 K;  2NVY C;  3H3V L;  3HOZ C;  2JA8 C;  3HKZ L;  1Y1V K;  5C3E K;  5IYB K;  3M3Y C;  3S1Q C;  4MEY A;  2Y0S L;  2B63 C;  3S14 K;  4OIP A;  5M5W K;  2E2I K;  1WCM C;  1Y1V C;  5IYB C;  5C3E C;  3GTQ K;  4A3E C;  3I4N K;  3GTM K;  1TWH K;  4MQ9 A; 
#chains in the Genus database with same CATH topology
 3S14 C;  2XCO A;  2A69 A;  2YU9 K;  1WOR A;  3I4N C;  2A6H A;  5FLM K;  3ERE D;  2A68 A;  4BXX C;  1TWC A;  1WQH A;  4YFK A;  1TWA C;  5FLM C;  4GTE A;  1WQG A;  4A3C K;  1YNN A;  1JVI A;  4LQY A;  4BLA A;  2VUM A;  5IYD C;  4A3C C;  4OIR A;  1YNJ A;  3GDZ A;  5EGE A;  3FOE A;  1XXC A;  4GFQ A;  4PAA A;  4Q5S A;  3T02 A;  3SZY A;  3AH5 A;  2R92 C;  2PHC B;  2GAG C;  3L4K A;  3GTO K;  5IOT A;  3GTQ A;  2P5M A;  1DCO A;  3GTO C;  2R7Z K;  3PO3 C;  2Y0S D;  4LJZ A;  4XSX A;  1F9N A;  4BLB A;  1TWC K;  1XZP B;  3HOY K;  5CHP A;  3AD7 C;  2NVY A;  1TWC C;  1INN A;  3Q3Q A;  3HOY C;  3DXJ A;  3WOD A;  2VUM K;  4KAR A;  1C0A A;  2ZUE A;  4AH6 A;  2GAH C;  1SMY A;  2VUM C;  4G7H A;  1O29 A;  1IS1 A;  4A3K C;  2CFA A;  2O5I A;  4XLP A;  1WOP A;  1YX2 A;  3RZD C;  1PJ7 A;  1R9T A;  4C3H K;  1TWF K;  3AD8 C;  3GTQ C;  4C3H C;  5EGH A;  3LPX A;  2NVY K;  4KAT A;  4J3N A;  3HOZ K;  1O2B A;  2JA8 K;  5CJ9 A;  1O26 A;  2NVQ C;  2NVY C;  1XZQ B;  3HOZ C;  2JA8 C;  3BP3 A;  5IYB K;  3BP8 C;  4KMA A;  4RMF A;  5M5W K;  4PAB A;  3VA7 A;  5IYB C;  2XCQ A;  1JQW A;  5JFE A;  5TMF A;  4X6A K;  5IOQ A;  3GIR A;  4Y52 C;  4FZB A;  1L0W A;  1I50 A;  5JVO A;  4KB4 A;  4X6A C;  2PA8 D;  2JA5 A;  4AYB D;  3LAJ A;  1ZVU A;  1R9T C;  3RZO K;  1WCM K;  2P8T A;  4A3E K;  4OIQ A;  3LAP A;  2PMZ D;  1DCH A;  5IYC K;  1DCP A;  3RZO C;  2EBB A;  4O2D A;  4BKW A;  5TJ3 A;  5IYC C;  3JST A;  3GTK A;  4BXX K;  4BY7 K;  1O2A A;  3A8J A;  2ZFZ A;  1TWA K;  1WSR A;  3K7A K;  4QIW D;  1BDF A;  4LK1 A;  4BY7 C;  1ZXO A;  2PPB A;  2O5J A;  3TFI A;  2GSU A;  1TWH A;  2NVT K;  1JOE A;  5IYD K;  3K7A C;  4GZY A;  3S1M K;  1WSV A;  3N3Y A;  5IOR A;  1O2F B;  2PA8 L;  4AYB L;  2NVT C;  3S1M C;  4GTA A;  5TMC A;  1HI9 A;  2A6E A;  1EK8 A;  2PMZ L;  4QJV B;  5IP9 C;  4MEX A;  4A3G K;  3S17 K;  4JK1 A;  4C45 A;  2R92 K;  1I50 C;  5E68 A;  3S0X A;  3QX3 A;  2JA5 C;  4A3G C;  4A3I C;  3S17 C;  1IQ0 A;  4QIW L;  4A3F K;  3PO3 K;  4KMH A;  1I6H C;  1XXB A;  2CFA B;  3GTK K;  3HKZ D;  1IBA A;  4A3F C;  1VJE A;  4A3J C;  4OIO A;  3GTK C;  5M3M K;  3TFH A;  4QJV A;  3M4O K;  1TWH C;  2E2J K;  4ZH4 A;  1YCL A;  5IP7 K;  4GTD A;  1VH2 A;  4G0V A;  3S1N C;  4A3K K;  2E2H A;  1USM A;  4YFN A;  3M4O C;  2E2J C;  1AB4 A;  1DD5 A;  5IP7 C;  3RZD K;  1J6W A;  3HKZ L;  1EI6 A;  3G4A A;  3M3Y C;  2Y0S L;  3ORE A;  2JA7 A;  4KDD A;  3T01 A;  3GTQ K;  4MQ9 A;  3N0B A;  1GE9 A;  3I4M K;  2R93 A;  2V6T A;  3S15 C;  4GTC A;  3G4C A;  1SFO A;  2NVQ K;  3FKI A;  3HOU K;  3I4M C;  3L4J A;  3S2H C;  3GTG A;  1I3Q A;  5M3F K;  3GTL A;  3HOU C;  3H0G A;  3CAG A;  3HOX K;  5IOS A;  5M5Y K;  2E2H K;  4Q4Z A;  4KB2 A;  2WB1 D;  4P9S A;  4GTF A;  4G0U A;  3HOX C;  5M5X K;  1B4A A;  2E2H C;  2JA6 A;  3A8K A;  2RH6 A;  4Y52 K;  2JA7 K;  4LR2 A;  5C4J C;  1WQF A;  4KMU A;  4WJ3 M;  1R9T K;  1B4B A;  4KC6 A;  3S1R K;  1EFW A;  2JA7 C;  1HQM A;  3TFJ A;  2YU9 A;  2R93 K;  4YFX A;  1ZBS A;  4DDQ A;  3S1R C;  4GT9 A;  1SFO K;  5D4D A;  2JH3 A;  3AQO A;  2R93 C;  1XPP A;  3V4G A;  1I3Q K;  2WB1 L;  5C44 K;  1SFO C;  3GTL K;  3AD9 C;  3FKI C;  4KAS A;  3H0G K;  2WAQ D;  3GTG C;  3GEE A;  5FJ8 K;  1I3Q C;  5C44 C;  3GTL C;  4Y7N C;  4A93 C;  3H0G C;  4C3J K;  1IL2 A;  2E2I A;  4LLG A;  3H3V D;  3GTM A;  2JA6 K;  4C3J C;  3IPJ A;  1PJ6 A;  3EQL A;  4GTL A;  1G51 A;  4WIL A;  3S16 C;  1WIH A;  1KQ4 A;  3GTJ A;  5IP9 K;  2JA6 C;  1WOO A;  1I50 K;  5L46 A;  4XLN A;  3GTP A;  3TTG A;  1ZQ1 C;  2JA5 K;  1ISE A;  1J98 A;  4GTB A;  4A3I K;  1IE0 A;  5C4X K;  2R7Z A;  3A8I A;  2CW0 A;  2Y3P A;  2KWA A;  4KN7 A;  3HOW K;  4A3L K;  1VRQ C;  2WAQ L;  4G7O A;  1I6H K;  1Y1W A;  2YU9 C;  4KMD A;  5C4X C;  4LK0 A;  2RGR A;  1EQR A;  1EH1 A;  3HOW C;  4A3L C;  2NVX A;  4A3J K;  3H3V L;  4WJ4 A;  1F7U A;  5C3E K;  4KM9 A;  1J6X A;  1O27 A;  4KM8 A;  4OIP A;  2FQT A;  3ADA C;  2E2I K;  1VLO A;  3MML B;  5C3E C;  4G0W A;  3GTM K;  1TWH K;  4NOI A;  1J6V A;  1USO A;  4G7Z A;  2E2I C;  3S1N K;  4YG2 A;  3GTJ K;  3GTM C;  4KAW X;  2ZUF A;  4OIN A;  1F7V A;  1UV7 A;  3AQP A;  3GTP K;  3GTJ C;  3CQZ A;  3M3Y K;  1TWF A;  4A3D K;  1RU0 A;  3S2D K;  3GTP C;  4KN4 A;  1XXA A;  1Y1W K;  4A3D C;  2R7Z C;  4P5A A;  4A3M K;  1V5V A;  3S2D C;  4XCH A;  1PJ5 A;  3GEH A;  4BBS K;  2NVX K;  1Y1W C;  2GSN A;  4A3M C;  3S15 K;  4BBS C;  2NVX C;  4XSZ A;  1BGW A;  3S2H K;  4ILD A;  4C2M K;  3NUH A;  1TWG A;  1BJT A;  3SZZ A;  2V6U A;  3FOF A;  3BUE A;  4C2M C;  3PO2 K;  1K83 A;  4C3I K;  1BS2 A;  2V6S A;  1XZP A;  3PO2 C;  4C3I C;  1O24 A;  1VGX A;  3CQZ K;  5C4J K;  2B63 A;  1WCM A;  1Y1V A;  2BE5 A;  3CQZ C;  3HXA A;  4LOW A;  1TWF C;  4FM9 A;  3GSI A;  1I6V A;  4M1X A;  4P5B A;  4A3B K;  1TWA A;  3OEP A;  1WOS A;  1TWG K;  4BBR K;  3HOV K;  4A3B C;  3FKI K;  3FHZ A;  4BY1 K;  2W7V A;  5HL8 A;  2XCR B;  3GTG K;  1TWG C;  1O28 A;  1K83 K;  4BBR C;  3HOV C;  4BY1 C;  4Y7N K;  4A93 K;  2FQO A;  1IW7 A;  1F93 A;  1K83 C;  1X31 C;  3S16 K;  3S1Q K;  2R92 A;  2D6F C;  2B63 K;  3OPF A;  1XZQ A;  1Y1V K;  2GSO A;  3S1Q C;  4MEY A;  2B63 C;  3S14 K;  3GTO A;  1O25 A;  3GEI A;  1WCM C;  1Y1V C;  4A3E C;  3I4N K;  3N0C A;  3T00 A;  1ZYR A; 
#chains in the Genus database with same CATH homology
 3S14 C;  4G7Z A;  3I4M K;  2E2I C;  2A69 A;  2YU9 K;  5TMF A;  3S1N K;  4YG2 A;  3GTJ K;  3I4N C;  3GTM C;  2A6H A;  5FLM K;  4X6A K;  2A68 A;  4BXX C;  3S15 C;  4OIN A;  4YFK A;  1TWA C;  4Y52 C;  2NVQ K;  3HOU K;  3I4M C;  3GTP K;  3S2H C;  3GTJ C;  5FLM C;  4X6A C;  2PA8 D;  3M3Y K;  4AYB D;  5M3F K;  4A3D K;  4A3C K;  1YNN A;  3HOU C;  3S2D K;  1R9T C;  3GTP C;  3RZO K;  4KN4 A;  5IYD C;  1WCM K;  3HOX K;  4A3E K;  1Y1W K;  5M5Y K;  2E2H K;  4OIQ A;  2R7Z C;  4A3C C;  4NOI A;  1YNJ A;  2PMZ D;  5IYC K;  4Q4Z A;  4A3M K;  4OIR A;  3S2D C;  4BBS K;  2WB1 D;  3RZO C;  2NVX K;  3HOX C;  5M5X K;  1Y1W C;  2E2H C;  4Q5S A;  5IYC C;  4BXX K;  4A3M C;  3S15 K;  4BBS C;  4BY7 K;  1TWA K;  4Y52 K;  2NVX C;  4XSZ A;  3S2H K;  2R92 C;  3K7A K;  5C4J C;  4QIW D;  4KMU A;  4C2M K;  2JA7 K;  3GTO K;  1BDF A;  4LK1 A;  4BY7 C;  2PPB A;  2O5J A;  1R9T K;  1ZYR A;  2NVT K;  3S1R K;  5IYD K;  3K7A C;  2JA7 C;  3S1M K;  4GZY A;  3GTO C;  1HQM A;  3PO2 K;  2PA8 L;  2R7Z K;  3PO3 C;  4C3I K;  4AYB L;  2Y0S D;  4YFX A;  4LJZ A;  2R93 K;  4XSX A;  2NVT C;  1TWC K;  3S1R C;  1SFO K;  5D4D A;  3S1M C;  3HOY K;  5TMC A;  3PO2 C;  2R93 C;  2A6E A;  2PMZ L;  4QJV B;  1XPP A;  3CQZ K;  1I3Q K;  5IP9 C;  4MEX A;  1TWC C;  4A3G K;  2WB1 L;  5C44 K;  1SFO C;  3S17 K;  4JK1 A;  2R92 K;  3FKI C;  3GTL K;  3HOY C;  1I50 C;  3H0G K;  5C4J K;  3DXJ A;  3WOD A;  2VUM K;  2WAQ D;  3GTG C;  5FJ8 K;  3CQZ C;  1I3Q C;  2BE5 A;  2JA5 C;  4A3G C;  1TWF C;  4A3I C;  5C44 C;  3S17 C;  3GTL C;  4Y7N C;  1SMY A;  4A93 C;  3H0G C;  4C3J K;  2VUM C;  1I6V A;  4QIW L;  4A3F K;  3PO3 K;  4LLG A;  1I6H C;  4G7H A;  3H3V D;  4A3K C;  3GTK K;  2JA6 K;  3HKZ D;  2O5I A;  3EQL A;  4A3B K;  4XLP A;  4A3F C;  3S16 C;  3RZD C;  4A3J C;  4OIO A;  3GTK C;  5IP9 K;  5M3M K;  2JA6 C;  4A3D C;  1TWG K;  4BBR K;  3HOV K;  4A3B C;  3FKI K;  4BY1 K;  1I50 K;  4XLN A;  4C3H K;  3GTG K;  4QJV A;  2JA5 K;  1TWF K;  1TWG C;  1K83 K;  4BBR C;  4A3I K;  3HOV C;  5C4X K;  3GTQ C;  4BY1 C;  4Y7N K;  2CW0 A;  4A93 K;  3M4O K;  1TWH C;  2E2J K;  4ZH4 A;  4KN7 A;  1IW7 A;  5IP7 K;  2WAQ L;  3HOW K;  4A3L K;  4G7O A;  1I6H K;  1K83 C;  2YU9 C;  2NVY K;  4A3K K;  3S1N C;  4LK0 A;  5C4X C;  4YFN A;  3HOZ K;  2JA8 K;  3M4O C;  2E2J C;  5IP7 C;  3HOW C;  3S16 K;  3S1Q K;  4A3L C;  2NVQ C;  3RZD K;  4A3J K;  2B63 K;  2NVY C;  3H3V L;  3HOZ C;  2JA8 C;  3HKZ L;  1Y1V K;  5C3E K;  5IYB K;  3M3Y C;  3S1Q C;  4MEY A;  2Y0S L;  2B63 C;  3S14 K;  4OIP A;  5M5W K;  2E2I K;  1WCM C;  1Y1V C;  5IYB C;  5C3E C;  3GTQ K;  4A3E C;  3I4N K;  3GTM K;  1TWH K;  4MQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...