3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
2NVYK 3M3YC 2E2JC 5TMCA 3RZDC 4C2MK 5C4JK 2PMZD 2B63C 2CW0A 5IYCK 5IYDC 3S17C 3M4OK 5C44K 4A3BK 2R93C 3S1RK 4QJVA 2WAQD 1I6VA 3EQLA 3HKZL 4Y7NK 4OINA 4A3EK 3GTQC 2BE5A 2YU9K 2R92C 3GTJC 3GTKC 5M5XK 3S16C 3PO3K 2A68A 3K7AK 3HOVC 3HKZD 4LJZA 3S2HK 1TWGC 2O5IA 3HOXK 2E2IK 4BBSK 5M3MK 1Y1VK 3HOWK 3I4MC 3K7AC 3S17K 3S15C 3GTGK 3S2HC 3H3VL 4C3IK 4XSZA 1TWCC 1TWAC 3GTGC 3GTLK 4QIWD 4A3EC 2E2HK 3GTQK 2R92K 1K83K 4OIPA 1TWAK 4NOIA 1I6HC 4Q5SA 4X6AC 1I50C 4A3CC 4A3JK 1TWGK 5M5WK 4A3CK 3GTPK 4LK0A 1TWHK 5C44C 4A3BC 3H3VD 5TMFA 2R7ZC 4YG2A 4BY7C 2R93K 5C4XC 3H0GC 5IP9K 4A3DC 1I3QK 2WB1L 4A3GK 4LLGA 2NVTK 5FJ8K 4XSXA 3H0GK 3M3YK 3HOZC 2PA8L 3S2DC 4X6AK 3DXJA 4YFNA 5IYDK 4YFXA 3S1MC 4QJVB 4A93C 4A3FC 3HOXC 2Y0SL 2A69A 4MEYA 4BBRC 4C3HK 5C4XK 5M3FK 1R9TC 4GZYA 3S16K 1I3QC 5D4DA 1HQMA 5C3EK 4OIRA 3GTLC 2E2HC 3RZOK 2Y0SD 3FKIK 4YFKA 1R9TK 3HOVK 4BXXC 3HOZK 1BDFA 1I6HK 3S2DK 4QIWL 3I4NC 1Y1VC 4C3JK 3FKIC 4BY1C 3GTMK 2JA7C 4KMUA 3HOUK 4A3JC 3HOWC 3S1MK 3PO2K 4A93K 3GTOC 3I4NK 1WCMK 4KN4A 1YNNA 3GTPC 4OIQA 4MQ9A 1TWHC 3S1NC 1YNJA 3GTOK 2A6HA 4AYBL 5IP9C 4ZH4A 5C3EC 4MEXA 4A3GC 5IP7K 4G7HA 1I50K 2PA8D 4BXXK 5IYBK 1TWFK 2JA6K 5IP7C 3CQZK 2JA7K 2WB1D 3HOUC 2E2JK 1TWFC 5C4JC 2JA6C 4A3MK 2R7ZK 4BY7K 2NVTC 2JA8K 4A3MC 3S14K 2O5JA 2NVQK 1SFOK 4OIOA 4Y7NC 4A3KC 3HOYK 2JA8C 3S14C 2NVYC 4A3KK 4A3FK 3HOYC 2B63K 4BBRK 3M4OC 1IW7A 3CQZC 4BY1K 3GTMC 2NVXC 4Y52C 1ZYRA 1SMYA 2NVXK 2WAQL 3RZOC 1Y1WK 4Y52K 4JK1A 4G7ZA 2YU9C 4XLNA 3GTJK 2A6EA 2PPBA 1SFOC 2NVQC 2VUMK 3GTKK 3S1QC 4Q4ZA 1Y1WC 4A3LC 1K83C 4XLPA 3PO2C 2E2IC 1WCMC 4BBSC 4AYBD 4LK1A 5IYCC 2JA5K 3I4MK 3S1NK 1TWCK 3S1RC 5FLMK 2JA5C 4A3IC 5M5YK 2VUMC 2PMZL 4KN7A 3S1QK 3S15K 5FLMC 1XPPA 5IYBC 3RZDK 4A3IK 3WODA 4A3DK 4G7OA 3PO3C 4A3LK
chains in the Genus database with same CATH superfamily
1F9NA 2B63C 3M4OK 5IYCK 3N0CA 2R93C 2JA6A 4Y7NK 3EQLA 3HKZL 3GTKA 3GTQC 1YX2A 3GTJC 5M5XK 1B4BA 1USOA 4LOWA 5M3MK 3I4MC 3GTPA 3H3VL 1XZQB 1TWCC 1TWAA 3GTGC 1PJ7A 3N0BA 1G51A 4Q5SA 4GTAA 1I50C 3L4JA 3GEIA 2R93K 3H3VD 2JA7A 4YG2A 5L46A 4A3DC 4LLGA 5FJ8K 3H0GK 3M3YK 4PABA 3HOZC 1XXCA 4GTLA 4YFNA 5IYDK 4FM9A 2NVXA 1IL2A 4KMHA 3HOXC 2Y0SL 4C3HK 5M3FK 1R9TC 3S16K 1HQMA 4P5AA 3S2DK 4QIWL 2R7ZA 4A3JC 4KB4A 4KM8A 3GTPC 1O29A 2A6HA 1WQHA 5IP9C 4A3GC 4G7HA 2PA8D 1O2BA 1J6VA 1HI9A 2JA6C 2R7ZK 4BY7K 1VJEA 3JSTA 2JA8K 2O5JA 3GSIA 1XZPB 2NVQK 3LPXA 1J6XA 2NVYC 4A3FK 3S0XA 1IW7A 5CHPA 2WAQL 3TFJA 3RZOC 4Y52K 4G7ZA 2VUMK 4XLNA 3GTKK 1AB4A 5E68A 4A3LC 4KM9A 4LK1A 2JA5K 1TWCK 1TWGA 4GTCA 3A8KA 2JA5C 5M5YK 2VUMC 5IYBC 4A3IK 3WODA 1V5VA 2NVYK 3M3YC 5TMCA 3RZDC 3S17C 5IYDC 4A3BK 1XZQA 1Y1WA 1I6VA 1ZXOA 4OINA 4A3EK 1VRQC 1ZVUA 2A68A 3K7AK 4LJZA 1EQRA 3GEEA 2E2IK 1Y1VK 3GTGK 2CFAB 3S2HC 3Q3QA 1WOSA 1O28A 1TWAC 3GTLK 4QIWD 1TWAK 4OIPA 3OREA 1BJTA 3GTQA 4XCHA 4A3CC 4A3JK 1ZQ1C 1I50A 2ZUFA 3GTPK 1Y1VA 5C44C 3HXAA 5TMFA 3H0GC 1IS1A 2VUMA 1RU0A 3BP3A 2PA8L 5TJ3A 4X6AK 4BKWA 1O27A 3S1MC 4M1XA 4QJVB 3GIRA 4A3FC 2FQTA 4BBRC 3BP8C 1INNA 1O26A 4KC6A 4GZYA 2E2HA 1VGXA 2CFAA 3AQPA 3V4GA 1KQ4A 4YFKA 3HOZK 1I6HK 5IOQA 3I4NC 3HOWC 4GT9A 3S15K 4BY1C 3GTMK 3S1MK 4A93K 1YCLA 3GTOC 3SZYA 4OIQA 4MQ9A 1TWHC 3S1NC 1EK8A 3GEHA 1JOEA 5IP7K 4BXXK 3LAJA 1TWFK 1O24A 1O25A 3N3YA 2E2JK 1TWFC 4A3MK 1XXBA 2R92A 2NVTC 1K83A 1SFOK 4Y7NC 4A3KC 1BS2A 1ISEA 2JA8C 1EFWA 2B63K 4BBRK 3M4OC 4PAAA 4BY1K 3GTMC 2NVXC 1IBAA 1WIHA 1SMYA 2P5MA 2NVXK 1WQGA 1Y1WK 2PPBA 2NVQC 2A6EA 1SFOC 1IQ0A 4KMDA 1WCMA 4XLPA 3PO2C 4BBSC 3NUHA 4AYBD 3S1RC 1B4AA 1J98A 4G0VA 4KB2A 1UV7A 1O2FB 1XXAA 4LR2A 2RGRA 2E2JC 1XZPA 4KASA 2P8TA 3S1RK 4QJVA 2WAQD 4KAWX 2R92C 4DDQA 3FHZA 2Y3PA 3PO3K 3TTGA 3HOVC 2NVYA 1VH2A 3OEPA 3GTOA 1TWGC 2O5IA 3S17K 3HOWK 3S15C 3K7AC 5EGEA 4XSZA 4C3IK 4BLAA 4KARA 4A3EC 2E2HK 2R92K 3AD7C 2GAGC 3GTGA 1K83K 3T00A 4NOIA 3GTLA 4FZBA 5M5WK 2XCRB 2E2IA 4A3CK 4LK0A 1TWHK 5C4XC 4P9SA 4KDDA 3LAPA 5IP9K 4P5BA 5IOSA 2V6SA 4ILDA 3G4CA 3DXJA 4C3HC 1PJ5A 4WJ3M 4A93C 2A69A 1R9TA 1F7UA 3BUEA 1I3QC 3GTLC 5C3EK 3RZOK 2Y0SD 3G4AA 3FKIK 3HOVK 2V6UA 1Y1VC 3FKIC 3HOUK 1PJ6A 4C3JC 4C45A 3CAGA 3AD8C 4AYBL 4ZH4A 2XCOA 1DCHA 3SZZA 5IYBK 2JA6K 5IORA 5IP7C 3AD9C 3CQZK 2JA7K 2WB1D 1DD5A 2ZUEA 4C2MC 3IPJA 4GTFA 2FQOA 5C4JC 1F93A 4AH6A 1WQFA 5HL8A 3S14C 3MMLB 3L4KA 3ERED 4GTDA 2GSUA 3CQZC 1JQWA 3CQZA 1ZYRA 3FOEA 4C3IC 1ZBSA 3S1QC 4Q4ZA 4GFQA 1WORA 3ADAC 1F7VA 1K83C 2R93A 1WCMC 4WJ4A 2PHCB 3OPFA 5FLMK 3GTMA 4A3IC 5EGHA 2PMZL 1DCPA 3AH5A 2D6FC 1XPPA 1WSRA 1WSVA 2RH6A 4G7OA 4A3LK 4C2MK 5C4JK 2PMZD 2CW0A 1WOOA 5IOTA 5C44K 1TWFA 1USMA 3T02A 4J3NA 3GTJA 2V6TA 2BE5A 3A8JA 2JH3A 2YU9K 3GTKC 3S16C 1X31C 3HKZD 3S2HK 4O2DA 3HOXK 4BBSK 1BGWA 4G0UA 2B63A 1JVIA 3GTQK 3A8IA 5JFEA 1I6HC 2EBBA 4X6AC 1TWGK 2GSOA 3H0GA 4A3BC 5JVOA 5CJ9A 2R7ZC 4BY7C 1J6WA 1I3QK 2WB1L 4A3GK 1GE9A 2NVTK 4XSXA 1TWHA 3S2DC 4YFXA 2GAHC 4KATA 4MEYA 1C0AA 4BLBA 1L0WA 5C4XK 4GTBA 5D4DA 4OIRA 1EI6A 2E2HC 1R9TK 4BXXC 1BDFA 1EH1A 3I4MK 4C3JK 2JA7C 4KMUA 2ZFZA 3PO2K 3I4NK 1WCMK 4KN4A 1DCOA 1YNNA 2KWAA 1YNJA 3GTOK 3TFIA 5C3EC 4MEXA 2W7VA 1I50K 1IE0A 3AQOA 4GTEA 3HOUC 3FOFA 4LQYA 1SFOA 3S14K 4A3MC 4OIOA 3HOYK 4RMFA 3T01A 4KMAA 4A3KK 3VA7A 3HOYC 1VLOA 2JA5A 1TWCA 4Y52C 1WOPA 4G0WA 3TFHA 4JK1A 2YU9C 3GTJK 1O2AA 2YU9A 1I3QA 1Y1WC 3QX3A 2E2IC 5IYCC 3FKIA 3GDZA 3S1NK 2GSNA 4WILA 2XCQA 4KN7A 3S1QK 5FLMC 4A3DK 3RZDK 3PO3C
chains in the Genus database with same CATH topology
2NVYK 3M3YC 2E2JC 5TMCA 3RZDC 4C2MK 5C4JK 2PMZD 2B63C 2CW0A 5IYCK 5IYDC 3S17C 3M4OK 5C44K 4A3BK 2R93C 3S1RK 4QJVA 2WAQD 1I6VA 3EQLA 3HKZL 4Y7NK 4OINA 4A3EK 3GTQC 2BE5A 2YU9K 2R92C 3GTJC 3GTKC 5M5XK 3S16C 3PO3K 2A68A 3K7AK 3HOVC 3HKZD 4LJZA 3S2HK 1TWGC 2O5IA 3HOXK 2E2IK 4BBSK 5M3MK 1Y1VK 3HOWK 3I4MC 3K7AC 3S17K 3S15C 3GTGK 3S2HC 3H3VL 4C3IK 4XSZA 1TWCC 1TWAC 3GTGC 3GTLK 4QIWD 4A3EC 2E2HK 3GTQK 2R92K 1K83K 4OIPA 1TWAK 4NOIA 1I6HC 4Q5SA 4X6AC 1I50C 4A3CC 4A3JK 1TWGK 5M5WK 4A3CK 3GTPK 4LK0A 1TWHK 5C44C 4A3BC 3H3VD 5TMFA 2R7ZC 4YG2A 4BY7C 2R93K 5C4XC 3H0GC 5IP9K 4A3DC 1I3QK 2WB1L 4A3GK 4LLGA 2NVTK 5FJ8K 4XSXA 3H0GK 3M3YK 3HOZC 2PA8L 3S2DC 4X6AK 3DXJA 4YFNA 5IYDK 4YFXA 3S1MC 4QJVB 4A93C 4A3FC 3HOXC 2Y0SL 2A69A 4MEYA 4BBRC 4C3HK 5C4XK 5M3FK 1R9TC 4GZYA 3S16K 1I3QC 5D4DA 1HQMA 5C3EK 4OIRA 3GTLC 2E2HC 3RZOK 2Y0SD 3FKIK 4YFKA 1R9TK 3HOVK 4BXXC 3HOZK 1BDFA 1I6HK 3S2DK 4QIWL 3I4NC 1Y1VC 4C3JK 3FKIC 4BY1C 3GTMK 2JA7C 4KMUA 3HOUK 4A3JC 3HOWC 3S1MK 3PO2K 4A93K 3GTOC 3I4NK 1WCMK 4KN4A 1YNNA 3GTPC 4OIQA 4MQ9A 1TWHC 3S1NC 1YNJA 3GTOK 2A6HA 4AYBL 5IP9C 4ZH4A 5C3EC 4MEXA 4A3GC 5IP7K 4G7HA 1I50K 2PA8D 4BXXK 5IYBK 1TWFK 2JA6K 5IP7C 3CQZK 2JA7K 2WB1D 3HOUC 2E2JK 1TWFC 5C4JC 2JA6C 4A3MK 2R7ZK 4BY7K 2NVTC 2JA8K 4A3MC 3S14K 2O5JA 2NVQK 1SFOK 4OIOA 4Y7NC 4A3KC 3HOYK 2JA8C 3S14C 2NVYC 4A3KK 4A3FK 3HOYC 2B63K 4BBRK 3M4OC 1IW7A 3CQZC 4BY1K 3GTMC 2NVXC 4Y52C 1ZYRA 1SMYA 2NVXK 2WAQL 3RZOC 1Y1WK 4Y52K 4JK1A 4G7ZA 2YU9C 4XLNA 3GTJK 2A6EA 2PPBA 1SFOC 2NVQC 2VUMK 3GTKK 3S1QC 4Q4ZA 1Y1WC 4A3LC 1K83C 4XLPA 3PO2C 2E2IC 1WCMC 4BBSC 4AYBD 4LK1A 5IYCC 2JA5K 3I4MK 3S1NK 1TWCK 3S1RC 5FLMK 2JA5C 4A3IC 5M5YK 2VUMC 2PMZL 4KN7A 3S1QK 3S15K 5FLMC 1XPPA 5IYBC 3RZDK 4A3IK 3WODA 4A3DK 4G7OA 3PO3C 4A3LK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY K;  3M3Y C;  2E2J C;  5TMC A;  3RZD C;  4C2M K;  5C4J K;  2PMZ D;  2B63 C;  2CW0 A;  5IYC K;  5IYD C;  3S17 C;  3M4O K;  5C44 K;  4A3B K;  2R93 C;  3S1R K;  4QJV A;  2WAQ D;  1I6V A;  3EQL A;  3HKZ L;  4Y7N K;  4OIN A;  4A3E K;  3GTQ C;  2BE5 A;  2YU9 K;  2R92 C;  3GTJ C;  3GTK C;  5M5X K;  3S16 C;  3PO3 K;  2A68 A;  3K7A K;  3HOV C;  3HKZ D;  4LJZ A;  3S2H K;  1TWG C;  2O5I A;  3HOX K;  2E2I K;  4BBS K;  5M3M K;  1Y1V K;  3HOW K;  3I4M C;  3K7A C;  3S17 K;  3S15 C;  3GTG K;  3S2H C;  3H3V L;  4C3I K;  4XSZ A;  1TWC C;  1TWA C;  3GTG C;  3GTL K;  4QIW D;  4A3E C;  2E2H K;  3GTQ K;  2R92 K;  1K83 K;  4OIP A;  1TWA K;  4NOI A;  1I6H C;  4Q5S A;  4X6A C;  1I50 C;  4A3C C;  4A3J K;  1TWG K;  5M5W K;  4A3C K;  3GTP K;  4LK0 A;  1TWH K;  5C44 C;  4A3B C;  3H3V D;  5TMF A;  2R7Z C;  4YG2 A;  4BY7 C;  2R93 K;  5C4X C;  3H0G C;  5IP9 K;  4A3D C;  1I3Q K;  2WB1 L;  4A3G K;  4LLG A;  2NVT K;  5FJ8 K;  4XSX A;  3H0G K;  3M3Y K;  3HOZ C;  2PA8 L;  3S2D C;  4X6A K;  3DXJ A;  4YFN A;  5IYD K;  4YFX A;  3S1M C;  4QJV B;  4A93 C;  4A3F C;  3HOX C;  2Y0S L;  2A69 A;  4MEY A;  4BBR C;  4C3H K;  5C4X K;  5M3F K;  1R9T C;  4GZY A;  3S16 K;  1I3Q C;  5D4D A;  1HQM A;  5C3E K;  4OIR A;  3GTL C;  2E2H C;  3RZO K;  2Y0S D;  3FKI K;  4YFK A;  1R9T K;  3HOV K;  4BXX C;  3HOZ K;  1BDF A;  1I6H K;  3S2D K;  4QIW L;  3I4N C;  1Y1V C;  4C3J K;  3FKI C;  4BY1 C;  3GTM K;  2JA7 C;  4KMU A;  3HOU K;  4A3J C;  3HOW C;  3S1M K;  3PO2 K;  4A93 K;  3GTO C;  3I4N K;  1WCM K;  4KN4 A;  1YNN A;  3GTP C;  4OIQ A;  4MQ9 A;  1TWH C;  3S1N C;  1YNJ A;  3GTO K;  2A6H A;  4AYB L;  5IP9 C;  4ZH4 A;  5C3E C;  4MEX A;  4A3G C;  5IP7 K;  4G7H A;  1I50 K;  2PA8 D;  4BXX K;  5IYB K;  1TWF K;  2JA6 K;  5IP7 C;  3CQZ K;  2JA7 K;  2WB1 D;  3HOU C;  2E2J K;  1TWF C;  5C4J C;  2JA6 C;  4A3M K;  2R7Z K;  4BY7 K;  2NVT C;  2JA8 K;  4A3M C;  3S14 K;  2O5J A;  2NVQ K;  1SFO K;  4OIO A;  4Y7N C;  4A3K C;  3HOY K;  2JA8 C;  3S14 C;  2NVY C;  4A3K K;  4A3F K;  3HOY C;  2B63 K;  4BBR K;  3M4O C;  1IW7 A;  3CQZ C;  4BY1 K;  3GTM C;  2NVX C;  4Y52 C;  1ZYR A;  1SMY A;  2NVX K;  2WAQ L;  3RZO C;  1Y1W K;  4Y52 K;  4JK1 A;  4G7Z A;  2YU9 C;  4XLN A;  3GTJ K;  2A6E A;  2PPB A;  1SFO C;  2NVQ C;  2VUM K;  3GTK K;  3S1Q C;  4Q4Z A;  1Y1W C;  4A3L C;  1K83 C;  4XLP A;  3PO2 C;  2E2I C;  1WCM C;  4BBS C;  4AYB D;  4LK1 A;  5IYC C;  2JA5 K;  3I4M K;  3S1N K;  1TWC K;  3S1R C;  5FLM K;  2JA5 C;  4A3I C;  5M5Y K;  2VUM C;  2PMZ L;  4KN7 A;  3S1Q K;  3S15 K;  5FLM C;  1XPP A;  5IYB C;  3RZD K;  4A3I K;  3WOD A;  4A3D K;  4G7O A;  3PO3 C;  4A3L K; 
#chains in the Genus database with same CATH topology
 1F9N A;  2B63 C;  3M4O K;  5IYC K;  3N0C A;  2R93 C;  2JA6 A;  4Y7N K;  3EQL A;  3HKZ L;  3GTK A;  3GTQ C;  1YX2 A;  3GTJ C;  5M5X K;  1B4B A;  1USO A;  4LOW A;  5M3M K;  3I4M C;  3GTP A;  3H3V L;  1XZQ B;  1TWC C;  1TWA A;  3GTG C;  1PJ7 A;  3N0B A;  1G51 A;  4Q5S A;  4GTA A;  1I50 C;  3L4J A;  3GEI A;  2R93 K;  3H3V D;  2JA7 A;  4YG2 A;  5L46 A;  4A3D C;  4LLG A;  5FJ8 K;  3H0G K;  3M3Y K;  4PAB A;  3HOZ C;  1XXC A;  4GTL A;  4YFN A;  5IYD K;  4FM9 A;  2NVX A;  1IL2 A;  4KMH A;  3HOX C;  2Y0S L;  4C3H K;  5M3F K;  1R9T C;  3S16 K;  1HQM A;  4P5A A;  3S2D K;  4QIW L;  2R7Z A;  4A3J C;  4KB4 A;  4KM8 A;  3GTP C;  1O29 A;  2A6H A;  1WQH A;  5IP9 C;  4A3G C;  4G7H A;  2PA8 D;  1O2B A;  1J6V A;  1HI9 A;  2JA6 C;  2R7Z K;  4BY7 K;  1VJE A;  3JST A;  2JA8 K;  2O5J A;  3GSI A;  1XZP B;  2NVQ K;  3LPX A;  1J6X A;  2NVY C;  4A3F K;  3S0X A;  1IW7 A;  5CHP A;  2WAQ L;  3TFJ A;  3RZO C;  4Y52 K;  4G7Z A;  2VUM K;  4XLN A;  3GTK K;  1AB4 A;  5E68 A;  4A3L C;  4KM9 A;  4LK1 A;  2JA5 K;  1TWC K;  1TWG A;  4GTC A;  3A8K A;  2JA5 C;  5M5Y K;  2VUM C;  5IYB C;  4A3I K;  3WOD A;  1V5V A;  2NVY K;  3M3Y C;  5TMC A;  3RZD C;  3S17 C;  5IYD C;  4A3B K;  1XZQ A;  1Y1W A;  1I6V A;  1ZXO A;  4OIN A;  4A3E K;  1VRQ C;  1ZVU A;  2A68 A;  3K7A K;  4LJZ A;  1EQR A;  3GEE A;  2E2I K;  1Y1V K;  3GTG K;  2CFA B;  3S2H C;  3Q3Q A;  1WOS A;  1O28 A;  1TWA C;  3GTL K;  4QIW D;  1TWA K;  4OIP A;  3ORE A;  1BJT A;  3GTQ A;  4XCH A;  4A3C C;  4A3J K;  1ZQ1 C;  1I50 A;  2ZUF A;  3GTP K;  1Y1V A;  5C44 C;  3HXA A;  5TMF A;  3H0G C;  1IS1 A;  2VUM A;  1RU0 A;  3BP3 A;  2PA8 L;  5TJ3 A;  4X6A K;  4BKW A;  1O27 A;  3S1M C;  4M1X A;  4QJV B;  3GIR A;  4A3F C;  2FQT A;  4BBR C;  3BP8 C;  1INN A;  1O26 A;  4KC6 A;  4GZY A;  2E2H A;  1VGX A;  2CFA A;  3AQP A;  3V4G A;  1KQ4 A;  4YFK A;  3HOZ K;  1I6H K;  5IOQ A;  3I4N C;  3HOW C;  4GT9 A;  3S15 K;  4BY1 C;  3GTM K;  3S1M K;  4A93 K;  1YCL A;  3GTO C;  3SZY A;  4OIQ A;  4MQ9 A;  1TWH C;  3S1N C;  1EK8 A;  3GEH A;  1JOE A;  5IP7 K;  4BXX K;  3LAJ A;  1TWF K;  1O24 A;  1O25 A;  3N3Y A;  2E2J K;  1TWF C;  4A3M K;  1XXB A;  2R92 A;  2NVT C;  1K83 A;  1SFO K;  4Y7N C;  4A3K C;  1BS2 A;  1ISE A;  2JA8 C;  1EFW A;  2B63 K;  4BBR K;  3M4O C;  4PAA A;  4BY1 K;  3GTM C;  2NVX C;  1IBA A;  1WIH A;  1SMY A;  2P5M A;  2NVX K;  1WQG A;  1Y1W K;  2PPB A;  2NVQ C;  2A6E A;  1SFO C;  1IQ0 A;  4KMD A;  1WCM A;  4XLP A;  3PO2 C;  4BBS C;  3NUH A;  4AYB D;  3S1R C;  1B4A A;  1J98 A;  4G0V A;  4KB2 A;  1UV7 A;  1O2F B;  1XXA A;  4LR2 A;  2RGR A;  2E2J C;  1XZP A;  4KAS A;  2P8T A;  3S1R K;  4QJV A;  2WAQ D;  4KAW X;  2R92 C;  4DDQ A;  3FHZ A;  2Y3P A;  3PO3 K;  3TTG A;  3HOV C;  2NVY A;  1VH2 A;  3OEP A;  3GTO A;  1TWG C;  2O5I A;  3S17 K;  3HOW K;  3S15 C;  3K7A C;  5EGE A;  4XSZ A;  4C3I K;  4BLA A;  4KAR A;  4A3E C;  2E2H K;  2R92 K;  3AD7 C;  2GAG C;  3GTG A;  1K83 K;  3T00 A;  4NOI A;  3GTL A;  4FZB A;  5M5W K;  2XCR B;  2E2I A;  4A3C K;  4LK0 A;  1TWH K;  5C4X C;  4P9S A;  4KDD A;  3LAP A;  5IP9 K;  4P5B A;  5IOS A;  2V6S A;  4ILD A;  3G4C A;  3DXJ A;  4C3H C;  1PJ5 A;  4WJ3 M;  4A93 C;  2A69 A;  1R9T A;  1F7U A;  3BUE A;  1I3Q C;  3GTL C;  5C3E K;  3RZO K;  2Y0S D;  3G4A A;  3FKI K;  3HOV K;  2V6U A;  1Y1V C;  3FKI C;  3HOU K;  1PJ6 A;  4C3J C;  4C45 A;  3CAG A;  3AD8 C;  4AYB L;  4ZH4 A;  2XCO A;  1DCH A;  3SZZ A;  5IYB K;  2JA6 K;  5IOR A;  5IP7 C;  3AD9 C;  3CQZ K;  2JA7 K;  2WB1 D;  1DD5 A;  2ZUE A;  4C2M C;  3IPJ A;  4GTF A;  2FQO A;  5C4J C;  1F93 A;  4AH6 A;  1WQF A;  5HL8 A;  3S14 C;  3MML B;  3L4K A;  3ERE D;  4GTD A;  2GSU A;  3CQZ C;  1JQW A;  3CQZ A;  1ZYR A;  3FOE A;  4C3I C;  1ZBS A;  3S1Q C;  4Q4Z A;  4GFQ A;  1WOR A;  3ADA C;  1F7V A;  1K83 C;  2R93 A;  1WCM C;  4WJ4 A;  2PHC B;  3OPF A;  5FLM K;  3GTM A;  4A3I C;  5EGH A;  2PMZ L;  1DCP A;  3AH5 A;  2D6F C;  1XPP A;  1WSR A;  1WSV A;  2RH6 A;  4G7O A;  4A3L K;  4C2M K;  5C4J K;  2PMZ D;  2CW0 A;  1WOO A;  5IOT A;  5C44 K;  1TWF A;  1USM A;  3T02 A;  4J3N A;  3GTJ A;  2V6T A;  2BE5 A;  3A8J A;  2JH3 A;  2YU9 K;  3GTK C;  3S16 C;  1X31 C;  3HKZ D;  3S2H K;  4O2D A;  3HOX K;  4BBS K;  1BGW A;  4G0U A;  2B63 A;  1JVI A;  3GTQ K;  3A8I A;  5JFE A;  1I6H C;  2EBB A;  4X6A C;  1TWG K;  2GSO A;  3H0G A;  4A3B C;  5JVO A;  5CJ9 A;  2R7Z C;  4BY7 C;  1J6W A;  1I3Q K;  2WB1 L;  4A3G K;  1GE9 A;  2NVT K;  4XSX A;  1TWH A;  3S2D C;  4YFX A;  2GAH C;  4KAT A;  4MEY A;  1C0A A;  4BLB A;  1L0W A;  5C4X K;  4GTB A;  5D4D A;  4OIR A;  1EI6 A;  2E2H C;  1R9T K;  4BXX C;  1BDF A;  1EH1 A;  3I4M K;  4C3J K;  2JA7 C;  4KMU A;  2ZFZ A;  3PO2 K;  3I4N K;  1WCM K;  4KN4 A;  1DCO A;  1YNN A;  2KWA A;  1YNJ A;  3GTO K;  3TFI A;  5C3E C;  4MEX A;  2W7V A;  1I50 K;  1IE0 A;  3AQO A;  4GTE A;  3HOU C;  3FOF A;  4LQY A;  1SFO A;  3S14 K;  4A3M C;  4OIO A;  3HOY K;  4RMF A;  3T01 A;  4KMA A;  4A3K K;  3VA7 A;  3HOY C;  1VLO A;  2JA5 A;  1TWC A;  4Y52 C;  1WOP A;  4G0W A;  3TFH A;  4JK1 A;  2YU9 C;  3GTJ K;  1O2A A;  2YU9 A;  1I3Q A;  1Y1W C;  3QX3 A;  2E2I C;  5IYC C;  3FKI A;  3GDZ A;  3S1N K;  2GSN A;  4WIL A;  2XCQ A;  4KN7 A;  3S1Q K;  5FLM C;  4A3D K;  3RZD K;  3PO3 C; 
#chains in the Genus database with same CATH homology
 2NVY K;  3M3Y C;  2E2J C;  5TMC A;  3RZD C;  4C2M K;  5C4J K;  2PMZ D;  2B63 C;  2CW0 A;  5IYC K;  5IYD C;  3S17 C;  3M4O K;  5C44 K;  4A3B K;  2R93 C;  3S1R K;  4QJV A;  2WAQ D;  1I6V A;  3EQL A;  3HKZ L;  4Y7N K;  4OIN A;  4A3E K;  3GTQ C;  2BE5 A;  2YU9 K;  2R92 C;  3GTJ C;  3GTK C;  5M5X K;  3S16 C;  3PO3 K;  2A68 A;  3K7A K;  3HOV C;  3HKZ D;  4LJZ A;  3S2H K;  1TWG C;  2O5I A;  3HOX K;  2E2I K;  4BBS K;  5M3M K;  1Y1V K;  3HOW K;  3I4M C;  3K7A C;  3S17 K;  3S15 C;  3GTG K;  3S2H C;  3H3V L;  4C3I K;  4XSZ A;  1TWC C;  1TWA C;  3GTG C;  3GTL K;  4QIW D;  4A3E C;  2E2H K;  3GTQ K;  2R92 K;  1K83 K;  4OIP A;  1TWA K;  4NOI A;  1I6H C;  4Q5S A;  4X6A C;  1I50 C;  4A3C C;  4A3J K;  1TWG K;  5M5W K;  4A3C K;  3GTP K;  4LK0 A;  1TWH K;  5C44 C;  4A3B C;  3H3V D;  5TMF A;  2R7Z C;  4YG2 A;  4BY7 C;  2R93 K;  5C4X C;  3H0G C;  5IP9 K;  4A3D C;  1I3Q K;  2WB1 L;  4A3G K;  4LLG A;  2NVT K;  5FJ8 K;  4XSX A;  3H0G K;  3M3Y K;  3HOZ C;  2PA8 L;  3S2D C;  4X6A K;  3DXJ A;  4YFN A;  5IYD K;  4YFX A;  3S1M C;  4QJV B;  4A93 C;  4A3F C;  3HOX C;  2Y0S L;  2A69 A;  4MEY A;  4BBR C;  4C3H K;  5C4X K;  5M3F K;  1R9T C;  4GZY A;  3S16 K;  1I3Q C;  5D4D A;  1HQM A;  5C3E K;  4OIR A;  3GTL C;  2E2H C;  3RZO K;  2Y0S D;  3FKI K;  4YFK A;  1R9T K;  3HOV K;  4BXX C;  3HOZ K;  1BDF A;  1I6H K;  3S2D K;  4QIW L;  3I4N C;  1Y1V C;  4C3J K;  3FKI C;  4BY1 C;  3GTM K;  2JA7 C;  4KMU A;  3HOU K;  4A3J C;  3HOW C;  3S1M K;  3PO2 K;  4A93 K;  3GTO C;  3I4N K;  1WCM K;  4KN4 A;  1YNN A;  3GTP C;  4OIQ A;  4MQ9 A;  1TWH C;  3S1N C;  1YNJ A;  3GTO K;  2A6H A;  4AYB L;  5IP9 C;  4ZH4 A;  5C3E C;  4MEX A;  4A3G C;  5IP7 K;  4G7H A;  1I50 K;  2PA8 D;  4BXX K;  5IYB K;  1TWF K;  2JA6 K;  5IP7 C;  3CQZ K;  2JA7 K;  2WB1 D;  3HOU C;  2E2J K;  1TWF C;  5C4J C;  2JA6 C;  4A3M K;  2R7Z K;  4BY7 K;  2NVT C;  2JA8 K;  4A3M C;  3S14 K;  2O5J A;  2NVQ K;  1SFO K;  4OIO A;  4Y7N C;  4A3K C;  3HOY K;  2JA8 C;  3S14 C;  2NVY C;  4A3K K;  4A3F K;  3HOY C;  2B63 K;  4BBR K;  3M4O C;  1IW7 A;  3CQZ C;  4BY1 K;  3GTM C;  2NVX C;  4Y52 C;  1ZYR A;  1SMY A;  2NVX K;  2WAQ L;  3RZO C;  1Y1W K;  4Y52 K;  4JK1 A;  4G7Z A;  2YU9 C;  4XLN A;  3GTJ K;  2A6E A;  2PPB A;  1SFO C;  2NVQ C;  2VUM K;  3GTK K;  3S1Q C;  4Q4Z A;  1Y1W C;  4A3L C;  1K83 C;  4XLP A;  3PO2 C;  2E2I C;  1WCM C;  4BBS C;  4AYB D;  4LK1 A;  5IYC C;  2JA5 K;  3I4M K;  3S1N K;  1TWC K;  3S1R C;  5FLM K;  2JA5 C;  4A3I C;  5M5Y K;  2VUM C;  2PMZ L;  4KN7 A;  3S1Q K;  3S15 K;  5FLM C;  1XPP A;  5IYB C;  3RZD K;  4A3I K;  3WOD A;  4A3D K;  4G7O A;  3PO3 C;  4A3L K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...