3S2DK

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s2dK00
3S1MK 3K7AK 4A3JC 5M3MK 4XLPA 4MEYA 5C3EC 4OIPA 3S1NK 4A3DC 3PO3K 1SMYA 3M4OC 4MEXA 4A3IK 1YNNA 5M5WK 4XLNA 3GTOC 3S17C 3H0GC 2JA6K 5D4DA 4YFXA 2NVQC 2PPBA 2JA7K 2PA8D 2BE5A 5C44K 4BXXK 2E2IC 1TWCK 2PMZD 1TWFK 4KN7A 2VUMK 1HQMA 3S1RC 2A6EA 2A6HA 1YNJA 3S2HK 2R93C 5C4XK 4QIWL 4G7ZA 4A3EC 2E2JK 3EQLA 2NVTC 1WCMC 4Y52K 3HOYC 2E2HC 3S2DK 5M5XK 4A3BK 2WB1D 4LLGA 4XSZA 4A3KK 4A3FC 4KMUA 3CQZC 4Q5SA 4BY1K 3GTLC 3GTJK 3PO2K 5FJ8K 1TWHK 3HOVK 3RZDC 4A3MK 3S1QC 3RZOC 2R7ZK 2CW0A 1BDFA 1TWGC 4ZH4A 1Y1WC 4OIQA 3HOWK 3S16C 4A93C 4A3GK 4JK1A 5M3FK 4NOIA 4BBRK 5FLMC 5C4JC 4XSXA 5M5YK 4A3LK 4YFNA 3HKZL 2NVXC 3M3YC 3GTKC 3HOXK 5IYDK 1I50K 2NVYC 3FKIK 3S15K 1K83C 4C3HK 2JA5C 2YU9C 3S1MC 2Y0SL 3K7AC 4QIWD 5TMCA 3S1NC 4KN4A 4YG2A 4BBSK 4Q4ZA 1ZYRA 5TMFA 3I4NK 3PO3C 1I3QK 4OIOA 4A3IC 2JA6C 2O5IA 3GTPK 5IYBK 2JA7C 5C44C 4BXXC 1R9TK 1TWCC 3H0GK 1Y1VC 1TWFC 5IP9K 2NVQK 4LK0A 4G7HA 2VUMC 4X6AK 2WAQL 3S2HC 1I6VA 4Y7NK 1I6HK 5C4XC 3S14C 5IP7K 1IW7A 1SFOK 2E2JC 3GTGK 2B63K 3GTQK 3I4MK 4LJZA 4QJVA 2R92K 4Y52C 3S2DC 4A3BC 2A69A 1TWAK 4A3KC 2JA8K 5IYCK 3HOYK 2Y0SD 3GTJC 1XPPA 1TWHC 3HOVC 4C2MK 4A3MC 3GTMK 3HOUC 3HOZK 4BY7K 2R7ZC 3HOWC 4A3LC 1TWGK 4A3CK 4A3JK 5C3EK 5IYDC 1I50C 3FKIC 4A3DK 2WAQD 3M4OK 3S17K 3GTOK 2JA5K 4BBSC 4OINA 3I4NC 2E2IK 4AYBL 1I3QC 4OIRA 3GTPC 3H3VL 3S1RK 2A68A 5IYBC 3HKZD 2R93K 4A3EK 1R9TC 2NVTK 4X6AC 5IP9C 4GZYA 1WCMK 2O5JA 4BY1C 2E2HK 3PO2C 4LK1A 4Y7NC 4A3FK 1Y1VK 1I6HC 5IP7C 3CQZK 1SFOC 3GTGC 3GTQC 2B63C 3GTLK 3I4MC 4C3IK 2R92C 4QJVB 2PA8L 3S14K 3RZDK 4A3GC 1TWAC 2PMZL 2JA8C 3S1QK 4BBRC 5IYCC 4G7OA 3RZOK 4MQ9A 1Y1WK 3WODA 3S16K 4A93K 3HOXC 5FLMK 5C4JK 3GTMC 3HOZC 3S15C 4BY7C 4AYBD 2NVXK 4YFKA 3M3YK 3GTKK 3H3VD 2WB1L 3DXJA 2NVYK 3HOUK 4C3JK 1K83K 2YU9K 4A3CC
chains in the Genus database with same CATH superfamily
4OIPA 1HI9A 3HXAA 3S17C 1BGWA 4YFXA 1L0WA 1I50A 2PA8D 2EBBA 2XCOA 2RH6A 4LOWA 3V4GA 2A6EA 2A6HA 3S2HK 3GIRA 4G7ZA 2E2JK 4C45A 1I3QA 3CAGA 2E2HC 4A3BK 4A3KK 2GSNA 4Q5SA 4BY1K 4C3IC 1TWHA 1SFOA 1VGXA 1TWGC 3HOWK 4A3LK 5FLMC 4ILDA 2D6FC 5IYDK 2JA5C 1PJ7A 4KATA 3S1MC 3K7AC 4KN4A 4BBSK 4A3IC 5IYBK 4AH6A 2JA7C 1XXBA 5C44C 4BXXC 1R9TK 3H0GK 4X6AK 2NVQK 3GTOA 2VUMC 4G7HA 1C0AA 3AQPA 5C4XC 2E2IA 4QJVA 4Y52C 3S2DC 2R92A 3G4CA 2JA8K 1WIHA 1WCMA 5IOSA 1TWHC 5IOQA 4A3MC 3HOZK 2R7ZC 1WQFA 5HL8A 2ZUFA 1JQWA 3ERED 1Y1WA 4GTLA 3FKIC 3BP8C 1ZVUA 1X31C 3S17K 3OPFA 3AD7C 3GTPC 3H3VL 1WOOA 4BLBA 2A68A 3AD8C 1IS1A 3GEIA 2JA6A 4BY1C 2E2HK 4LK1A 4PABA 1I6HC 1Y1VK 3QX3A 1DCHA 3I4MC 2XCRB 4C3IK 2R92C 2PA8L 2V6UA 3LAJA 5EGEA 1V5VA 2ZUEA 1XZQB 5FLMK 1DCOA 3N3YA 4KM9A 1WSVA 1O24A 3GTJA 3HOUK 4KB2A 4LQYA 1XXAA 4WJ4A 4A3CC 1K83A 3S1MK 3K7AK 2GAGC 3M4OC 4A3IK 5M5WK 3H0GC 5D4DA 2GAHC 2NVQC 2JA7K 3GSIA 5C44K 4BXXK 4FM9A 2FQOA 1AB4A 2VUMK 3JSTA 5C4XK 2W7VA 4Y52K 3S2DK 5M5XK 2WB1D 4G0UA 1WORA 1TWHK 3MMLB 4A3MK 1XZPB 4LR2A 1VLOA 3RZOC 2R7ZK 3GTGA 2B63A 2P5MA 2P8TA 4NOIA 1TWAA 4XSXA 5C4JC 5CJ9A 2NVXC 3M3YC 3HOXK 3FKIK 1K83C 2CFAA 4WILA 4C3HK 2YU9C 2RGRA 3GTMA 4QIWD 3S1NC 4YG2A 3PO3C 5TMFA 3GTPK 2O5IA 3A8KA 2PHCB 4M1XA 2FQTA 1TWCC 3T01A 1Y1VC 1TWFC 3G4AA 1I6HK 2V6TA 3AH5A 3L4JA 3I4MK 2R92K 3TFIA 2KWAA 3GEHA 2R93A 5L46A 3HOYK 4G0WA 3HOUC 3CQZA 3GTLA 1O26A 4FZBA 5IORA 4A3CK 2JH3A 1I50C 1O2BA 3M4OK 4XCHA 1I3QC 4OIRA 1USMA 3AD9C 4GZYA 5JFEA 1J6VA 4Y7NC 5IOTA 1GE9A 1DCPA 5IP7C 1SFOC 4QJVB 1G51A 3S14K 4G7OA 4GTFA 1F93A 3RZOK 1VRQC 4C2MC 3HOXC 5C4JK 3BP3A 1EK8A 4C3HC 4AYBD 2NVXK 4KMDA 3M3YK 2WB1L 3DXJA 1K83K 3GTKA 2YU9K 2NVYA 2V6SA 1IQ0A 5M3MK 1JVIA 4MEYA 3NUHA 3FOFA 3S1NK 1WOSA 3PO3K 1WSRA 4KM8A 5JVOA 1YNNA 3GTOC 1WQHA 1F7VA 4RMFA 2BE5A 3SZYA 3OEPA 2E2IC 1TWCK 1TWFK 1F7UA 4GFQA 3S1RC 1YNJA 4A3EC 4QIWL 1WCMC 3HOYC 4LLGA 4BLAA 4XSZA 1PJ5A 4GTAA 5CHPA 3BUEA 5FJ8K 3RZDC 4GTCA 3S1QC 4KAWX 2CW0A 1BDFA 4ZH4A 1INNA 1Y1WC 3S16C 1EFWA 4JK1A 4BBRK 1XZQA 4YFNA 3HKZL 3GTKC 4G0VA 1I50K 2NVYC 4C3JC 3GDZA 2GSOA 4Q4ZA 3VA7A 1O2AA 1USOA 4GTEA 3T02A 3IPJA 1I3QK 4OIOA 2JA6C 2ZFZA 1DD5A 4LK0A 1IE0A 1IBAA 4Y7NK 1J6XA 4KB4A 1IW7A 5IP7K 1SFOK 3S14C 3LAPA 3GTQA 2A69A 2Y0SD 3GTJC 1JOEA 1IL2A 3HOVC 2E2HA 4C2MK 3FOEA 1F9NA 4BKWA 1WQGA 1XZPA 1TWGA 1YX2A 3L4KA 3LPXA 4KMHA 2WAQD 3GTOK 4P5BA 3I4NC 2E2IK 2JA5A 4AYBL 4KMAA 3S1RK 3HKZD 4WJ3M 1PJ6A 4A3EK 5IP9C 1WCMK 1WOPA 4KDDA 2JA7A 4P5AA 3GTQC 3GTGC 2B63C 2VUMA 4P9SA 1XXCA 3RZDK 1TWAC 1BS2A 4PAAA 5EGHA 4BBRC 5IYCC 3S1QK 1Y1WK 3WODA 1EI6A 3S16K 4KASA 3GTMC 4BY7C 1KQ4A 1VH2A 3GTKK 2NVYK 4C3JK 4GTDA 4DDQA 1EQRA 2R7ZA 4A3JC 4XLPA 5C3EC 4A3DC 1SMYA 4GT9A 3SZZA 4MEXA 4XLNA 2GSUA 2JA6K 1O25A 1RU0A 2PPBA 3FKIA 1ZXOA 2PMZD 3Q3QA 3TTGA 4KN7A 1ZBSA 1HQMA 1O29A 2R93C 3EQLA 3AQOA 2NVTC 3GTPA 2XCQA 3A8IA 4A3FC 4KMUA 3CQZC 1B4BA 3GTLC 3GTJK 3PO2K 3HOVK 4O2DA 1EH1A 3OREA 4OIQA 4A93C 4A3GK 5M3FK 5M5YK 3S0XA 3GEEA 2Y3PA 3S15K 2Y0SL 5TMCA 1ZQ1C 1ZYRA 3I4NK 3FHZA 1UV7A 4KC6A 4GTBA 5IP9K 1R9TA 3H0GA 2WAQL 3S2HC 1I6VA 3GTQK 2E2JC 3GTGK 1O2FB 2B63K 4LJZA 4A3BC 1TWAK 4A3KC 5IYCK 3T00A 1XPPA 1O28A 3GTMK 4BY7K 3HOWC 1BJTA 4J3NA 4A3LC 1J98A 1TWGK 5TJ3A 4A3JK 5C3EK 5IYDC 4A3DK 2NVXA 2JA5K 1O27A 4BBSC 4OINA 2YU9A 3A8JA 3N0CA 5IYBC 2R93K 1J6WA 1R9TC 2NVTK 4X6AC 2O5JA 5E68A 3PO2C 4A3FK 1B4AA 3CQZK 1YCLA 1TWCA 3N0BA 1Y1VA 1ISEA 1TWFA 3GTLK 1VJEA 4A3GC 2PMZL 2JA8C 4MQ9A 3ADAC 4A93K 3HOZC 3S15C 4KARA 2CFAB 4YFKA 3TFHA 3H3VD 3TFJA
chains in the Genus database with same CATH topology
3S1MK 3K7AK 4A3JC 5M3MK 4XLPA 4MEYA 5C3EC 4OIPA 3S1NK 4A3DC 3PO3K 1SMYA 3M4OC 4MEXA 4A3IK 1YNNA 5M5WK 4XLNA 3GTOC 3S17C 3H0GC 2JA6K 5D4DA 4YFXA 2NVQC 2PPBA 2JA7K 2PA8D 2BE5A 5C44K 4BXXK 2E2IC 1TWCK 2PMZD 1TWFK 4KN7A 2VUMK 1HQMA 3S1RC 2A6EA 2A6HA 1YNJA 3S2HK 2R93C 5C4XK 4QIWL 4G7ZA 4A3EC 2E2JK 3EQLA 2NVTC 1WCMC 4Y52K 3HOYC 2E2HC 3S2DK 5M5XK 4A3BK 2WB1D 4LLGA 4XSZA 4A3KK 4A3FC 4KMUA 3CQZC 4Q5SA 4BY1K 3GTLC 3GTJK 3PO2K 5FJ8K 1TWHK 3HOVK 3RZDC 4A3MK 3S1QC 3RZOC 2R7ZK 2CW0A 1BDFA 1TWGC 4ZH4A 1Y1WC 4OIQA 3HOWK 3S16C 4A93C 4A3GK 4JK1A 5M3FK 4NOIA 4BBRK 5FLMC 5C4JC 4XSXA 5M5YK 4A3LK 4YFNA 3HKZL 2NVXC 3M3YC 3GTKC 3HOXK 5IYDK 1I50K 2NVYC 3FKIK 3S15K 1K83C 4C3HK 2JA5C 2YU9C 3S1MC 2Y0SL 3K7AC 4QIWD 5TMCA 3S1NC 4KN4A 4YG2A 4BBSK 4Q4ZA 1ZYRA 5TMFA 3I4NK 3PO3C 1I3QK 4OIOA 4A3IC 2JA6C 2O5IA 3GTPK 5IYBK 2JA7C 5C44C 4BXXC 1R9TK 1TWCC 3H0GK 1Y1VC 1TWFC 5IP9K 2NVQK 4LK0A 4G7HA 2VUMC 4X6AK 2WAQL 3S2HC 1I6VA 4Y7NK 1I6HK 5C4XC 3S14C 5IP7K 1IW7A 1SFOK 2E2JC 3GTGK 2B63K 3GTQK 3I4MK 4LJZA 4QJVA 2R92K 4Y52C 3S2DC 4A3BC 2A69A 1TWAK 4A3KC 2JA8K 5IYCK 3HOYK 2Y0SD 3GTJC 1XPPA 1TWHC 3HOVC 4C2MK 4A3MC 3GTMK 3HOUC 3HOZK 4BY7K 2R7ZC 3HOWC 4A3LC 1TWGK 4A3CK 4A3JK 5C3EK 5IYDC 1I50C 3FKIC 4A3DK 2WAQD 3M4OK 3S17K 3GTOK 2JA5K 4BBSC 4OINA 3I4NC 2E2IK 4AYBL 1I3QC 4OIRA 3GTPC 3H3VL 3S1RK 2A68A 5IYBC 3HKZD 2R93K 4A3EK 1R9TC 2NVTK 4X6AC 5IP9C 4GZYA 1WCMK 2O5JA 4BY1C 2E2HK 3PO2C 4LK1A 4Y7NC 4A3FK 1Y1VK 1I6HC 5IP7C 3CQZK 1SFOC 3GTGC 3GTQC 2B63C 3GTLK 3I4MC 4C3IK 2R92C 4QJVB 2PA8L 3S14K 3RZDK 4A3GC 1TWAC 2PMZL 2JA8C 3S1QK 4BBRC 5IYCC 4G7OA 3RZOK 4MQ9A 1Y1WK 3WODA 3S16K 4A93K 3HOXC 5FLMK 5C4JK 3GTMC 3HOZC 3S15C 4BY7C 4AYBD 2NVXK 4YFKA 3M3YK 3GTKK 3H3VD 2WB1L 3DXJA 2NVYK 3HOUK 4C3JK 1K83K 2YU9K 4A3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M K;  3K7A K;  4A3J C;  5M3M K;  4XLP A;  4MEY A;  5C3E C;  4OIP A;  3S1N K;  4A3D C;  3PO3 K;  1SMY A;  3M4O C;  4MEX A;  4A3I K;  1YNN A;  5M5W K;  4XLN A;  3GTO C;  3S17 C;  3H0G C;  2JA6 K;  5D4D A;  4YFX A;  2NVQ C;  2PPB A;  2JA7 K;  2PA8 D;  2BE5 A;  5C44 K;  4BXX K;  2E2I C;  1TWC K;  2PMZ D;  1TWF K;  4KN7 A;  2VUM K;  1HQM A;  3S1R C;  2A6E A;  2A6H A;  1YNJ A;  3S2H K;  2R93 C;  5C4X K;  4QIW L;  4G7Z A;  4A3E C;  2E2J K;  3EQL A;  2NVT C;  1WCM C;  4Y52 K;  3HOY C;  2E2H C;  3S2D K;  5M5X K;  4A3B K;  2WB1 D;  4LLG A;  4XSZ A;  4A3K K;  4A3F C;  4KMU A;  3CQZ C;  4Q5S A;  4BY1 K;  3GTL C;  3GTJ K;  3PO2 K;  5FJ8 K;  1TWH K;  3HOV K;  3RZD C;  4A3M K;  3S1Q C;  3RZO C;  2R7Z K;  2CW0 A;  1BDF A;  1TWG C;  4ZH4 A;  1Y1W C;  4OIQ A;  3HOW K;  3S16 C;  4A93 C;  4A3G K;  4JK1 A;  5M3F K;  4NOI A;  4BBR K;  5FLM C;  5C4J C;  4XSX A;  5M5Y K;  4A3L K;  4YFN A;  3HKZ L;  2NVX C;  3M3Y C;  3GTK C;  3HOX K;  5IYD K;  1I50 K;  2NVY C;  3FKI K;  3S15 K;  1K83 C;  4C3H K;  2JA5 C;  2YU9 C;  3S1M C;  2Y0S L;  3K7A C;  4QIW D;  5TMC A;  3S1N C;  4KN4 A;  4YG2 A;  4BBS K;  4Q4Z A;  1ZYR A;  5TMF A;  3I4N K;  3PO3 C;  1I3Q K;  4OIO A;  4A3I C;  2JA6 C;  2O5I A;  3GTP K;  5IYB K;  2JA7 C;  5C44 C;  4BXX C;  1R9T K;  1TWC C;  3H0G K;  1Y1V C;  1TWF C;  5IP9 K;  2NVQ K;  4LK0 A;  4G7H A;  2VUM C;  4X6A K;  2WAQ L;  3S2H C;  1I6V A;  4Y7N K;  1I6H K;  5C4X C;  3S14 C;  5IP7 K;  1IW7 A;  1SFO K;  2E2J C;  3GTG K;  2B63 K;  3GTQ K;  3I4M K;  4LJZ A;  4QJV A;  2R92 K;  4Y52 C;  3S2D C;  4A3B C;  2A69 A;  1TWA K;  4A3K C;  2JA8 K;  5IYC K;  3HOY K;  2Y0S D;  3GTJ C;  1XPP A;  1TWH C;  3HOV C;  4C2M K;  4A3M C;  3GTM K;  3HOU C;  3HOZ K;  4BY7 K;  2R7Z C;  3HOW C;  4A3L C;  1TWG K;  4A3C K;  4A3J K;  5C3E K;  5IYD C;  1I50 C;  3FKI C;  4A3D K;  2WAQ D;  3M4O K;  3S17 K;  3GTO K;  2JA5 K;  4BBS C;  4OIN A;  3I4N C;  2E2I K;  4AYB L;  1I3Q C;  4OIR A;  3GTP C;  3H3V L;  3S1R K;  2A68 A;  5IYB C;  3HKZ D;  2R93 K;  4A3E K;  1R9T C;  2NVT K;  4X6A C;  5IP9 C;  4GZY A;  1WCM K;  2O5J A;  4BY1 C;  2E2H K;  3PO2 C;  4LK1 A;  4Y7N C;  4A3F K;  1Y1V K;  1I6H C;  5IP7 C;  3CQZ K;  1SFO C;  3GTG C;  3GTQ C;  2B63 C;  3GTL K;  3I4M C;  4C3I K;  2R92 C;  4QJV B;  2PA8 L;  3S14 K;  3RZD K;  4A3G C;  1TWA C;  2PMZ L;  2JA8 C;  3S1Q K;  4BBR C;  5IYC C;  4G7O A;  3RZO K;  4MQ9 A;  1Y1W K;  3WOD A;  3S16 K;  4A93 K;  3HOX C;  5FLM K;  5C4J K;  3GTM C;  3HOZ C;  3S15 C;  4BY7 C;  4AYB D;  2NVX K;  4YFK A;  3M3Y K;  3GTK K;  3H3V D;  2WB1 L;  3DXJ A;  2NVY K;  3HOU K;  4C3J K;  1K83 K;  2YU9 K;  4A3C C; 
#chains in the Genus database with same CATH topology
 4OIP A;  1HI9 A;  3HXA A;  3S17 C;  1BGW A;  4YFX A;  1L0W A;  1I50 A;  2PA8 D;  2EBB A;  2XCO A;  2RH6 A;  4LOW A;  3V4G A;  2A6E A;  2A6H A;  3S2H K;  3GIR A;  4G7Z A;  2E2J K;  4C45 A;  1I3Q A;  3CAG A;  2E2H C;  4A3B K;  4A3K K;  2GSN A;  4Q5S A;  4BY1 K;  4C3I C;  1TWH A;  1SFO A;  1VGX A;  1TWG C;  3HOW K;  4A3L K;  5FLM C;  4ILD A;  2D6F C;  5IYD K;  2JA5 C;  1PJ7 A;  4KAT A;  3S1M C;  3K7A C;  4KN4 A;  4BBS K;  4A3I C;  5IYB K;  4AH6 A;  2JA7 C;  1XXB A;  5C44 C;  4BXX C;  1R9T K;  3H0G K;  4X6A K;  2NVQ K;  3GTO A;  2VUM C;  4G7H A;  1C0A A;  3AQP A;  5C4X C;  2E2I A;  4QJV A;  4Y52 C;  3S2D C;  2R92 A;  3G4C A;  2JA8 K;  1WIH A;  1WCM A;  5IOS A;  1TWH C;  5IOQ A;  4A3M C;  3HOZ K;  2R7Z C;  1WQF A;  5HL8 A;  2ZUF A;  1JQW A;  3ERE D;  1Y1W A;  4GTL A;  3FKI C;  3BP8 C;  1ZVU A;  1X31 C;  3S17 K;  3OPF A;  3AD7 C;  3GTP C;  3H3V L;  1WOO A;  4BLB A;  2A68 A;  3AD8 C;  1IS1 A;  3GEI A;  2JA6 A;  4BY1 C;  2E2H K;  4LK1 A;  4PAB A;  1I6H C;  1Y1V K;  3QX3 A;  1DCH A;  3I4M C;  2XCR B;  4C3I K;  2R92 C;  2PA8 L;  2V6U A;  3LAJ A;  5EGE A;  1V5V A;  2ZUE A;  1XZQ B;  5FLM K;  1DCO A;  3N3Y A;  4KM9 A;  1WSV A;  1O24 A;  3GTJ A;  3HOU K;  4KB2 A;  4LQY A;  1XXA A;  4WJ4 A;  4A3C C;  1K83 A;  3S1M K;  3K7A K;  2GAG C;  3M4O C;  4A3I K;  5M5W K;  3H0G C;  5D4D A;  2GAH C;  2NVQ C;  2JA7 K;  3GSI A;  5C44 K;  4BXX K;  4FM9 A;  2FQO A;  1AB4 A;  2VUM K;  3JST A;  5C4X K;  2W7V A;  4Y52 K;  3S2D K;  5M5X K;  2WB1 D;  4G0U A;  1WOR A;  1TWH K;  3MML B;  4A3M K;  1XZP B;  4LR2 A;  1VLO A;  3RZO C;  2R7Z K;  3GTG A;  2B63 A;  2P5M A;  2P8T A;  4NOI A;  1TWA A;  4XSX A;  5C4J C;  5CJ9 A;  2NVX C;  3M3Y C;  3HOX K;  3FKI K;  1K83 C;  2CFA A;  4WIL A;  4C3H K;  2YU9 C;  2RGR A;  3GTM A;  4QIW D;  3S1N C;  4YG2 A;  3PO3 C;  5TMF A;  3GTP K;  2O5I A;  3A8K A;  2PHC B;  4M1X A;  2FQT A;  1TWC C;  3T01 A;  1Y1V C;  1TWF C;  3G4A A;  1I6H K;  2V6T A;  3AH5 A;  3L4J A;  3I4M K;  2R92 K;  3TFI A;  2KWA A;  3GEH A;  2R93 A;  5L46 A;  3HOY K;  4G0W A;  3HOU C;  3CQZ A;  3GTL A;  1O26 A;  4FZB A;  5IOR A;  4A3C K;  2JH3 A;  1I50 C;  1O2B A;  3M4O K;  4XCH A;  1I3Q C;  4OIR A;  1USM A;  3AD9 C;  4GZY A;  5JFE A;  1J6V A;  4Y7N C;  5IOT A;  1GE9 A;  1DCP A;  5IP7 C;  1SFO C;  4QJV B;  1G51 A;  3S14 K;  4G7O A;  4GTF A;  1F93 A;  3RZO K;  1VRQ C;  4C2M C;  3HOX C;  5C4J K;  3BP3 A;  1EK8 A;  4C3H C;  4AYB D;  2NVX K;  4KMD A;  3M3Y K;  2WB1 L;  3DXJ A;  1K83 K;  3GTK A;  2YU9 K;  2NVY A;  2V6S A;  1IQ0 A;  5M3M K;  1JVI A;  4MEY A;  3NUH A;  3FOF A;  3S1N K;  1WOS A;  3PO3 K;  1WSR A;  4KM8 A;  5JVO A;  1YNN A;  3GTO C;  1WQH A;  1F7V A;  4RMF A;  2BE5 A;  3SZY A;  3OEP A;  2E2I C;  1TWC K;  1TWF K;  1F7U A;  4GFQ A;  3S1R C;  1YNJ A;  4A3E C;  4QIW L;  1WCM C;  3HOY C;  4LLG A;  4BLA A;  4XSZ A;  1PJ5 A;  4GTA A;  5CHP A;  3BUE A;  5FJ8 K;  3RZD C;  4GTC A;  3S1Q C;  4KAW X;  2CW0 A;  1BDF A;  4ZH4 A;  1INN A;  1Y1W C;  3S16 C;  1EFW A;  4JK1 A;  4BBR K;  1XZQ A;  4YFN A;  3HKZ L;  3GTK C;  4G0V A;  1I50 K;  2NVY C;  4C3J C;  3GDZ A;  2GSO A;  4Q4Z A;  3VA7 A;  1O2A A;  1USO A;  4GTE A;  3T02 A;  3IPJ A;  1I3Q K;  4OIO A;  2JA6 C;  2ZFZ A;  1DD5 A;  4LK0 A;  1IE0 A;  1IBA A;  4Y7N K;  1J6X A;  4KB4 A;  1IW7 A;  5IP7 K;  1SFO K;  3S14 C;  3LAP A;  3GTQ A;  2A69 A;  2Y0S D;  3GTJ C;  1JOE A;  1IL2 A;  3HOV C;  2E2H A;  4C2M K;  3FOE A;  1F9N A;  4BKW A;  1WQG A;  1XZP A;  1TWG A;  1YX2 A;  3L4K A;  3LPX A;  4KMH A;  2WAQ D;  3GTO K;  4P5B A;  3I4N C;  2E2I K;  2JA5 A;  4AYB L;  4KMA A;  3S1R K;  3HKZ D;  4WJ3 M;  1PJ6 A;  4A3E K;  5IP9 C;  1WCM K;  1WOP A;  4KDD A;  2JA7 A;  4P5A A;  3GTQ C;  3GTG C;  2B63 C;  2VUM A;  4P9S A;  1XXC A;  3RZD K;  1TWA C;  1BS2 A;  4PAA A;  5EGH A;  4BBR C;  5IYC C;  3S1Q K;  1Y1W K;  3WOD A;  1EI6 A;  3S16 K;  4KAS A;  3GTM C;  4BY7 C;  1KQ4 A;  1VH2 A;  3GTK K;  2NVY K;  4C3J K;  4GTD A;  4DDQ A;  1EQR A;  2R7Z A;  4A3J C;  4XLP A;  5C3E C;  4A3D C;  1SMY A;  4GT9 A;  3SZZ A;  4MEX A;  4XLN A;  2GSU A;  2JA6 K;  1O25 A;  1RU0 A;  2PPB A;  3FKI A;  1ZXO A;  2PMZ D;  3Q3Q A;  3TTG A;  4KN7 A;  1ZBS A;  1HQM A;  1O29 A;  2R93 C;  3EQL A;  3AQO A;  2NVT C;  3GTP A;  2XCQ A;  3A8I A;  4A3F C;  4KMU A;  3CQZ C;  1B4B A;  3GTL C;  3GTJ K;  3PO2 K;  3HOV K;  4O2D A;  1EH1 A;  3ORE A;  4OIQ A;  4A93 C;  4A3G K;  5M3F K;  5M5Y K;  3S0X A;  3GEE A;  2Y3P A;  3S15 K;  2Y0S L;  5TMC A;  1ZQ1 C;  1ZYR A;  3I4N K;  3FHZ A;  1UV7 A;  4KC6 A;  4GTB A;  5IP9 K;  1R9T A;  3H0G A;  2WAQ L;  3S2H C;  1I6V A;  3GTQ K;  2E2J C;  3GTG K;  1O2F B;  2B63 K;  4LJZ A;  4A3B C;  1TWA K;  4A3K C;  5IYC K;  3T00 A;  1XPP A;  1O28 A;  3GTM K;  4BY7 K;  3HOW C;  1BJT A;  4J3N A;  4A3L C;  1J98 A;  1TWG K;  5TJ3 A;  4A3J K;  5C3E K;  5IYD C;  4A3D K;  2NVX A;  2JA5 K;  1O27 A;  4BBS C;  4OIN A;  2YU9 A;  3A8J A;  3N0C A;  5IYB C;  2R93 K;  1J6W A;  1R9T C;  2NVT K;  4X6A C;  2O5J A;  5E68 A;  3PO2 C;  4A3F K;  1B4A A;  3CQZ K;  1YCL A;  1TWC A;  3N0B A;  1Y1V A;  1ISE A;  1TWF A;  3GTL K;  1VJE A;  4A3G C;  2PMZ L;  2JA8 C;  4MQ9 A;  3ADA C;  4A93 K;  3HOZ C;  3S15 C;  4KAR A;  2CFA B;  4YFK A;  3TFH A;  3H3V D;  3TFJ A; 
#chains in the Genus database with same CATH homology
 3S1M K;  3K7A K;  4A3J C;  5M3M K;  4XLP A;  4MEY A;  5C3E C;  4OIP A;  3S1N K;  4A3D C;  3PO3 K;  1SMY A;  3M4O C;  4MEX A;  4A3I K;  1YNN A;  5M5W K;  4XLN A;  3GTO C;  3S17 C;  3H0G C;  2JA6 K;  5D4D A;  4YFX A;  2NVQ C;  2PPB A;  2JA7 K;  2PA8 D;  2BE5 A;  5C44 K;  4BXX K;  2E2I C;  1TWC K;  2PMZ D;  1TWF K;  4KN7 A;  2VUM K;  1HQM A;  3S1R C;  2A6E A;  2A6H A;  1YNJ A;  3S2H K;  2R93 C;  5C4X K;  4QIW L;  4G7Z A;  4A3E C;  2E2J K;  3EQL A;  2NVT C;  1WCM C;  4Y52 K;  3HOY C;  2E2H C;  3S2D K;  5M5X K;  4A3B K;  2WB1 D;  4LLG A;  4XSZ A;  4A3K K;  4A3F C;  4KMU A;  3CQZ C;  4Q5S A;  4BY1 K;  3GTL C;  3GTJ K;  3PO2 K;  5FJ8 K;  1TWH K;  3HOV K;  3RZD C;  4A3M K;  3S1Q C;  3RZO C;  2R7Z K;  2CW0 A;  1BDF A;  1TWG C;  4ZH4 A;  1Y1W C;  4OIQ A;  3HOW K;  3S16 C;  4A93 C;  4A3G K;  4JK1 A;  5M3F K;  4NOI A;  4BBR K;  5FLM C;  5C4J C;  4XSX A;  5M5Y K;  4A3L K;  4YFN A;  3HKZ L;  2NVX C;  3M3Y C;  3GTK C;  3HOX K;  5IYD K;  1I50 K;  2NVY C;  3FKI K;  3S15 K;  1K83 C;  4C3H K;  2JA5 C;  2YU9 C;  3S1M C;  2Y0S L;  3K7A C;  4QIW D;  5TMC A;  3S1N C;  4KN4 A;  4YG2 A;  4BBS K;  4Q4Z A;  1ZYR A;  5TMF A;  3I4N K;  3PO3 C;  1I3Q K;  4OIO A;  4A3I C;  2JA6 C;  2O5I A;  3GTP K;  5IYB K;  2JA7 C;  5C44 C;  4BXX C;  1R9T K;  1TWC C;  3H0G K;  1Y1V C;  1TWF C;  5IP9 K;  2NVQ K;  4LK0 A;  4G7H A;  2VUM C;  4X6A K;  2WAQ L;  3S2H C;  1I6V A;  4Y7N K;  1I6H K;  5C4X C;  3S14 C;  5IP7 K;  1IW7 A;  1SFO K;  2E2J C;  3GTG K;  2B63 K;  3GTQ K;  3I4M K;  4LJZ A;  4QJV A;  2R92 K;  4Y52 C;  3S2D C;  4A3B C;  2A69 A;  1TWA K;  4A3K C;  2JA8 K;  5IYC K;  3HOY K;  2Y0S D;  3GTJ C;  1XPP A;  1TWH C;  3HOV C;  4C2M K;  4A3M C;  3GTM K;  3HOU C;  3HOZ K;  4BY7 K;  2R7Z C;  3HOW C;  4A3L C;  1TWG K;  4A3C K;  4A3J K;  5C3E K;  5IYD C;  1I50 C;  3FKI C;  4A3D K;  2WAQ D;  3M4O K;  3S17 K;  3GTO K;  2JA5 K;  4BBS C;  4OIN A;  3I4N C;  2E2I K;  4AYB L;  1I3Q C;  4OIR A;  3GTP C;  3H3V L;  3S1R K;  2A68 A;  5IYB C;  3HKZ D;  2R93 K;  4A3E K;  1R9T C;  2NVT K;  4X6A C;  5IP9 C;  4GZY A;  1WCM K;  2O5J A;  4BY1 C;  2E2H K;  3PO2 C;  4LK1 A;  4Y7N C;  4A3F K;  1Y1V K;  1I6H C;  5IP7 C;  3CQZ K;  1SFO C;  3GTG C;  3GTQ C;  2B63 C;  3GTL K;  3I4M C;  4C3I K;  2R92 C;  4QJV B;  2PA8 L;  3S14 K;  3RZD K;  4A3G C;  1TWA C;  2PMZ L;  2JA8 C;  3S1Q K;  4BBR C;  5IYC C;  4G7O A;  3RZO K;  4MQ9 A;  1Y1W K;  3WOD A;  3S16 K;  4A93 K;  3HOX C;  5FLM K;  5C4J K;  3GTM C;  3HOZ C;  3S15 C;  4BY7 C;  4AYB D;  2NVX K;  4YFK A;  3M3Y K;  3GTK K;  3H3V D;  2WB1 L;  3DXJ A;  2NVY K;  3HOU K;  4C3J K;  1K83 K;  2YU9 K;  4A3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...