1JQWA

The 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein luxS
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jqwA00
1YCLA 1JOEA 1J6XA 1VGXA 1INNA 1VJEA 2FQOA 1JVIA 1J6VA 1VH2A 1J98A 1JQWA 1J6WA 2FQTA 4XCHA 5E68A 1IE0A
chains in the Genus database with same CATH superfamily
1L0WA 3HOYC 4YFKA 3GTPK 5M3FK 4KM8A 3LPXA 3I4NC 4LOWA 2W7VA 1R9TC 4WILA 4KDDA 1ZVUA 3GTMA 2R7ZC 5C4XC 3HOZC 1YNNA 2Y0SL 2R92A 4ZH4A 2JA6C 3I4MK 2V6UA 4BLBA 1Y1WC 4A3CC 1EH1A 4A3KK 5TMCA 4A3DK 2NVTK 3TTGA 4YFXA 1O26A 1VLOA 4KB2A 4P5AA 2GSNA 2RGRA 4KASA 1TWCA 1TWAA 4KAWX 5C44K 2YU9K 4OIRA 1XXCA 2CW0A 3K7AK 3N0CA 1VRQC 3TFHA 2B63C 5IOSA 3GTQC 4A3BK 4XLNA 1TWGK 3BUEA 5C3EC 3NUHA 1EFWA 3GEEA 2EBBA 5IORA 4GTAA 2NVXC 1YCLA 2BE5A 1O25A 4C3IC 4GTFA 2V6TA 2WB1L 4BXXC 4A93K 1DD5A 3HOYK 2KWAA 3A8JA 1GE9A 3I4NK 3ADAC 1C0AA 3GSIA 4GTLA 5C4XK 3HOZK 3TFJA 2JA6K 3GTGA 1F93A 4KB4A 1I50A 4A3CK 1Y1WK 4LLGA 4MQ9A 3H3VD 1VH2A 4MEYA 3S2DC 2WAQD 4KARA 1WCMA 2CFAA 1O27A 2Y3PA 4A3GC 1Y1VC 2R93A 4QJVA 3S1NC 2FQTA 4BBRC 4A3DC 2JA8C 3S1MK 2B63K 5C3EK 3HOXC 1TWFC 3GTKA 2Y0SD 1SFOA 2PHCB 4YG2A 3FOEA 4BKWA 2D6FC 3T00A 3AD7C 4C3IK 2XCOA 3GTLC 1IQ0A 4BXXK 4C2MC 3N3YA 3GTKC 1O24A 3BP8C 4A3IK 4KMDA 3QX3A 1INNA 1PJ6A 5JFEA 2GSOA 3GTOA 1J98A 1B4AA 1O2FB 5L46A 4LR2A 3HOWC 3S14C 1WIHA 2E2IA 1PJ7A 3GTOC 2A69A 4LK1A 1DCOA 3S2DK 3GEHA 4MEXA 1I50K 4PAAA 1RU0A 2NVYC 4A3GK 1Y1VK 1VJEA 3RZOC 1XZQA 2JA7A 2JA5A 3HOVC 4GTBA 4A3MK 3S1NK 2WB1D 1KQ4A 3Q3QA 2XCRB 4BBRK 2A6HA 2JA8K 3GTMC 2R92C 3HOXK 1TWFK 3T01A 1WOSA 1IS1A 1O29A 4GFQA 4XSXA 2ZUEA 3GTLK 4A3FC 3HXAA 1XZPA 3S1MC 4C2MK 3GDZA 3GTKK 4QIWD 1TWCC 1TWAC 1SFOK 1BGWA 4AH6A 1G51A 3HKZL 2RH6A 4O2DA 1BJTA 5TMFA 4KATA 1JQWA 4FZBA 1USMA 4A3JC 4G0WA 4DDQA 5IYDC 1BDFA 3HOWK 3S14K 1EI6A 4OIOA 4BBSC 3GTOK 4KN7A 4A3EC 1I3QA 1DCPA 4A3IC 3SZZA 4G7ZA 5IYBC 3VA7A 3BP3A 4KMUA 1SMYA 2NVYK 3S16K 3OEPA 3H0GA 3RZOK 4Y52C 1WQGA 3HOVK 5C4JC 3FKIA 2A6EA 1HI9A 3GTMK 1ZYRA 4Y7NC 2VUMA 4QIWL 2R92K 3GTGC 3SZYA 4XLPA 4GTEA 1WQHA 2JA7K 1I50C 2E2HA 3GTJA 4KN4A 4BY7C 1I6HC 1WOOA 3OREA 4G0UA 2JH3A 5IYCC 1ISEA 3RZDC 4A3MC 5M5YK 4A3FK 3M4OK 4XSZA 3T02A 1WCMC 5M5XK 2E2HC 4G7HA 3CQZA 2E2JC 1TWCK 1TWAK 4WJ3M 3A8KA 2R93C 4LJZA 4J3NA 4RMFA 5CHPA 1DCHA 3EQLA 3CQZC 3S15C 5E68A 4A3JK 3G4CA 1F7UA 5IYDK 2GSUA 4BBSK 4AYBL 4A3EK 1SFOC 5JVOA 5IP7C 1K83A 4GTCA 2YU9A 1ZXOA 5IYBK 2ZFZA 1O2BA 1J6XA 1TWGA 5TJ3A 4Y52K 5C4JK 1K83C 4KM9A 1XPPA 3G4AA 4Y7NK 3GTGK 2A68A 4JK1A 3L4JA 1WQFA 4QJVB 3HKZD 3LAPA 4BY7K 3FKIK 1I6HK 3LAJA 3S16C 2E2IC 3FHZA 4WJ4A 4YFNA 5FJ8K 5IYCK 3RZDK 3AQPA 1R9TA 1X31C 3M3YK 2NVQC 2PA8L 1WCMK 2E2HK 3S1RK 4GZYA 2R7ZA 2JA6A 5EGEA 2E2JK 3WODA 4G0VA 2JA7C 2JA5C 2R93K 3OPFA 1Y1WA 5IP9C 3S2HK 1EQRA 3CQZK 2PMZL 3S15K 1AB4A 1TWHA 3M4OC 1PJ5A 5FLMC 3PO3C 4C3HC 1O28A 5D4DA 5IP7K 3ERED 2O5JA 3CAGA 4ILDA 1WSVA 1TWHC 3GEIA 4G7OA 4BY1C 2B63A 3GTQA 4Q5SA 3DXJA 1K83K 4BLAA 4C3JC 1WOPA 4KMHA 3IPJA 5M3MK 2NVXA 3S17C 2GAHC 5HL8A 1XZQB 4A3LC 4PABA 3JSTA 1JVIA 3N0BA 2E2IK 1B4BA 1I3QC 1JOEA 1HQMA 4LK0A 2NVQK 3AQOA 4AYBD 3FOFA 1ZBSA 2ZUFA 3H0GC 3PO2C 2JA5K 1XZPB 5IP9K 2P5MA 3FKIC 4OIPA 1R9TK 1USOA 2R7ZK 1I6VA 5EGHA 2VUMC 4LQYA 2GAGC 3GTPA 1WORA 1IL2A 1J6VA 2XCQA 3M3YC 3S1QC 5FLMK 3S1RC 3PO3K 4C3HK 5IOQA 3GTJC 4C45A 1IE0A 3AD8C 2V6SA 3HOUC 4X6AC 1VGXA 1Y1VA 3TFIA 3GIRA 2PPBA 3GTPC 4GT9A 3V4GA 1TWHK 3A8IA 4GTDA 4BY1K 3MMLB 3S2HC 1F9NA 4OIQA 4OINA 1J6WA 3AD9C 1V5VA 1IBAA 4C3JK 3I4MC 1TWFA 2PA8D 4A3KC 5IOTA 3S17K 1F7VA 2NVTC 1XXBA 2P8TA 3GTQK 4A3LK 1UV7A 4Q4ZA 1XXAA 3GTLA 3AH5A 4P9SA 1BS2A 3L4KA 1YX2A 2NVXK 4FM9A 2PMZD 1I3QK 2O5IA 5C44C 1WSRA 2CFAB 2YU9C 4P5BA 3K7AC 3H3VL 5CJ9A 1YNJA 4NOIA 4A3BC 3H0GK 1TWGC 5M5WK 3PO2K 2WAQL 1EK8A 2VUMK 1ZQ1C 3S1QK 4KC6A 1IW7A 2FQOA 3S0XA 3GTJK 4KMAA 2NVYA 4XCHA 3HOUK 4X6AK 4A93C 1O2AA 4M1XA
chains in the Genus database with same CATH topology
1YCLA 1JOEA 1J6XA 1VGXA 1INNA 1VJEA 2FQOA 1JVIA 1J6VA 1VH2A 1J98A 1JQWA 1J6WA 2FQTA 4XCHA 5E68A 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  1JOE A;  1J6X A;  1VGX A;  1INN A;  1VJE A;  2FQO A;  1JVI A;  1J6V A;  1VH2 A;  1J98 A;  1JQW A;  1J6W A;  2FQT A;  4XCH A;  5E68 A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 1L0W A;  3HOY C;  4YFK A;  3GTP K;  5M3F K;  4KM8 A;  3LPX A;  3I4N C;  4LOW A;  2W7V A;  1R9T C;  4WIL A;  4KDD A;  1ZVU A;  3GTM A;  2R7Z C;  5C4X C;  3HOZ C;  1YNN A;  2Y0S L;  2R92 A;  4ZH4 A;  2JA6 C;  3I4M K;  2V6U A;  4BLB A;  1Y1W C;  4A3C C;  1EH1 A;  4A3K K;  5TMC A;  4A3D K;  2NVT K;  3TTG A;  4YFX A;  1O26 A;  1VLO A;  4KB2 A;  4P5A A;  2GSN A;  2RGR A;  4KAS A;  1TWC A;  1TWA A;  4KAW X;  5C44 K;  2YU9 K;  4OIR A;  1XXC A;  2CW0 A;  3K7A K;  3N0C A;  1VRQ C;  3TFH A;  2B63 C;  5IOS A;  3GTQ C;  4A3B K;  4XLN A;  1TWG K;  3BUE A;  5C3E C;  3NUH A;  1EFW A;  3GEE A;  2EBB A;  5IOR A;  4GTA A;  2NVX C;  1YCL A;  2BE5 A;  1O25 A;  4C3I C;  4GTF A;  2V6T A;  2WB1 L;  4BXX C;  4A93 K;  1DD5 A;  3HOY K;  2KWA A;  3A8J A;  1GE9 A;  3I4N K;  3ADA C;  1C0A A;  3GSI A;  4GTL A;  5C4X K;  3HOZ K;  3TFJ A;  2JA6 K;  3GTG A;  1F93 A;  4KB4 A;  1I50 A;  4A3C K;  1Y1W K;  4LLG A;  4MQ9 A;  3H3V D;  1VH2 A;  4MEY A;  3S2D C;  2WAQ D;  4KAR A;  1WCM A;  2CFA A;  1O27 A;  2Y3P A;  4A3G C;  1Y1V C;  2R93 A;  4QJV A;  3S1N C;  2FQT A;  4BBR C;  4A3D C;  2JA8 C;  3S1M K;  2B63 K;  5C3E K;  3HOX C;  1TWF C;  3GTK A;  2Y0S D;  1SFO A;  2PHC B;  4YG2 A;  3FOE A;  4BKW A;  2D6F C;  3T00 A;  3AD7 C;  4C3I K;  2XCO A;  3GTL C;  1IQ0 A;  4BXX K;  4C2M C;  3N3Y A;  3GTK C;  1O24 A;  3BP8 C;  4A3I K;  4KMD A;  3QX3 A;  1INN A;  1PJ6 A;  5JFE A;  2GSO A;  3GTO A;  1J98 A;  1B4A A;  1O2F B;  5L46 A;  4LR2 A;  3HOW C;  3S14 C;  1WIH A;  2E2I A;  1PJ7 A;  3GTO C;  2A69 A;  4LK1 A;  1DCO A;  3S2D K;  3GEH A;  4MEX A;  1I50 K;  4PAA A;  1RU0 A;  2NVY C;  4A3G K;  1Y1V K;  1VJE A;  3RZO C;  1XZQ A;  2JA7 A;  2JA5 A;  3HOV C;  4GTB A;  4A3M K;  3S1N K;  2WB1 D;  1KQ4 A;  3Q3Q A;  2XCR B;  4BBR K;  2A6H A;  2JA8 K;  3GTM C;  2R92 C;  3HOX K;  1TWF K;  3T01 A;  1WOS A;  1IS1 A;  1O29 A;  4GFQ A;  4XSX A;  2ZUE A;  3GTL K;  4A3F C;  3HXA A;  1XZP A;  3S1M C;  4C2M K;  3GDZ A;  3GTK K;  4QIW D;  1TWC C;  1TWA C;  1SFO K;  1BGW A;  4AH6 A;  1G51 A;  3HKZ L;  2RH6 A;  4O2D A;  1BJT A;  5TMF A;  4KAT A;  1JQW A;  4FZB A;  1USM A;  4A3J C;  4G0W A;  4DDQ A;  5IYD C;  1BDF A;  3HOW K;  3S14 K;  1EI6 A;  4OIO A;  4BBS C;  3GTO K;  4KN7 A;  4A3E C;  1I3Q A;  1DCP A;  4A3I C;  3SZZ A;  4G7Z A;  5IYB C;  3VA7 A;  3BP3 A;  4KMU A;  1SMY A;  2NVY K;  3S16 K;  3OEP A;  3H0G A;  3RZO K;  4Y52 C;  1WQG A;  3HOV K;  5C4J C;  3FKI A;  2A6E A;  1HI9 A;  3GTM K;  1ZYR A;  4Y7N C;  2VUM A;  4QIW L;  2R92 K;  3GTG C;  3SZY A;  4XLP A;  4GTE A;  1WQH A;  2JA7 K;  1I50 C;  2E2H A;  3GTJ A;  4KN4 A;  4BY7 C;  1I6H C;  1WOO A;  3ORE A;  4G0U A;  2JH3 A;  5IYC C;  1ISE A;  3RZD C;  4A3M C;  5M5Y K;  4A3F K;  3M4O K;  4XSZ A;  3T02 A;  1WCM C;  5M5X K;  2E2H C;  4G7H A;  3CQZ A;  2E2J C;  1TWC K;  1TWA K;  4WJ3 M;  3A8K A;  2R93 C;  4LJZ A;  4J3N A;  4RMF A;  5CHP A;  1DCH A;  3EQL A;  3CQZ C;  3S15 C;  5E68 A;  4A3J K;  3G4C A;  1F7U A;  5IYD K;  2GSU A;  4BBS K;  4AYB L;  4A3E K;  1SFO C;  5JVO A;  5IP7 C;  1K83 A;  4GTC A;  2YU9 A;  1ZXO A;  5IYB K;  2ZFZ A;  1O2B A;  1J6X A;  1TWG A;  5TJ3 A;  4Y52 K;  5C4J K;  1K83 C;  4KM9 A;  1XPP A;  3G4A A;  4Y7N K;  3GTG K;  2A68 A;  4JK1 A;  3L4J A;  1WQF A;  4QJV B;  3HKZ D;  3LAP A;  4BY7 K;  3FKI K;  1I6H K;  3LAJ A;  3S16 C;  2E2I C;  3FHZ A;  4WJ4 A;  4YFN A;  5FJ8 K;  5IYC K;  3RZD K;  3AQP A;  1R9T A;  1X31 C;  3M3Y K;  2NVQ C;  2PA8 L;  1WCM K;  2E2H K;  3S1R K;  4GZY A;  2R7Z A;  2JA6 A;  5EGE A;  2E2J K;  3WOD A;  4G0V A;  2JA7 C;  2JA5 C;  2R93 K;  3OPF A;  1Y1W A;  5IP9 C;  3S2H K;  1EQR A;  3CQZ K;  2PMZ L;  3S15 K;  1AB4 A;  1TWH A;  3M4O C;  1PJ5 A;  5FLM C;  3PO3 C;  4C3H C;  1O28 A;  5D4D A;  5IP7 K;  3ERE D;  2O5J A;  3CAG A;  4ILD A;  1WSV A;  1TWH C;  3GEI A;  4G7O A;  4BY1 C;  2B63 A;  3GTQ A;  4Q5S A;  3DXJ A;  1K83 K;  4BLA A;  4C3J C;  1WOP A;  4KMH A;  3IPJ A;  5M3M K;  2NVX A;  3S17 C;  2GAH C;  5HL8 A;  1XZQ B;  4A3L C;  4PAB A;  3JST A;  1JVI A;  3N0B A;  2E2I K;  1B4B A;  1I3Q C;  1JOE A;  1HQM A;  4LK0 A;  2NVQ K;  3AQO A;  4AYB D;  3FOF A;  1ZBS A;  2ZUF A;  3H0G C;  3PO2 C;  2JA5 K;  1XZP B;  5IP9 K;  2P5M A;  3FKI C;  4OIP A;  1R9T K;  1USO A;  2R7Z K;  1I6V A;  5EGH A;  2VUM C;  4LQY A;  2GAG C;  3GTP A;  1WOR A;  1IL2 A;  1J6V A;  2XCQ A;  3M3Y C;  3S1Q C;  5FLM K;  3S1R C;  3PO3 K;  4C3H K;  5IOQ A;  3GTJ C;  4C45 A;  1IE0 A;  3AD8 C;  2V6S A;  3HOU C;  4X6A C;  1VGX A;  1Y1V A;  3TFI A;  3GIR A;  2PPB A;  3GTP C;  4GT9 A;  3V4G A;  1TWH K;  3A8I A;  4GTD A;  4BY1 K;  3MML B;  3S2H C;  1F9N A;  4OIQ A;  4OIN A;  1J6W A;  3AD9 C;  1V5V A;  1IBA A;  4C3J K;  3I4M C;  1TWF A;  2PA8 D;  4A3K C;  5IOT A;  3S17 K;  1F7V A;  2NVT C;  1XXB A;  2P8T A;  3GTQ K;  4A3L K;  1UV7 A;  4Q4Z A;  1XXA A;  3GTL A;  3AH5 A;  4P9S A;  1BS2 A;  3L4K A;  1YX2 A;  2NVX K;  4FM9 A;  2PMZ D;  1I3Q K;  2O5I A;  5C44 C;  1WSR A;  2CFA B;  2YU9 C;  4P5B A;  3K7A C;  3H3V L;  5CJ9 A;  1YNJ A;  4NOI A;  4A3B C;  3H0G K;  1TWG C;  5M5W K;  3PO2 K;  2WAQ L;  1EK8 A;  2VUM K;  1ZQ1 C;  3S1Q K;  4KC6 A;  1IW7 A;  2FQO A;  3S0X A;  3GTJ K;  4KMA A;  2NVY A;  4XCH A;  3HOU K;  4X6A K;  4A93 C;  1O2A A;  4M1X A; 
#chains in the Genus database with same CATH homology
 1YCL A;  1JOE A;  1J6X A;  1VGX A;  1INN A;  1VJE A;  2FQO A;  1JVI A;  1J6V A;  1VH2 A;  1J98 A;  1JQW A;  1J6W A;  2FQT A;  4XCH A;  5E68 A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...