1JQWA

The 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
molecule keywords Autoinducer-2 production protein luxS
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jqwA00
1JQWA 1J98A 1J6XA 1VGXA 1JOEA 1J6VA 1INNA 4XCHA 1JVIA 1IE0A 2FQTA 1VJEA 5E68A 2FQOA 1YCLA 1J6WA 1VH2A
chains in the Genus database with same CATH superfamily
3HOVC 2A6EA 3GTQC 5IORA 2JA7A 3S15C 1TWCC 5C3EK 3GTLA 1R9TC 5FJ8K 5C3EC 3S1MK 3M3YC 2A69A 4RMFA 1TWHC 3TTGA 3GTMC 4YFXA 3FHZA 2RH6A 1ZQ1C 4A3FC 4Y7NK 4A3IK 4C2MC 3S2DK 1DCPA 3CQZK 3S16K 2GAHC 4KN7A 2JA6A 3RZOC 1TWAC 4LK0A 3GTKK 2GSUA 3JSTA 3T02A 3HOZK 5M5YK 3GTLC 1WQFA 4Q5SA 2JA5A 2NVYA 4P9SA 1YX2A 5IP7K 2W7VA 4WJ4A 1JVIA 1YCLA 3I4MC 3GTOC 2R92A 3M4OC 2B63K 4AYBD 4BBSK 3FOEA 3OEPA 1X31C 4A3LC 1O29A 1IQ0A 1WCMK 4A3GK 4Q4ZA 1USOA 1I3QC 4ZH4A 4J3NA 4YFKA 3S2HC 3S1QK 2Y0SD 2ZFZA 1DCOA 1KQ4A 1IL2A 4NOIA 2PMZD 1EFWA 3H0GK 2NVQC 4BLBA 4PABA 1BDFA 1IE0A 4BLAA 1TWHA 3RZDC 4GFQA 3GTJC 3GEHA 2NVXK 3IPJA 1L0WA 1V5VA 2PA8L 5IYCK 3AD9C 3FKIC 3AD8C 2WB1D 3N3YA 3VA7A 1ZXOA 4A93C 4A3CK 4QIWL 1J6VA 1BGWA 2A68A 2NVTK 5IOTA 3DXJA 4GTLA 3OREA 3GTQA 1XZPB 3G4CA 4A3JK 1B4AA 4BXXK 5IYDK 4G0VA 1YNNA 4BY1K 2O5IA 3GEIA 3EQLA 3S1NC 3SZZA 2JA8C 1JOEA 1TWAK 3A8IA 1XXCA 1I50C 1O2BA 1I3QK 1O25A 4C3JC 3S17K 3PO2K 2NVXA 4Y52C 2R7ZK 5TMCA 3N0BA 3AD7C 4KAWX 1VGXA 4Y52K 1ZBSA 4A3JC 1O28A 5E68A 4QJVB 3PO3C 1BJTA 1F7UA 1O26A 1WORA 3ERED 5IP9K 5TMFA 3CQZA 1WQHA 4OINA 3GTGK 2R92C 1K83C 3A8KA 1R9TK 2B63A 3GTGC 2FQTA 4G7OA 4YG2A 2CFAA 3MMLB 4PAAA 3GTJK 4GTCA 3AQPA 1VLOA 2V6UA 3PO3K 1WQGA 3RZOK 1Y1VC 4BBRK 3V4GA 1B4BA 3CQZC 3AH5A 4BY1C 5IP9C 1WCMC 4A3GC 3NUHA 3Q3QA 1ISEA 1I50K 3S14K 2Y0SL 4ILDA 4KM9A 5JVOA 5CJ9A 1TWAA 1F7VA 3GSIA 2Y3PA 3S1NK 5L46A 3GTPA 4G0UA 5EGHA 4A3LK 1JQWA 4BXXC 1O27A 1WSRA 3S14C 3GEEA 2ZUEA 2WAQD 2R93K 1YNJA 3AQOA 4QJVA 2NVTC 4GTFA 1J6XA 1WIHA 4XLPA 4MEXA 3S17C 3PO2C 1IW7A 2CFAB 1K83A 2JH3A 2V6TA 4GZYA 4YFNA 1R9TA 1PJ6A 3FKIK 1Y1WC 3M3YK 2JA5K 4BY7K 4O2DA 1Y1WK 4KN4A 2NVXC 3S2HK 3S1QC 2E2IC 3HOYK 4LLGA 1EI6A 1ZVUA 3S1MC 4LOWA 2YU9A 3LAPA 1I6VA 3G4AA 4OIQA 3GTLK 1IS1A 2R7ZC 3GTMA 3N0CA 4BBRC 3RZDK 4X6AK 1EK8A 4G0WA 2E2IA 4A3EK 5IOSA 3GTOK 1O2AA 4LJZA 3TFIA 4KMUA 4AH6A 3I4NK 4KB2A 4KDDA 1EQRA 5TJ3A 4LR2A 5C4XC 4A93K 2P8TA 3FOFA 1Y1VA 1K83K 2R92K 1O2FB 4G7ZA 4A3KK 4A3FK 1WOOA 2GSNA 1G51A 4KB4A 1DCHA 4OIPA 5C44K 4BKWA 3SZYA 3M4OK 1XZQB 1XXAA 1TWFA 4XSXA 4A3MK 2R93A 5IYDC 2O5JA 3S15K 2P5MA 4C3IK 4GTAA 1SMYA 2A6HA 5M3FK 1TWHK 2ZUFA 4C3HC 2E2HC 1C0AA 3GTPK 2XCRB 1HI9A 3ADAC 4GTBA 3S1RC 2JA6C 2PMZL 3LPXA 5M3MK 5D4DA 1TWCK 3QX3A 3I4MK 5M5XK 4C45A 3HOVK 4GT9A 1I50A 4KC6A 3GTKA 3S2DC 1IBAA 2RGRA 2NVQK 4XCHA 2WB1L 1PJ5A 4BY7C 4A3DC 2E2JC 1GE9A 2PA8D 1I6HC 2R7ZA 1PJ7A 3GTQK 3GTMK 2GSOA 4A3CC 1J6WA 1TWFK 3L4JA 3S1RK 2PHCB 4M1XA 4KMDA 1J98A 3T01A 2GAGC 1Y1VK 1SFOA 3GTGA 3HXAA 1DD5A 4Y7NC 4A3IC 1EH1A 3K7AK 2JA8K 1I6HK 5IOQA 3L4KA 5IYCC 3LAJA 2NVYC 1HQMA 4A3KC 4G7HA 3HOZC 4WJ3M 2YU9C 3S0XA 3HOYC 3GTKC 4LQYA 4JK1A 2E2IK 2XCOA 5C4JC 4C3HK 2VUMK 1TWGC 3BP3A 1RU0A 2JA7K 3A8JA 4MQ9A 1XXBA 2KWAA 4MEYA 5FLMK 1WCMA 3GTPC 4AYBL 3HOWK 4FM9A 3WODA 3T00A 2CW0A 4KMAA 3S16C 1WSVA 3HOXK 5EGEA 1INNA 3TFHA 4KASA 1O24A 3I4NC 2NVYK 2PPBA 3H3VL 3OPFA 1AB4A 5CHPA 4LK1A 2V6SA 3CAGA 4BBSC 1VJEA 1TWFC 1TWGK 1SFOC 3HOUK 4C2MK 5HL8A 3H0GC 5FLMC 1VH2A 5IP7C 4WILA 4XLNA 1Y1WA 3GDZA 3HOXC 4A3BK 4KATA 2EBBA 4GTDA 1XZPA 3TFJA 2D6FC 5IYBC 2JA5C 3K7AC 3GTJA 5IYBK 1UV7A 3H0GA 1SFOK 3HOUC 1BS2A 3HKZD 2XCQA 2VUMC 3H3VD 4KARA 5C4XK 1F93A 4FZBA 4GTEA 4KMHA 2JA6K 4C3JK 4A3MC 5M5WK 4OIRA 4A3EC 1ZYRA 1F9NA 4KM8A 1TWGA 2VUMA 3GIRA 3HOWC 4DDQA 5C44C 1I3QA 3HKZL 2YU9K 4A3DK 2E2JK 4P5AA 1USMA 1XZQA 2E2HA 2JA7C 1TWCA 4OIOA 5C4JK 5JFEA 3BP8C 4QIWD 3BUEA 1XPPA 4C3IC 3GTOA 4P5BA 2WAQL 3FKIA 1WOSA 2FQOA 4XSZA 2BE5A 1VRQC 2R93C 2E2HK 1WOPA 2B63C 4X6AC 4A3BC
chains in the Genus database with same CATH topology
1JQWA 1J98A 1J6XA 1VGXA 1JOEA 1J6VA 1INNA 4XCHA 1JVIA 1IE0A 2FQTA 1VJEA 5E68A 2FQOA 1YCLA 1J6WA 1VH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1J98 A;  1J6X A;  1VGX A;  1JOE A;  1J6V A;  1INN A;  4XCH A;  1JVI A;  1IE0 A;  2FQT A;  1VJE A;  5E68 A;  2FQO A;  1YCL A;  1J6W A;  1VH2 A; 
#chains in the Genus database with same CATH topology
 3HOV C;  2A6E A;  3GTQ C;  5IOR A;  2JA7 A;  3S15 C;  1TWC C;  5C3E K;  3GTL A;  1R9T C;  5FJ8 K;  5C3E C;  3S1M K;  3M3Y C;  2A69 A;  4RMF A;  1TWH C;  3TTG A;  3GTM C;  4YFX A;  3FHZ A;  2RH6 A;  1ZQ1 C;  4A3F C;  4Y7N K;  4A3I K;  4C2M C;  3S2D K;  1DCP A;  3CQZ K;  3S16 K;  2GAH C;  4KN7 A;  2JA6 A;  3RZO C;  1TWA C;  4LK0 A;  3GTK K;  2GSU A;  3JST A;  3T02 A;  3HOZ K;  5M5Y K;  3GTL C;  1WQF A;  4Q5S A;  2JA5 A;  2NVY A;  4P9S A;  1YX2 A;  5IP7 K;  2W7V A;  4WJ4 A;  1JVI A;  1YCL A;  3I4M C;  3GTO C;  2R92 A;  3M4O C;  2B63 K;  4AYB D;  4BBS K;  3FOE A;  3OEP A;  1X31 C;  4A3L C;  1O29 A;  1IQ0 A;  1WCM K;  4A3G K;  4Q4Z A;  1USO A;  1I3Q C;  4ZH4 A;  4J3N A;  4YFK A;  3S2H C;  3S1Q K;  2Y0S D;  2ZFZ A;  1DCO A;  1KQ4 A;  1IL2 A;  4NOI A;  2PMZ D;  1EFW A;  3H0G K;  2NVQ C;  4BLB A;  4PAB A;  1BDF A;  1IE0 A;  4BLA A;  1TWH A;  3RZD C;  4GFQ A;  3GTJ C;  3GEH A;  2NVX K;  3IPJ A;  1L0W A;  1V5V A;  2PA8 L;  5IYC K;  3AD9 C;  3FKI C;  3AD8 C;  2WB1 D;  3N3Y A;  3VA7 A;  1ZXO A;  4A93 C;  4A3C K;  4QIW L;  1J6V A;  1BGW A;  2A68 A;  2NVT K;  5IOT A;  3DXJ A;  4GTL A;  3ORE A;  3GTQ A;  1XZP B;  3G4C A;  4A3J K;  1B4A A;  4BXX K;  5IYD K;  4G0V A;  1YNN A;  4BY1 K;  2O5I A;  3GEI A;  3EQL A;  3S1N C;  3SZZ A;  2JA8 C;  1JOE A;  1TWA K;  3A8I A;  1XXC A;  1I50 C;  1O2B A;  1I3Q K;  1O25 A;  4C3J C;  3S17 K;  3PO2 K;  2NVX A;  4Y52 C;  2R7Z K;  5TMC A;  3N0B A;  3AD7 C;  4KAW X;  1VGX A;  4Y52 K;  1ZBS A;  4A3J C;  1O28 A;  5E68 A;  4QJV B;  3PO3 C;  1BJT A;  1F7U A;  1O26 A;  1WOR A;  3ERE D;  5IP9 K;  5TMF A;  3CQZ A;  1WQH A;  4OIN A;  3GTG K;  2R92 C;  1K83 C;  3A8K A;  1R9T K;  2B63 A;  3GTG C;  2FQT A;  4G7O A;  4YG2 A;  2CFA A;  3MML B;  4PAA A;  3GTJ K;  4GTC A;  3AQP A;  1VLO A;  2V6U A;  3PO3 K;  1WQG A;  3RZO K;  1Y1V C;  4BBR K;  3V4G A;  1B4B A;  3CQZ C;  3AH5 A;  4BY1 C;  5IP9 C;  1WCM C;  4A3G C;  3NUH A;  3Q3Q A;  1ISE A;  1I50 K;  3S14 K;  2Y0S L;  4ILD A;  4KM9 A;  5JVO A;  5CJ9 A;  1TWA A;  1F7V A;  3GSI A;  2Y3P A;  3S1N K;  5L46 A;  3GTP A;  4G0U A;  5EGH A;  4A3L K;  1JQW A;  4BXX C;  1O27 A;  1WSR A;  3S14 C;  3GEE A;  2ZUE A;  2WAQ D;  2R93 K;  1YNJ A;  3AQO A;  4QJV A;  2NVT C;  4GTF A;  1J6X A;  1WIH A;  4XLP A;  4MEX A;  3S17 C;  3PO2 C;  1IW7 A;  2CFA B;  1K83 A;  2JH3 A;  2V6T A;  4GZY A;  4YFN A;  1R9T A;  1PJ6 A;  3FKI K;  1Y1W C;  3M3Y K;  2JA5 K;  4BY7 K;  4O2D A;  1Y1W K;  4KN4 A;  2NVX C;  3S2H K;  3S1Q C;  2E2I C;  3HOY K;  4LLG A;  1EI6 A;  1ZVU A;  3S1M C;  4LOW A;  2YU9 A;  3LAP A;  1I6V A;  3G4A A;  4OIQ A;  3GTL K;  1IS1 A;  2R7Z C;  3GTM A;  3N0C A;  4BBR C;  3RZD K;  4X6A K;  1EK8 A;  4G0W A;  2E2I A;  4A3E K;  5IOS A;  3GTO K;  1O2A A;  4LJZ A;  3TFI A;  4KMU A;  4AH6 A;  3I4N K;  4KB2 A;  4KDD A;  1EQR A;  5TJ3 A;  4LR2 A;  5C4X C;  4A93 K;  2P8T A;  3FOF A;  1Y1V A;  1K83 K;  2R92 K;  1O2F B;  4G7Z A;  4A3K K;  4A3F K;  1WOO A;  2GSN A;  1G51 A;  4KB4 A;  1DCH A;  4OIP A;  5C44 K;  4BKW A;  3SZY A;  3M4O K;  1XZQ B;  1XXA A;  1TWF A;  4XSX A;  4A3M K;  2R93 A;  5IYD C;  2O5J A;  3S15 K;  2P5M A;  4C3I K;  4GTA A;  1SMY A;  2A6H A;  5M3F K;  1TWH K;  2ZUF A;  4C3H C;  2E2H C;  1C0A A;  3GTP K;  2XCR B;  1HI9 A;  3ADA C;  4GTB A;  3S1R C;  2JA6 C;  2PMZ L;  3LPX A;  5M3M K;  5D4D A;  1TWC K;  3QX3 A;  3I4M K;  5M5X K;  4C45 A;  3HOV K;  4GT9 A;  1I50 A;  4KC6 A;  3GTK A;  3S2D C;  1IBA A;  2RGR A;  2NVQ K;  4XCH A;  2WB1 L;  1PJ5 A;  4BY7 C;  4A3D C;  2E2J C;  1GE9 A;  2PA8 D;  1I6H C;  2R7Z A;  1PJ7 A;  3GTQ K;  3GTM K;  2GSO A;  4A3C C;  1J6W A;  1TWF K;  3L4J A;  3S1R K;  2PHC B;  4M1X A;  4KMD A;  1J98 A;  3T01 A;  2GAG C;  1Y1V K;  1SFO A;  3GTG A;  3HXA A;  1DD5 A;  4Y7N C;  4A3I C;  1EH1 A;  3K7A K;  2JA8 K;  1I6H K;  5IOQ A;  3L4K A;  5IYC C;  3LAJ A;  2NVY C;  1HQM A;  4A3K C;  4G7H A;  3HOZ C;  4WJ3 M;  2YU9 C;  3S0X A;  3HOY C;  3GTK C;  4LQY A;  4JK1 A;  2E2I K;  2XCO A;  5C4J C;  4C3H K;  2VUM K;  1TWG C;  3BP3 A;  1RU0 A;  2JA7 K;  3A8J A;  4MQ9 A;  1XXB A;  2KWA A;  4MEY A;  5FLM K;  1WCM A;  3GTP C;  4AYB L;  3HOW K;  4FM9 A;  3WOD A;  3T00 A;  2CW0 A;  4KMA A;  3S16 C;  1WSV A;  3HOX K;  5EGE A;  1INN A;  3TFH A;  4KAS A;  1O24 A;  3I4N C;  2NVY K;  2PPB A;  3H3V L;  3OPF A;  1AB4 A;  5CHP A;  4LK1 A;  2V6S A;  3CAG A;  4BBS C;  1VJE A;  1TWF C;  1TWG K;  1SFO C;  3HOU K;  4C2M K;  5HL8 A;  3H0G C;  5FLM C;  1VH2 A;  5IP7 C;  4WIL A;  4XLN A;  1Y1W A;  3GDZ A;  3HOX C;  4A3B K;  4KAT A;  2EBB A;  4GTD A;  1XZP A;  3TFJ A;  2D6F C;  5IYB C;  2JA5 C;  3K7A C;  3GTJ A;  5IYB K;  1UV7 A;  3H0G A;  1SFO K;  3HOU C;  1BS2 A;  3HKZ D;  2XCQ A;  2VUM C;  3H3V D;  4KAR A;  5C4X K;  1F93 A;  4FZB A;  4GTE A;  4KMH A;  2JA6 K;  4C3J K;  4A3M C;  5M5W K;  4OIR A;  4A3E C;  1ZYR A;  1F9N A;  4KM8 A;  1TWG A;  2VUM A;  3GIR A;  3HOW C;  4DDQ A;  5C44 C;  1I3Q A;  3HKZ L;  2YU9 K;  4A3D K;  2E2J K;  4P5A A;  1USM A;  1XZQ A;  2E2H A;  2JA7 C;  1TWC A;  4OIO A;  5C4J K;  5JFE A;  3BP8 C;  4QIW D;  3BUE A;  1XPP A;  4C3I C;  3GTO A;  4P5B A;  2WAQ L;  3FKI A;  1WOS A;  2FQO A;  4XSZ A;  2BE5 A;  1VRQ C;  2R93 C;  2E2H K;  1WOP A;  2B63 C;  4X6A C;  4A3B C; 
#chains in the Genus database with same CATH homology
 1JQW A;  1J98 A;  1J6X A;  1VGX A;  1JOE A;  1J6V A;  1INN A;  4XCH A;  1JVI A;  1IE0 A;  2FQT A;  1VJE A;  5E68 A;  2FQO A;  1YCL A;  1J6W A;  1VH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...