1JQWA

The 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Autoinducer-2 production protein luxS
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jqwA00
1J6WA 1JQWA 4XCHA 5E68A 1J98A 1VH2A 1J6XA 1VJEA 2FQOA 2FQTA 1INNA 1JOEA 1VGXA 1YCLA 1J6VA 1JVIA 1IE0A
chains in the Genus database with same CATH superfamily
1WCMA 1IW7A 2NVQC 2GSNA 2V6SA 4BLBA 1TWGK 1XXAA 2E2JC 3L4JA 4YFXA 4OIOA 5IYCK 1Y1VK 1IQ0A 1R9TA 1VH2A 3JSTA 4ZH4A 3GTKC 3T01A 4GZYA 1K83A 1JQWA 3HOYC 3S1RC 1ZYRA 4BY7K 3S1NK 3HOWK 3AD7C 3S2HK 3PO2K 4LQYA 4GTFA 3OPFA 4LK1A 1TWGA 3QX3A 5D4DA 3H3VD 3GTOA 5IYBK 1V5VA 4LLGA 5FJ8K 4A3GC 1VRQC 1TWAK 2CFAB 4GTDA 3CQZK 3S14K 4A3EK 5TMFA 1WOOA 3GIRA 4G7OA 3GTKA 2R92C 3Q3QA 3N0CA 4XLPA 1TWCC 4MEYA 2PA8D 2O5JA 3NUHA 5TMCA 1TWAA 4M1XA 5E68A 1I3QK 3HOXK 2XCOA 1ZBSA 1PJ5A 5IOSA 3GTJK 2V6UA 1Y1WK 1IL2A 2R92A 3A8KA 4OINA 4YG2A 4KMAA 2NVTC 4A3BK 1TWCA 3M4OK 3HOZK 4BY1K 4BBRK 1I3QA 1O26A 4KARA 2A69A 3S16K 1I6HK 4A93C 2YU9K 3T02A 5CJ9A 1X31C 4WILA 4C3IC 4A3LK 4A3KK 5IP7K 4YFNA 3GTJA 4XCHA 1Y1WA 4BKWA 3IPJA 3BP8C 1L0WA 4OIPA 1EQRA 4C2MK 2JA6C 1TWHK 1G51A 2V6TA 4X6AC 3FKIA 4KM8A 4KMUA 1F93A 1TWFK 2ZUFA 5M5WK 3RZDC 4KDDA 3H3VL 2NVYC 3HOVC 1SFOK 2E2HC 1ZVUA 4GTBA 4G0UA 4C45A 4A3FC 1YCLA 4RMFA 1IE0A 1J6WA 2B63K 5C4XC 2FQTA 4YFKA 4WJ3M 3V4GA 1F9NA 1R9TC 2P5MA 1XZQA 5C3EK 4GTLA 3I4NK 1O2AA 3OEPA 5JVOA 1WQHA 3GTPK 1WQFA 4C3HC 3LAJA 3GTLK 1DCHA 2NVYA 2E2HA 4A3IK 1TWGC 2JH3A 2R7ZK 2B63A 2Y0SD 5IOQA 1O25A 4BXXC 4WJ4A 4BY7C 4QJVA 3OREA 3S1NC 3HOWC 1I6VA 3S2HC 2VUMA 1DD5A 2R7ZA 5IYBC 2JA5K 1TWAC 1KQ4A 1WSVA 2D6FC 2JA7K 3S14C 4XSZA 1Y1VA 4A3EC 3AD9C 1DCOA 4P5AA 3S2DK 1RU0A 3S1QC 3G4CA 1VJEA 2WB1D 1B4BA 3ADAC 3AQPA 1EH1A 1DCPA 1I3QC 4A3JK 3GTGK 3HOXC 3S1RK 3FOEA 1UV7A 1WOPA 4G7HA 1I50K 1YX2A 3CQZA 4G7ZA 3GTQK 4MEXA 3ERED 4C3JC 2FQOA 4KN4A 3GTJC 1Y1WC 3H0GK 1JVIA 4OIRA 3EQLA 3SZYA 1XZPA 4KC6A 3M4OC 3HOZC 4BY1C 4BBRC 1PJ7A 3BUEA 1BS2A 2WAQD 3S16C 5C44K 4G0VA 1J6XA 4A3DK 3GTQA 3BP3A 2YU9C 3HOUK 4A3LC 3FKIC 3N0BA 4QIWD 5IP7C 3WODA 2O5IA 5M3FK 2R93K 5IOTA 4Y7NK 3GEHA 2Y0SL 4AYBD 3LAPA 4MQ9A 1TWHC 2PPBA 1WIHA 5C4JK 3FHZA 1TWFC 2NVTK 4LOWA 3CAGA 3PO3C 2YU9A 2E2IK 2ZFZA 4PABA 3S1MK 2KWAA 3I4MC 2GAGC 4KB4A 3S15K 4Y52C 1ISEA 5IYDK 5FLMK 2JA8C 4C3IK 3HKZD 3A8IA 2NVXK 2B63C 4AH6A 4XLNA 3DXJA 1J6VA 1EI6A 2RGRA 2CFAA 2WB1L 1TWHA 5C3EC 1EFWA 2E2IA 1BDFA 3I4NC 3K7AK 1TWFA 3GEIA 4A3MK 4A3CK 1JOEA 4Q4ZA 2VUMC 4KATA 1SFOA 2JA6K 4X6AK 4Q5SA 4GTAA 4A3IC 4J3NA 3FOFA 2R7ZC 3GSIA 2GAHC 3GTMK 5CHPA 3HOVK 4GT9A 4BBSK 2RH6A 1F7VA 3A8JA 5IYCC 1Y1VC 4PAAA 1WCMK 1YNJA 4A3FK 1O2BA 5IP9K 3TFJA 3S17K 5C4XK 2WAQL 3GTPA 1R9TK 3GTLA 3HXAA 3PO2C 1HQMA 4NOIA 1K83K 4XSXA 4KAWX 3AD8C 2JA7C 1WOSA 3M3YK 4QIWL 1IS1A 1O24A 2W7VA 3CQZC 2GSOA 3S2DC 3L4KA 4LK0A 3RZOK 4AYBL 3GTOK 2GSUA 2NVQK 5HL8A 2E2JK 1GE9A 3S0XA 1INNA 1ZQ1C 4BLAA 4BXXK 2BE5A 4A3JC 3GTGC 4KN7A 4KMDA 3GTKK 2JA5A 1O29A 2JA7A 1IBAA 1I50C 1VGXA 3HOYK 4DDQA 5IORA 3GTQC 1O2FB 3G4AA 4G0WA 3TTGA 5EGEA 3H0GC 3HKZL 1F7UA 4LR2A 1XXCA 4A3GK 1XPPA 1USMA 3GEEA 1XZQB 3VA7A 1PJ6A 4A3BC 3T00A 5C44C 4A3DC 1O27A 3S1QK 3GTGA 3HOUC 2R92K 2EBBA 4FM9A 1I6HC 1I50A 1TWCK 1C0AA 2R93C 4Y7NC 5JFEA 4A3KC 4GFQA 3H0GA 1BJTA 1XXBA 2XCQA 3LPXA 1YNNA 4QJVB 4C3JK 4JK1A 3TFHA 2A68A 5C4JC 2P8TA 2ZUEA 4C2MC 4FZBA 2E2IC 3S1MC 1AB4A 1USOA 3S15C 2R93A 5IYDC 1SFOC 5FLMC 2PMZL 3FKIK 5M5XK 2NVXC 4A93K 2A6HA 2Y3PA 4GTCA 3K7AC 1EK8A 4A3MC 4A3CC 1WQGA 2A6EA 3SZZA 1ZXOA 4KB2A 1J98A 3TFIA 2CW0A 3GTPC 3GTLC 3GTMC 1SMYA 5M5YK 1WSRA 4OIQA 4O2DA 3PO3K 1O28A 2XCRB 2NVXA 2PHCB 3I4MK 4BBSC 3GDZA 4ILDA 3RZDK 4P5BA 2NVYK 4Y52K 1XZPB 3AQOA 1WCMC 4KM9A 2E2HK 3N3YA 2JA8K 1B4AA 5IP9C 3S17C 1BGWA 3AH5A 3MMLB 5TJ3A 4P9SA 2JA6A 5M3MK 1K83C 4LJZA 2PA8L 3M3YC 5L46A 5EGHA 3GTMA 4KASA 1WORA 4KMHA 2JA5C 1VLOA 1HI9A 2VUMK 2PMZD 4C3HK 3RZOC 3GTOC 4GTEA
chains in the Genus database with same CATH topology
1J6WA 1JQWA 4XCHA 5E68A 1J98A 1VH2A 1J6XA 1VJEA 2FQOA 2FQTA 1INNA 1JOEA 1VGXA 1YCLA 1J6VA 1JVIA 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6W A;  1JQW A;  4XCH A;  5E68 A;  1J98 A;  1VH2 A;  1J6X A;  1VJE A;  2FQO A;  2FQT A;  1INN A;  1JOE A;  1VGX A;  1YCL A;  1J6V A;  1JVI A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 1WCM A;  1IW7 A;  2NVQ C;  2GSN A;  2V6S A;  4BLB A;  1TWG K;  1XXA A;  2E2J C;  3L4J A;  4YFX A;  4OIO A;  5IYC K;  1Y1V K;  1IQ0 A;  1R9T A;  1VH2 A;  3JST A;  4ZH4 A;  3GTK C;  3T01 A;  4GZY A;  1K83 A;  1JQW A;  3HOY C;  3S1R C;  1ZYR A;  4BY7 K;  3S1N K;  3HOW K;  3AD7 C;  3S2H K;  3PO2 K;  4LQY A;  4GTF A;  3OPF A;  4LK1 A;  1TWG A;  3QX3 A;  5D4D A;  3H3V D;  3GTO A;  5IYB K;  1V5V A;  4LLG A;  5FJ8 K;  4A3G C;  1VRQ C;  1TWA K;  2CFA B;  4GTD A;  3CQZ K;  3S14 K;  4A3E K;  5TMF A;  1WOO A;  3GIR A;  4G7O A;  3GTK A;  2R92 C;  3Q3Q A;  3N0C A;  4XLP A;  1TWC C;  4MEY A;  2PA8 D;  2O5J A;  3NUH A;  5TMC A;  1TWA A;  4M1X A;  5E68 A;  1I3Q K;  3HOX K;  2XCO A;  1ZBS A;  1PJ5 A;  5IOS A;  3GTJ K;  2V6U A;  1Y1W K;  1IL2 A;  2R92 A;  3A8K A;  4OIN A;  4YG2 A;  4KMA A;  2NVT C;  4A3B K;  1TWC A;  3M4O K;  3HOZ K;  4BY1 K;  4BBR K;  1I3Q A;  1O26 A;  4KAR A;  2A69 A;  3S16 K;  1I6H K;  4A93 C;  2YU9 K;  3T02 A;  5CJ9 A;  1X31 C;  4WIL A;  4C3I C;  4A3L K;  4A3K K;  5IP7 K;  4YFN A;  3GTJ A;  4XCH A;  1Y1W A;  4BKW A;  3IPJ A;  3BP8 C;  1L0W A;  4OIP A;  1EQR A;  4C2M K;  2JA6 C;  1TWH K;  1G51 A;  2V6T A;  4X6A C;  3FKI A;  4KM8 A;  4KMU A;  1F93 A;  1TWF K;  2ZUF A;  5M5W K;  3RZD C;  4KDD A;  3H3V L;  2NVY C;  3HOV C;  1SFO K;  2E2H C;  1ZVU A;  4GTB A;  4G0U A;  4C45 A;  4A3F C;  1YCL A;  4RMF A;  1IE0 A;  1J6W A;  2B63 K;  5C4X C;  2FQT A;  4YFK A;  4WJ3 M;  3V4G A;  1F9N A;  1R9T C;  2P5M A;  1XZQ A;  5C3E K;  4GTL A;  3I4N K;  1O2A A;  3OEP A;  5JVO A;  1WQH A;  3GTP K;  1WQF A;  4C3H C;  3LAJ A;  3GTL K;  1DCH A;  2NVY A;  2E2H A;  4A3I K;  1TWG C;  2JH3 A;  2R7Z K;  2B63 A;  2Y0S D;  5IOQ A;  1O25 A;  4BXX C;  4WJ4 A;  4BY7 C;  4QJV A;  3ORE A;  3S1N C;  3HOW C;  1I6V A;  3S2H C;  2VUM A;  1DD5 A;  2R7Z A;  5IYB C;  2JA5 K;  1TWA C;  1KQ4 A;  1WSV A;  2D6F C;  2JA7 K;  3S14 C;  4XSZ A;  1Y1V A;  4A3E C;  3AD9 C;  1DCO A;  4P5A A;  3S2D K;  1RU0 A;  3S1Q C;  3G4C A;  1VJE A;  2WB1 D;  1B4B A;  3ADA C;  3AQP A;  1EH1 A;  1DCP A;  1I3Q C;  4A3J K;  3GTG K;  3HOX C;  3S1R K;  3FOE A;  1UV7 A;  1WOP A;  4G7H A;  1I50 K;  1YX2 A;  3CQZ A;  4G7Z A;  3GTQ K;  4MEX A;  3ERE D;  4C3J C;  2FQO A;  4KN4 A;  3GTJ C;  1Y1W C;  3H0G K;  1JVI A;  4OIR A;  3EQL A;  3SZY A;  1XZP A;  4KC6 A;  3M4O C;  3HOZ C;  4BY1 C;  4BBR C;  1PJ7 A;  3BUE A;  1BS2 A;  2WAQ D;  3S16 C;  5C44 K;  4G0V A;  1J6X A;  4A3D K;  3GTQ A;  3BP3 A;  2YU9 C;  3HOU K;  4A3L C;  3FKI C;  3N0B A;  4QIW D;  5IP7 C;  3WOD A;  2O5I A;  5M3F K;  2R93 K;  5IOT A;  4Y7N K;  3GEH A;  2Y0S L;  4AYB D;  3LAP A;  4MQ9 A;  1TWH C;  2PPB A;  1WIH A;  5C4J K;  3FHZ A;  1TWF C;  2NVT K;  4LOW A;  3CAG A;  3PO3 C;  2YU9 A;  2E2I K;  2ZFZ A;  4PAB A;  3S1M K;  2KWA A;  3I4M C;  2GAG C;  4KB4 A;  3S15 K;  4Y52 C;  1ISE A;  5IYD K;  5FLM K;  2JA8 C;  4C3I K;  3HKZ D;  3A8I A;  2NVX K;  2B63 C;  4AH6 A;  4XLN A;  3DXJ A;  1J6V A;  1EI6 A;  2RGR A;  2CFA A;  2WB1 L;  1TWH A;  5C3E C;  1EFW A;  2E2I A;  1BDF A;  3I4N C;  3K7A K;  1TWF A;  3GEI A;  4A3M K;  4A3C K;  1JOE A;  4Q4Z A;  2VUM C;  4KAT A;  1SFO A;  2JA6 K;  4X6A K;  4Q5S A;  4GTA A;  4A3I C;  4J3N A;  3FOF A;  2R7Z C;  3GSI A;  2GAH C;  3GTM K;  5CHP A;  3HOV K;  4GT9 A;  4BBS K;  2RH6 A;  1F7V A;  3A8J A;  5IYC C;  1Y1V C;  4PAA A;  1WCM K;  1YNJ A;  4A3F K;  1O2B A;  5IP9 K;  3TFJ A;  3S17 K;  5C4X K;  2WAQ L;  3GTP A;  1R9T K;  3GTL A;  3HXA A;  3PO2 C;  1HQM A;  4NOI A;  1K83 K;  4XSX A;  4KAW X;  3AD8 C;  2JA7 C;  1WOS A;  3M3Y K;  4QIW L;  1IS1 A;  1O24 A;  2W7V A;  3CQZ C;  2GSO A;  3S2D C;  3L4K A;  4LK0 A;  3RZO K;  4AYB L;  3GTO K;  2GSU A;  2NVQ K;  5HL8 A;  2E2J K;  1GE9 A;  3S0X A;  1INN A;  1ZQ1 C;  4BLA A;  4BXX K;  2BE5 A;  4A3J C;  3GTG C;  4KN7 A;  4KMD A;  3GTK K;  2JA5 A;  1O29 A;  2JA7 A;  1IBA A;  1I50 C;  1VGX A;  3HOY K;  4DDQ A;  5IOR A;  3GTQ C;  1O2F B;  3G4A A;  4G0W A;  3TTG A;  5EGE A;  3H0G C;  3HKZ L;  1F7U A;  4LR2 A;  1XXC A;  4A3G K;  1XPP A;  1USM A;  3GEE A;  1XZQ B;  3VA7 A;  1PJ6 A;  4A3B C;  3T00 A;  5C44 C;  4A3D C;  1O27 A;  3S1Q K;  3GTG A;  3HOU C;  2R92 K;  2EBB A;  4FM9 A;  1I6H C;  1I50 A;  1TWC K;  1C0A A;  2R93 C;  4Y7N C;  5JFE A;  4A3K C;  4GFQ A;  3H0G A;  1BJT A;  1XXB A;  2XCQ A;  3LPX A;  1YNN A;  4QJV B;  4C3J K;  4JK1 A;  3TFH A;  2A68 A;  5C4J C;  2P8T A;  2ZUE A;  4C2M C;  4FZB A;  2E2I C;  3S1M C;  1AB4 A;  1USO A;  3S15 C;  2R93 A;  5IYD C;  1SFO C;  5FLM C;  2PMZ L;  3FKI K;  5M5X K;  2NVX C;  4A93 K;  2A6H A;  2Y3P A;  4GTC A;  3K7A C;  1EK8 A;  4A3M C;  4A3C C;  1WQG A;  2A6E A;  3SZZ A;  1ZXO A;  4KB2 A;  1J98 A;  3TFI A;  2CW0 A;  3GTP C;  3GTL C;  3GTM C;  1SMY A;  5M5Y K;  1WSR A;  4OIQ A;  4O2D A;  3PO3 K;  1O28 A;  2XCR B;  2NVX A;  2PHC B;  3I4M K;  4BBS C;  3GDZ A;  4ILD A;  3RZD K;  4P5B A;  2NVY K;  4Y52 K;  1XZP B;  3AQO A;  1WCM C;  4KM9 A;  2E2H K;  3N3Y A;  2JA8 K;  1B4A A;  5IP9 C;  3S17 C;  1BGW A;  3AH5 A;  3MML B;  5TJ3 A;  4P9S A;  2JA6 A;  5M3M K;  1K83 C;  4LJZ A;  2PA8 L;  3M3Y C;  5L46 A;  5EGH A;  3GTM A;  4KAS A;  1WOR A;  4KMH A;  2JA5 C;  1VLO A;  1HI9 A;  2VUM K;  2PMZ D;  4C3H K;  3RZO C;  3GTO C;  4GTE A; 
#chains in the Genus database with same CATH homology
 1J6W A;  1JQW A;  4XCH A;  5E68 A;  1J98 A;  1VH2 A;  1J6X A;  1VJE A;  2FQO A;  2FQT A;  1INN A;  1JOE A;  1VGX A;  1YCL A;  1J6V A;  1JVI A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...