1JQWA

The 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
b'ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein luxS
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jqwA00
1JVIA 1YCLA 1IE0A 1JQWA 1VJEA 2FQOA 1JOEA 1J98A 2FQTA 1J6WA 4XCHA 5E68A 1J6VA 1VGXA 1INNA 1J6XA 1VH2A
chains in the Genus database with same CATH superfamily
4J3NA 3GTMA 2V6UA 3OREA 1O24A 3I4NK 4FM9A 1V5VA 2NVYC 2BE5A 5CJ9A 2JA8C 4KM8A 4A3IC 1WQHA 3GEIA 3CQZA 1O28A 1INNA 3S2DK 1O2FB 1WOOA 4KMDA 2PA8D 4KN4A 3GTKK 2ZUEA 1JOEA 5FLMC 5IYBC 5EGHA 3FOFA 1SFOC 3A8IA 2JA5A 2PMZL 4KN7A 4KATA 2R93K 3FOEA 3GTMK 3S2HC 4DDQA 2PHCB 2RGRA 1BJTA 4AH6A 1IQ0A 1WSVA 4BBSC 3BP8C 3CQZK 3HOUC 3AD9C 3FKIA 4C3HC 3K7AK 1DCPA 2PMZD 3HKZL 5IORA 3VA7A 2B63A 5C4XK 2O5JA 2JA5K 4PABA 5IOSA 1Y1VC 2E2IK 3S1QK 3LAPA 3GTGC 4AYBD 2VUMC 3RZOK 3H3VL 4GTAA 4A3BC 1I6HK 3TFIA 2VUMA 1DD5A 1XXCA 3GTJK 3FKIK 4RMFA 5C44K 2XCOA 2B63K 1L0WA 3S15K 2D6FC 3GTLK 1O26A 4Y7NK 1WCMC 3AH5A 3LPXA 4A93K 2NVXA 4GTCA 4M1XA 2GSNA 5IYDK 4YG2A 3L4JA 1XPPA 1TWAA 1XZQB 4G0VA 4BY1K 4BLAA 2P5MA 4LLGA 4FZBA 3GTQK 1TWFA 3S1RC 1O27A 2WB1L 2E2HK 4MQ9A 4A3MC 4OINA 2NVXK 4C2MC 1WOSA 2NVTC 3HOXC 4A3CC 1TWAK 1YX2A 3TFHA 5C4JK 5TMCA 3PO3K 3AD7C 2JA6K 4P9SA 3N0CA 4XSXA 4Q4ZA 4A3GC 4GTEA 1IE0A 4GTBA 1IS1A 2CFAA 3CAGA 4NOIA 3I4NC 4A3LK 4LOWA 1F7UA 5IYCK 4Y52K 1ISEA 4Q5SA 4A3GK 3S2DC 2GAGC 4QJVA 1JVIA 3IPJA 1Y1WK 2WAQD 4OIRA 3GTKC 4G7OA 4BKWA 1USMA 2V6TA 3GTKA 4A3FK 1I50K 2R93C 4G7HA 5M5WK 3M4OK 2PA8L 3G4CA 3GTMC 1IW7A 1WQGA 2R93A 4O2DA 1I6VA 3H0GK 4OIOA 4P5AA 1EFWA 4A3EK 3G4AA 2E2JK 4A3DK 1ZVUA 3CQZC 3PO2K 1DCOA 3GTPA 3I4MK 3K7AC 5TMFA 3HOZK 3S0XA 5C4XC 5M5YK 3S14K 2JA5C 2R7ZA 3EQLA 3S1QC 4BXXK 1BGWA 1HQMA 2Y3PA 3BP3A 2E2IA 3RZOC 4G0UA 1ZYRA 5M3FK 3RZDK 1GE9A 1I6HC 5IP7K 4C3IK 2FQTA 3WODA 4A3KC 4KMUA 4AYBL 3GTJC 1VRQC 4WJ3M 3FKIC 3GTPK 3NUHA 3GTJA 1WIHA 3A8JA 2B63C 1TWCK 4Y7NC 1IBAA 2CW0A 2R7ZK 3GTLA 3ERED 4LJZA 3S17K 3DXJA 4A93C 4X6AK 5IYDC 2GSOA 4XCHA 4BBRK 4YFKA 1O25A 5EGEA 4BY1C 2Y0SL 1J6XA 1EH1A 3GTQC 1TWHA 4OIQA 3GTQA 2E2HC 4LK0A 1SFOK 3LAJA 2E2HA 2NVXC 1XXAA 5D4DA 1TWAC 2Y0SD 3MMLB 3HOVK 3S1NK 5C4JC 5M3MK 3PO3C 1ZXOA 4MEXA 3S1MK 4OIPA 2JA6C 2KWAA 5IP9C 1C0AA 2JA6A 1TWFC 1TWHK 1F7VA 3S16K 4A3LC 4G0WA 3GIRA 3T02A 1EI6A 5IYCC 1XZPA 2O5IA 4Y52C 3HOYC 4C3JC 1Y1WC 1YNNA 2R92A 1J6VA 3GTGK 1Y1WA 2GAHC 1PJ5A 4A3FC 1F93A 1X31C 3AQOA 1XZQA 2NVQK 2WAQL 3M4OC 1I50A 2W7VA 3H0GC 1PJ6A 2ZFZA 2CFAB 2YU9K 4A3EC 3L4KA 1R9TA 3H0GA 4A3JK 2E2JC 4QIWD 4A3DC 3PO2C 5JFEA 1TWGA 1YNJA 2JH3A 2R92K 2JA7A 1WORA 3HOZC 1J98A 3S14C 1XXBA 3Q3QA 4BXXC 1DCHA 4KAWX 3TTGA 3GTOA 3RZDC 4C3IC 1R9TK 1J6WA 3N0BA 1I3QA 4GZYA 1BS2A 3V4GA 4XLPA 4KC6A 1TWGK 4LR2A 3GTPC 1VGXA 2JA7K 4A3MK 1ZBSA 5HL8A 1K83A 3GDZA 1TWCC 3N3YA 5L46A 5M5XK 2R7ZC 4A3CK 3QX3A 4P5BA 5C3EK 3SZZA 1TWCA 3S17C 1USOA 2E2IC 3GTOK 4X6AC 4BBRC 1I3QK 5CHPA 3A8KA 5E68A 3HOWK 1VH2A 2NVYA 2A69A 4C45A 1K83K 5C44C 1WQFA 2GSUA 3T00A 3S15C 3GTLC 4LQYA 4BY7K 1F9NA 4GTFA 3BUEA 5JVOA 2P8TA 2A68A 3M3YK 1SFOA 1G51A 1BDFA 2XCRB 3HOVC 2EBBA 3S1NC 1AB4A 3GEHA 4GTDA 1WSRA 4ZH4A 2RH6A 3S1MC 1ZQ1C 4YFNA 2A6EA 4LK1A 2NVYK 3JSTA 1TWHC 1RU0A 2JA8K 3S16C 4A3IK 1UV7A 1YCLA 1VJEA 5TJ3A 4KDDA 4WJ4A 2A6HA 4PAAA 4MEYA 1O29A 2PPBA 5FLMK 1O2BA 3GEEA 1B4BA 5IYBK 1Y1VA 3TFJA 3SZYA 1SMYA 2NVQC 3S2HK 4YFXA 3GTGA 1B4AA 5IOTA 4GTLA 4A3KK 3HKZD 4BBSK 5IOQA 3HOUK 2YU9C 4A3JC 4C3HK 2YU9A 1XZPB 2R92C 3H3VD 1KQ4A 1Y1VK 4ILDA 1WCMA 4GT9A 3OEPA 4KM9A 4QIWL 4XLNA 2VUMK 4G7ZA 3T01A 1I50C 4A3BK 2ZUFA 3AD8C 4JK1A 1R9TC 1WOPA 4KMHA 4KMAA 1TWGC 4KB2A 4XSZA 2XCQA 1HI9A 1VLOA 2JA7C 2V6SA 1WCMK 3OPFA 3I4MC 2FQOA 1IL2A 4QJVB 3ADAC 3FHZA 5C3EC 3AQPA 3GTOC 4GFQA 5IP9K 2WB1D 1I3QC 4KB4A 1TWFK 4KARA 1EK8A 5IP7C 3HOWC 4BLBA 3S1RK 1O2AA 3HOYK 1K83C 3GSIA 4WILA 4C3JK 4C2MK 4BY7C 4KASA 2NVTK 3HOXK 5FJ8K 1JQWA 3M3YC 3HXAA 1EQRA 1PJ7A
chains in the Genus database with same CATH topology
1JVIA 1YCLA 1IE0A 1JQWA 1VJEA 2FQOA 1JOEA 1J98A 2FQTA 1J6WA 4XCHA 5E68A 1J6VA 1VGXA 1INNA 1J6XA 1VH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  1YCL A;  1IE0 A;  1JQW A;  1VJE A;  2FQO A;  1JOE A;  1J98 A;  2FQT A;  1J6W A;  4XCH A;  5E68 A;  1J6V A;  1VGX A;  1INN A;  1J6X A;  1VH2 A; 
#chains in the Genus database with same CATH topology
 4J3N A;  3GTM A;  2V6U A;  3ORE A;  1O24 A;  3I4N K;  4FM9 A;  1V5V A;  2NVY C;  2BE5 A;  5CJ9 A;  2JA8 C;  4KM8 A;  4A3I C;  1WQH A;  3GEI A;  3CQZ A;  1O28 A;  1INN A;  3S2D K;  1O2F B;  1WOO A;  4KMD A;  2PA8 D;  4KN4 A;  3GTK K;  2ZUE A;  1JOE A;  5FLM C;  5IYB C;  5EGH A;  3FOF A;  1SFO C;  3A8I A;  2JA5 A;  2PMZ L;  4KN7 A;  4KAT A;  2R93 K;  3FOE A;  3GTM K;  3S2H C;  4DDQ A;  2PHC B;  2RGR A;  1BJT A;  4AH6 A;  1IQ0 A;  1WSV A;  4BBS C;  3BP8 C;  3CQZ K;  3HOU C;  3AD9 C;  3FKI A;  4C3H C;  3K7A K;  1DCP A;  2PMZ D;  3HKZ L;  5IOR A;  3VA7 A;  2B63 A;  5C4X K;  2O5J A;  2JA5 K;  4PAB A;  5IOS A;  1Y1V C;  2E2I K;  3S1Q K;  3LAP A;  3GTG C;  4AYB D;  2VUM C;  3RZO K;  3H3V L;  4GTA A;  4A3B C;  1I6H K;  3TFI A;  2VUM A;  1DD5 A;  1XXC A;  3GTJ K;  3FKI K;  4RMF A;  5C44 K;  2XCO A;  2B63 K;  1L0W A;  3S15 K;  2D6F C;  3GTL K;  1O26 A;  4Y7N K;  1WCM C;  3AH5 A;  3LPX A;  4A93 K;  2NVX A;  4GTC A;  4M1X A;  2GSN A;  5IYD K;  4YG2 A;  3L4J A;  1XPP A;  1TWA A;  1XZQ B;  4G0V A;  4BY1 K;  4BLA A;  2P5M A;  4LLG A;  4FZB A;  3GTQ K;  1TWF A;  3S1R C;  1O27 A;  2WB1 L;  2E2H K;  4MQ9 A;  4A3M C;  4OIN A;  2NVX K;  4C2M C;  1WOS A;  2NVT C;  3HOX C;  4A3C C;  1TWA K;  1YX2 A;  3TFH A;  5C4J K;  5TMC A;  3PO3 K;  3AD7 C;  2JA6 K;  4P9S A;  3N0C A;  4XSX A;  4Q4Z A;  4A3G C;  4GTE A;  1IE0 A;  4GTB A;  1IS1 A;  2CFA A;  3CAG A;  4NOI A;  3I4N C;  4A3L K;  4LOW A;  1F7U A;  5IYC K;  4Y52 K;  1ISE A;  4Q5S A;  4A3G K;  3S2D C;  2GAG C;  4QJV A;  1JVI A;  3IPJ A;  1Y1W K;  2WAQ D;  4OIR A;  3GTK C;  4G7O A;  4BKW A;  1USM A;  2V6T A;  3GTK A;  4A3F K;  1I50 K;  2R93 C;  4G7H A;  5M5W K;  3M4O K;  2PA8 L;  3G4C A;  3GTM C;  1IW7 A;  1WQG A;  2R93 A;  4O2D A;  1I6V A;  3H0G K;  4OIO A;  4P5A A;  1EFW A;  4A3E K;  3G4A A;  2E2J K;  4A3D K;  1ZVU A;  3CQZ C;  3PO2 K;  1DCO A;  3GTP A;  3I4M K;  3K7A C;  5TMF A;  3HOZ K;  3S0X A;  5C4X C;  5M5Y K;  3S14 K;  2JA5 C;  2R7Z A;  3EQL A;  3S1Q C;  4BXX K;  1BGW A;  1HQM A;  2Y3P A;  3BP3 A;  2E2I A;  3RZO C;  4G0U A;  1ZYR A;  5M3F K;  3RZD K;  1GE9 A;  1I6H C;  5IP7 K;  4C3I K;  2FQT A;  3WOD A;  4A3K C;  4KMU A;  4AYB L;  3GTJ C;  1VRQ C;  4WJ3 M;  3FKI C;  3GTP K;  3NUH A;  3GTJ A;  1WIH A;  3A8J A;  2B63 C;  1TWC K;  4Y7N C;  1IBA A;  2CW0 A;  2R7Z K;  3GTL A;  3ERE D;  4LJZ A;  3S17 K;  3DXJ A;  4A93 C;  4X6A K;  5IYD C;  2GSO A;  4XCH A;  4BBR K;  4YFK A;  1O25 A;  5EGE A;  4BY1 C;  2Y0S L;  1J6X A;  1EH1 A;  3GTQ C;  1TWH A;  4OIQ A;  3GTQ A;  2E2H C;  4LK0 A;  1SFO K;  3LAJ A;  2E2H A;  2NVX C;  1XXA A;  5D4D A;  1TWA C;  2Y0S D;  3MML B;  3HOV K;  3S1N K;  5C4J C;  5M3M K;  3PO3 C;  1ZXO A;  4MEX A;  3S1M K;  4OIP A;  2JA6 C;  2KWA A;  5IP9 C;  1C0A A;  2JA6 A;  1TWF C;  1TWH K;  1F7V A;  3S16 K;  4A3L C;  4G0W A;  3GIR A;  3T02 A;  1EI6 A;  5IYC C;  1XZP A;  2O5I A;  4Y52 C;  3HOY C;  4C3J C;  1Y1W C;  1YNN A;  2R92 A;  1J6V A;  3GTG K;  1Y1W A;  2GAH C;  1PJ5 A;  4A3F C;  1F93 A;  1X31 C;  3AQO A;  1XZQ A;  2NVQ K;  2WAQ L;  3M4O C;  1I50 A;  2W7V A;  3H0G C;  1PJ6 A;  2ZFZ A;  2CFA B;  2YU9 K;  4A3E C;  3L4K A;  1R9T A;  3H0G A;  4A3J K;  2E2J C;  4QIW D;  4A3D C;  3PO2 C;  5JFE A;  1TWG A;  1YNJ A;  2JH3 A;  2R92 K;  2JA7 A;  1WOR A;  3HOZ C;  1J98 A;  3S14 C;  1XXB A;  3Q3Q A;  4BXX C;  1DCH A;  4KAW X;  3TTG A;  3GTO A;  3RZD C;  4C3I C;  1R9T K;  1J6W A;  3N0B A;  1I3Q A;  4GZY A;  1BS2 A;  3V4G A;  4XLP A;  4KC6 A;  1TWG K;  4LR2 A;  3GTP C;  1VGX A;  2JA7 K;  4A3M K;  1ZBS A;  5HL8 A;  1K83 A;  3GDZ A;  1TWC C;  3N3Y A;  5L46 A;  5M5X K;  2R7Z C;  4A3C K;  3QX3 A;  4P5B A;  5C3E K;  3SZZ A;  1TWC A;  3S17 C;  1USO A;  2E2I C;  3GTO K;  4X6A C;  4BBR C;  1I3Q K;  5CHP A;  3A8K A;  5E68 A;  3HOW K;  1VH2 A;  2NVY A;  2A69 A;  4C45 A;  1K83 K;  5C44 C;  1WQF A;  2GSU A;  3T00 A;  3S15 C;  3GTL C;  4LQY A;  4BY7 K;  1F9N A;  4GTF A;  3BUE A;  5JVO A;  2P8T A;  2A68 A;  3M3Y K;  1SFO A;  1G51 A;  1BDF A;  2XCR B;  3HOV C;  2EBB A;  3S1N C;  1AB4 A;  3GEH A;  4GTD A;  1WSR A;  4ZH4 A;  2RH6 A;  3S1M C;  1ZQ1 C;  4YFN A;  2A6E A;  4LK1 A;  2NVY K;  3JST A;  1TWH C;  1RU0 A;  2JA8 K;  3S16 C;  4A3I K;  1UV7 A;  1YCL A;  1VJE A;  5TJ3 A;  4KDD A;  4WJ4 A;  2A6H A;  4PAA A;  4MEY A;  1O29 A;  2PPB A;  5FLM K;  1O2B A;  3GEE A;  1B4B A;  5IYB K;  1Y1V A;  3TFJ A;  3SZY A;  1SMY A;  2NVQ C;  3S2H K;  4YFX A;  3GTG A;  1B4A A;  5IOT A;  4GTL A;  4A3K K;  3HKZ D;  4BBS K;  5IOQ A;  3HOU K;  2YU9 C;  4A3J C;  4C3H K;  2YU9 A;  1XZP B;  2R92 C;  3H3V D;  1KQ4 A;  1Y1V K;  4ILD A;  1WCM A;  4GT9 A;  3OEP A;  4KM9 A;  4QIW L;  4XLN A;  2VUM K;  4G7Z A;  3T01 A;  1I50 C;  4A3B K;  2ZUF A;  3AD8 C;  4JK1 A;  1R9T C;  1WOP A;  4KMH A;  4KMA A;  1TWG C;  4KB2 A;  4XSZ A;  2XCQ A;  1HI9 A;  1VLO A;  2JA7 C;  2V6S A;  1WCM K;  3OPF A;  3I4M C;  2FQO A;  1IL2 A;  4QJV B;  3ADA C;  3FHZ A;  5C3E C;  3AQP A;  3GTO C;  4GFQ A;  5IP9 K;  2WB1 D;  1I3Q C;  4KB4 A;  1TWF K;  4KAR A;  1EK8 A;  5IP7 C;  3HOW C;  4BLB A;  3S1R K;  1O2A A;  3HOY K;  1K83 C;  3GSI A;  4WIL A;  4C3J K;  4C2M K;  4BY7 C;  4KAS A;  2NVT K;  3HOX K;  5FJ8 K;  1JQW A;  3M3Y C;  3HXA A;  1EQR A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 1JVI A;  1YCL A;  1IE0 A;  1JQW A;  1VJE A;  2FQO A;  1JOE A;  1J98 A;  2FQT A;  1J6W A;  4XCH A;  5E68 A;  1J6V A;  1VGX A;  1INN A;  1J6X A;  1VH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...