1JQWA

The 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
molecule keywords Autoinducer-2 production protein luxS
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jqwA00
1IE0A 1INNA 2FQOA 1JOEA 1J6XA 1JVIA 5E68A 2FQTA 4XCHA 1VH2A 1J6WA 1VGXA 1VJEA 1JQWA 1J6VA 1YCLA 1J98A
chains in the Genus database with same CATH superfamily
3I4MK 1XXBA 4MEXA 4XCHA 1YCLA 3HOYK 3EQLA 4MEYA 4BLBA 1TWFA 1F9NA 2VUMA 1WCMK 1VH2A 3GTJA 4KMAA 3S2HC 3G4AA 1G51A 3LAPA 2PMZD 4PABA 5IP9C 1SFOK 4A3BC 3TFIA 4A3LC 4A3KC 2R92C 3M4OK 3DXJA 2R93C 4GZYA 3GTJK 2A68A 2JA5C 2R92A 4C3IC 1K83K 2EBBA 3GTOC 4PAAA 3GTPC 5IP7C 4MQ9A 3HOZC 3VA7A 2E2JC 4LR2A 3S1NC 1WQGA 1WIHA 5IYDC 2NVXK 4C3JC 5IYCC 3L4JA 1C0AA 3GTQC 4BKWA 2A6EA 5EGHA 1O2BA 1O27A 4GTLA 1TWAK 1ZVUA 1Y1WA 1VJEA 2R93A 4KMUA 1IE0A 1EQRA 4Y7NK 4BXXC 2P5MA 4C3HC 1GE9A 3AD9C 1IBAA 1I6VA 3SZZA 5FLMK 4ILDA 1IQ0A 1IS1A 5C3EK 1ISEA 1V5VA 1I6HK 1R9TC 3CQZK 2VUMC 5IOQA 1B4AA 2NVTK 3AQPA 3TFJA 1DCPA 3A8JA 4BY1K 3BUEA 3LPXA 1WOSA 1INNA 3GTMC 1DCHA 4OINA 3GTOK 3GTLC 4Q4ZA 1R9TK 3QX3A 3AD7C 2NVXA 5M3FK 5IOSA 1Y1VC 3HOYC 4A3CC 3TTGA 3HOWK 3GTLA 3S2DK 3GTMA 1K83C 1PJ7A 1WQHA 5TMFA 4G0UA 4YG2A 1TWGC 4AH6A 1RU0A 2YU9K 5M5XK 4A3LK 2E2JK 1ZXOA 2BE5A 4AYBD 1JOEA 2CFAB 3A8IA 1TWCA 2WB1L 3N0BA 4KB2A 3S0XA 3A8KA 4ZH4A 4KMDA 5IYCK 4GTDA 3GTGA 3T02A 2R7ZA 2V6TA 1XZPB 2VUMK 3IPJA 1WOPA 5C3EC 1J6WA 2A69A 3AD8C 2XCOA 5C4JC 4A3GC 4Y7NC 4BXXK 4LLGA 2PA8L 2PA8D 2WB1D 4Q5SA 2A6HA 2R92K 3GTQK 1VLOA 3HOXK 4G0VA 4GTBA 4BY7C 3N3YA 1TWFC 2O5JA 3GTGK 3ADAC 3GTKC 4KMHA 4A3IK 3HKZL 1SMYA 4KM8A 4G7ZA 4X6AK 4A3FK 4A3DK 3FKIK 3S1NK 1PJ5A 2JA7A 2RGRA 4QIWL 2B63C 4KASA 5FLMC 4GTEA 3GTMK 2JA5A 2D6FC 3S1QC 2PPBA 3S17C 1TWHK 3AH5A 2XCRB 2GSOA 2B63K 4KM9A 1DD5A 4G7OA 2CW0A 1J98A 2JH3A 3HOVC 3MMLB 4WJ3M 1TWHC 3BP3A 4QJVA 1EH1A 1HQMA 2YU9C 1USMA 2YU9A 4Y52K 3GSIA 3CQZA 3NUHA 4LK0A 3AQOA 4AYBL 3S2DC 2E2IC 3HOUK 5D4DA 2WAQD 1IL2A 1IW7A 5IOTA 4BBRK 3S15C 2GAHC 4FZBA 1I3QC 3H0GA 4Y52C 4C2MK 4A3EC 1HI9A 4DDQA 1XZQB 3RZOK 3M4OC 4OIOA 2R93K 3FOFA 1VRQC 3FKIC 2Y0SD 2PHCB 3S1QK 3PO2K 3LAJA 2WAQL 4NOIA 5M5WK 1BDFA 2ZUEA 4OIQA 4XSZA 3GTKK 3FHZA 4A3MC 3PO3K 1J6XA 3S14K 1DCOA 5IYBC 3BP8C 4X6AC 1L0WA 4WILA 2XCQA 3S16C 3GEEA 1I50A 2E2HA 4A3KK 4BY7K 2Y0SL 3TFHA 3GEIA 3HOVK 5C4XK 1O24A 3RZDC 4A3IC 4LQYA 3H3VD 2V6SA 1PJ6A 1ZYRA 1WOOA 4A3FC 1XXAA 1XPPA 4G0WA 1TWAA 3I4NC 1WSVA 1O29A 4XSXA 1USOA 1O26A 1XZQA 3V4GA 1SFOA 4BLAA 2E2IK 3HOUC 3GTPK 3HOXC 4BBSC 3K7AC 1VGXA 2Y3PA 1JQWA 5JVOA 4KDDA 1TWFK 2JA6K 4P5AA 2GAGC 3H0GK 5IP9K 1SFOC 4A3BK 3L4KA 2NVYK 5CHPA 3PO2C 4XLNA 1O2FB 2JA6A 4C3HK 4C45A 3CAGA 4BBSK 3S14C 2R7ZK 4GT9A 3OEPA 5IYBK 2E2IA 1Y1VK 1WSRA 1TWAC 3PO3C 5IP7K 1TWCK 4A93K 2NVYC 2V6UA 4KN4A 2NVQK 3HOWC 5CJ9A 2JA8K 3FOEA 5TMCA 4KN7A 2RH6A 3OPFA 4FM9A 2E2HC 3M3YK 3GTLK 1XXCA 3HKZD 2PMZL 2NVYA 4GTAA 4OIPA 4A93C 1TWHA 1I50K 4G7HA 4OIRA 1JVIA 3S16K 5C44C 4A3CK 3S1RK 1BS2A 3Q3QA 3GIRA 5C4XC 3FKIA 1J6VA 1YX2A 4A3GK 2CFAA 3H0GC 1I3QA 5C44K 3I4NK 3CQZC 1Y1VA 4C2MC 4A3EK 3RZOC 4KAWX 4YFNA 1BJTA 1ZBSA 5M3MK 3RZDK 2FQTA 3WODA 4YFXA 2FQOA 4GTFA 1O28A 3I4MC 4KATA 5C4JK 1Y1WK 5L46A 1X31C 1R9TA 3GTPA 3GTOA 4WJ4A 3S17K 4O2DA 3G4CA 2R7ZC 3HOZK 2JA6C 3GTGC 2W7VA 2B63A 4M1XA 5HL8A 5JFEA 2JA7C 3S1RC 1UV7A 5M5YK 3S1MK 2JA8C 1BGWA 3SZYA 1WORA 3GDZA 2P8TA 4KARA 1AB4A 4XLPA 1K83A 2E2HK 3M3YC 4A3JC 5E68A 4RMFA 5TJ3A 3K7AK 3N0CA 4P9SA 3T01A 4LK1A 3H3VL 3S1MC 4A3DC 4QJVB 3GTKA 3S15K 1EK8A 4YFKA 1YNJA 1YNNA 1KQ4A 1O2AA 2NVTC 1I50C 3S2HK 4P5BA 3JSTA 4QIWD 3GEHA 4JK1A 1TWCC 1O25A 1EFWA 2NVQC 1WQFA 2JA5K 1ZQ1C 4C3IK 4A3MK 2GSNA 2O5IA 3GTJC 1TWGA 3HXAA 1F93A 2JA7K 4GFQA 4BBRC 4KC6A 5IORA 1I3QK 2ZUFA 4LOWA 2ZFZA 4KB4A 2GSUA 1B4BA 5EGEA 4GTCA 1XZPA 1F7UA 3OREA 2KWAA 1Y1WC 4J3NA 4BY1C 2NVXC 3ERED 5IYDK 1TWGK 1EI6A 1WCMC 1WCMA 4LJZA 3T00A 4C3JK 5FJ8K 1F7VA 3GTQA 4A3JK 1I6HC
chains in the Genus database with same CATH topology
1IE0A 1INNA 2FQOA 1JOEA 1J6XA 1JVIA 5E68A 2FQTA 4XCHA 1VH2A 1J6WA 1VGXA 1VJEA 1JQWA 1J6VA 1YCLA 1J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IE0 A;  1INN A;  2FQO A;  1JOE A;  1J6X A;  1JVI A;  5E68 A;  2FQT A;  4XCH A;  1VH2 A;  1J6W A;  1VGX A;  1VJE A;  1JQW A;  1J6V A;  1YCL A;  1J98 A; 
#chains in the Genus database with same CATH topology
 3I4M K;  1XXB A;  4MEX A;  4XCH A;  1YCL A;  3HOY K;  3EQL A;  4MEY A;  4BLB A;  1TWF A;  1F9N A;  2VUM A;  1WCM K;  1VH2 A;  3GTJ A;  4KMA A;  3S2H C;  3G4A A;  1G51 A;  3LAP A;  2PMZ D;  4PAB A;  5IP9 C;  1SFO K;  4A3B C;  3TFI A;  4A3L C;  4A3K C;  2R92 C;  3M4O K;  3DXJ A;  2R93 C;  4GZY A;  3GTJ K;  2A68 A;  2JA5 C;  2R92 A;  4C3I C;  1K83 K;  2EBB A;  3GTO C;  4PAA A;  3GTP C;  5IP7 C;  4MQ9 A;  3HOZ C;  3VA7 A;  2E2J C;  4LR2 A;  3S1N C;  1WQG A;  1WIH A;  5IYD C;  2NVX K;  4C3J C;  5IYC C;  3L4J A;  1C0A A;  3GTQ C;  4BKW A;  2A6E A;  5EGH A;  1O2B A;  1O27 A;  4GTL A;  1TWA K;  1ZVU A;  1Y1W A;  1VJE A;  2R93 A;  4KMU A;  1IE0 A;  1EQR A;  4Y7N K;  4BXX C;  2P5M A;  4C3H C;  1GE9 A;  3AD9 C;  1IBA A;  1I6V A;  3SZZ A;  5FLM K;  4ILD A;  1IQ0 A;  1IS1 A;  5C3E K;  1ISE A;  1V5V A;  1I6H K;  1R9T C;  3CQZ K;  2VUM C;  5IOQ A;  1B4A A;  2NVT K;  3AQP A;  3TFJ A;  1DCP A;  3A8J A;  4BY1 K;  3BUE A;  3LPX A;  1WOS A;  1INN A;  3GTM C;  1DCH A;  4OIN A;  3GTO K;  3GTL C;  4Q4Z A;  1R9T K;  3QX3 A;  3AD7 C;  2NVX A;  5M3F K;  5IOS A;  1Y1V C;  3HOY C;  4A3C C;  3TTG A;  3HOW K;  3GTL A;  3S2D K;  3GTM A;  1K83 C;  1PJ7 A;  1WQH A;  5TMF A;  4G0U A;  4YG2 A;  1TWG C;  4AH6 A;  1RU0 A;  2YU9 K;  5M5X K;  4A3L K;  2E2J K;  1ZXO A;  2BE5 A;  4AYB D;  1JOE A;  2CFA B;  3A8I A;  1TWC A;  2WB1 L;  3N0B A;  4KB2 A;  3S0X A;  3A8K A;  4ZH4 A;  4KMD A;  5IYC K;  4GTD A;  3GTG A;  3T02 A;  2R7Z A;  2V6T A;  1XZP B;  2VUM K;  3IPJ A;  1WOP A;  5C3E C;  1J6W A;  2A69 A;  3AD8 C;  2XCO A;  5C4J C;  4A3G C;  4Y7N C;  4BXX K;  4LLG A;  2PA8 L;  2PA8 D;  2WB1 D;  4Q5S A;  2A6H A;  2R92 K;  3GTQ K;  1VLO A;  3HOX K;  4G0V A;  4GTB A;  4BY7 C;  3N3Y A;  1TWF C;  2O5J A;  3GTG K;  3ADA C;  3GTK C;  4KMH A;  4A3I K;  3HKZ L;  1SMY A;  4KM8 A;  4G7Z A;  4X6A K;  4A3F K;  4A3D K;  3FKI K;  3S1N K;  1PJ5 A;  2JA7 A;  2RGR A;  4QIW L;  2B63 C;  4KAS A;  5FLM C;  4GTE A;  3GTM K;  2JA5 A;  2D6F C;  3S1Q C;  2PPB A;  3S17 C;  1TWH K;  3AH5 A;  2XCR B;  2GSO A;  2B63 K;  4KM9 A;  1DD5 A;  4G7O A;  2CW0 A;  1J98 A;  2JH3 A;  3HOV C;  3MML B;  4WJ3 M;  1TWH C;  3BP3 A;  4QJV A;  1EH1 A;  1HQM A;  2YU9 C;  1USM A;  2YU9 A;  4Y52 K;  3GSI A;  3CQZ A;  3NUH A;  4LK0 A;  3AQO A;  4AYB L;  3S2D C;  2E2I C;  3HOU K;  5D4D A;  2WAQ D;  1IL2 A;  1IW7 A;  5IOT A;  4BBR K;  3S15 C;  2GAH C;  4FZB A;  1I3Q C;  3H0G A;  4Y52 C;  4C2M K;  4A3E C;  1HI9 A;  4DDQ A;  1XZQ B;  3RZO K;  3M4O C;  4OIO A;  2R93 K;  3FOF A;  1VRQ C;  3FKI C;  2Y0S D;  2PHC B;  3S1Q K;  3PO2 K;  3LAJ A;  2WAQ L;  4NOI A;  5M5W K;  1BDF A;  2ZUE A;  4OIQ A;  4XSZ A;  3GTK K;  3FHZ A;  4A3M C;  3PO3 K;  1J6X A;  3S14 K;  1DCO A;  5IYB C;  3BP8 C;  4X6A C;  1L0W A;  4WIL A;  2XCQ A;  3S16 C;  3GEE A;  1I50 A;  2E2H A;  4A3K K;  4BY7 K;  2Y0S L;  3TFH A;  3GEI A;  3HOV K;  5C4X K;  1O24 A;  3RZD C;  4A3I C;  4LQY A;  3H3V D;  2V6S A;  1PJ6 A;  1ZYR A;  1WOO A;  4A3F C;  1XXA A;  1XPP A;  4G0W A;  1TWA A;  3I4N C;  1WSV A;  1O29 A;  4XSX A;  1USO A;  1O26 A;  1XZQ A;  3V4G A;  1SFO A;  4BLA A;  2E2I K;  3HOU C;  3GTP K;  3HOX C;  4BBS C;  3K7A C;  1VGX A;  2Y3P A;  1JQW A;  5JVO A;  4KDD A;  1TWF K;  2JA6 K;  4P5A A;  2GAG C;  3H0G K;  5IP9 K;  1SFO C;  4A3B K;  3L4K A;  2NVY K;  5CHP A;  3PO2 C;  4XLN A;  1O2F B;  2JA6 A;  4C3H K;  4C45 A;  3CAG A;  4BBS K;  3S14 C;  2R7Z K;  4GT9 A;  3OEP A;  5IYB K;  2E2I A;  1Y1V K;  1WSR A;  1TWA C;  3PO3 C;  5IP7 K;  1TWC K;  4A93 K;  2NVY C;  2V6U A;  4KN4 A;  2NVQ K;  3HOW C;  5CJ9 A;  2JA8 K;  3FOE A;  5TMC A;  4KN7 A;  2RH6 A;  3OPF A;  4FM9 A;  2E2H C;  3M3Y K;  3GTL K;  1XXC A;  3HKZ D;  2PMZ L;  2NVY A;  4GTA A;  4OIP A;  4A93 C;  1TWH A;  1I50 K;  4G7H A;  4OIR A;  1JVI A;  3S16 K;  5C44 C;  4A3C K;  3S1R K;  1BS2 A;  3Q3Q A;  3GIR A;  5C4X C;  3FKI A;  1J6V A;  1YX2 A;  4A3G K;  2CFA A;  3H0G C;  1I3Q A;  5C44 K;  3I4N K;  3CQZ C;  1Y1V A;  4C2M C;  4A3E K;  3RZO C;  4KAW X;  4YFN A;  1BJT A;  1ZBS A;  5M3M K;  3RZD K;  2FQT A;  3WOD A;  4YFX A;  2FQO A;  4GTF A;  1O28 A;  3I4M C;  4KAT A;  5C4J K;  1Y1W K;  5L46 A;  1X31 C;  1R9T A;  3GTP A;  3GTO A;  4WJ4 A;  3S17 K;  4O2D A;  3G4C A;  2R7Z C;  3HOZ K;  2JA6 C;  3GTG C;  2W7V A;  2B63 A;  4M1X A;  5HL8 A;  5JFE A;  2JA7 C;  3S1R C;  1UV7 A;  5M5Y K;  3S1M K;  2JA8 C;  1BGW A;  3SZY A;  1WOR A;  3GDZ A;  2P8T A;  4KAR A;  1AB4 A;  4XLP A;  1K83 A;  2E2H K;  3M3Y C;  4A3J C;  5E68 A;  4RMF A;  5TJ3 A;  3K7A K;  3N0C A;  4P9S A;  3T01 A;  4LK1 A;  3H3V L;  3S1M C;  4A3D C;  4QJV B;  3GTK A;  3S15 K;  1EK8 A;  4YFK A;  1YNJ A;  1YNN A;  1KQ4 A;  1O2A A;  2NVT C;  1I50 C;  3S2H K;  4P5B A;  3JST A;  4QIW D;  3GEH A;  4JK1 A;  1TWC C;  1O25 A;  1EFW A;  2NVQ C;  1WQF A;  2JA5 K;  1ZQ1 C;  4C3I K;  4A3M K;  2GSN A;  2O5I A;  3GTJ C;  1TWG A;  3HXA A;  1F93 A;  2JA7 K;  4GFQ A;  4BBR C;  4KC6 A;  5IOR A;  1I3Q K;  2ZUF A;  4LOW A;  2ZFZ A;  4KB4 A;  2GSU A;  1B4B A;  5EGE A;  4GTC A;  1XZP A;  1F7U A;  3ORE A;  2KWA A;  1Y1W C;  4J3N A;  4BY1 C;  2NVX C;  3ERE D;  5IYD K;  1TWG K;  1EI6 A;  1WCM C;  1WCM A;  4LJZ A;  3T00 A;  4C3J K;  5FJ8 K;  1F7V A;  3GTQ A;  4A3J K;  1I6H C; 
#chains in the Genus database with same CATH homology
 1IE0 A;  1INN A;  2FQO A;  1JOE A;  1J6X A;  1JVI A;  5E68 A;  2FQT A;  4XCH A;  1VH2 A;  1J6W A;  1VGX A;  1VJE A;  1JQW A;  1J6V A;  1YCL A;  1J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...