3RZDK

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzdK00
3GTJC 1TWGK 1HQMA 2JA7K 3H3VD 4X6AC 3H0GK 4A3IC 3HOVC 2WAQD 4C3HK 3S17K 4A3CC 2O5JA 2NVYK 4NOIA 5IP7K 3GTMC 4A3DC 1SFOK 5FJ8K 4A3LK 4Y52C 3S1MK 2R92C 4A3KK 5C3EK 5FLMC 3S1QC 4A3MC 2CW0A 1TWAK 2Y0SD 3FKIK 3CQZK 3DXJA 4MEXA 4A3BC 2E2HC 2A69A 2E2IK 4GZYA 4C3IK 1I6HC 3S14C 3HOXC 4G7OA 3RZDK 3K7AC 5IYBC 3I4MC 1Y1WC 4BBRC 2JA5C 3GTJK 5IYCC 3S15C 3HOZC 3HOWC 4A3IK 4A3EC 3HOVK 2NVTC 4XLPA 4A3CK 5IYDC 3HOYC 5C44C 3GTMK 5M5WK 2PA8L 4YFKA 2YU9C 4A3DK 4Y52K 3EQLA 2R92K 1Y1VC 4OIPA 2B63C 2R7ZC 5FLMK 2PPBA 3S1QK 4Q5SA 4A3MK 1YNJA 4JK1A 3S16C 3GTPC 5M3FK 2JA8C 1TWHC 4AYBD 1K83C 2E2HK 3GTQC 3HOUC 4A3BK 5M5YK 3I4NC 4OIOA 4BY7C 2NVQC 4YFNA 4OIQA 3S14K 3PO3C 1I6HK 3HOXK 4C3JK 3K7AK 5IYBK 3I4MK 1TWFC 4BBRK 1Y1WK 2JA6C 4A3JC 2JA5K 5IYCK 3S15K 3HOZK 5D4DA 3HOWK 3M3YC 5C4XC 2PMZL 4XLNA 3GTLC 2A68A 4A3EK 2NVTK 3S2HC 3WODA 5IYDK 1I3QC 3HOYK 4MEYA 1I50C 4XSZA 5C44K 4BY1C 4X6AK 2YU9K 3GTKC 2E2JC 2PA8D 1XPPA 1Y1VK 4KMUA 1WCMC 2NVXC 2B63K 2R7ZK 1SMYA 1R9TC 3S16K 3GTPK 3HOUK 2JA8K 1TWHK 3GTQK 1K83K 4KN7A 4LLGA 4QIWL 3S1RC 4BY7K 1YNNA 1BDFA 3I4NK 1TWCC 5TMCA 4G7ZA 2NVQK 4OINA 3S1NC 3PO3K 2R93C 4BBSC 2A6EA 5M5XK 4A3FC 4G7HA 1TWFK 2JA6K 4BXXC 4QJVB 4A3JK 4LK1A 2WB1L 4Y7NC 2VUMC 3M3YK 5C4XK 3GTOC 3HKZL 3GTLK 2PMZD 3S2HK 3RZOC 1IW7A 1I3QK 4YG2A 5IP9C 1I50K 4BY1K 4A93C 4C2MK 3GTKK 2E2JK 3GTGC 3M4OC 5C4JC 3S2DC 4A3GC 3PO2C 1WCMK 2NVXK 3H3VL 1TWGC 2JA7C 1R9TK 2A6HA 3H0GC 2WAQL 4YFXA 3S1RK 3S17C 1TWCK 4QIWD 2O5IA 3S1NK 2NVYC 5IP7C 1SFOC 4ZH4A 4MQ9A 4BBSK 3S1MC 4A3LC 4AYBL 4A3FK 2R93K 4BXXK 4LK0A 4OIRA 5TMFA 4A3KC 5C3EC 4KN4A 5M3MK 2Y0SL 2WB1D 3FKIC 1TWAC 2BE5A 4Y7NK 3CQZC 2VUMK 3GTOK 2E2IC 3HKZD 3RZOK 4Q4ZA 5IP9K 4XSXA 4A93K 4QJVA 3RZDC 1I6VA 1ZYRA 3GTGK 5C4JK 3M4OK 3S2DK 4A3GK 3PO2K 4LJZA
chains in the Genus database with same CATH superfamily
3GTJC 3GTKA 2WAQD 2O5JA 4NOIA 3LAJA 5FJ8K 2R92C 1TWCA 1IE0A 1IL2A 1J6WA 3CQZK 2E2HC 2JH3A 2GSUA 4PABA 4KMAA 3HOXC 5IYBC 2JA5C 3GTJK 1XZQB 3GDZA 4XLPA 5IYDC 3T02A 3HOYC 3LAPA 3EQLA 2R92K 1Y1VC 4G0UA 5TJ3A 2NVYA 3AD8C 2PPBA 1SFOA 1J6VA 1YNJA 1EI6A 2FQOA 4JK1A 3GTPC 3HOUC 4AYBD 2E2HK 5M5YK 2NVQC 3FKIA 3HOXK 4KARA 3G4CA 5IYBK 1TWFC 1IBAA 4A3JC 2JA5K 3CAGA 3ERED 5C4XC 3AD9C 4KDDA 3S2HC 5IYDK 3HOYK 4MEYA 4DDQA 4BY1C 4WJ3M 3GTKC 2PA8D 3GIRA 1Y1VK 4KMUA 4GTLA 2B63A 4C3HC 1USMA 1L0WA 3GTPK 3HOUK 4XCHA 3A8IA 1TWCC 2NVQK 3S1NC 4OINA 1X31C 1TWFK 2W7VA 3SZZA 4A3JK 4LK1A 1F9NA 1XZPA 3N0CA 3FHZA 1WIHA 5C4XK 4G0VA 2PMZD 3S2HK 2V6TA 4P5BA 5IP9C 2ZUFA 4BY1K 4ILDA 3GTKK 2ZUEA 3A8KA 1WCMA 1TWGC 2RH6A 3AH5A 3TFJA 2YU9A 2WAQL 4YFXA 3S17C 2R7ZA 1TWCK 4QIWD 3S1NK 2NVYC 1DCOA 1SFOC 4ZH4A 4A3LC 4KC6A 3BP8C 3TFIA 4P9SA 5C3EC 5EGHA 3L4KA 2WB1D 3FKIC 3FOEA 2CFAA 5IP9K 1HI9A 4XSXA 4QJVA 3RZDC 3GTLA 1ZYRA 1I3QA 2D6FC 1ISEA 1TWGK 1HQMA 5IORA 4PAAA 4X6AC 4A3IC 1VLOA 1O29A 3BP3A 4KM8A 3S17K 2NVYK 1RU0A 1SFOK 4GTAA 4A3LK 4Y52C 5C3EK 3S1QC 5JFEA 4A3MC 2R93A 2CW0A 3FKIK 3DXJA 1WOPA 2VUMA 1F7UA 4GTEA 4C3JC 3RZDK 1B4BA 1PJ6A 1O2AA 3HOZC 4G0WA 4A3IK 4GTDA 2PA8L 4YFKA 2YU9C 4Y52K 4GT9A 1O25A 3HXAA 5CHPA 2GAHC 2R7ZC 3S1QK 4A3MK 2JA8C 1TWHC 1DCHA 4OIQA 1TWAA 4C3JK 1EH1A 4J3NA 1BJTA 1EFWA 3HOZK 2PMZL 3GTLC 1WOOA 1I3QC 1VRQC 1DCPA 1J98A 5E68A 2YU9K 1ZQ1C 3OREA 4BLAA 2FQTA 2R7ZK 4C45A 2JA8K 1TWHK 4QIWL 4FZBA 1K83A 1BDFA 1XXCA 3JSTA 1EQRA 2R93C 1J6XA 4BBSC 4QJVB 2WB1L 3N0BA 4Y7NC 2VUMC 1Y1WA 3GTOC 1F7VA 3GTLK 1O24A 1IW7A 1I3QK 1ZBSA 3S2DC 3PO2C 4FM9A 3TFHA 5IOTA 2O5IA 3LPXA 1V5VA 2R93K 4BBSK 3S1MC 5TMFA 4A3KC 4KN4A 5M3MK 3ADAC 4Y7NK 1TWAC 2VUMK 5IOQA 3GTOK 2JA6A 3SZYA 4KMHA 5L46A 3S2DK 3PO2K 4LJZA 1BGWA 1WQGA 4BKWA 3H3VD 3HOVC 2NVXA 4C3HK 4A3CC 2EBBA 4AH6A 3S1MK 3GEEA 4A3KK 5FLMC 1B4AA 3T00A 1TWAK 4A3BC 1DD5A 2A69A 4GTFA 3S14C 2GSNA 4G7OA 1O2FB 5IOSA 1Y1WC 4BBRC 4GFQA 3QX3A 4LOWA 3S15C 1ZXOA 3HOWC 3GTGA 4KAWX 4A3EC 3HOVK 4A3CK 2JA7A 3FOFA 3T01A 1JOEA 1XZQA 3H0GA 2XCQA 4OIPA 1G51A 2B63C 4Q5SA 5FLMK 2RGRA 5EGEA 3S16C 4A3BK 5M3FK 4GTCA 4BY7C 4OIOA 2ZFZA 1INNA 3S14K 4BLBA 5HL8A 3PO3C 3GSIA 2E2IA 1Y1WK 4BBRK 2JA6C 3OPFA 3S15K 1WSVA 3HOWK 1AB4A 3N3YA 3M3YC 4XLNA 3NUHA 1YCLA 2A68A 1XXBA 4A3EK 3WODA 4X6AK 2E2JC 1XPPA 3GEIA 1Y1VA 1WCMC 2NVXC 2B63K 3GTMA 1SMYA 3IPJA 3S16K 4M1XA 4BY7K 3S1RC 1YNNA 5TMCA 3PO3K 1USOA 4KB2A 1XZPB 2A6EA 5M5XK 1JQWA 4G7HA 2JA6K 1TWFA 4RMFA 1O26A 3M3YK 1VJEA 1C0AA 4A93C 2GSOA 1YX2A 2E2JK 3GTGC 3M4OC 1IS1A 1WCMK 2NVXK 3H3VL 3A8JA 4WILA 2XCRB 2JA7C 2A6HA 3H0GC 3L4JA 3S1RK 1JVIA 5IP7C 3GTQA 4MQ9A 4LK0A 4LQYA 4OIRA 2CFAB 2BE5A 2E2IC 3HKZD 4Q4ZA 4C3IC 4A93K 4O2DA 1I6VA 3GTGK 3M4OK 1I50A 1TWGA 2JA7K 3H0GK 1O28A 2Y3PA 5CJ9A 1R9TA 3GTMC 5IP7K 2GAGC 4A3DC 1KQ4A 1F93A 1XXAA 3AQOA 4KM9A 2Y0SD 4MEXA 2E2IK 1IQ0A 4GZYA 2V6UA 4C3IK 1I6HC 1BS2A 3K7AC 3I4MC 2V6SA 5IYCC 4LR2A 2NVTC 1EK8A 2P8TA 4KATA 5C44C 3GTMK 5M5WK 4A3DK 3GTQC 1K83C 3MMLB 3I4NC 1WQHA 4YFNA 1I6HK 3CQZA 1VGXA 3K7AK 3I4MK 3V4GA 1PJ5A 5IYCK 3GEHA 5D4DA 3AD7C 1ZVUA 2NVTK 2PHCB 3GTJA 4XSZA 1I50C 5C44K 4C2MC 2P5MA 3VA7A 2KWAA 1VH2A 1O2BA 3AQPA 4GTBA 1R9TC 1WSRA 3GTQK 2R92A 1PJ7A 1K83K 1TWHA 4KN7A 4LLGA 3Q3QA 3TTGA 3I4NK 4G7ZA 2E2HA 4A3FC 3OEPA 4BXXC 3BUEA 1WOSA 1GE9A 3HKZL 2JA5A 3RZOC 3S0XA 4YG2A 1I50K 4C2MK 4KB4A 1WORA 5C4JC 4A3GC 3G4AA 1R9TK 4P5AA 4KMDA 3GTPA 4AYBL 4A3FK 2XCOA 4BXXK 2Y0SL 3CQZC 3GTOA 5JVOA 3RZOK 4WJ4A 4KASA 1UV7A 1O27A 5C4JK 1WQFA 4A3GK
chains in the Genus database with same CATH topology
3GTJC 1TWGK 1HQMA 2JA7K 3H3VD 4X6AC 3H0GK 4A3IC 3HOVC 2WAQD 4C3HK 3S17K 4A3CC 2O5JA 2NVYK 4NOIA 5IP7K 3GTMC 4A3DC 1SFOK 5FJ8K 4A3LK 4Y52C 3S1MK 2R92C 4A3KK 5C3EK 5FLMC 3S1QC 4A3MC 2CW0A 1TWAK 2Y0SD 3FKIK 3CQZK 3DXJA 4MEXA 4A3BC 2E2HC 2A69A 2E2IK 4GZYA 4C3IK 1I6HC 3S14C 3HOXC 4G7OA 3RZDK 3K7AC 5IYBC 3I4MC 1Y1WC 4BBRC 2JA5C 3GTJK 5IYCC 3S15C 3HOZC 3HOWC 4A3IK 4A3EC 3HOVK 2NVTC 4XLPA 4A3CK 5IYDC 3HOYC 5C44C 3GTMK 5M5WK 2PA8L 4YFKA 2YU9C 4A3DK 4Y52K 3EQLA 2R92K 1Y1VC 4OIPA 2B63C 2R7ZC 5FLMK 2PPBA 3S1QK 4Q5SA 4A3MK 1YNJA 4JK1A 3S16C 3GTPC 5M3FK 2JA8C 1TWHC 4AYBD 1K83C 2E2HK 3GTQC 3HOUC 4A3BK 5M5YK 3I4NC 4OIOA 4BY7C 2NVQC 4YFNA 4OIQA 3S14K 3PO3C 1I6HK 3HOXK 4C3JK 3K7AK 5IYBK 3I4MK 1TWFC 4BBRK 1Y1WK 2JA6C 4A3JC 2JA5K 5IYCK 3S15K 3HOZK 5D4DA 3HOWK 3M3YC 5C4XC 2PMZL 4XLNA 3GTLC 2A68A 4A3EK 2NVTK 3S2HC 3WODA 5IYDK 1I3QC 3HOYK 4MEYA 1I50C 4XSZA 5C44K 4BY1C 4X6AK 2YU9K 3GTKC 2E2JC 2PA8D 1XPPA 1Y1VK 4KMUA 1WCMC 2NVXC 2B63K 2R7ZK 1SMYA 1R9TC 3S16K 3GTPK 3HOUK 2JA8K 1TWHK 3GTQK 1K83K 4KN7A 4LLGA 4QIWL 3S1RC 4BY7K 1YNNA 1BDFA 3I4NK 1TWCC 5TMCA 4G7ZA 2NVQK 4OINA 3S1NC 3PO3K 2R93C 4BBSC 2A6EA 5M5XK 4A3FC 4G7HA 1TWFK 2JA6K 4BXXC 4QJVB 4A3JK 4LK1A 2WB1L 4Y7NC 2VUMC 3M3YK 5C4XK 3GTOC 3HKZL 3GTLK 2PMZD 3S2HK 3RZOC 1IW7A 1I3QK 4YG2A 5IP9C 1I50K 4BY1K 4A93C 4C2MK 3GTKK 2E2JK 3GTGC 3M4OC 5C4JC 3S2DC 4A3GC 3PO2C 1WCMK 2NVXK 3H3VL 1TWGC 2JA7C 1R9TK 2A6HA 3H0GC 2WAQL 4YFXA 3S1RK 3S17C 1TWCK 4QIWD 2O5IA 3S1NK 2NVYC 5IP7C 1SFOC 4ZH4A 4MQ9A 4BBSK 3S1MC 4A3LC 4AYBL 4A3FK 2R93K 4BXXK 4LK0A 4OIRA 5TMFA 4A3KC 5C3EC 4KN4A 5M3MK 2Y0SL 2WB1D 3FKIC 1TWAC 2BE5A 4Y7NK 3CQZC 2VUMK 3GTOK 2E2IC 3HKZD 3RZOK 4Q4ZA 5IP9K 4XSXA 4A93K 4QJVA 3RZDC 1I6VA 1ZYRA 3GTGK 5C4JK 3M4OK 3S2DK 4A3GK 3PO2K 4LJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ C;  1TWG K;  1HQM A;  2JA7 K;  3H3V D;  4X6A C;  3H0G K;  4A3I C;  3HOV C;  2WAQ D;  4C3H K;  3S17 K;  4A3C C;  2O5J A;  2NVY K;  4NOI A;  5IP7 K;  3GTM C;  4A3D C;  1SFO K;  5FJ8 K;  4A3L K;  4Y52 C;  3S1M K;  2R92 C;  4A3K K;  5C3E K;  5FLM C;  3S1Q C;  4A3M C;  2CW0 A;  1TWA K;  2Y0S D;  3FKI K;  3CQZ K;  3DXJ A;  4MEX A;  4A3B C;  2E2H C;  2A69 A;  2E2I K;  4GZY A;  4C3I K;  1I6H C;  3S14 C;  3HOX C;  4G7O A;  3RZD K;  3K7A C;  5IYB C;  3I4M C;  1Y1W C;  4BBR C;  2JA5 C;  3GTJ K;  5IYC C;  3S15 C;  3HOZ C;  3HOW C;  4A3I K;  4A3E C;  3HOV K;  2NVT C;  4XLP A;  4A3C K;  5IYD C;  3HOY C;  5C44 C;  3GTM K;  5M5W K;  2PA8 L;  4YFK A;  2YU9 C;  4A3D K;  4Y52 K;  3EQL A;  2R92 K;  1Y1V C;  4OIP A;  2B63 C;  2R7Z C;  5FLM K;  2PPB A;  3S1Q K;  4Q5S A;  4A3M K;  1YNJ A;  4JK1 A;  3S16 C;  3GTP C;  5M3F K;  2JA8 C;  1TWH C;  4AYB D;  1K83 C;  2E2H K;  3GTQ C;  3HOU C;  4A3B K;  5M5Y K;  3I4N C;  4OIO A;  4BY7 C;  2NVQ C;  4YFN A;  4OIQ A;  3S14 K;  3PO3 C;  1I6H K;  3HOX K;  4C3J K;  3K7A K;  5IYB K;  3I4M K;  1TWF C;  4BBR K;  1Y1W K;  2JA6 C;  4A3J C;  2JA5 K;  5IYC K;  3S15 K;  3HOZ K;  5D4D A;  3HOW K;  3M3Y C;  5C4X C;  2PMZ L;  4XLN A;  3GTL C;  2A68 A;  4A3E K;  2NVT K;  3S2H C;  3WOD A;  5IYD K;  1I3Q C;  3HOY K;  4MEY A;  1I50 C;  4XSZ A;  5C44 K;  4BY1 C;  4X6A K;  2YU9 K;  3GTK C;  2E2J C;  2PA8 D;  1XPP A;  1Y1V K;  4KMU A;  1WCM C;  2NVX C;  2B63 K;  2R7Z K;  1SMY A;  1R9T C;  3S16 K;  3GTP K;  3HOU K;  2JA8 K;  1TWH K;  3GTQ K;  1K83 K;  4KN7 A;  4LLG A;  4QIW L;  3S1R C;  4BY7 K;  1YNN A;  1BDF A;  3I4N K;  1TWC C;  5TMC A;  4G7Z A;  2NVQ K;  4OIN A;  3S1N C;  3PO3 K;  2R93 C;  4BBS C;  2A6E A;  5M5X K;  4A3F C;  4G7H A;  1TWF K;  2JA6 K;  4BXX C;  4QJV B;  4A3J K;  4LK1 A;  2WB1 L;  4Y7N C;  2VUM C;  3M3Y K;  5C4X K;  3GTO C;  3HKZ L;  3GTL K;  2PMZ D;  3S2H K;  3RZO C;  1IW7 A;  1I3Q K;  4YG2 A;  5IP9 C;  1I50 K;  4BY1 K;  4A93 C;  4C2M K;  3GTK K;  2E2J K;  3GTG C;  3M4O C;  5C4J C;  3S2D C;  4A3G C;  3PO2 C;  1WCM K;  2NVX K;  3H3V L;  1TWG C;  2JA7 C;  1R9T K;  2A6H A;  3H0G C;  2WAQ L;  4YFX A;  3S1R K;  3S17 C;  1TWC K;  4QIW D;  2O5I A;  3S1N K;  2NVY C;  5IP7 C;  1SFO C;  4ZH4 A;  4MQ9 A;  4BBS K;  3S1M C;  4A3L C;  4AYB L;  4A3F K;  2R93 K;  4BXX K;  4LK0 A;  4OIR A;  5TMF A;  4A3K C;  5C3E C;  4KN4 A;  5M3M K;  2Y0S L;  2WB1 D;  3FKI C;  1TWA C;  2BE5 A;  4Y7N K;  3CQZ C;  2VUM K;  3GTO K;  2E2I C;  3HKZ D;  3RZO K;  4Q4Z A;  5IP9 K;  4XSX A;  4A93 K;  4QJV A;  3RZD C;  1I6V A;  1ZYR A;  3GTG K;  5C4J K;  3M4O K;  3S2D K;  4A3G K;  3PO2 K;  4LJZ A; 
#chains in the Genus database with same CATH topology
 3GTJ C;  3GTK A;  2WAQ D;  2O5J A;  4NOI A;  3LAJ A;  5FJ8 K;  2R92 C;  1TWC A;  1IE0 A;  1IL2 A;  1J6W A;  3CQZ K;  2E2H C;  2JH3 A;  2GSU A;  4PAB A;  4KMA A;  3HOX C;  5IYB C;  2JA5 C;  3GTJ K;  1XZQ B;  3GDZ A;  4XLP A;  5IYD C;  3T02 A;  3HOY C;  3LAP A;  3EQL A;  2R92 K;  1Y1V C;  4G0U A;  5TJ3 A;  2NVY A;  3AD8 C;  2PPB A;  1SFO A;  1J6V A;  1YNJ A;  1EI6 A;  2FQO A;  4JK1 A;  3GTP C;  3HOU C;  4AYB D;  2E2H K;  5M5Y K;  2NVQ C;  3FKI A;  3HOX K;  4KAR A;  3G4C A;  5IYB K;  1TWF C;  1IBA A;  4A3J C;  2JA5 K;  3CAG A;  3ERE D;  5C4X C;  3AD9 C;  4KDD A;  3S2H C;  5IYD K;  3HOY K;  4MEY A;  4DDQ A;  4BY1 C;  4WJ3 M;  3GTK C;  2PA8 D;  3GIR A;  1Y1V K;  4KMU A;  4GTL A;  2B63 A;  4C3H C;  1USM A;  1L0W A;  3GTP K;  3HOU K;  4XCH A;  3A8I A;  1TWC C;  2NVQ K;  3S1N C;  4OIN A;  1X31 C;  1TWF K;  2W7V A;  3SZZ A;  4A3J K;  4LK1 A;  1F9N A;  1XZP A;  3N0C A;  3FHZ A;  1WIH A;  5C4X K;  4G0V A;  2PMZ D;  3S2H K;  2V6T A;  4P5B A;  5IP9 C;  2ZUF A;  4BY1 K;  4ILD A;  3GTK K;  2ZUE A;  3A8K A;  1WCM A;  1TWG C;  2RH6 A;  3AH5 A;  3TFJ A;  2YU9 A;  2WAQ L;  4YFX A;  3S17 C;  2R7Z A;  1TWC K;  4QIW D;  3S1N K;  2NVY C;  1DCO A;  1SFO C;  4ZH4 A;  4A3L C;  4KC6 A;  3BP8 C;  3TFI A;  4P9S A;  5C3E C;  5EGH A;  3L4K A;  2WB1 D;  3FKI C;  3FOE A;  2CFA A;  5IP9 K;  1HI9 A;  4XSX A;  4QJV A;  3RZD C;  3GTL A;  1ZYR A;  1I3Q A;  2D6F C;  1ISE A;  1TWG K;  1HQM A;  5IOR A;  4PAA A;  4X6A C;  4A3I C;  1VLO A;  1O29 A;  3BP3 A;  4KM8 A;  3S17 K;  2NVY K;  1RU0 A;  1SFO K;  4GTA A;  4A3L K;  4Y52 C;  5C3E K;  3S1Q C;  5JFE A;  4A3M C;  2R93 A;  2CW0 A;  3FKI K;  3DXJ A;  1WOP A;  2VUM A;  1F7U A;  4GTE A;  4C3J C;  3RZD K;  1B4B A;  1PJ6 A;  1O2A A;  3HOZ C;  4G0W A;  4A3I K;  4GTD A;  2PA8 L;  4YFK A;  2YU9 C;  4Y52 K;  4GT9 A;  1O25 A;  3HXA A;  5CHP A;  2GAH C;  2R7Z C;  3S1Q K;  4A3M K;  2JA8 C;  1TWH C;  1DCH A;  4OIQ A;  1TWA A;  4C3J K;  1EH1 A;  4J3N A;  1BJT A;  1EFW A;  3HOZ K;  2PMZ L;  3GTL C;  1WOO A;  1I3Q C;  1VRQ C;  1DCP A;  1J98 A;  5E68 A;  2YU9 K;  1ZQ1 C;  3ORE A;  4BLA A;  2FQT A;  2R7Z K;  4C45 A;  2JA8 K;  1TWH K;  4QIW L;  4FZB A;  1K83 A;  1BDF A;  1XXC A;  3JST A;  1EQR A;  2R93 C;  1J6X A;  4BBS C;  4QJV B;  2WB1 L;  3N0B A;  4Y7N C;  2VUM C;  1Y1W A;  3GTO C;  1F7V A;  3GTL K;  1O24 A;  1IW7 A;  1I3Q K;  1ZBS A;  3S2D C;  3PO2 C;  4FM9 A;  3TFH A;  5IOT A;  2O5I A;  3LPX A;  1V5V A;  2R93 K;  4BBS K;  3S1M C;  5TMF A;  4A3K C;  4KN4 A;  5M3M K;  3ADA C;  4Y7N K;  1TWA C;  2VUM K;  5IOQ A;  3GTO K;  2JA6 A;  3SZY A;  4KMH A;  5L46 A;  3S2D K;  3PO2 K;  4LJZ A;  1BGW A;  1WQG A;  4BKW A;  3H3V D;  3HOV C;  2NVX A;  4C3H K;  4A3C C;  2EBB A;  4AH6 A;  3S1M K;  3GEE A;  4A3K K;  5FLM C;  1B4A A;  3T00 A;  1TWA K;  4A3B C;  1DD5 A;  2A69 A;  4GTF A;  3S14 C;  2GSN A;  4G7O A;  1O2F B;  5IOS A;  1Y1W C;  4BBR C;  4GFQ A;  3QX3 A;  4LOW A;  3S15 C;  1ZXO A;  3HOW C;  3GTG A;  4KAW X;  4A3E C;  3HOV K;  4A3C K;  2JA7 A;  3FOF A;  3T01 A;  1JOE A;  1XZQ A;  3H0G A;  2XCQ A;  4OIP A;  1G51 A;  2B63 C;  4Q5S A;  5FLM K;  2RGR A;  5EGE A;  3S16 C;  4A3B K;  5M3F K;  4GTC A;  4BY7 C;  4OIO A;  2ZFZ A;  1INN A;  3S14 K;  4BLB A;  5HL8 A;  3PO3 C;  3GSI A;  2E2I A;  1Y1W K;  4BBR K;  2JA6 C;  3OPF A;  3S15 K;  1WSV A;  3HOW K;  1AB4 A;  3N3Y A;  3M3Y C;  4XLN A;  3NUH A;  1YCL A;  2A68 A;  1XXB A;  4A3E K;  3WOD A;  4X6A K;  2E2J C;  1XPP A;  3GEI A;  1Y1V A;  1WCM C;  2NVX C;  2B63 K;  3GTM A;  1SMY A;  3IPJ A;  3S16 K;  4M1X A;  4BY7 K;  3S1R C;  1YNN A;  5TMC A;  3PO3 K;  1USO A;  4KB2 A;  1XZP B;  2A6E A;  5M5X K;  1JQW A;  4G7H A;  2JA6 K;  1TWF A;  4RMF A;  1O26 A;  3M3Y K;  1VJE A;  1C0A A;  4A93 C;  2GSO A;  1YX2 A;  2E2J K;  3GTG C;  3M4O C;  1IS1 A;  1WCM K;  2NVX K;  3H3V L;  3A8J A;  4WIL A;  2XCR B;  2JA7 C;  2A6H A;  3H0G C;  3L4J A;  3S1R K;  1JVI A;  5IP7 C;  3GTQ A;  4MQ9 A;  4LK0 A;  4LQY A;  4OIR A;  2CFA B;  2BE5 A;  2E2I C;  3HKZ D;  4Q4Z A;  4C3I C;  4A93 K;  4O2D A;  1I6V A;  3GTG K;  3M4O K;  1I50 A;  1TWG A;  2JA7 K;  3H0G K;  1O28 A;  2Y3P A;  5CJ9 A;  1R9T A;  3GTM C;  5IP7 K;  2GAG C;  4A3D C;  1KQ4 A;  1F93 A;  1XXA A;  3AQO A;  4KM9 A;  2Y0S D;  4MEX A;  2E2I K;  1IQ0 A;  4GZY A;  2V6U A;  4C3I K;  1I6H C;  1BS2 A;  3K7A C;  3I4M C;  2V6S A;  5IYC C;  4LR2 A;  2NVT C;  1EK8 A;  2P8T A;  4KAT A;  5C44 C;  3GTM K;  5M5W K;  4A3D K;  3GTQ C;  1K83 C;  3MML B;  3I4N C;  1WQH A;  4YFN A;  1I6H K;  3CQZ A;  1VGX A;  3K7A K;  3I4M K;  3V4G A;  1PJ5 A;  5IYC K;  3GEH A;  5D4D A;  3AD7 C;  1ZVU A;  2NVT K;  2PHC B;  3GTJ A;  4XSZ A;  1I50 C;  5C44 K;  4C2M C;  2P5M A;  3VA7 A;  2KWA A;  1VH2 A;  1O2B A;  3AQP A;  4GTB A;  1R9T C;  1WSR A;  3GTQ K;  2R92 A;  1PJ7 A;  1K83 K;  1TWH A;  4KN7 A;  4LLG A;  3Q3Q A;  3TTG A;  3I4N K;  4G7Z A;  2E2H A;  4A3F C;  3OEP A;  4BXX C;  3BUE A;  1WOS A;  1GE9 A;  3HKZ L;  2JA5 A;  3RZO C;  3S0X A;  4YG2 A;  1I50 K;  4C2M K;  4KB4 A;  1WOR A;  5C4J C;  4A3G C;  3G4A A;  1R9T K;  4P5A A;  4KMD A;  3GTP A;  4AYB L;  4A3F K;  2XCO A;  4BXX K;  2Y0S L;  3CQZ C;  3GTO A;  5JVO A;  3RZO K;  4WJ4 A;  4KAS A;  1UV7 A;  1O27 A;  5C4J K;  1WQF A;  4A3G K; 
#chains in the Genus database with same CATH homology
 3GTJ C;  1TWG K;  1HQM A;  2JA7 K;  3H3V D;  4X6A C;  3H0G K;  4A3I C;  3HOV C;  2WAQ D;  4C3H K;  3S17 K;  4A3C C;  2O5J A;  2NVY K;  4NOI A;  5IP7 K;  3GTM C;  4A3D C;  1SFO K;  5FJ8 K;  4A3L K;  4Y52 C;  3S1M K;  2R92 C;  4A3K K;  5C3E K;  5FLM C;  3S1Q C;  4A3M C;  2CW0 A;  1TWA K;  2Y0S D;  3FKI K;  3CQZ K;  3DXJ A;  4MEX A;  4A3B C;  2E2H C;  2A69 A;  2E2I K;  4GZY A;  4C3I K;  1I6H C;  3S14 C;  3HOX C;  4G7O A;  3RZD K;  3K7A C;  5IYB C;  3I4M C;  1Y1W C;  4BBR C;  2JA5 C;  3GTJ K;  5IYC C;  3S15 C;  3HOZ C;  3HOW C;  4A3I K;  4A3E C;  3HOV K;  2NVT C;  4XLP A;  4A3C K;  5IYD C;  3HOY C;  5C44 C;  3GTM K;  5M5W K;  2PA8 L;  4YFK A;  2YU9 C;  4A3D K;  4Y52 K;  3EQL A;  2R92 K;  1Y1V C;  4OIP A;  2B63 C;  2R7Z C;  5FLM K;  2PPB A;  3S1Q K;  4Q5S A;  4A3M K;  1YNJ A;  4JK1 A;  3S16 C;  3GTP C;  5M3F K;  2JA8 C;  1TWH C;  4AYB D;  1K83 C;  2E2H K;  3GTQ C;  3HOU C;  4A3B K;  5M5Y K;  3I4N C;  4OIO A;  4BY7 C;  2NVQ C;  4YFN A;  4OIQ A;  3S14 K;  3PO3 C;  1I6H K;  3HOX K;  4C3J K;  3K7A K;  5IYB K;  3I4M K;  1TWF C;  4BBR K;  1Y1W K;  2JA6 C;  4A3J C;  2JA5 K;  5IYC K;  3S15 K;  3HOZ K;  5D4D A;  3HOW K;  3M3Y C;  5C4X C;  2PMZ L;  4XLN A;  3GTL C;  2A68 A;  4A3E K;  2NVT K;  3S2H C;  3WOD A;  5IYD K;  1I3Q C;  3HOY K;  4MEY A;  1I50 C;  4XSZ A;  5C44 K;  4BY1 C;  4X6A K;  2YU9 K;  3GTK C;  2E2J C;  2PA8 D;  1XPP A;  1Y1V K;  4KMU A;  1WCM C;  2NVX C;  2B63 K;  2R7Z K;  1SMY A;  1R9T C;  3S16 K;  3GTP K;  3HOU K;  2JA8 K;  1TWH K;  3GTQ K;  1K83 K;  4KN7 A;  4LLG A;  4QIW L;  3S1R C;  4BY7 K;  1YNN A;  1BDF A;  3I4N K;  1TWC C;  5TMC A;  4G7Z A;  2NVQ K;  4OIN A;  3S1N C;  3PO3 K;  2R93 C;  4BBS C;  2A6E A;  5M5X K;  4A3F C;  4G7H A;  1TWF K;  2JA6 K;  4BXX C;  4QJV B;  4A3J K;  4LK1 A;  2WB1 L;  4Y7N C;  2VUM C;  3M3Y K;  5C4X K;  3GTO C;  3HKZ L;  3GTL K;  2PMZ D;  3S2H K;  3RZO C;  1IW7 A;  1I3Q K;  4YG2 A;  5IP9 C;  1I50 K;  4BY1 K;  4A93 C;  4C2M K;  3GTK K;  2E2J K;  3GTG C;  3M4O C;  5C4J C;  3S2D C;  4A3G C;  3PO2 C;  1WCM K;  2NVX K;  3H3V L;  1TWG C;  2JA7 C;  1R9T K;  2A6H A;  3H0G C;  2WAQ L;  4YFX A;  3S1R K;  3S17 C;  1TWC K;  4QIW D;  2O5I A;  3S1N K;  2NVY C;  5IP7 C;  1SFO C;  4ZH4 A;  4MQ9 A;  4BBS K;  3S1M C;  4A3L C;  4AYB L;  4A3F K;  2R93 K;  4BXX K;  4LK0 A;  4OIR A;  5TMF A;  4A3K C;  5C3E C;  4KN4 A;  5M3M K;  2Y0S L;  2WB1 D;  3FKI C;  1TWA C;  2BE5 A;  4Y7N K;  3CQZ C;  2VUM K;  3GTO K;  2E2I C;  3HKZ D;  3RZO K;  4Q4Z A;  5IP9 K;  4XSX A;  4A93 K;  4QJV A;  3RZD C;  1I6V A;  1ZYR A;  3GTG K;  5C4J K;  3M4O K;  3S2D K;  4A3G K;  3PO2 K;  4LJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...