3RZDK

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzdK00
3GTOC 2VUMC 4A3BC 2WAQD 3CQZK 4QIWD 5IP7K 3I4MK 3M3YC 1HQMA 4XLPA 4NOIA 3FKIC 2B63C 3S17K 2E2JC 4Q4ZA 3WODA 2PPBA 4A93C 1YNJA 1TWHC 4G7OA 1I6VA 4BBSK 4GZYA 1TWCK 4A3IK 1TWGC 3S15K 2Y0SD 2A6EA 4A3FK 4LK1A 2NVQK 2O5JA 3GTQK 3GTPK 1IW7A 3I4NC 3S14C 3HOVC 3PO2C 5C4XK 2R93C 3PO3C 2JA8C 5C4JC 3RZDK 3GTMK 4YFXA 3HOZC 3RZOK 4A3DC 2NVYC 4OIPA 4G7HA 5IYCC 3H3VL 4BXXK 3S1MK 3S1QK 2YU9K 5C44K 1XPPA 1WCMC 1TWFK 5FLMC 2WAQL 1Y1WC 1I3QC 2NVXC 4A3EK 4ZH4A 4BY1C 4OIQA 3GTLC 3S2HC 1I50C 2JA5C 1YNNA 3HOUK 1R9TC 5M5WK 2JA6K 4KN7A 2Y0SL 2JA7C 4BY7K 4Y7NC 4A3MC 3GTOK 3H3VD 1TWAC 4BBRK 5M5XK 4A3KC 3S16K 4AYBL 3M3YK 3FKIK 2B63K 4QJVB 4C3JK 3HOXC 2E2JK 4A3JC 2NVTC 5TMFA 4A93K 3HOWC 1TWHK 2E2IK 3HOYC 4AYBD 1TWGK 5C3EK 2PA8L 5IYBC 3I4NK 3M4OC 3H0GC 4BBSC 2A68A 2R92C 3HOVK 2BE5A 3PO2K 3EQLA 3CQZC 5IP7C 5D4DA 2JA8K 3I4MC 5M5YK 2R93K 4Y52C 5C4JK 3HOZK 2PA8D 4A3CC 4OIRA 4A3DK 4A3GK 3HKZD 3S1NK 2E2HC 4KN4A 3GTKC 2A69A 1TWCC 1ZYRA 5IP9C 3S15C 2O5IA 1Y1WK 4X6AK 1Y1VK 1I3QK 2NVXK 3GTQC 1K83K 3K7AK 4BY1K 4C3IK 3S1RC 1BDFA 2R7ZC 3GTLK 5C4XC 3S2HK 2VUMK 1SFOC 4A3BK 4XSXA 3RZDC 1R9TK 3GTMC 5M3MK 2JA7K 2PMZD 4A3MK 4BXXC 4A3LC 4A3KK 2CW0A 3GTGC 5M3FK 1SMYA 1TWFC 4XSZA 5IYDC 3HOXK 4A3JK 3S2DC 4LK0A 3HOWK 3HOYK 5C3EC 2WB1D 4C3HK 3GTJC 1I6HC 3HKZL 4OIOA 4C2MK 3S14K 4LLGA 3PO3K 2JA6C 4BY7C 3S17C 4OINA 2R92K 2NVYK 4BBRC 5IYCK 3S16C 4Y52K 3DXJA 4A3IC 2A6HA 4A3CK 1WCMK 5FLMK 4A3FC 2NVQC 2E2IC 4Q5SA 2E2HK 3GTPC 4MQ9A 2PMZL 3GTKK 5IP9K 4LJZA 1I50K 2JA5K 3RZOC 4YG2A 4YFKA 4QJVA 3S1RK 4Y7NK 2R7ZK 2WB1L 1TWAK 1SFOK 3S1MC 3S1QC 2YU9C 5C44C 4A3GC 3S1NC 4MEYA 5FJ8K 4JK1A 4KMUA 4YFNA 4XLNA 2NVTK 4A3LK 4G7ZA 4A3EC 3GTGK 5IYDK 4X6AC 5TMCA 4QIWL 3S2DK 1Y1VC 4MEXA 3HOUC 1K83C 5IYBK 3K7AC 3GTJK 3M4OK 1I6HK 3H0GK
chains in the Genus database with same CATH superfamily
4WILA 4GFQA 3FKIC 2B63C 2E2JC 4Q4ZA 3WODA 3GEHA 2RGRA 4A93C 1TWHC 3FOEA 1J98A 3JSTA 4GZYA 1TWGC 2O5JA 4LK1A 5E68A 3GTPK 3I4NC 1IW7A 4KARA 4XCHA 4O2DA 2ZUFA 4P9SA 3RZDK 1I50A 3GTMK 4OIPA 2EBBA 5IYCC 3H3VL 2YU9K 4GTEA 5FLMC 5IOTA 1I3QC 2NVXC 4ZH4A 4OIQA 4KATA 5M5WK 2JA6K 4KN7A 4A3MC 1O27A 3H0GA 3M3YK 3V4GA 4DDQA 2NVTC 4BLAA 4C3HC 3A8IA 5JFEA 5IYBC 4C45A 4BBSC 2A68A 4PABA 2R92C 3HOVK 3GTPA 1F7VA 1B4AA 1WQGA 4Y52C 3TFJA 2RH6A 4A3GK 3GTMA 3BP8C 4GTDA 2A69A 1TWCC 1XZPA 3AD9C 3S15C 1WQHA 2O5IA 2YU9A 1ZVUA 1INNA 4BY1K 3N3YA 5C4XC 1ZQ1C 3GTLK 3S2HK 2VUMK 2PHCB 1R9TK 1WOPA 5M3MK 5L46A 4M1XA 2JA7K 2JA6A 1JOEA 1O25A 4FM9A 1UV7A 1JVIA 4GTFA 3GTGC 5IYDC 1JQWA 4A3JK 4LK0A 1J6WA 3HOYK 3TFHA 1I6HC 4C2MK 1YCLA 1GE9A 4LLGA 2ZUEA 1V5VA 3T01A 5CJ9A 2NVQC 2E2HK 3GTKK 1PJ7A 5IP9K 2GAHC 2JA5K 4KM9A 1TWAK 3GTLA 3S1MC 1R9TA 4MEYA 5FJ8K 2JA7A 3TFIA 4A3EC 3HOUC 3H3VD 3GTJK 3AD7C 1XZPB 4A3BC 4QIWD 5IP7K 1DCPA 4XLPA 3SZYA 2PPBA 3LAJA 4G7OA 4A3IK 2V6TA 4A3FK 3S14C 3PO2C 5IOSA 2E2HA 3GTKA 3PO3C 4YFXA 2JA5A 2NVYC 4BXXK 3S1QK 1TWAA 5C44K 1Y1WC 1RU0A 3Q3QA 4LR2A 1EQRA 1I50C 3G4CA 3OEPA 4KDDA 1VH2A 2Y0SL 4BY7K 3IPJA 1ZXOA 5EGHA 3GTJA 1IE0A 3TTGA 3FKIK 2B63K 4C3JK 3N0CA 2E2JK 4A93K 3HOWC 1TWHK 2E2IK 1BJTA 4AYBD 1TWGK 4KAWX 3I4NK 3H0GC 3GIRA 3BP3A 1VGXA 2XCQA 2PA8D 4A3CC 1EK8A 4X6AK 3A8KA 3GDZA 1I3QK 2NVXK 1K83K 4PAAA 3S1RC 2R7ZC 1O24A 5JVOA 1SFOC 3RZDC 3GTMC 4A3MK 5IORA 3AQOA 4GTAA 4A3LC 4GT9A 2CW0A 5M3FK 4XSZA 3S2DC 3FKIA 2B63A 4G0WA 4C3HK 1TWHA 3HKZL 2E2IA 1TWGA 1XXCA 2JA6C 3S17C 2R92K 2KWAA 4Y52K 3DXJA 1WCMK 4AH6A 3A8JA 3QX3A 5TJ3A 2GSNA 3FHZA 3RZOC 4YG2A 1I3QA 2NVXA 1K83A 4Y7NK 2GAGC 4A3GC 2Y3PA 4XLNA 4YFNA 1F9NA 3GTGK 1B4BA 5IYDK 5TMCA 3LPXA 4MEXA 3M4OK 1I6HK 1C0AA 3GTOC 2VUMC 3CQZK 3I4MK 1O26A 1HQMA 1EI6A 5HL8A 1USMA 2R92A 1I6VA 3MMLB 1AB4A 3ERED 4GTBA 4LQYA 3LAPA 2Y0SD 2NVQK 1WIHA 1WCMA 3GTQK 2R93C 1TWCA 1IL2A 2JA8C 5C4JC 3GEEA 2D6FC 3HOZC 4A3DC 1X31C 4G7HA 5CHPA 3S1MK 4GTLA 1XPPA 1TWFK 2WAQL 3VA7A 3L4JA 4A3EK 1YX2A 4C3IC 3GTGA 3T02A 2JA5C 1YNNA 3HOUK 1WOSA 3BUEA 2P8TA 1TWAC 4BBRK 5M5XK 3AQPA 4A3KC 3S16K 4WJ4A 2P5MA 3CQZA 3S0XA 3HOXC 5TMFA 1HI9A 1DCOA 5IOQA 1DCHA 3PO2K 3AD8C 2BE5A 3GTQA 3T00A 3EQLA 3HXAA 5IP7C 5D4DA 5M5YK 4OIRA 3GEIA 3HKZD 3S1NK 4KMHA 4KN4A 2GSOA 1BGWA 1Y1WK 4KM8A 1Y1VK 1TWFA 3K7AK 2CFAA 1BDFA 4BKWA 2V6SA 4BXXC 2FQTA 1J6VA 1SMYA 3HOWK 5C3EC 4OIOA 1WORA 2JH3A 1XXBA 1ISEA 4BY7C 3OPFA 1BS2A 5IYCK 1IQ0A 4C3JC 4A3CK 2A6HA 1O28A 5FLMK 4KASA 2E2IC 3ADAC 2NVYA 3GTPC 4Q5SA 2PMZL 1VLOA 1EFWA 4P5BA 1Y1WA 1IS1A 1Y1VA 4QJVA 3S1RK 2R7ZK 2WB1L 1SFOK 2YU9C 1KQ4A 4JK1A 4KMUA 3FOFA 2NVTK 4A3LK 4X6AC 4FZBA 4QIWL 3S2DK 1K83C 1XXAA 5IYBK 4G0UA 4BBSK 3GSIA 2WAQD 3M3YC 4NOIA 2CFAB 3S17K 1YNJA 4KC6A 1TWCK 5EGEA 3S15K 2A6EA 1VRQC 3HOVC 5C4XK 1F7UA 3RZOK 2R7ZA 4KMDA 1SFOA 2GSUA 1WCMC 1L0WA 1O29A 1WOOA 3G4AA 4BY1C 3GTLC 1WSRA 3S2HC 1R9TC 1DD5A 2JA7C 1XZQA 4Y7NC 1PJ5A 3GTOK 4G0VA 3NUHA 4AYBL 4KB4A 4QJVB 4A3JC 4KMAA 3HOYC 1O2FB 3CAGA 4C2MC 4RMFA 5C3EK 2PA8L 4LOWA 3M4OC 1PJ6A 2R93K 3CQZC 3L4KA 3I4MC 2JA8K 2FQOA 5C4JK 3HOZK 4A3DK 1G51A 1WQFA 1J6XA 2E2HC 3GTKC 1ZYRA 5IP9C 1USOA 1F93A 3GTQC 4C3IK 4ILDA 3SZZA 1ZBSA 4A3BK 4KB2A 4XSXA 2PMZD 3AH5A 4P5AA 3GTOA 4BLBA 4A3KK 2VUMA 3OREA 1O2AA 1TWFC 3HOXK 2V6UA 2W7VA 2WB1D 3GTJC 2ZFZA 3S14K 3PO3K 4OINA 4J3NA 2NVYK 4BBRC 3S16C 2R93A 1XZQB 4A3IC 4A3FC 4GTCA 4MQ9A 4LJZA 1IBAA 1I50K 2XCRB 4YFKA 1WSVA 3N0BA 1VJEA 1O2BA 3S1QC 2XCOA 5C44C 3S1NC 4G7ZA 4WJ3M 1Y1VC 1EH1A 3K7AC 3H0GK
chains in the Genus database with same CATH topology
3GTOC 2VUMC 4A3BC 2WAQD 3CQZK 4QIWD 5IP7K 3I4MK 3M3YC 1HQMA 4XLPA 4NOIA 3FKIC 2B63C 3S17K 2E2JC 4Q4ZA 3WODA 2PPBA 4A93C 1YNJA 1TWHC 4G7OA 1I6VA 4BBSK 4GZYA 1TWCK 4A3IK 1TWGC 3S15K 2Y0SD 2A6EA 4A3FK 4LK1A 2NVQK 2O5JA 3GTQK 3GTPK 1IW7A 3I4NC 3S14C 3HOVC 3PO2C 5C4XK 2R93C 3PO3C 2JA8C 5C4JC 3RZDK 3GTMK 4YFXA 3HOZC 3RZOK 4A3DC 2NVYC 4OIPA 4G7HA 5IYCC 3H3VL 4BXXK 3S1MK 3S1QK 2YU9K 5C44K 1XPPA 1WCMC 1TWFK 5FLMC 2WAQL 1Y1WC 1I3QC 2NVXC 4A3EK 4ZH4A 4BY1C 4OIQA 3GTLC 3S2HC 1I50C 2JA5C 1YNNA 3HOUK 1R9TC 5M5WK 2JA6K 4KN7A 2Y0SL 2JA7C 4BY7K 4Y7NC 4A3MC 3GTOK 3H3VD 1TWAC 4BBRK 5M5XK 4A3KC 3S16K 4AYBL 3M3YK 3FKIK 2B63K 4QJVB 4C3JK 3HOXC 2E2JK 4A3JC 2NVTC 5TMFA 4A93K 3HOWC 1TWHK 2E2IK 3HOYC 4AYBD 1TWGK 5C3EK 2PA8L 5IYBC 3I4NK 3M4OC 3H0GC 4BBSC 2A68A 2R92C 3HOVK 2BE5A 3PO2K 3EQLA 3CQZC 5IP7C 5D4DA 2JA8K 3I4MC 5M5YK 2R93K 4Y52C 5C4JK 3HOZK 2PA8D 4A3CC 4OIRA 4A3DK 4A3GK 3HKZD 3S1NK 2E2HC 4KN4A 3GTKC 2A69A 1TWCC 1ZYRA 5IP9C 3S15C 2O5IA 1Y1WK 4X6AK 1Y1VK 1I3QK 2NVXK 3GTQC 1K83K 3K7AK 4BY1K 4C3IK 3S1RC 1BDFA 2R7ZC 3GTLK 5C4XC 3S2HK 2VUMK 1SFOC 4A3BK 4XSXA 3RZDC 1R9TK 3GTMC 5M3MK 2JA7K 2PMZD 4A3MK 4BXXC 4A3LC 4A3KK 2CW0A 3GTGC 5M3FK 1SMYA 1TWFC 4XSZA 5IYDC 3HOXK 4A3JK 3S2DC 4LK0A 3HOWK 3HOYK 5C3EC 2WB1D 4C3HK 3GTJC 1I6HC 3HKZL 4OIOA 4C2MK 3S14K 4LLGA 3PO3K 2JA6C 4BY7C 3S17C 4OINA 2R92K 2NVYK 4BBRC 5IYCK 3S16C 4Y52K 3DXJA 4A3IC 2A6HA 4A3CK 1WCMK 5FLMK 4A3FC 2NVQC 2E2IC 4Q5SA 2E2HK 3GTPC 4MQ9A 2PMZL 3GTKK 5IP9K 4LJZA 1I50K 2JA5K 3RZOC 4YG2A 4YFKA 4QJVA 3S1RK 4Y7NK 2R7ZK 2WB1L 1TWAK 1SFOK 3S1MC 3S1QC 2YU9C 5C44C 4A3GC 3S1NC 4MEYA 5FJ8K 4JK1A 4KMUA 4YFNA 4XLNA 2NVTK 4A3LK 4G7ZA 4A3EC 3GTGK 5IYDK 4X6AC 5TMCA 4QIWL 3S2DK 1Y1VC 4MEXA 3HOUC 1K83C 5IYBK 3K7AC 3GTJK 3M4OK 1I6HK 3H0GK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO C;  2VUM C;  4A3B C;  2WAQ D;  3CQZ K;  4QIW D;  5IP7 K;  3I4M K;  3M3Y C;  1HQM A;  4XLP A;  4NOI A;  3FKI C;  2B63 C;  3S17 K;  2E2J C;  4Q4Z A;  3WOD A;  2PPB A;  4A93 C;  1YNJ A;  1TWH C;  4G7O A;  1I6V A;  4BBS K;  4GZY A;  1TWC K;  4A3I K;  1TWG C;  3S15 K;  2Y0S D;  2A6E A;  4A3F K;  4LK1 A;  2NVQ K;  2O5J A;  3GTQ K;  3GTP K;  1IW7 A;  3I4N C;  3S14 C;  3HOV C;  3PO2 C;  5C4X K;  2R93 C;  3PO3 C;  2JA8 C;  5C4J C;  3RZD K;  3GTM K;  4YFX A;  3HOZ C;  3RZO K;  4A3D C;  2NVY C;  4OIP A;  4G7H A;  5IYC C;  3H3V L;  4BXX K;  3S1M K;  3S1Q K;  2YU9 K;  5C44 K;  1XPP A;  1WCM C;  1TWF K;  5FLM C;  2WAQ L;  1Y1W C;  1I3Q C;  2NVX C;  4A3E K;  4ZH4 A;  4BY1 C;  4OIQ A;  3GTL C;  3S2H C;  1I50 C;  2JA5 C;  1YNN A;  3HOU K;  1R9T C;  5M5W K;  2JA6 K;  4KN7 A;  2Y0S L;  2JA7 C;  4BY7 K;  4Y7N C;  4A3M C;  3GTO K;  3H3V D;  1TWA C;  4BBR K;  5M5X K;  4A3K C;  3S16 K;  4AYB L;  3M3Y K;  3FKI K;  2B63 K;  4QJV B;  4C3J K;  3HOX C;  2E2J K;  4A3J C;  2NVT C;  5TMF A;  4A93 K;  3HOW C;  1TWH K;  2E2I K;  3HOY C;  4AYB D;  1TWG K;  5C3E K;  2PA8 L;  5IYB C;  3I4N K;  3M4O C;  3H0G C;  4BBS C;  2A68 A;  2R92 C;  3HOV K;  2BE5 A;  3PO2 K;  3EQL A;  3CQZ C;  5IP7 C;  5D4D A;  2JA8 K;  3I4M C;  5M5Y K;  2R93 K;  4Y52 C;  5C4J K;  3HOZ K;  2PA8 D;  4A3C C;  4OIR A;  4A3D K;  4A3G K;  3HKZ D;  3S1N K;  2E2H C;  4KN4 A;  3GTK C;  2A69 A;  1TWC C;  1ZYR A;  5IP9 C;  3S15 C;  2O5I A;  1Y1W K;  4X6A K;  1Y1V K;  1I3Q K;  2NVX K;  3GTQ C;  1K83 K;  3K7A K;  4BY1 K;  4C3I K;  3S1R C;  1BDF A;  2R7Z C;  3GTL K;  5C4X C;  3S2H K;  2VUM K;  1SFO C;  4A3B K;  4XSX A;  3RZD C;  1R9T K;  3GTM C;  5M3M K;  2JA7 K;  2PMZ D;  4A3M K;  4BXX C;  4A3L C;  4A3K K;  2CW0 A;  3GTG C;  5M3F K;  1SMY A;  1TWF C;  4XSZ A;  5IYD C;  3HOX K;  4A3J K;  3S2D C;  4LK0 A;  3HOW K;  3HOY K;  5C3E C;  2WB1 D;  4C3H K;  3GTJ C;  1I6H C;  3HKZ L;  4OIO A;  4C2M K;  3S14 K;  4LLG A;  3PO3 K;  2JA6 C;  4BY7 C;  3S17 C;  4OIN A;  2R92 K;  2NVY K;  4BBR C;  5IYC K;  3S16 C;  4Y52 K;  3DXJ A;  4A3I C;  2A6H A;  4A3C K;  1WCM K;  5FLM K;  4A3F C;  2NVQ C;  2E2I C;  4Q5S A;  2E2H K;  3GTP C;  4MQ9 A;  2PMZ L;  3GTK K;  5IP9 K;  4LJZ A;  1I50 K;  2JA5 K;  3RZO C;  4YG2 A;  4YFK A;  4QJV A;  3S1R K;  4Y7N K;  2R7Z K;  2WB1 L;  1TWA K;  1SFO K;  3S1M C;  3S1Q C;  2YU9 C;  5C44 C;  4A3G C;  3S1N C;  4MEY A;  5FJ8 K;  4JK1 A;  4KMU A;  4YFN A;  4XLN A;  2NVT K;  4A3L K;  4G7Z A;  4A3E C;  3GTG K;  5IYD K;  4X6A C;  5TMC A;  4QIW L;  3S2D K;  1Y1V C;  4MEX A;  3HOU C;  1K83 C;  5IYB K;  3K7A C;  3GTJ K;  3M4O K;  1I6H K;  3H0G K; 
#chains in the Genus database with same CATH topology
 4WIL A;  4GFQ A;  3FKI C;  2B63 C;  2E2J C;  4Q4Z A;  3WOD A;  3GEH A;  2RGR A;  4A93 C;  1TWH C;  3FOE A;  1J98 A;  3JST A;  4GZY A;  1TWG C;  2O5J A;  4LK1 A;  5E68 A;  3GTP K;  3I4N C;  1IW7 A;  4KAR A;  4XCH A;  4O2D A;  2ZUF A;  4P9S A;  3RZD K;  1I50 A;  3GTM K;  4OIP A;  2EBB A;  5IYC C;  3H3V L;  2YU9 K;  4GTE A;  5FLM C;  5IOT A;  1I3Q C;  2NVX C;  4ZH4 A;  4OIQ A;  4KAT A;  5M5W K;  2JA6 K;  4KN7 A;  4A3M C;  1O27 A;  3H0G A;  3M3Y K;  3V4G A;  4DDQ A;  2NVT C;  4BLA A;  4C3H C;  3A8I A;  5JFE A;  5IYB C;  4C45 A;  4BBS C;  2A68 A;  4PAB A;  2R92 C;  3HOV K;  3GTP A;  1F7V A;  1B4A A;  1WQG A;  4Y52 C;  3TFJ A;  2RH6 A;  4A3G K;  3GTM A;  3BP8 C;  4GTD A;  2A69 A;  1TWC C;  1XZP A;  3AD9 C;  3S15 C;  1WQH A;  2O5I A;  2YU9 A;  1ZVU A;  1INN A;  4BY1 K;  3N3Y A;  5C4X C;  1ZQ1 C;  3GTL K;  3S2H K;  2VUM K;  2PHC B;  1R9T K;  1WOP A;  5M3M K;  5L46 A;  4M1X A;  2JA7 K;  2JA6 A;  1JOE A;  1O25 A;  4FM9 A;  1UV7 A;  1JVI A;  4GTF A;  3GTG C;  5IYD C;  1JQW A;  4A3J K;  4LK0 A;  1J6W A;  3HOY K;  3TFH A;  1I6H C;  4C2M K;  1YCL A;  1GE9 A;  4LLG A;  2ZUE A;  1V5V A;  3T01 A;  5CJ9 A;  2NVQ C;  2E2H K;  3GTK K;  1PJ7 A;  5IP9 K;  2GAH C;  2JA5 K;  4KM9 A;  1TWA K;  3GTL A;  3S1M C;  1R9T A;  4MEY A;  5FJ8 K;  2JA7 A;  3TFI A;  4A3E C;  3HOU C;  3H3V D;  3GTJ K;  3AD7 C;  1XZP B;  4A3B C;  4QIW D;  5IP7 K;  1DCP A;  4XLP A;  3SZY A;  2PPB A;  3LAJ A;  4G7O A;  4A3I K;  2V6T A;  4A3F K;  3S14 C;  3PO2 C;  5IOS A;  2E2H A;  3GTK A;  3PO3 C;  4YFX A;  2JA5 A;  2NVY C;  4BXX K;  3S1Q K;  1TWA A;  5C44 K;  1Y1W C;  1RU0 A;  3Q3Q A;  4LR2 A;  1EQR A;  1I50 C;  3G4C A;  3OEP A;  4KDD A;  1VH2 A;  2Y0S L;  4BY7 K;  3IPJ A;  1ZXO A;  5EGH A;  3GTJ A;  1IE0 A;  3TTG A;  3FKI K;  2B63 K;  4C3J K;  3N0C A;  2E2J K;  4A93 K;  3HOW C;  1TWH K;  2E2I K;  1BJT A;  4AYB D;  1TWG K;  4KAW X;  3I4N K;  3H0G C;  3GIR A;  3BP3 A;  1VGX A;  2XCQ A;  2PA8 D;  4A3C C;  1EK8 A;  4X6A K;  3A8K A;  3GDZ A;  1I3Q K;  2NVX K;  1K83 K;  4PAA A;  3S1R C;  2R7Z C;  1O24 A;  5JVO A;  1SFO C;  3RZD C;  3GTM C;  4A3M K;  5IOR A;  3AQO A;  4GTA A;  4A3L C;  4GT9 A;  2CW0 A;  5M3F K;  4XSZ A;  3S2D C;  3FKI A;  2B63 A;  4G0W A;  4C3H K;  1TWH A;  3HKZ L;  2E2I A;  1TWG A;  1XXC A;  2JA6 C;  3S17 C;  2R92 K;  2KWA A;  4Y52 K;  3DXJ A;  1WCM K;  4AH6 A;  3A8J A;  3QX3 A;  5TJ3 A;  2GSN A;  3FHZ A;  3RZO C;  4YG2 A;  1I3Q A;  2NVX A;  1K83 A;  4Y7N K;  2GAG C;  4A3G C;  2Y3P A;  4XLN A;  4YFN A;  1F9N A;  3GTG K;  1B4B A;  5IYD K;  5TMC A;  3LPX A;  4MEX A;  3M4O K;  1I6H K;  1C0A A;  3GTO C;  2VUM C;  3CQZ K;  3I4M K;  1O26 A;  1HQM A;  1EI6 A;  5HL8 A;  1USM A;  2R92 A;  1I6V A;  3MML B;  1AB4 A;  3ERE D;  4GTB A;  4LQY A;  3LAP A;  2Y0S D;  2NVQ K;  1WIH A;  1WCM A;  3GTQ K;  2R93 C;  1TWC A;  1IL2 A;  2JA8 C;  5C4J C;  3GEE A;  2D6F C;  3HOZ C;  4A3D C;  1X31 C;  4G7H A;  5CHP A;  3S1M K;  4GTL A;  1XPP A;  1TWF K;  2WAQ L;  3VA7 A;  3L4J A;  4A3E K;  1YX2 A;  4C3I C;  3GTG A;  3T02 A;  2JA5 C;  1YNN A;  3HOU K;  1WOS A;  3BUE A;  2P8T A;  1TWA C;  4BBR K;  5M5X K;  3AQP A;  4A3K C;  3S16 K;  4WJ4 A;  2P5M A;  3CQZ A;  3S0X A;  3HOX C;  5TMF A;  1HI9 A;  1DCO A;  5IOQ A;  1DCH A;  3PO2 K;  3AD8 C;  2BE5 A;  3GTQ A;  3T00 A;  3EQL A;  3HXA A;  5IP7 C;  5D4D A;  5M5Y K;  4OIR A;  3GEI A;  3HKZ D;  3S1N K;  4KMH A;  4KN4 A;  2GSO A;  1BGW A;  1Y1W K;  4KM8 A;  1Y1V K;  1TWF A;  3K7A K;  2CFA A;  1BDF A;  4BKW A;  2V6S A;  4BXX C;  2FQT A;  1J6V A;  1SMY A;  3HOW K;  5C3E C;  4OIO A;  1WOR A;  2JH3 A;  1XXB A;  1ISE A;  4BY7 C;  3OPF A;  1BS2 A;  5IYC K;  1IQ0 A;  4C3J C;  4A3C K;  2A6H A;  1O28 A;  5FLM K;  4KAS A;  2E2I C;  3ADA C;  2NVY A;  3GTP C;  4Q5S A;  2PMZ L;  1VLO A;  1EFW A;  4P5B A;  1Y1W A;  1IS1 A;  1Y1V A;  4QJV A;  3S1R K;  2R7Z K;  2WB1 L;  1SFO K;  2YU9 C;  1KQ4 A;  4JK1 A;  4KMU A;  3FOF A;  2NVT K;  4A3L K;  4X6A C;  4FZB A;  4QIW L;  3S2D K;  1K83 C;  1XXA A;  5IYB K;  4G0U A;  4BBS K;  3GSI A;  2WAQ D;  3M3Y C;  4NOI A;  2CFA B;  3S17 K;  1YNJ A;  4KC6 A;  1TWC K;  5EGE A;  3S15 K;  2A6E A;  1VRQ C;  3HOV C;  5C4X K;  1F7U A;  3RZO K;  2R7Z A;  4KMD A;  1SFO A;  2GSU A;  1WCM C;  1L0W A;  1O29 A;  1WOO A;  3G4A A;  4BY1 C;  3GTL C;  1WSR A;  3S2H C;  1R9T C;  1DD5 A;  2JA7 C;  1XZQ A;  4Y7N C;  1PJ5 A;  3GTO K;  4G0V A;  3NUH A;  4AYB L;  4KB4 A;  4QJV B;  4A3J C;  4KMA A;  3HOY C;  1O2F B;  3CAG A;  4C2M C;  4RMF A;  5C3E K;  2PA8 L;  4LOW A;  3M4O C;  1PJ6 A;  2R93 K;  3CQZ C;  3L4K A;  3I4M C;  2JA8 K;  2FQO A;  5C4J K;  3HOZ K;  4A3D K;  1G51 A;  1WQF A;  1J6X A;  2E2H C;  3GTK C;  1ZYR A;  5IP9 C;  1USO A;  1F93 A;  3GTQ C;  4C3I K;  4ILD A;  3SZZ A;  1ZBS A;  4A3B K;  4KB2 A;  4XSX A;  2PMZ D;  3AH5 A;  4P5A A;  3GTO A;  4BLB A;  4A3K K;  2VUM A;  3ORE A;  1O2A A;  1TWF C;  3HOX K;  2V6U A;  2W7V A;  2WB1 D;  3GTJ C;  2ZFZ A;  3S14 K;  3PO3 K;  4OIN A;  4J3N A;  2NVY K;  4BBR C;  3S16 C;  2R93 A;  1XZQ B;  4A3I C;  4A3F C;  4GTC A;  4MQ9 A;  4LJZ A;  1IBA A;  1I50 K;  2XCR B;  4YFK A;  1WSV A;  3N0B A;  1VJE A;  1O2B A;  3S1Q C;  2XCO A;  5C44 C;  3S1N C;  4G7Z A;  4WJ3 M;  1Y1V C;  1EH1 A;  3K7A C;  3H0G K; 
#chains in the Genus database with same CATH homology
 3GTO C;  2VUM C;  4A3B C;  2WAQ D;  3CQZ K;  4QIW D;  5IP7 K;  3I4M K;  3M3Y C;  1HQM A;  4XLP A;  4NOI A;  3FKI C;  2B63 C;  3S17 K;  2E2J C;  4Q4Z A;  3WOD A;  2PPB A;  4A93 C;  1YNJ A;  1TWH C;  4G7O A;  1I6V A;  4BBS K;  4GZY A;  1TWC K;  4A3I K;  1TWG C;  3S15 K;  2Y0S D;  2A6E A;  4A3F K;  4LK1 A;  2NVQ K;  2O5J A;  3GTQ K;  3GTP K;  1IW7 A;  3I4N C;  3S14 C;  3HOV C;  3PO2 C;  5C4X K;  2R93 C;  3PO3 C;  2JA8 C;  5C4J C;  3RZD K;  3GTM K;  4YFX A;  3HOZ C;  3RZO K;  4A3D C;  2NVY C;  4OIP A;  4G7H A;  5IYC C;  3H3V L;  4BXX K;  3S1M K;  3S1Q K;  2YU9 K;  5C44 K;  1XPP A;  1WCM C;  1TWF K;  5FLM C;  2WAQ L;  1Y1W C;  1I3Q C;  2NVX C;  4A3E K;  4ZH4 A;  4BY1 C;  4OIQ A;  3GTL C;  3S2H C;  1I50 C;  2JA5 C;  1YNN A;  3HOU K;  1R9T C;  5M5W K;  2JA6 K;  4KN7 A;  2Y0S L;  2JA7 C;  4BY7 K;  4Y7N C;  4A3M C;  3GTO K;  3H3V D;  1TWA C;  4BBR K;  5M5X K;  4A3K C;  3S16 K;  4AYB L;  3M3Y K;  3FKI K;  2B63 K;  4QJV B;  4C3J K;  3HOX C;  2E2J K;  4A3J C;  2NVT C;  5TMF A;  4A93 K;  3HOW C;  1TWH K;  2E2I K;  3HOY C;  4AYB D;  1TWG K;  5C3E K;  2PA8 L;  5IYB C;  3I4N K;  3M4O C;  3H0G C;  4BBS C;  2A68 A;  2R92 C;  3HOV K;  2BE5 A;  3PO2 K;  3EQL A;  3CQZ C;  5IP7 C;  5D4D A;  2JA8 K;  3I4M C;  5M5Y K;  2R93 K;  4Y52 C;  5C4J K;  3HOZ K;  2PA8 D;  4A3C C;  4OIR A;  4A3D K;  4A3G K;  3HKZ D;  3S1N K;  2E2H C;  4KN4 A;  3GTK C;  2A69 A;  1TWC C;  1ZYR A;  5IP9 C;  3S15 C;  2O5I A;  1Y1W K;  4X6A K;  1Y1V K;  1I3Q K;  2NVX K;  3GTQ C;  1K83 K;  3K7A K;  4BY1 K;  4C3I K;  3S1R C;  1BDF A;  2R7Z C;  3GTL K;  5C4X C;  3S2H K;  2VUM K;  1SFO C;  4A3B K;  4XSX A;  3RZD C;  1R9T K;  3GTM C;  5M3M K;  2JA7 K;  2PMZ D;  4A3M K;  4BXX C;  4A3L C;  4A3K K;  2CW0 A;  3GTG C;  5M3F K;  1SMY A;  1TWF C;  4XSZ A;  5IYD C;  3HOX K;  4A3J K;  3S2D C;  4LK0 A;  3HOW K;  3HOY K;  5C3E C;  2WB1 D;  4C3H K;  3GTJ C;  1I6H C;  3HKZ L;  4OIO A;  4C2M K;  3S14 K;  4LLG A;  3PO3 K;  2JA6 C;  4BY7 C;  3S17 C;  4OIN A;  2R92 K;  2NVY K;  4BBR C;  5IYC K;  3S16 C;  4Y52 K;  3DXJ A;  4A3I C;  2A6H A;  4A3C K;  1WCM K;  5FLM K;  4A3F C;  2NVQ C;  2E2I C;  4Q5S A;  2E2H K;  3GTP C;  4MQ9 A;  2PMZ L;  3GTK K;  5IP9 K;  4LJZ A;  1I50 K;  2JA5 K;  3RZO C;  4YG2 A;  4YFK A;  4QJV A;  3S1R K;  4Y7N K;  2R7Z K;  2WB1 L;  1TWA K;  1SFO K;  3S1M C;  3S1Q C;  2YU9 C;  5C44 C;  4A3G C;  3S1N C;  4MEY A;  5FJ8 K;  4JK1 A;  4KMU A;  4YFN A;  4XLN A;  2NVT K;  4A3L K;  4G7Z A;  4A3E C;  3GTG K;  5IYD K;  4X6A C;  5TMC A;  4QIW L;  3S2D K;  1Y1V C;  4MEX A;  3HOU C;  1K83 C;  5IYB K;  3K7A C;  3GTJ K;  3M4O K;  1I6H K;  3H0G K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...