3RZDK

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzdK00
5C44C 3M3YC 4OIOA 3S2DC 5M3FK 4BBRC 4A3KC 2VUMK 2R93C 4Y52K 1TWCK 2E2JC 4ZH4A 1WCMC 4KN4A 4MQ9A 3S14K 4A93C 4BBSK 1TWHK 4Y52C 4A3FC 2NVQK 2E2JK 4A3JC 1I6VA 1ZYRA 1Y1VK 4Q5SA 2BE5A 2NVTK 5C4JK 4A3JK 4QIWD 5IP7C 4A3EC 1I50K 4A3CC 1YNNA 4C3IK 5IP7K 3RZOC 4G7HA 3PO3C 4OIQA 3GTMK 5M5YK 3GTPC 4YFNA 5IYCC 5TMFA 1TWAK 2NVYC 4OIPA 4A3MC 3RZOK 3GTGK 3HOWC 1TWGC 2A69A 4YFXA 3GTQK 4KN7A 4YFKA 3GTJC 3S15K 4A3BC 4A3DK 4A3GK 5FLMK 4QIWL 4BY7K 4A3BK 3FKIK 4A3DC 3CQZK 1I3QK 3I4NC 1IW7A 4KMUA 5C3EK 3I4MC 4GZYA 4A3IK 2B63C 2R92C 4BXXK 2E2IK 3S1RC 2VUMC 2B63K 2R92K 3RZDC 2E2IC 4BXXC 5FJ8K 1R9TC 2WB1D 4MEYA 4NOIA 5IP9K 3M4OC 2A6HA 4JK1A 4OIRA 3HOYK 5IYDC 2YU9K 5C4XC 2NVTC 2PMZL 1BDFA 5IYBC 4QJVB 4OINA 1XPPA 2PA8D 4X6AK 4C3JK 4LK0A 3GTQC 3GTJK 3HKZL 3H3VL 3HOZK 1Y1WC 2JA7K 2JA8K 3GTKC 3S1NC 3K7AK 4QJVA 5IYCK 4A3MK 3HKZD 3S1MC 3FKIC 2CW0A 1TWFC 2PA8L 3HOVC 4Y7NC 3S2HC 3HOUC 1WCMK 4A93K 4XSXA 2JA5K 3H3VD 3HOVK 3CQZC 3I4NK 4BBRK 2WAQD 5M5XK 2JA6K 1YNJA 2R7ZC 4A3IC 4XLPA 3HOYC 2YU9C 3PO2C 2O5JA 5IYDK 3S16C 2R7ZK 3S1QC 4A3LC 4AYBL 4YG2A 3RZDK 1I6HC 1R9TK 2PMZD 3GTMC 5C4JC 3S1QK 1K83C 3GTOK 1I6HK 5C4XK 1Y1WK 2JA7C 2WB1L 2A68A 2E2HK 2A6EA 2Y0SL 5M5WK 3H0GC 4G7ZA 5TMCA 4C3HK 1TWAC 2NVYK 3H0GK 4LLGA 4MEXA 3DXJA 3GTKK 3HOUK 3K7AC 3M3YK 3S1NK 4A3GC 1TWCC 1TWFK 4BY1C 4BY7C 3S1RK 5M3MK 4C2MK 1TWHC 5C44K 4A3FK 2NVQC 5D4DA 2JA6C 4LJZA 3S2DK 4BY1K 3GTLK 2JA5C 4Q4ZA 5C3EC 3I4MK 3PO2K 2R93K 3EQLA 4XSZA 3M4OK 2Y0SD 2O5IA 2PPBA 3GTLC 1I50C 3S14C 4XLNA 3S17C 4BBSC 4AYBD 5IYBK 1SMYA 1K83K 1Y1VC 3GTOC 3PO3K 3S17K 3S16K 5IP9C 4A3LK 2E2HC 4A3EK 3WODA 2WAQL 3HOZC 4A3CK 2JA8C 1SFOC 3HOWK 3S15C 2NVXK 1HQMA 4LK1A 4X6AC 1SFOK 3GTPK 5FLMC 2NVXC 3HOXC 4Y7NK 3S2HK 3GTGC 1I3QC 1TWGK 3HOXK 4A3KK 3S1MK 4G7OA
chains in the Genus database with same CATH superfamily
2R93C 1WCMC 4KN4A 4MQ9A 4LR2A 1F93A 1C0AA 4BKWA 4RMFA 4QIWD 5IP7C 1I50A 4A3CC 1YNNA 4C3IK 2FQTA 2GAGC 2E2HA 1F9NA 3AH5A 4A3MC 1TWAK 2NVYC 4OIPA 3HOWC 2A69A 3GTQK 4KN7A 4KMAA 2GAHC 3CQZK 1I3QK 1IW7A 4KMUA 1JQWA 5C3EK 3OREA 4PAAA 4A3IK 4BXXK 3T01A 3RZDC 2WB1D 3GTMA 4C3IC 3L4JA 3FOFA 1K83A 2YU9K 1VGXA 1BDFA 3TFIA 3MMLB 4WJ4A 1VH2A 1XPPA 2P8TA 2PA8D 4FM9A 4X6AK 3GTQC 4LOWA 2JA8K 1L0WA 3S1NC 4QJVA 2RGRA 4M1XA 1TWCA 1HI9A 2PA8L 2XCOA 4Y7NC 4P5AA 1WCMK 2JA5K 1RU0A 3I4NK 3CAGA 3FOEA 3QX3A 3GTOA 4FZBA 5IYDK 1O24A 2V6SA 3VA7A 2R7ZK 3S1QC 5IOQA 3NUHA 3GTOK 1I6HK 2Y3PA 5IORA 4G0UA 4C3HK 1TWAC 2NVYK 3AQPA 4LLGA 3M3YK 3DXJA 3GTKK 2ZUEA 1TWCC 1TWFK 4BY1C 4C45A 5M3MK 4A3FK 3S2DK 2NVQC 5D4DA 4LJZA 1USOA 3S17C 1PJ6A 3BP3A 1SMYA 3GTOC 3PO3K 3S16K 4A3EK 1AB4A 3HOZC 2JA8C 3AD9C 3GTJA 4X6AC 1F7UA 1GE9A 5FLMC 4GTCA 3GTGC 4J3NA 3HOXK 2GSUA 4C2MC 5C44C 3S2DC 1JVIA 3GEIA 4A3KC 2FQOA 2VUMK 1UV7A 2E2JC 1XXBA 5L46A 3S14K 2JA6A 1TWHA 2GSNA 2E2IA 3AD8C 4Y52C 2NVTK 5C4JK 4KC6A 4A3JK 3TFJA 4A3EC 1I50K 3RZOC 3GTMK 3GSIA 5IYCC 1SFOA 3LAPA 3GTGK 4YFXA 3GTJC 2P5MA 2ZUFA 2ZFZA 4A3BK 3FKIK 4A3DC 3CQZA 3GEEA 4GZYA 2R7ZA 3AQOA 1BS2A 2R93A 1ZXOA 1WCMA 4DDQA 3GEHA 5TJ3A 2B63K 2R92K 1R9TC 5IOSA 1IQ0A 3M4OC 3HOYK 4O2DA 4KMDA 5C4XC 1XXCA 3S0XA 4LK0A 4AH6A 3HKZL 3H3VL 3HOZK 1Y1WC 4C3JC 3K7AK 4A3MK 3HKZD 2V6TA 1KQ4A 1XZPB 3HOVK 1JOEA 3CQZC 4BBRK 1O28A 3GTLA 5M5XK 1YNJA 2R7ZC 1J98A 3G4AA 3HOYC 2YU9C 1ISEA 4AYBL 1XZQB 4YG2A 1R9TA 3GTMC 5C4JC 1K83C 5IOTA 2WB1L 2A6EA 1YCLA 2NVXA 4G7ZA 5TMCA 3GTQA 3H0GK 2CFAA 3BP8C 3S1NK 3LAJA 4A3GC 3TFHA 1DCPA 3V4GA 5CJ9A 2JA5C 3I4MK 3EQLA 3M4OK 2Y0SD 4BBSC 3GTLC 2XCRB 4XLNA 1K83K 1Y1VC 2YU9A 4GTEA 5JVOA 4KASA 2WAQL 4GFQA 3HOWK 1J6VA 1HQMA 4LK1A 1EFWA 1WOOA 2NVXC 3HOXC 1EH1A 1O2FB 1TWGK 4G7OA 2RH6A 3M3YC 4BBRC 1VRQC 3SZYA 4Y52K 4ZH4A 4A93C 4BBSK 1TWHK 2NVQK 4A3JC 1ZYRA 1XZPA 3A8JA 5IP7K 3PO3C 4OIQA 3GTKA 5EGEA 3S15K 1VLOA 1WQHA 4YFKA 4A3GK 1O29A 1WQGA 5E68A 5FLMK 4GTFA 3N0BA 1WIHA 3I4MC 2JH3A 3N3YA 2VUMC 4BXXC 2E2IC 3IPJA 3N0CA 4MEYA 2A6HA 4KM8A 4G0VA 3BUEA 4OIRA 2NVTC 2PMZL 4WJ3M 3H0GA 4C3JK 4KMHA 4GTBA 5HL8A 3GTJK 2JA7K 1WQFA 3FKIC 1WSRA 2CW0A 3A8KA 3HOUC 4A93K 1O2BA 4XSXA 1XZQA 3H3VD 2WAQD 2V6UA 4A3IC 4XLPA 4KB4A 3S16C 2GSOA 4A3LC 1X31C 4KDDA 3RZDK 3L4KA 1I6HC 3Q3QA 1R9TK 3A8IA 3S1QK 4XCHA 1PJ7A 3JSTA 1DCOA 1Y1WK 2A68A 2E2HK 1ZBSA 4PABA 1Y1WA 4MEXA 3HOUK 3FKIA 1EK8A 4GT9A 4KAWX 1EQRA 4BY7C 4GTAA 3S1RK 3OPFA 4Q4ZA 2PHCB 4BLAA 1WSVA 1ZQ1C 5EGHA 4KB2A 1I50C 2KWAA 4GTLA 2PPBA 1IBAA 4AYBD 1O26A 1BJTA 1INNA 5IYBK 1O27A 3S17K 4GTDA 2E2HC 3GTPA 4A3CK 4BLBA 1SFOK 3GTPK 3S2HK 1I3QC 1WORA 4A3KK 4KM9A 3S1MK 3GIRA 4OIOA 5M3FK 1TWCK 1ZVUA 3FHZA 4A3FC 2E2JK 4Q5SA 1I6VA 2JA5A 1Y1VK 3SZZA 2BE5A 2EBBA 1B4BA 2CFAB 4WILA 1Y1VA 4G7HA 3AD7C 5M5YK 3GTPC 4YFNA 5TMFA 1B4AA 3RZOK 1BGWA 1TWGC 4A3BC 4LQYA 4A3DK 4QIWL 1O2AA 4BY7K 1I3QA 3I4NC 2W7VA 2B63C 2R92C 2E2IK 3S1RC 4P9SA 3T02A 1F7VA 1J6WA 5FJ8K 1IL2A 1O25A 4NOIA 5IP9K 1WOPA 2XCQA 4JK1A 1IE0A 5IYDC 1DCHA 5IYBC 4QJVB 4OINA 3LPXA 1G51A 1TWAA 3HXAA 4G0WA 3GTKC 5IYCK 3S1MC 3TTGA 1TWGA 4C3HC 1TWFC 1EI6A 1IS1A 4ILDA 3HOVC 3S2HC 5JFEA 1PJ5A 3GDZA 4P5BA 3OEPA 2JA6K 2R92A 2B63A 3G4CA 2VUMA 2O5JA 3PO2C 1XXAA 3ERED 1YX2A 1DD5A 1J6XA 2PMZD 5C4XK 2JA7C 4KATA 2Y0SL 5M5WK 3H0GC 3ADAC 3GTGA 5CHPA 3T00A 3K7AC 4KARA 1WOSA 1TWFA 2JA6C 4C2MK 1TWHC 5C44K 4BY1K 2D6FC 3GTLK 3PO2K 5C3EC 2R93K 4XSZA 1USMA 2O5IA 3S14C 1VJEA 5IP9C 4A3LK 3WODA 1V5VA 2NVYA 1SFOC 3S15C 2NVXK 2JA7A 4Y7NK
chains in the Genus database with same CATH topology
5C44C 3M3YC 4OIOA 3S2DC 5M3FK 4BBRC 4A3KC 2VUMK 2R93C 4Y52K 1TWCK 2E2JC 4ZH4A 1WCMC 4KN4A 4MQ9A 3S14K 4A93C 4BBSK 1TWHK 4Y52C 4A3FC 2NVQK 2E2JK 4A3JC 1I6VA 1ZYRA 1Y1VK 4Q5SA 2BE5A 2NVTK 5C4JK 4A3JK 4QIWD 5IP7C 4A3EC 1I50K 4A3CC 1YNNA 4C3IK 5IP7K 3RZOC 4G7HA 3PO3C 4OIQA 3GTMK 5M5YK 3GTPC 4YFNA 5IYCC 5TMFA 1TWAK 2NVYC 4OIPA 4A3MC 3RZOK 3GTGK 3HOWC 1TWGC 2A69A 4YFXA 3GTQK 4KN7A 4YFKA 3GTJC 3S15K 4A3BC 4A3DK 4A3GK 5FLMK 4QIWL 4BY7K 4A3BK 3FKIK 4A3DC 3CQZK 1I3QK 3I4NC 1IW7A 4KMUA 5C3EK 3I4MC 4GZYA 4A3IK 2B63C 2R92C 4BXXK 2E2IK 3S1RC 2VUMC 2B63K 2R92K 3RZDC 2E2IC 4BXXC 5FJ8K 1R9TC 2WB1D 4MEYA 4NOIA 5IP9K 3M4OC 2A6HA 4JK1A 4OIRA 3HOYK 5IYDC 2YU9K 5C4XC 2NVTC 2PMZL 1BDFA 5IYBC 4QJVB 4OINA 1XPPA 2PA8D 4X6AK 4C3JK 4LK0A 3GTQC 3GTJK 3HKZL 3H3VL 3HOZK 1Y1WC 2JA7K 2JA8K 3GTKC 3S1NC 3K7AK 4QJVA 5IYCK 4A3MK 3HKZD 3S1MC 3FKIC 2CW0A 1TWFC 2PA8L 3HOVC 4Y7NC 3S2HC 3HOUC 1WCMK 4A93K 4XSXA 2JA5K 3H3VD 3HOVK 3CQZC 3I4NK 4BBRK 2WAQD 5M5XK 2JA6K 1YNJA 2R7ZC 4A3IC 4XLPA 3HOYC 2YU9C 3PO2C 2O5JA 5IYDK 3S16C 2R7ZK 3S1QC 4A3LC 4AYBL 4YG2A 3RZDK 1I6HC 1R9TK 2PMZD 3GTMC 5C4JC 3S1QK 1K83C 3GTOK 1I6HK 5C4XK 1Y1WK 2JA7C 2WB1L 2A68A 2E2HK 2A6EA 2Y0SL 5M5WK 3H0GC 4G7ZA 5TMCA 4C3HK 1TWAC 2NVYK 3H0GK 4LLGA 4MEXA 3DXJA 3GTKK 3HOUK 3K7AC 3M3YK 3S1NK 4A3GC 1TWCC 1TWFK 4BY1C 4BY7C 3S1RK 5M3MK 4C2MK 1TWHC 5C44K 4A3FK 2NVQC 5D4DA 2JA6C 4LJZA 3S2DK 4BY1K 3GTLK 2JA5C 4Q4ZA 5C3EC 3I4MK 3PO2K 2R93K 3EQLA 4XSZA 3M4OK 2Y0SD 2O5IA 2PPBA 3GTLC 1I50C 3S14C 4XLNA 3S17C 4BBSC 4AYBD 5IYBK 1SMYA 1K83K 1Y1VC 3GTOC 3PO3K 3S17K 3S16K 5IP9C 4A3LK 2E2HC 4A3EK 3WODA 2WAQL 3HOZC 4A3CK 2JA8C 1SFOC 3HOWK 3S15C 2NVXK 1HQMA 4LK1A 4X6AC 1SFOK 3GTPK 5FLMC 2NVXC 3HOXC 4Y7NK 3S2HK 3GTGC 1I3QC 1TWGK 3HOXK 4A3KK 3S1MK 4G7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 C;  3M3Y C;  4OIO A;  3S2D C;  5M3F K;  4BBR C;  4A3K C;  2VUM K;  2R93 C;  4Y52 K;  1TWC K;  2E2J C;  4ZH4 A;  1WCM C;  4KN4 A;  4MQ9 A;  3S14 K;  4A93 C;  4BBS K;  1TWH K;  4Y52 C;  4A3F C;  2NVQ K;  2E2J K;  4A3J C;  1I6V A;  1ZYR A;  1Y1V K;  4Q5S A;  2BE5 A;  2NVT K;  5C4J K;  4A3J K;  4QIW D;  5IP7 C;  4A3E C;  1I50 K;  4A3C C;  1YNN A;  4C3I K;  5IP7 K;  3RZO C;  4G7H A;  3PO3 C;  4OIQ A;  3GTM K;  5M5Y K;  3GTP C;  4YFN A;  5IYC C;  5TMF A;  1TWA K;  2NVY C;  4OIP A;  4A3M C;  3RZO K;  3GTG K;  3HOW C;  1TWG C;  2A69 A;  4YFX A;  3GTQ K;  4KN7 A;  4YFK A;  3GTJ C;  3S15 K;  4A3B C;  4A3D K;  4A3G K;  5FLM K;  4QIW L;  4BY7 K;  4A3B K;  3FKI K;  4A3D C;  3CQZ K;  1I3Q K;  3I4N C;  1IW7 A;  4KMU A;  5C3E K;  3I4M C;  4GZY A;  4A3I K;  2B63 C;  2R92 C;  4BXX K;  2E2I K;  3S1R C;  2VUM C;  2B63 K;  2R92 K;  3RZD C;  2E2I C;  4BXX C;  5FJ8 K;  1R9T C;  2WB1 D;  4MEY A;  4NOI A;  5IP9 K;  3M4O C;  2A6H A;  4JK1 A;  4OIR A;  3HOY K;  5IYD C;  2YU9 K;  5C4X C;  2NVT C;  2PMZ L;  1BDF A;  5IYB C;  4QJV B;  4OIN A;  1XPP A;  2PA8 D;  4X6A K;  4C3J K;  4LK0 A;  3GTQ C;  3GTJ K;  3HKZ L;  3H3V L;  3HOZ K;  1Y1W C;  2JA7 K;  2JA8 K;  3GTK C;  3S1N C;  3K7A K;  4QJV A;  5IYC K;  4A3M K;  3HKZ D;  3S1M C;  3FKI C;  2CW0 A;  1TWF C;  2PA8 L;  3HOV C;  4Y7N C;  3S2H C;  3HOU C;  1WCM K;  4A93 K;  4XSX A;  2JA5 K;  3H3V D;  3HOV K;  3CQZ C;  3I4N K;  4BBR K;  2WAQ D;  5M5X K;  2JA6 K;  1YNJ A;  2R7Z C;  4A3I C;  4XLP A;  3HOY C;  2YU9 C;  3PO2 C;  2O5J A;  5IYD K;  3S16 C;  2R7Z K;  3S1Q C;  4A3L C;  4AYB L;  4YG2 A;  3RZD K;  1I6H C;  1R9T K;  2PMZ D;  3GTM C;  5C4J C;  3S1Q K;  1K83 C;  3GTO K;  1I6H K;  5C4X K;  1Y1W K;  2JA7 C;  2WB1 L;  2A68 A;  2E2H K;  2A6E A;  2Y0S L;  5M5W K;  3H0G C;  4G7Z A;  5TMC A;  4C3H K;  1TWA C;  2NVY K;  3H0G K;  4LLG A;  4MEX A;  3DXJ A;  3GTK K;  3HOU K;  3K7A C;  3M3Y K;  3S1N K;  4A3G C;  1TWC C;  1TWF K;  4BY1 C;  4BY7 C;  3S1R K;  5M3M K;  4C2M K;  1TWH C;  5C44 K;  4A3F K;  2NVQ C;  5D4D A;  2JA6 C;  4LJZ A;  3S2D K;  4BY1 K;  3GTL K;  2JA5 C;  4Q4Z A;  5C3E C;  3I4M K;  3PO2 K;  2R93 K;  3EQL A;  4XSZ A;  3M4O K;  2Y0S D;  2O5I A;  2PPB A;  3GTL C;  1I50 C;  3S14 C;  4XLN A;  3S17 C;  4BBS C;  4AYB D;  5IYB K;  1SMY A;  1K83 K;  1Y1V C;  3GTO C;  3PO3 K;  3S17 K;  3S16 K;  5IP9 C;  4A3L K;  2E2H C;  4A3E K;  3WOD A;  2WAQ L;  3HOZ C;  4A3C K;  2JA8 C;  1SFO C;  3HOW K;  3S15 C;  2NVX K;  1HQM A;  4LK1 A;  4X6A C;  1SFO K;  3GTP K;  5FLM C;  2NVX C;  3HOX C;  4Y7N K;  3S2H K;  3GTG C;  1I3Q C;  1TWG K;  3HOX K;  4A3K K;  3S1M K;  4G7O A; 
#chains in the Genus database with same CATH topology
 2R93 C;  1WCM C;  4KN4 A;  4MQ9 A;  4LR2 A;  1F93 A;  1C0A A;  4BKW A;  4RMF A;  4QIW D;  5IP7 C;  1I50 A;  4A3C C;  1YNN A;  4C3I K;  2FQT A;  2GAG C;  2E2H A;  1F9N A;  3AH5 A;  4A3M C;  1TWA K;  2NVY C;  4OIP A;  3HOW C;  2A69 A;  3GTQ K;  4KN7 A;  4KMA A;  2GAH C;  3CQZ K;  1I3Q K;  1IW7 A;  4KMU A;  1JQW A;  5C3E K;  3ORE A;  4PAA A;  4A3I K;  4BXX K;  3T01 A;  3RZD C;  2WB1 D;  3GTM A;  4C3I C;  3L4J A;  3FOF A;  1K83 A;  2YU9 K;  1VGX A;  1BDF A;  3TFI A;  3MML B;  4WJ4 A;  1VH2 A;  1XPP A;  2P8T A;  2PA8 D;  4FM9 A;  4X6A K;  3GTQ C;  4LOW A;  2JA8 K;  1L0W A;  3S1N C;  4QJV A;  2RGR A;  4M1X A;  1TWC A;  1HI9 A;  2PA8 L;  2XCO A;  4Y7N C;  4P5A A;  1WCM K;  2JA5 K;  1RU0 A;  3I4N K;  3CAG A;  3FOE A;  3QX3 A;  3GTO A;  4FZB A;  5IYD K;  1O24 A;  2V6S A;  3VA7 A;  2R7Z K;  3S1Q C;  5IOQ A;  3NUH A;  3GTO K;  1I6H K;  2Y3P A;  5IOR A;  4G0U A;  4C3H K;  1TWA C;  2NVY K;  3AQP A;  4LLG A;  3M3Y K;  3DXJ A;  3GTK K;  2ZUE A;  1TWC C;  1TWF K;  4BY1 C;  4C45 A;  5M3M K;  4A3F K;  3S2D K;  2NVQ C;  5D4D A;  4LJZ A;  1USO A;  3S17 C;  1PJ6 A;  3BP3 A;  1SMY A;  3GTO C;  3PO3 K;  3S16 K;  4A3E K;  1AB4 A;  3HOZ C;  2JA8 C;  3AD9 C;  3GTJ A;  4X6A C;  1F7U A;  1GE9 A;  5FLM C;  4GTC A;  3GTG C;  4J3N A;  3HOX K;  2GSU A;  4C2M C;  5C44 C;  3S2D C;  1JVI A;  3GEI A;  4A3K C;  2FQO A;  2VUM K;  1UV7 A;  2E2J C;  1XXB A;  5L46 A;  3S14 K;  2JA6 A;  1TWH A;  2GSN A;  2E2I A;  3AD8 C;  4Y52 C;  2NVT K;  5C4J K;  4KC6 A;  4A3J K;  3TFJ A;  4A3E C;  1I50 K;  3RZO C;  3GTM K;  3GSI A;  5IYC C;  1SFO A;  3LAP A;  3GTG K;  4YFX A;  3GTJ C;  2P5M A;  2ZUF A;  2ZFZ A;  4A3B K;  3FKI K;  4A3D C;  3CQZ A;  3GEE A;  4GZY A;  2R7Z A;  3AQO A;  1BS2 A;  2R93 A;  1ZXO A;  1WCM A;  4DDQ A;  3GEH A;  5TJ3 A;  2B63 K;  2R92 K;  1R9T C;  5IOS A;  1IQ0 A;  3M4O C;  3HOY K;  4O2D A;  4KMD A;  5C4X C;  1XXC A;  3S0X A;  4LK0 A;  4AH6 A;  3HKZ L;  3H3V L;  3HOZ K;  1Y1W C;  4C3J C;  3K7A K;  4A3M K;  3HKZ D;  2V6T A;  1KQ4 A;  1XZP B;  3HOV K;  1JOE A;  3CQZ C;  4BBR K;  1O28 A;  3GTL A;  5M5X K;  1YNJ A;  2R7Z C;  1J98 A;  3G4A A;  3HOY C;  2YU9 C;  1ISE A;  4AYB L;  1XZQ B;  4YG2 A;  1R9T A;  3GTM C;  5C4J C;  1K83 C;  5IOT A;  2WB1 L;  2A6E A;  1YCL A;  2NVX A;  4G7Z A;  5TMC A;  3GTQ A;  3H0G K;  2CFA A;  3BP8 C;  3S1N K;  3LAJ A;  4A3G C;  3TFH A;  1DCP A;  3V4G A;  5CJ9 A;  2JA5 C;  3I4M K;  3EQL A;  3M4O K;  2Y0S D;  4BBS C;  3GTL C;  2XCR B;  4XLN A;  1K83 K;  1Y1V C;  2YU9 A;  4GTE A;  5JVO A;  4KAS A;  2WAQ L;  4GFQ A;  3HOW K;  1J6V A;  1HQM A;  4LK1 A;  1EFW A;  1WOO A;  2NVX C;  3HOX C;  1EH1 A;  1O2F B;  1TWG K;  4G7O A;  2RH6 A;  3M3Y C;  4BBR C;  1VRQ C;  3SZY A;  4Y52 K;  4ZH4 A;  4A93 C;  4BBS K;  1TWH K;  2NVQ K;  4A3J C;  1ZYR A;  1XZP A;  3A8J A;  5IP7 K;  3PO3 C;  4OIQ A;  3GTK A;  5EGE A;  3S15 K;  1VLO A;  1WQH A;  4YFK A;  4A3G K;  1O29 A;  1WQG A;  5E68 A;  5FLM K;  4GTF A;  3N0B A;  1WIH A;  3I4M C;  2JH3 A;  3N3Y A;  2VUM C;  4BXX C;  2E2I C;  3IPJ A;  3N0C A;  4MEY A;  2A6H A;  4KM8 A;  4G0V A;  3BUE A;  4OIR A;  2NVT C;  2PMZ L;  4WJ3 M;  3H0G A;  4C3J K;  4KMH A;  4GTB A;  5HL8 A;  3GTJ K;  2JA7 K;  1WQF A;  3FKI C;  1WSR A;  2CW0 A;  3A8K A;  3HOU C;  4A93 K;  1O2B A;  4XSX A;  1XZQ A;  3H3V D;  2WAQ D;  2V6U A;  4A3I C;  4XLP A;  4KB4 A;  3S16 C;  2GSO A;  4A3L C;  1X31 C;  4KDD A;  3RZD K;  3L4K A;  1I6H C;  3Q3Q A;  1R9T K;  3A8I A;  3S1Q K;  4XCH A;  1PJ7 A;  3JST A;  1DCO A;  1Y1W K;  2A68 A;  2E2H K;  1ZBS A;  4PAB A;  1Y1W A;  4MEX A;  3HOU K;  3FKI A;  1EK8 A;  4GT9 A;  4KAW X;  1EQR A;  4BY7 C;  4GTA A;  3S1R K;  3OPF A;  4Q4Z A;  2PHC B;  4BLA A;  1WSV A;  1ZQ1 C;  5EGH A;  4KB2 A;  1I50 C;  2KWA A;  4GTL A;  2PPB A;  1IBA A;  4AYB D;  1O26 A;  1BJT A;  1INN A;  5IYB K;  1O27 A;  3S17 K;  4GTD A;  2E2H C;  3GTP A;  4A3C K;  4BLB A;  1SFO K;  3GTP K;  3S2H K;  1I3Q C;  1WOR A;  4A3K K;  4KM9 A;  3S1M K;  3GIR A;  4OIO A;  5M3F K;  1TWC K;  1ZVU A;  3FHZ A;  4A3F C;  2E2J K;  4Q5S A;  1I6V A;  2JA5 A;  1Y1V K;  3SZZ A;  2BE5 A;  2EBB A;  1B4B A;  2CFA B;  4WIL A;  1Y1V A;  4G7H A;  3AD7 C;  5M5Y K;  3GTP C;  4YFN A;  5TMF A;  1B4A A;  3RZO K;  1BGW A;  1TWG C;  4A3B C;  4LQY A;  4A3D K;  4QIW L;  1O2A A;  4BY7 K;  1I3Q A;  3I4N C;  2W7V A;  2B63 C;  2R92 C;  2E2I K;  3S1R C;  4P9S A;  3T02 A;  1F7V A;  1J6W A;  5FJ8 K;  1IL2 A;  1O25 A;  4NOI A;  5IP9 K;  1WOP A;  2XCQ A;  4JK1 A;  1IE0 A;  5IYD C;  1DCH A;  5IYB C;  4QJV B;  4OIN A;  3LPX A;  1G51 A;  1TWA A;  3HXA A;  4G0W A;  3GTK C;  5IYC K;  3S1M C;  3TTG A;  1TWG A;  4C3H C;  1TWF C;  1EI6 A;  1IS1 A;  4ILD A;  3HOV C;  3S2H C;  5JFE A;  1PJ5 A;  3GDZ A;  4P5B A;  3OEP A;  2JA6 K;  2R92 A;  2B63 A;  3G4C A;  2VUM A;  2O5J A;  3PO2 C;  1XXA A;  3ERE D;  1YX2 A;  1DD5 A;  1J6X A;  2PMZ D;  5C4X K;  2JA7 C;  4KAT A;  2Y0S L;  5M5W K;  3H0G C;  3ADA C;  3GTG A;  5CHP A;  3T00 A;  3K7A C;  4KAR A;  1WOS A;  1TWF A;  2JA6 C;  4C2M K;  1TWH C;  5C44 K;  4BY1 K;  2D6F C;  3GTL K;  3PO2 K;  5C3E C;  2R93 K;  4XSZ A;  1USM A;  2O5I A;  3S14 C;  1VJE A;  5IP9 C;  4A3L K;  3WOD A;  1V5V A;  2NVY A;  1SFO C;  3S15 C;  2NVX K;  2JA7 A;  4Y7N K; 
#chains in the Genus database with same CATH homology
 5C44 C;  3M3Y C;  4OIO A;  3S2D C;  5M3F K;  4BBR C;  4A3K C;  2VUM K;  2R93 C;  4Y52 K;  1TWC K;  2E2J C;  4ZH4 A;  1WCM C;  4KN4 A;  4MQ9 A;  3S14 K;  4A93 C;  4BBS K;  1TWH K;  4Y52 C;  4A3F C;  2NVQ K;  2E2J K;  4A3J C;  1I6V A;  1ZYR A;  1Y1V K;  4Q5S A;  2BE5 A;  2NVT K;  5C4J K;  4A3J K;  4QIW D;  5IP7 C;  4A3E C;  1I50 K;  4A3C C;  1YNN A;  4C3I K;  5IP7 K;  3RZO C;  4G7H A;  3PO3 C;  4OIQ A;  3GTM K;  5M5Y K;  3GTP C;  4YFN A;  5IYC C;  5TMF A;  1TWA K;  2NVY C;  4OIP A;  4A3M C;  3RZO K;  3GTG K;  3HOW C;  1TWG C;  2A69 A;  4YFX A;  3GTQ K;  4KN7 A;  4YFK A;  3GTJ C;  3S15 K;  4A3B C;  4A3D K;  4A3G K;  5FLM K;  4QIW L;  4BY7 K;  4A3B K;  3FKI K;  4A3D C;  3CQZ K;  1I3Q K;  3I4N C;  1IW7 A;  4KMU A;  5C3E K;  3I4M C;  4GZY A;  4A3I K;  2B63 C;  2R92 C;  4BXX K;  2E2I K;  3S1R C;  2VUM C;  2B63 K;  2R92 K;  3RZD C;  2E2I C;  4BXX C;  5FJ8 K;  1R9T C;  2WB1 D;  4MEY A;  4NOI A;  5IP9 K;  3M4O C;  2A6H A;  4JK1 A;  4OIR A;  3HOY K;  5IYD C;  2YU9 K;  5C4X C;  2NVT C;  2PMZ L;  1BDF A;  5IYB C;  4QJV B;  4OIN A;  1XPP A;  2PA8 D;  4X6A K;  4C3J K;  4LK0 A;  3GTQ C;  3GTJ K;  3HKZ L;  3H3V L;  3HOZ K;  1Y1W C;  2JA7 K;  2JA8 K;  3GTK C;  3S1N C;  3K7A K;  4QJV A;  5IYC K;  4A3M K;  3HKZ D;  3S1M C;  3FKI C;  2CW0 A;  1TWF C;  2PA8 L;  3HOV C;  4Y7N C;  3S2H C;  3HOU C;  1WCM K;  4A93 K;  4XSX A;  2JA5 K;  3H3V D;  3HOV K;  3CQZ C;  3I4N K;  4BBR K;  2WAQ D;  5M5X K;  2JA6 K;  1YNJ A;  2R7Z C;  4A3I C;  4XLP A;  3HOY C;  2YU9 C;  3PO2 C;  2O5J A;  5IYD K;  3S16 C;  2R7Z K;  3S1Q C;  4A3L C;  4AYB L;  4YG2 A;  3RZD K;  1I6H C;  1R9T K;  2PMZ D;  3GTM C;  5C4J C;  3S1Q K;  1K83 C;  3GTO K;  1I6H K;  5C4X K;  1Y1W K;  2JA7 C;  2WB1 L;  2A68 A;  2E2H K;  2A6E A;  2Y0S L;  5M5W K;  3H0G C;  4G7Z A;  5TMC A;  4C3H K;  1TWA C;  2NVY K;  3H0G K;  4LLG A;  4MEX A;  3DXJ A;  3GTK K;  3HOU K;  3K7A C;  3M3Y K;  3S1N K;  4A3G C;  1TWC C;  1TWF K;  4BY1 C;  4BY7 C;  3S1R K;  5M3M K;  4C2M K;  1TWH C;  5C44 K;  4A3F K;  2NVQ C;  5D4D A;  2JA6 C;  4LJZ A;  3S2D K;  4BY1 K;  3GTL K;  2JA5 C;  4Q4Z A;  5C3E C;  3I4M K;  3PO2 K;  2R93 K;  3EQL A;  4XSZ A;  3M4O K;  2Y0S D;  2O5I A;  2PPB A;  3GTL C;  1I50 C;  3S14 C;  4XLN A;  3S17 C;  4BBS C;  4AYB D;  5IYB K;  1SMY A;  1K83 K;  1Y1V C;  3GTO C;  3PO3 K;  3S17 K;  3S16 K;  5IP9 C;  4A3L K;  2E2H C;  4A3E K;  3WOD A;  2WAQ L;  3HOZ C;  4A3C K;  2JA8 C;  1SFO C;  3HOW K;  3S15 C;  2NVX K;  1HQM A;  4LK1 A;  4X6A C;  1SFO K;  3GTP K;  5FLM C;  2NVX C;  3HOX C;  4Y7N K;  3S2H K;  3GTG C;  1I3Q C;  1TWG K;  3HOX K;  4A3K K;  3S1M K;  4G7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...