3RZDK

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzdK00
4G7HA 2JA5C 1TWFK 4Q5SA 4OINA 3RZDC 4Y7NC 4X6AK 4A3FC 2R7ZK 3HOXC 4BXXC 2O5JA 4C3IK 1I6HK 1I6HC 1SFOK 4OIRA 3WODA 2VUMK 3M3YC 4A3BK 5IP7K 3CQZC 4BBRK 1TWCC 5FLMK 3GTJC 2YU9C 2PMZL 3HOUK 3S1MC 4A3EK 4G7OA 4A3DK 4MEXA 2WB1L 2R92C 4XLNA 3S15K 1WCMC 2E2JK 3HOXK 5IYCK 3S14C 1TWAK 2NVTC 1TWAC 2NVTK 2NVYK 2A6EA 2NVYC 3GTPC 3GTPK 4A3CK 3S2DC 4A3LC 3S17K 3S17C 4JK1A 1TWGC 3S2HK 1ZYRA 1TWFC 2R93C 4AYBL 4BY1K 3K7AK 2JA7C 2E2HK 1I3QK 4A3GK 2E2JC 1I50C 3H0GK 2R92K 4A93C 2Y0SD 2R7ZC 3S1NC 3H3VD 2JA6C 2Y0SL 1TWGK 4X6AC 4MEYA 5C44K 2B63K 5M5XK 1Y1WC 4QJVA 3S2HC 3GTLK 4OIOA 3HKZD 4KN4A 1I50K 3H0GC 5IP9K 3HOZC 4A3JC 2BE5A 3S15C 3GTKC 4BY7C 3FKIK 5FJ8K 3RZDK 2CW0A 4YFNA 2JA8K 1I6VA 2JA8C 3S1QK 5IYDK 3S2DK 4QIWL 3S1RC 1BDFA 3GTGC 2A68A 5M3MK 5IYCC 3HOZK 1YNJA 3PO3C 3S14K 2PA8L 4A3KC 3K7AC 4OIQA 4Y52C 3RZOC 4GZYA 4KMUA 3GTOC 3I4MK 3GTOK 3I4MC 4BBSK 5IYBK 5IYDC 1TWCK 3S1NK 4XSXA 3FKIC 4NOIA 2NVXC 2PMZD 4LK1A 2E2HC 4KN7A 3PO2C 3GTMK 3I4NC 3HOYC 4ZH4A 1TWHK 4LLGA 1R9TC 2NVQK 4YFKA 4A3MC 4A3LK 1XPPA 4A3MK 1SMYA 2WB1D 2B63C 5IYBC 2WAQL 5FLMC 5D4DA 3GTJK 3HOUC 3S1MK 5C4JC 3GTLC 3PO2K 4YG2A 2PA8D 3I4NK 2E2IC 1Y1VK 5TMCA 1WCMK 5M5WK 4XSZA 3HOYK 1IW7A 4A93K 1YNNA 3RZOK 4LJZA 4BBSC 3CQZK 1HQMA 4BBRC 2YU9K 4BXXK 4Y52K 1SFOC 3M4OC 2R93K 4A3JK 4BY1C 2JA7K 3HKZL 4XLPA 4QJVB 5C4JK 4YFXA 5C3EK 3S1QC 1Y1VC 2JA5K 5IP9C 3GTKK 4BY7K 2PPBA 2O5IA 5M5YK 4QIWD 3GTMC 2A6HA 4A3BC 4A3DC 1K83K 3S16K 3M4OK 1Y1WK 5C4XC 4A3EC 1TWHC 1I3QC 4AYBD 3HOVK 5C3EC 3HOVC 2VUMC 3M3YK 4Q4ZA 5IP7C 3GTQK 3GTQC 2NVXK 3DXJA 3HOWK 4C3HK 4LK0A 3HOWC 4MQ9A 2A69A 5C44C 2E2IK 3S1RK 5TMFA 3GTGK 4C2MK 2JA6K 4Y7NK 3PO3K 5C4XK 3H3VL 4C3JK 4A3FK 5M3FK 2NVQC 1K83C 4A3IK 4A3KK 4A3IC 3S16C 4G7ZA 4A3CC 3EQLA 1R9TK 4A3GC 4OIPA 2WAQD
chains in the Genus database with same CATH superfamily
2JA5C 1TWFK 5JVOA 1B4AA 3TFJA 3BP3A 2B63A 2JA6A 3OEPA 4GTBA 4C3IK 3GTQA 1I6HC 4OIRA 4A3BK 4A3DK 5IP7K 4BBRK 3GTJC 2PMZL 2V6SA 2JH3A 4MEXA 4WILA 1UV7A 4XLNA 3S15K 4P5AA 5IYCK 2NVTC 3GTPC 3GIRA 2XCOA 1WSVA 3N3YA 4JK1A 1TWGC 3LAJA 3S2HK 1YCLA 2FQTA 2JA7C 1ZVUA 1L0WA 1XZPB 2E2HK 4A3GK 4KB4A 4FM9A 4J3NA 2R92K 3V4GA 4A93C 2Y0SD 3CAGA 3IPJA 2R7ZC 4WJ4A 1EK8A 4KDDA 1TWGK 4X6AC 4MEYA 2B63K 1F9NA 3HKZD 4KN4A 4BKWA 3S15C 1R9TA 3GTKC 3RZDK 1O27A 5IYDK 4QIWL 2XCQA 2P8TA 2E2IA 3PO3C 3S14K 3RZOC 4GZYA 4BBSK 3I4MK 1VH2A 3S0XA 5IYDC 1PJ6A 4XSXA 3ERED 2E2HC 3GTMK 4KATA 4LLGA 1R9TC 3GTKA 4A3MK 2B63C 1O2FB 5FLMC 3HOUC 3S1MK 5C4JC 4C3HC 4YG2A 1TWGA 1HI9A 3GEIA 4XSZA 3RZOK 4G0UA 4BBSC 4BBRC 2R92A 4GT9A 2E2HA 4BY1C 4YFXA 5C3EK 2RH6A 1WSRA 3S1QC 4BY7K 2RGRA 3GTMC 3OREA 1X31C 3A8KA 1IS1A 1I3QC 1TWCA 3HOVK 5C3EC 1EI6A 3HXAA 4Q4ZA 3GTQK 4KMDA 4C3HK 3GDZA 4LK0A 1EH1A 2CFAA 4GTDA 3Q3QA 2JA6K 3H3VL 1F93A 4G0WA 2NVQC 1K83C 3AH5A 3S16C 1TWFA 3EQLA 3SZYA 3G4CA 1I50A 3RZDC 1USOA 2V6UA 3HOXC 3QX3A 1I6HK 3H0GA 5IOSA 4KMAA 5TJ3A 5E68A 2WB1L 2R92C 1K83A 1VJEA 1F7VA 3HOXK 2E2JK 2NVTK 5IORA 3GTPK 2A6EA 1TWAA 2NVYC 3A8IA 2JA5A 1F7UA 3S2DC 1WQHA 3GEHA 4A3LC 2ZUEA 4FZBA 1XZPA 2ZUFA 2R93A 4AYBL 1SFOA 3S1NC 4C2MC 5M5XK 1Y1WC 4M1XA 1WQFA 3S2HC 1VLOA 4OIOA 3HOZC 4WJ3M 4BY7C 1XXAA 3S1QK 2JA8K 4KASA 3NUHA 1B4BA 3S2DK 1O28A 4KM8A 1JQWA 4O2DA 5JFEA 3GTGA 1EQRA 5M3MK 2GAHC 1YNJA 3I4MC 5IYBK 4KC6A 3FKIC 2NVXC 1Y1WA 4LK1A 4C45A 2KWAA 5HL8A 1TWHK 3SZZA 1ZQ1C 4A3MC 1XPPA 2WB1D 5IYBC 4BLBA 4XCHA 3GTLA 3I4NK 2E2IC 2YU9A 3N0CA 2GSUA 4A93K 1YNNA 4Y52K 4LJZA 3CQZK 3AD9C 1WCMA 1SFOC 3BUEA 1WIHA 3HKZL 3AQOA 5C4JK 1Y1VC 1J6XA 1ZXOA 5M5YK 1O25A 4LOWA 3GEEA 1JVIA 3M4OK 3HOVC 2VUMA 1GE9A 3DXJA 3HOWK 2A69A 1J98A 1O29A 4C2MK 3JSTA 4C3JK 4A3FK 4GTLA 4A3IK 4A3KK 2D6FC 3FKIA 4A3GC 3VA7A 5IP9C 4G7HA 4Q5SA 4OINA 4Y7NC 4X6AK 4C3JC 4A3FC 2EBBA 4GTAA 2R7ZK 4BXXC 1WORA 4LQYA 2NVXA 2YU9C 1ISEA 1TWCC 4AH6A 1I3QA 5FLMK 3HOUK 4G7OA 4A3EK 5EGEA 1WCMC 1DCHA 3S14C 3PO3K 1TWAC 2NVYA 2NVYK 2FQOA 3S17C 1ZYRA 1TWFC 2R93C 4GTCA 2JA7A 1AB4A 4BY1K 1I3QK 1VGXA 3L4KA 2R7ZA 3H3VD 2JA6C 1EFWA 2Y3PA 3LPXA 2Y0SL 1Y1VA 2GSOA 1PJ7A 4GTFA 4BLAA 4A3JC 3GTJA 2BE5A 1DCPA 3LAPA 3FKIK 5FJ8K 1IBAA 4YFNA 1BGWA 1I6VA 2JA8C 4DDQA 4KM9A 3S1RC 1BDFA 3GTGC 2A68A 5IYCC 1INNA 4OIQA 3GTOK 5IOTA 3GTOA 4NOIA 3A8JA 4KN7A 1DD5A 4GFQA 3GSIA 4LR2A 1C0AA 4ZH4A 4A3LK 4YFKA 2WAQL 3GTJK 5D4DA 5CHPA 3TTGA 2PA8D 1Y1VK 1WCMK 5M5WK 3CQZA 1BJTA 2XCRB 3HOYK 2W7VA 2YU9K 1HQMA 4BXXK 3BP8C 2JA7K 1J6WA 4QJVB 2GAGC 1WOOA 1Y1WK 1WOPA 4G0VA 2VUMC 3ADAC 3M3YK 3G4AA 1DCOA 2NVXK 1XXCA 3HOWC 4RMFA 3S1RK 1XZQB 5TMFA 3GTGK 1IE0A 5M3FK 4A3IC 4A3CC 4P9SA 4KMHA 3FOEA 4OIPA 1RU0A 1ZBSA 1O2BA 1KQ4A 2GSNA 2O5JA 4C3IC 1SFOK 3WODA 2VUMK 3M3YC 3CQZC 3S1MC 4PAAA 4KARA 1IQ0A 1TWAK 4PABA 3GTPA 1J6VA 4A3CK 3S17K 2P5MA 1VRQC 3K7AK 2E2JC 1I50C 3AD8C 3AQPA 3H0GK 3OPFA 4P5BA 4GTEA 5C44K 3FHZA 4QJVA 3GTLK 1I50K 3H0GC 5IP9K 2CW0A 1TWHA 1JOEA 5EGHA 3N0BA 3HOZK 2PA8L 4A3KC 1V5VA 3K7AC 4KAWX 4Y52C 4KMUA 3GTOC 3TFIA 3AD7C 1TWCK 1O2AA 3S1NK 3T01A 1IL2A 2PMZD 3PO2C 3I4NC 4ILDA 2V6TA 3HOYC 3TFHA 2NVQK 1SMYA 3GTLC 3PO2K 5TMCA 1IW7A 3L4JA 1USMA 1XZQA 1YX2A 5IOQA 3M4OC 2R93K 4A3JK 4XLPA 1O26A 1XXBA 2PHCB 2JA5K 3GTKK 3MMLB 2PPBA 2O5IA 3T00A 4QIWD 2A6HA 4A3BC 4A3DC 3GTMA 1K83K 3FOFA 3S16K 5C4XC 1G51A 4A3EC 1TWHC 4AYBD 5IP7C 2CFAB 3T02A 3GTQC 4KB2A 2ZFZA 1WOSA 4MQ9A 5C44C 2E2IK 5L46A 4Y7NK 5C4XK 1PJ5A 1WQGA 4G7ZA 5CJ9A 1BS2A 1R9TK 1O24A 2WAQD
chains in the Genus database with same CATH topology
4G7HA 2JA5C 1TWFK 4Q5SA 4OINA 3RZDC 4Y7NC 4X6AK 4A3FC 2R7ZK 3HOXC 4BXXC 2O5JA 4C3IK 1I6HK 1I6HC 1SFOK 4OIRA 3WODA 2VUMK 3M3YC 4A3BK 5IP7K 3CQZC 4BBRK 1TWCC 5FLMK 3GTJC 2YU9C 2PMZL 3HOUK 3S1MC 4A3EK 4G7OA 4A3DK 4MEXA 2WB1L 2R92C 4XLNA 3S15K 1WCMC 2E2JK 3HOXK 5IYCK 3S14C 1TWAK 2NVTC 1TWAC 2NVTK 2NVYK 2A6EA 2NVYC 3GTPC 3GTPK 4A3CK 3S2DC 4A3LC 3S17K 3S17C 4JK1A 1TWGC 3S2HK 1ZYRA 1TWFC 2R93C 4AYBL 4BY1K 3K7AK 2JA7C 2E2HK 1I3QK 4A3GK 2E2JC 1I50C 3H0GK 2R92K 4A93C 2Y0SD 2R7ZC 3S1NC 3H3VD 2JA6C 2Y0SL 1TWGK 4X6AC 4MEYA 5C44K 2B63K 5M5XK 1Y1WC 4QJVA 3S2HC 3GTLK 4OIOA 3HKZD 4KN4A 1I50K 3H0GC 5IP9K 3HOZC 4A3JC 2BE5A 3S15C 3GTKC 4BY7C 3FKIK 5FJ8K 3RZDK 2CW0A 4YFNA 2JA8K 1I6VA 2JA8C 3S1QK 5IYDK 3S2DK 4QIWL 3S1RC 1BDFA 3GTGC 2A68A 5M3MK 5IYCC 3HOZK 1YNJA 3PO3C 3S14K 2PA8L 4A3KC 3K7AC 4OIQA 4Y52C 3RZOC 4GZYA 4KMUA 3GTOC 3I4MK 3GTOK 3I4MC 4BBSK 5IYBK 5IYDC 1TWCK 3S1NK 4XSXA 3FKIC 4NOIA 2NVXC 2PMZD 4LK1A 2E2HC 4KN7A 3PO2C 3GTMK 3I4NC 3HOYC 4ZH4A 1TWHK 4LLGA 1R9TC 2NVQK 4YFKA 4A3MC 4A3LK 1XPPA 4A3MK 1SMYA 2WB1D 2B63C 5IYBC 2WAQL 5FLMC 5D4DA 3GTJK 3HOUC 3S1MK 5C4JC 3GTLC 3PO2K 4YG2A 2PA8D 3I4NK 2E2IC 1Y1VK 5TMCA 1WCMK 5M5WK 4XSZA 3HOYK 1IW7A 4A93K 1YNNA 3RZOK 4LJZA 4BBSC 3CQZK 1HQMA 4BBRC 2YU9K 4BXXK 4Y52K 1SFOC 3M4OC 2R93K 4A3JK 4BY1C 2JA7K 3HKZL 4XLPA 4QJVB 5C4JK 4YFXA 5C3EK 3S1QC 1Y1VC 2JA5K 5IP9C 3GTKK 4BY7K 2PPBA 2O5IA 5M5YK 4QIWD 3GTMC 2A6HA 4A3BC 4A3DC 1K83K 3S16K 3M4OK 1Y1WK 5C4XC 4A3EC 1TWHC 1I3QC 4AYBD 3HOVK 5C3EC 3HOVC 2VUMC 3M3YK 4Q4ZA 5IP7C 3GTQK 3GTQC 2NVXK 3DXJA 3HOWK 4C3HK 4LK0A 3HOWC 4MQ9A 2A69A 5C44C 2E2IK 3S1RK 5TMFA 3GTGK 4C2MK 2JA6K 4Y7NK 3PO3K 5C4XK 3H3VL 4C3JK 4A3FK 5M3FK 2NVQC 1K83C 4A3IK 4A3KK 4A3IC 3S16C 4G7ZA 4A3CC 3EQLA 1R9TK 4A3GC 4OIPA 2WAQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H A;  2JA5 C;  1TWF K;  4Q5S A;  4OIN A;  3RZD C;  4Y7N C;  4X6A K;  4A3F C;  2R7Z K;  3HOX C;  4BXX C;  2O5J A;  4C3I K;  1I6H K;  1I6H C;  1SFO K;  4OIR A;  3WOD A;  2VUM K;  3M3Y C;  4A3B K;  5IP7 K;  3CQZ C;  4BBR K;  1TWC C;  5FLM K;  3GTJ C;  2YU9 C;  2PMZ L;  3HOU K;  3S1M C;  4A3E K;  4G7O A;  4A3D K;  4MEX A;  2WB1 L;  2R92 C;  4XLN A;  3S15 K;  1WCM C;  2E2J K;  3HOX K;  5IYC K;  3S14 C;  1TWA K;  2NVT C;  1TWA C;  2NVT K;  2NVY K;  2A6E A;  2NVY C;  3GTP C;  3GTP K;  4A3C K;  3S2D C;  4A3L C;  3S17 K;  3S17 C;  4JK1 A;  1TWG C;  3S2H K;  1ZYR A;  1TWF C;  2R93 C;  4AYB L;  4BY1 K;  3K7A K;  2JA7 C;  2E2H K;  1I3Q K;  4A3G K;  2E2J C;  1I50 C;  3H0G K;  2R92 K;  4A93 C;  2Y0S D;  2R7Z C;  3S1N C;  3H3V D;  2JA6 C;  2Y0S L;  1TWG K;  4X6A C;  4MEY A;  5C44 K;  2B63 K;  5M5X K;  1Y1W C;  4QJV A;  3S2H C;  3GTL K;  4OIO A;  3HKZ D;  4KN4 A;  1I50 K;  3H0G C;  5IP9 K;  3HOZ C;  4A3J C;  2BE5 A;  3S15 C;  3GTK C;  4BY7 C;  3FKI K;  5FJ8 K;  3RZD K;  2CW0 A;  4YFN A;  2JA8 K;  1I6V A;  2JA8 C;  3S1Q K;  5IYD K;  3S2D K;  4QIW L;  3S1R C;  1BDF A;  3GTG C;  2A68 A;  5M3M K;  5IYC C;  3HOZ K;  1YNJ A;  3PO3 C;  3S14 K;  2PA8 L;  4A3K C;  3K7A C;  4OIQ A;  4Y52 C;  3RZO C;  4GZY A;  4KMU A;  3GTO C;  3I4M K;  3GTO K;  3I4M C;  4BBS K;  5IYB K;  5IYD C;  1TWC K;  3S1N K;  4XSX A;  3FKI C;  4NOI A;  2NVX C;  2PMZ D;  4LK1 A;  2E2H C;  4KN7 A;  3PO2 C;  3GTM K;  3I4N C;  3HOY C;  4ZH4 A;  1TWH K;  4LLG A;  1R9T C;  2NVQ K;  4YFK A;  4A3M C;  4A3L K;  1XPP A;  4A3M K;  1SMY A;  2WB1 D;  2B63 C;  5IYB C;  2WAQ L;  5FLM C;  5D4D A;  3GTJ K;  3HOU C;  3S1M K;  5C4J C;  3GTL C;  3PO2 K;  4YG2 A;  2PA8 D;  3I4N K;  2E2I C;  1Y1V K;  5TMC A;  1WCM K;  5M5W K;  4XSZ A;  3HOY K;  1IW7 A;  4A93 K;  1YNN A;  3RZO K;  4LJZ A;  4BBS C;  3CQZ K;  1HQM A;  4BBR C;  2YU9 K;  4BXX K;  4Y52 K;  1SFO C;  3M4O C;  2R93 K;  4A3J K;  4BY1 C;  2JA7 K;  3HKZ L;  4XLP A;  4QJV B;  5C4J K;  4YFX A;  5C3E K;  3S1Q C;  1Y1V C;  2JA5 K;  5IP9 C;  3GTK K;  4BY7 K;  2PPB A;  2O5I A;  5M5Y K;  4QIW D;  3GTM C;  2A6H A;  4A3B C;  4A3D C;  1K83 K;  3S16 K;  3M4O K;  1Y1W K;  5C4X C;  4A3E C;  1TWH C;  1I3Q C;  4AYB D;  3HOV K;  5C3E C;  3HOV C;  2VUM C;  3M3Y K;  4Q4Z A;  5IP7 C;  3GTQ K;  3GTQ C;  2NVX K;  3DXJ A;  3HOW K;  4C3H K;  4LK0 A;  3HOW C;  4MQ9 A;  2A69 A;  5C44 C;  2E2I K;  3S1R K;  5TMF A;  3GTG K;  4C2M K;  2JA6 K;  4Y7N K;  3PO3 K;  5C4X K;  3H3V L;  4C3J K;  4A3F K;  5M3F K;  2NVQ C;  1K83 C;  4A3I K;  4A3K K;  4A3I C;  3S16 C;  4G7Z A;  4A3C C;  3EQL A;  1R9T K;  4A3G C;  4OIP A;  2WAQ D; 
#chains in the Genus database with same CATH topology
 2JA5 C;  1TWF K;  5JVO A;  1B4A A;  3TFJ A;  3BP3 A;  2B63 A;  2JA6 A;  3OEP A;  4GTB A;  4C3I K;  3GTQ A;  1I6H C;  4OIR A;  4A3B K;  4A3D K;  5IP7 K;  4BBR K;  3GTJ C;  2PMZ L;  2V6S A;  2JH3 A;  4MEX A;  4WIL A;  1UV7 A;  4XLN A;  3S15 K;  4P5A A;  5IYC K;  2NVT C;  3GTP C;  3GIR A;  2XCO A;  1WSV A;  3N3Y A;  4JK1 A;  1TWG C;  3LAJ A;  3S2H K;  1YCL A;  2FQT A;  2JA7 C;  1ZVU A;  1L0W A;  1XZP B;  2E2H K;  4A3G K;  4KB4 A;  4FM9 A;  4J3N A;  2R92 K;  3V4G A;  4A93 C;  2Y0S D;  3CAG A;  3IPJ A;  2R7Z C;  4WJ4 A;  1EK8 A;  4KDD A;  1TWG K;  4X6A C;  4MEY A;  2B63 K;  1F9N A;  3HKZ D;  4KN4 A;  4BKW A;  3S15 C;  1R9T A;  3GTK C;  3RZD K;  1O27 A;  5IYD K;  4QIW L;  2XCQ A;  2P8T A;  2E2I A;  3PO3 C;  3S14 K;  3RZO C;  4GZY A;  4BBS K;  3I4M K;  1VH2 A;  3S0X A;  5IYD C;  1PJ6 A;  4XSX A;  3ERE D;  2E2H C;  3GTM K;  4KAT A;  4LLG A;  1R9T C;  3GTK A;  4A3M K;  2B63 C;  1O2F B;  5FLM C;  3HOU C;  3S1M K;  5C4J C;  4C3H C;  4YG2 A;  1TWG A;  1HI9 A;  3GEI A;  4XSZ A;  3RZO K;  4G0U A;  4BBS C;  4BBR C;  2R92 A;  4GT9 A;  2E2H A;  4BY1 C;  4YFX A;  5C3E K;  2RH6 A;  1WSR A;  3S1Q C;  4BY7 K;  2RGR A;  3GTM C;  3ORE A;  1X31 C;  3A8K A;  1IS1 A;  1I3Q C;  1TWC A;  3HOV K;  5C3E C;  1EI6 A;  3HXA A;  4Q4Z A;  3GTQ K;  4KMD A;  4C3H K;  3GDZ A;  4LK0 A;  1EH1 A;  2CFA A;  4GTD A;  3Q3Q A;  2JA6 K;  3H3V L;  1F93 A;  4G0W A;  2NVQ C;  1K83 C;  3AH5 A;  3S16 C;  1TWF A;  3EQL A;  3SZY A;  3G4C A;  1I50 A;  3RZD C;  1USO A;  2V6U A;  3HOX C;  3QX3 A;  1I6H K;  3H0G A;  5IOS A;  4KMA A;  5TJ3 A;  5E68 A;  2WB1 L;  2R92 C;  1K83 A;  1VJE A;  1F7V A;  3HOX K;  2E2J K;  2NVT K;  5IOR A;  3GTP K;  2A6E A;  1TWA A;  2NVY C;  3A8I A;  2JA5 A;  1F7U A;  3S2D C;  1WQH A;  3GEH A;  4A3L C;  2ZUE A;  4FZB A;  1XZP A;  2ZUF A;  2R93 A;  4AYB L;  1SFO A;  3S1N C;  4C2M C;  5M5X K;  1Y1W C;  4M1X A;  1WQF A;  3S2H C;  1VLO A;  4OIO A;  3HOZ C;  4WJ3 M;  4BY7 C;  1XXA A;  3S1Q K;  2JA8 K;  4KAS A;  3NUH A;  1B4B A;  3S2D K;  1O28 A;  4KM8 A;  1JQW A;  4O2D A;  5JFE A;  3GTG A;  1EQR A;  5M3M K;  2GAH C;  1YNJ A;  3I4M C;  5IYB K;  4KC6 A;  3FKI C;  2NVX C;  1Y1W A;  4LK1 A;  4C45 A;  2KWA A;  5HL8 A;  1TWH K;  3SZZ A;  1ZQ1 C;  4A3M C;  1XPP A;  2WB1 D;  5IYB C;  4BLB A;  4XCH A;  3GTL A;  3I4N K;  2E2I C;  2YU9 A;  3N0C A;  2GSU A;  4A93 K;  1YNN A;  4Y52 K;  4LJZ A;  3CQZ K;  3AD9 C;  1WCM A;  1SFO C;  3BUE A;  1WIH A;  3HKZ L;  3AQO A;  5C4J K;  1Y1V C;  1J6X A;  1ZXO A;  5M5Y K;  1O25 A;  4LOW A;  3GEE A;  1JVI A;  3M4O K;  3HOV C;  2VUM A;  1GE9 A;  3DXJ A;  3HOW K;  2A69 A;  1J98 A;  1O29 A;  4C2M K;  3JST A;  4C3J K;  4A3F K;  4GTL A;  4A3I K;  4A3K K;  2D6F C;  3FKI A;  4A3G C;  3VA7 A;  5IP9 C;  4G7H A;  4Q5S A;  4OIN A;  4Y7N C;  4X6A K;  4C3J C;  4A3F C;  2EBB A;  4GTA A;  2R7Z K;  4BXX C;  1WOR A;  4LQY A;  2NVX A;  2YU9 C;  1ISE A;  1TWC C;  4AH6 A;  1I3Q A;  5FLM K;  3HOU K;  4G7O A;  4A3E K;  5EGE A;  1WCM C;  1DCH A;  3S14 C;  3PO3 K;  1TWA C;  2NVY A;  2NVY K;  2FQO A;  3S17 C;  1ZYR A;  1TWF C;  2R93 C;  4GTC A;  2JA7 A;  1AB4 A;  4BY1 K;  1I3Q K;  1VGX A;  3L4K A;  2R7Z A;  3H3V D;  2JA6 C;  1EFW A;  2Y3P A;  3LPX A;  2Y0S L;  1Y1V A;  2GSO A;  1PJ7 A;  4GTF A;  4BLA A;  4A3J C;  3GTJ A;  2BE5 A;  1DCP A;  3LAP A;  3FKI K;  5FJ8 K;  1IBA A;  4YFN A;  1BGW A;  1I6V A;  2JA8 C;  4DDQ A;  4KM9 A;  3S1R C;  1BDF A;  3GTG C;  2A68 A;  5IYC C;  1INN A;  4OIQ A;  3GTO K;  5IOT A;  3GTO A;  4NOI A;  3A8J A;  4KN7 A;  1DD5 A;  4GFQ A;  3GSI A;  4LR2 A;  1C0A A;  4ZH4 A;  4A3L K;  4YFK A;  2WAQ L;  3GTJ K;  5D4D A;  5CHP A;  3TTG A;  2PA8 D;  1Y1V K;  1WCM K;  5M5W K;  3CQZ A;  1BJT A;  2XCR B;  3HOY K;  2W7V A;  2YU9 K;  1HQM A;  4BXX K;  3BP8 C;  2JA7 K;  1J6W A;  4QJV B;  2GAG C;  1WOO A;  1Y1W K;  1WOP A;  4G0V A;  2VUM C;  3ADA C;  3M3Y K;  3G4A A;  1DCO A;  2NVX K;  1XXC A;  3HOW C;  4RMF A;  3S1R K;  1XZQ B;  5TMF A;  3GTG K;  1IE0 A;  5M3F K;  4A3I C;  4A3C C;  4P9S A;  4KMH A;  3FOE A;  4OIP A;  1RU0 A;  1ZBS A;  1O2B A;  1KQ4 A;  2GSN A;  2O5J A;  4C3I C;  1SFO K;  3WOD A;  2VUM K;  3M3Y C;  3CQZ C;  3S1M C;  4PAA A;  4KAR A;  1IQ0 A;  1TWA K;  4PAB A;  3GTP A;  1J6V A;  4A3C K;  3S17 K;  2P5M A;  1VRQ C;  3K7A K;  2E2J C;  1I50 C;  3AD8 C;  3AQP A;  3H0G K;  3OPF A;  4P5B A;  4GTE A;  5C44 K;  3FHZ A;  4QJV A;  3GTL K;  1I50 K;  3H0G C;  5IP9 K;  2CW0 A;  1TWH A;  1JOE A;  5EGH A;  3N0B A;  3HOZ K;  2PA8 L;  4A3K C;  1V5V A;  3K7A C;  4KAW X;  4Y52 C;  4KMU A;  3GTO C;  3TFI A;  3AD7 C;  1TWC K;  1O2A A;  3S1N K;  3T01 A;  1IL2 A;  2PMZ D;  3PO2 C;  3I4N C;  4ILD A;  2V6T A;  3HOY C;  3TFH A;  2NVQ K;  1SMY A;  3GTL C;  3PO2 K;  5TMC A;  1IW7 A;  3L4J A;  1USM A;  1XZQ A;  1YX2 A;  5IOQ A;  3M4O C;  2R93 K;  4A3J K;  4XLP A;  1O26 A;  1XXB A;  2PHC B;  2JA5 K;  3GTK K;  3MML B;  2PPB A;  2O5I A;  3T00 A;  4QIW D;  2A6H A;  4A3B C;  4A3D C;  3GTM A;  1K83 K;  3FOF A;  3S16 K;  5C4X C;  1G51 A;  4A3E C;  1TWH C;  4AYB D;  5IP7 C;  2CFA B;  3T02 A;  3GTQ C;  4KB2 A;  2ZFZ A;  1WOS A;  4MQ9 A;  5C44 C;  2E2I K;  5L46 A;  4Y7N K;  5C4X K;  1PJ5 A;  1WQG A;  4G7Z A;  5CJ9 A;  1BS2 A;  1R9T K;  1O24 A;  2WAQ D; 
#chains in the Genus database with same CATH homology
 4G7H A;  2JA5 C;  1TWF K;  4Q5S A;  4OIN A;  3RZD C;  4Y7N C;  4X6A K;  4A3F C;  2R7Z K;  3HOX C;  4BXX C;  2O5J A;  4C3I K;  1I6H K;  1I6H C;  1SFO K;  4OIR A;  3WOD A;  2VUM K;  3M3Y C;  4A3B K;  5IP7 K;  3CQZ C;  4BBR K;  1TWC C;  5FLM K;  3GTJ C;  2YU9 C;  2PMZ L;  3HOU K;  3S1M C;  4A3E K;  4G7O A;  4A3D K;  4MEX A;  2WB1 L;  2R92 C;  4XLN A;  3S15 K;  1WCM C;  2E2J K;  3HOX K;  5IYC K;  3S14 C;  1TWA K;  2NVT C;  1TWA C;  2NVT K;  2NVY K;  2A6E A;  2NVY C;  3GTP C;  3GTP K;  4A3C K;  3S2D C;  4A3L C;  3S17 K;  3S17 C;  4JK1 A;  1TWG C;  3S2H K;  1ZYR A;  1TWF C;  2R93 C;  4AYB L;  4BY1 K;  3K7A K;  2JA7 C;  2E2H K;  1I3Q K;  4A3G K;  2E2J C;  1I50 C;  3H0G K;  2R92 K;  4A93 C;  2Y0S D;  2R7Z C;  3S1N C;  3H3V D;  2JA6 C;  2Y0S L;  1TWG K;  4X6A C;  4MEY A;  5C44 K;  2B63 K;  5M5X K;  1Y1W C;  4QJV A;  3S2H C;  3GTL K;  4OIO A;  3HKZ D;  4KN4 A;  1I50 K;  3H0G C;  5IP9 K;  3HOZ C;  4A3J C;  2BE5 A;  3S15 C;  3GTK C;  4BY7 C;  3FKI K;  5FJ8 K;  3RZD K;  2CW0 A;  4YFN A;  2JA8 K;  1I6V A;  2JA8 C;  3S1Q K;  5IYD K;  3S2D K;  4QIW L;  3S1R C;  1BDF A;  3GTG C;  2A68 A;  5M3M K;  5IYC C;  3HOZ K;  1YNJ A;  3PO3 C;  3S14 K;  2PA8 L;  4A3K C;  3K7A C;  4OIQ A;  4Y52 C;  3RZO C;  4GZY A;  4KMU A;  3GTO C;  3I4M K;  3GTO K;  3I4M C;  4BBS K;  5IYB K;  5IYD C;  1TWC K;  3S1N K;  4XSX A;  3FKI C;  4NOI A;  2NVX C;  2PMZ D;  4LK1 A;  2E2H C;  4KN7 A;  3PO2 C;  3GTM K;  3I4N C;  3HOY C;  4ZH4 A;  1TWH K;  4LLG A;  1R9T C;  2NVQ K;  4YFK A;  4A3M C;  4A3L K;  1XPP A;  4A3M K;  1SMY A;  2WB1 D;  2B63 C;  5IYB C;  2WAQ L;  5FLM C;  5D4D A;  3GTJ K;  3HOU C;  3S1M K;  5C4J C;  3GTL C;  3PO2 K;  4YG2 A;  2PA8 D;  3I4N K;  2E2I C;  1Y1V K;  5TMC A;  1WCM K;  5M5W K;  4XSZ A;  3HOY K;  1IW7 A;  4A93 K;  1YNN A;  3RZO K;  4LJZ A;  4BBS C;  3CQZ K;  1HQM A;  4BBR C;  2YU9 K;  4BXX K;  4Y52 K;  1SFO C;  3M4O C;  2R93 K;  4A3J K;  4BY1 C;  2JA7 K;  3HKZ L;  4XLP A;  4QJV B;  5C4J K;  4YFX A;  5C3E K;  3S1Q C;  1Y1V C;  2JA5 K;  5IP9 C;  3GTK K;  4BY7 K;  2PPB A;  2O5I A;  5M5Y K;  4QIW D;  3GTM C;  2A6H A;  4A3B C;  4A3D C;  1K83 K;  3S16 K;  3M4O K;  1Y1W K;  5C4X C;  4A3E C;  1TWH C;  1I3Q C;  4AYB D;  3HOV K;  5C3E C;  3HOV C;  2VUM C;  3M3Y K;  4Q4Z A;  5IP7 C;  3GTQ K;  3GTQ C;  2NVX K;  3DXJ A;  3HOW K;  4C3H K;  4LK0 A;  3HOW C;  4MQ9 A;  2A69 A;  5C44 C;  2E2I K;  3S1R K;  5TMF A;  3GTG K;  4C2M K;  2JA6 K;  4Y7N K;  3PO3 K;  5C4X K;  3H3V L;  4C3J K;  4A3F K;  5M3F K;  2NVQ C;  1K83 C;  4A3I K;  4A3K K;  4A3I C;  3S16 C;  4G7Z A;  4A3C C;  3EQL A;  1R9T K;  4A3G C;  4OIP A;  2WAQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...