3S1QK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1qK00
4YFKA 3M3YK 2WB1L 3S1QC 3GTGC 4A3KK 5FLMK 2WAQD 1IW7A 3RZDC 3M4OC 4A3FC 4A3LC 3GTQC 3FKIK 2A68A 4C3JK 5D4DA 3RZOC 4X6AC 4Y52K 4A3DC 2B63K 4Y7NK 1TWHC 2PMZD 3HOVK 3S1MK 4QIWD 2E2HC 3S14K 3I4NK 4A3BC 2CW0A 5IP9K 1XPPA 2NVTK 4LJZA 4BBRK 4KN4A 4LLGA 4QJVB 1I50C 5IYCC 2VUMK 4BY7C 4LK0A 3S1RK 4BXXK 4G7ZA 2NVYK 2E2JC 2NVXK 3HOWK 3HOZC 2PA8L 4XSZA 2E2IC 3GTPK 4YFXA 5FJ8K 5IYDC 4A3EK 4KN7A 5IP7K 3I4MC 4A93C 5C4JK 2A6EA 4BY1K 4ZH4A 1I6HC 2PPBA 3HOYK 3PO2K 2BE5A 2JA5K 2JA6K 4A3JC 2R92C 4A3CK 3GTGK 3GTLC 4QJVA 1R9TC 3GTOC 4AYBD 2R93C 4C3IK 2JA8K 4A3FK 3K7AC 1K83K 1TWCK 4A3MC 1TWFK 1TWAC 2YU9K 3S15C 3S2DK 3PO3K 1BDFA 1SFOC 4G7OA 1I6VA 1WCMK 3HKZD 3H0GK 5C3EC 3CQZK 2E2HK 2R7ZK 3HOXC 3S17K 5TMFA 3H3VL 4C3HK 4BBSC 5IYBC 1Y1VC 1I3QK 1Y1WC 4Q5SA 5C4XC 4A3IC 1SMYA 2WAQL 1YNJA 3DXJA 3GTJC 2NVQC 3M3YC 4OIRA 5M5YK 5FLMC 3GTMK 2PMZL 4Q4ZA 4A3JK 2O5IA 3S1NC 4QIWL 4XSXA 3S1QK 2Y0SD 2JA7C 4Y52C 4MQ9A 4OIOA 4A3GC 2B63C 3S1MC 1TWGC 4YG2A 3HOVC 3RZDK 3M4OK 4GZYA 4A3LK 3S14C 4G7HA 2WB1D 3GTQK 3RZOK 3I4NC 4X6AK 4A3DK 5M3MK 1TWHK 2VUMC 5IYDK 4MEYA 3S1RC 4BXXC 5C3EK 4A3BK 2NVYC 2NVXC 3HOWC 4OINA 3EQLA 3S16C 3S2HC 4BBSK 5C44C 5IYCK 4A3EC 1I50K 1Y1WK 4OIQA 3GTKC 3HOUC 4BY7K 5C4XK 2E2JK 2A69A 4LK1A 3HOZK 4AYBL 2E2IK 3HOYC 2JA6C 2JA5C 3PO2C 3GTJK 4JK1A 2NVQK 4A93K 4MEXA 3I4MK 4NOIA 3WODA 4A3CC 5M5WK 4A3KC 1I6HK 1HQMA 2PA8D 2JA8C 3H3VD 3S1NK 3HKZL 2R92K 1TWCC 1K83C 3FKIC 5M5XK 2JA7K 4A3GK 1TWFC 2YU9C 4Y7NC 4YFNA 1R9TK 3GTLK 3GTOK 1TWGK 4XLPA 3PO3C 3S2DC 2R93K 1WCMC 3K7AK 3H0GC 4A3MK 3CQZC 2R7ZC 5IP9C 2O5JA 1ZYRA 3S17C 2NVTC 1TWAK 4BBRC 3S15K 1I3QC 1SFOK 1YNNA 3S16K 3S2HK 3HOXK 2A6HA 4XLNA 3GTPC 5C44K 4KMUA 4C2MK 5IYBK 1Y1VK 5IP7C 3GTKK 5C4JC 3HOUK 2Y0SL 4BY1C 4A3IK 5M3FK 5TMCA 3GTMC 4OIPA
chains in the Genus database with same CATH superfamily
4KAWX 1O26A 3GEEA 3M3YK 1HI9A 3GTGC 3QX3A 2VUMA 3TFHA 1IW7A 4A3FC 4A3LC 4KB4A 3GTQC 5D4DA 3RZOC 3GTPA 2B63K 3AH5A 4GTBA 4A3BC 3AD8C 4G0UA 1XPPA 2NVTK 4LJZA 4BBRK 2JA5A 4AH6A 1VH2A 4BY7C 1L0WA 3GTGA 1GE9A 2E2JC 2NVXK 2PA8L 4YFXA 4KN7A 3GTQA 5C4JK 1TWFA 4BKWA 1DCOA 1I6HC 3HOYK 4A3JC 4A3CK 4G0VA 1R9TC 1J6XA 1O2AA 1BDFA 1SFOC 1WCMK 1WOPA 3H3VL 4C3HK 4BBSC 3HXAA 1Y1VC 3GIRA 4Q5SA 4A3IC 1ZXOA 3A8JA 1RU0A 3GTJC 2NVQC 3GSIA 4WJ4A 5M5YK 1SFOA 4Q4ZA 4QIWL 1ZBSA 4XSXA 1EQRA 4Y52C 1XXBA 1Y1VA 4A3LK 3LPXA 3GTQK 2WB1D 3RZOK 3S14C 3GTJA 5C3EK 4A3BK 3HOWC 5C44C 3Q3QA 3GTKC 4BY7K 1JQWA 1O25A 2E2JK 4LK1A 3PO2C 1G51A 1PJ7A 1KQ4A 1I6HK 4RMFA 1HQMA 3OREA 2JA7K 4A3GK 1R9TK 1O24A 1IQ0A 3GTKA 1XXCA 4BBRC 2NVTC 1SFOK 2FQOA 1WOOA 1WSRA 4KMUA 1Y1VK 5C4JC 2PHCB 2Y0SL 4A3IK 5M3FK 2B63A 2Y3PA 1USMA 2RGRA 1YCLA 4KM8A 1WORA 3RZDC 4FM9A 2NVXA 4X6AC 4Y52K 1VJEA 3S14K 1O2BA 5IP9K 4KMDA 4C3HC 4LLGA 5IYCC 2ZUEA 4G7ZA 3HOWK 4GTDA 1ISEA 3A8IA 5IYDC 4A93C 5IP7K 3I4MC 4BY1K 3PO2K 1WCMA 2XCQA 1J6WA 1O29A 3GEHA 1USOA 4KARA 4AYBD 3FHZA 4C45A 4P5BA 4A3MC 1X31C 2EBBA 3T02A 5EGEA 4GTEA 4LOWA 2E2HK 5C3EC 1EFWA 3L4JA 3A8KA 1WIHA 4GTLA 4OIRA 4KB2A 4FZBA 4GTAA 2JA7C 4A3GC 4MQ9A 4YG2A 3HOVC 4P9SA 3RZDK 1B4AA 3OPFA 2JH3A 2P5MA 4X6AK 3BP3A 4BXXC 3EQLA 1F7UA 5IYCK 4A3EC 1VGXA 2CFAB 5C4XK 2JA7A 1R9TA 2JA6C 4A93K 5IYDK 4WJ3M 3I4MK 5M5WK 3FOFA 3T00A 2JA8C 3BP8C 3S1NK 1TWCC 4BLBA 2YU9C 4GFQA 1TWGK 3PO3C 2CFAA 3N0CA 3H0GC 3IPJA 3CQZC 4A3MK 5IP9C 2ZUFA 1ZYRA 2JA6A 1YNNA 3GEIA 3S16K 2A6HA 4XLNA 2W7VA 1O28A 3TTGA 5IP7C 1TWCA 4BY1C 3ADAC 2YU9A 3GTMC 4YFKA 2WB1L 1WSVA 4A3KK 2WAQD 3M4OC 1XZPB 4A3DC 2PMZD 3HOVK 2E2HC 1EH1A 5IOTA 1XZQB 4QJVB 1I50C 5L46A 1WQHA 4LK0A 4BXXK 4XSZA 2E2IC 3SZYA 5FJ8K 4A3EK 1XZPA 3AD9C 3TFJA 4ZH4A 2GSNA 2JA6K 4J3NA 2E2HA 3GTLC 1XZQA 4QJVA 1J98A 3GTOC 4KM9A 2R93C 2JA8K 1AB4A 2RH6A 1TWCK 3AQPA 2YU9K 1TWAC 1ZVUA 3S15C 3PO3K 2P8TA 5CJ9A 1BGWA 1I6VA 3HKZD 3H0GK 3CQZK 3HOXC 3G4CA 1O2FB 1PJ5A 3N0BA 5E68A 4C2MC 5IYBC 5JVOA 5C4XC 3GTLA 3GTOA 2R93A 1SMYA 1UV7A 1YNJA 1TWAA 4XCHA 3S0XA 5FLMC 3GTMK 3S1NC 2GSUA 4C3JC 3S1MC 1TWGC 3M4OK 1VRQC 4G7HA 3I4NC 4A3DK 5M3MK 3NUHA 2VUMC 4GT9A 3S1RC 3N3YA 2NVYC 2XCRB 3S16C 1PJ6A 3ERED 1I50K 1Y1WK 2GAHC 3BUEA 3SZZA 1TWGA 4AYBL 2E2IK 2JA5C 4JK1A 4MEXA 3WODA 2GSOA 4A3KC 1V5VA 2ZFZA 2PA8D 4C3IC 1K83C 2NVYA 5EGHA 3FOEA 1TWFC 4LR2A 3GTLK 4YFNA 3GTOK 3S2DC 2R93K 4KASA 4XLPA 2R7ZC 2O5JA 3S17C 2V6SA 3JSTA 1TWAK 4PABA 3S15K 3VA7A 3CAGA 4KMAA 1I3QC 3S2HK 3HOXK 4C2MK 1YX2A 5IYBK 2D6FC 1K83A 3HOUK 2V6UA 5CHPA 1WQFA 5TMCA 3H3VD 4OIPA 3LAJA 2R7ZA 4BLAA 3S1QC 4WILA 5FLMK 3AQOA 1I3QA 1INNA 4DDQA 3FKIK 2A68A 4C3JK 3MMLB 5TJ3A 4Y7NK 1EI6A 1TWHC 3TFIA 3S1MK 4QIWD 3I4NK 2CW0A 4PAAA 4KN4A 1XXAA 2VUMK 1JOEA 3S1RK 2NVYK 3HOZC 3GTPK 3LAPA 2A6EA 1WOSA 2PPBA 1DCPA 1TWHA 2BE5A 2JA5K 3H0GA 3CQZA 2R92C 3L4KA 3GTGK 3GDZA 4KDDA 5HL8A 4C3IK 1IE0A 4A3FK 3K7AC 1B4BA 1K83K 5JFEA 1C0AA 1TWFK 1BS2A 1VLOA 5IORA 3S2DK 4G7OA 1IBAA 2R7ZK 4G0WA 3S17K 3GTMA 5TMFA 1JVIA 1Y1WC 1I3QK 1IL2A 2R92A 4M1XA 2WAQL 3DXJA 1IS1A 3M3YC 1J6VA 2PMZL 4A3JK 2O5IA 3S1QK 2Y0SD 4OIOA 2B63C 1I50A 1Y1WA 4GZYA 2XCOA 2E2IA 1DD5A 4GTCA 3G4AA 1TWHK 1O27A 4MEYA 4P5AA 2NVXC 3S2HC 4OINA 1F93A 2GAGC 3V4GA 4BBSK 5IOSA 4KC6A 3AD7C 3T01A 4OIQA 3HOUC 4GTFA 4KMHA 3OEPA 2A69A 3HOZK 3HOYC 2KWAA 3GTJK 2NVQK 1F9NA 5IOQA 4NOIA 4A3CC 4KATA 3HKZL 2R92K 3FKIC 5M5XK 4LQYA 4Y7NC 1BJTA 1EK8A 2FQTA 1WCMC 1F7VA 3K7AK 1DCHA 1ZQ1C 2V6TA 3GTPC 4ILDA 5C44K 3GTKK 1WQGA 3FKIA 4O2DA
chains in the Genus database with same CATH topology
4YFKA 3M3YK 2WB1L 3S1QC 3GTGC 4A3KK 5FLMK 2WAQD 1IW7A 3RZDC 3M4OC 4A3FC 4A3LC 3GTQC 3FKIK 2A68A 4C3JK 5D4DA 3RZOC 4X6AC 4Y52K 4A3DC 2B63K 4Y7NK 1TWHC 2PMZD 3HOVK 3S1MK 4QIWD 2E2HC 3S14K 3I4NK 4A3BC 2CW0A 5IP9K 1XPPA 2NVTK 4LJZA 4BBRK 4KN4A 4LLGA 4QJVB 1I50C 5IYCC 2VUMK 4BY7C 4LK0A 3S1RK 4BXXK 4G7ZA 2NVYK 2E2JC 2NVXK 3HOWK 3HOZC 2PA8L 4XSZA 2E2IC 3GTPK 4YFXA 5FJ8K 5IYDC 4A3EK 4KN7A 5IP7K 3I4MC 4A93C 5C4JK 2A6EA 4BY1K 4ZH4A 1I6HC 2PPBA 3HOYK 3PO2K 2BE5A 2JA5K 2JA6K 4A3JC 2R92C 4A3CK 3GTGK 3GTLC 4QJVA 1R9TC 3GTOC 4AYBD 2R93C 4C3IK 2JA8K 4A3FK 3K7AC 1K83K 1TWCK 4A3MC 1TWFK 1TWAC 2YU9K 3S15C 3S2DK 3PO3K 1BDFA 1SFOC 4G7OA 1I6VA 1WCMK 3HKZD 3H0GK 5C3EC 3CQZK 2E2HK 2R7ZK 3HOXC 3S17K 5TMFA 3H3VL 4C3HK 4BBSC 5IYBC 1Y1VC 1I3QK 1Y1WC 4Q5SA 5C4XC 4A3IC 1SMYA 2WAQL 1YNJA 3DXJA 3GTJC 2NVQC 3M3YC 4OIRA 5M5YK 5FLMC 3GTMK 2PMZL 4Q4ZA 4A3JK 2O5IA 3S1NC 4QIWL 4XSXA 3S1QK 2Y0SD 2JA7C 4Y52C 4MQ9A 4OIOA 4A3GC 2B63C 3S1MC 1TWGC 4YG2A 3HOVC 3RZDK 3M4OK 4GZYA 4A3LK 3S14C 4G7HA 2WB1D 3GTQK 3RZOK 3I4NC 4X6AK 4A3DK 5M3MK 1TWHK 2VUMC 5IYDK 4MEYA 3S1RC 4BXXC 5C3EK 4A3BK 2NVYC 2NVXC 3HOWC 4OINA 3EQLA 3S16C 3S2HC 4BBSK 5C44C 5IYCK 4A3EC 1I50K 1Y1WK 4OIQA 3GTKC 3HOUC 4BY7K 5C4XK 2E2JK 2A69A 4LK1A 3HOZK 4AYBL 2E2IK 3HOYC 2JA6C 2JA5C 3PO2C 3GTJK 4JK1A 2NVQK 4A93K 4MEXA 3I4MK 4NOIA 3WODA 4A3CC 5M5WK 4A3KC 1I6HK 1HQMA 2PA8D 2JA8C 3H3VD 3S1NK 3HKZL 2R92K 1TWCC 1K83C 3FKIC 5M5XK 2JA7K 4A3GK 1TWFC 2YU9C 4Y7NC 4YFNA 1R9TK 3GTLK 3GTOK 1TWGK 4XLPA 3PO3C 3S2DC 2R93K 1WCMC 3K7AK 3H0GC 4A3MK 3CQZC 2R7ZC 5IP9C 2O5JA 1ZYRA 3S17C 2NVTC 1TWAK 4BBRC 3S15K 1I3QC 1SFOK 1YNNA 3S16K 3S2HK 3HOXK 2A6HA 4XLNA 3GTPC 5C44K 4KMUA 4C2MK 5IYBK 1Y1VK 5IP7C 3GTKK 5C4JC 3HOUK 2Y0SL 4BY1C 4A3IK 5M3FK 5TMCA 3GTMC 4OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK A;  3M3Y K;  2WB1 L;  3S1Q C;  3GTG C;  4A3K K;  5FLM K;  2WAQ D;  1IW7 A;  3RZD C;  3M4O C;  4A3F C;  4A3L C;  3GTQ C;  3FKI K;  2A68 A;  4C3J K;  5D4D A;  3RZO C;  4X6A C;  4Y52 K;  4A3D C;  2B63 K;  4Y7N K;  1TWH C;  2PMZ D;  3HOV K;  3S1M K;  4QIW D;  2E2H C;  3S14 K;  3I4N K;  4A3B C;  2CW0 A;  5IP9 K;  1XPP A;  2NVT K;  4LJZ A;  4BBR K;  4KN4 A;  4LLG A;  4QJV B;  1I50 C;  5IYC C;  2VUM K;  4BY7 C;  4LK0 A;  3S1R K;  4BXX K;  4G7Z A;  2NVY K;  2E2J C;  2NVX K;  3HOW K;  3HOZ C;  2PA8 L;  4XSZ A;  2E2I C;  3GTP K;  4YFX A;  5FJ8 K;  5IYD C;  4A3E K;  4KN7 A;  5IP7 K;  3I4M C;  4A93 C;  5C4J K;  2A6E A;  4BY1 K;  4ZH4 A;  1I6H C;  2PPB A;  3HOY K;  3PO2 K;  2BE5 A;  2JA5 K;  2JA6 K;  4A3J C;  2R92 C;  4A3C K;  3GTG K;  3GTL C;  4QJV A;  1R9T C;  3GTO C;  4AYB D;  2R93 C;  4C3I K;  2JA8 K;  4A3F K;  3K7A C;  1K83 K;  1TWC K;  4A3M C;  1TWF K;  1TWA C;  2YU9 K;  3S15 C;  3S2D K;  3PO3 K;  1BDF A;  1SFO C;  4G7O A;  1I6V A;  1WCM K;  3HKZ D;  3H0G K;  5C3E C;  3CQZ K;  2E2H K;  2R7Z K;  3HOX C;  3S17 K;  5TMF A;  3H3V L;  4C3H K;  4BBS C;  5IYB C;  1Y1V C;  1I3Q K;  1Y1W C;  4Q5S A;  5C4X C;  4A3I C;  1SMY A;  2WAQ L;  1YNJ A;  3DXJ A;  3GTJ C;  2NVQ C;  3M3Y C;  4OIR A;  5M5Y K;  5FLM C;  3GTM K;  2PMZ L;  4Q4Z A;  4A3J K;  2O5I A;  3S1N C;  4QIW L;  4XSX A;  3S1Q K;  2Y0S D;  2JA7 C;  4Y52 C;  4MQ9 A;  4OIO A;  4A3G C;  2B63 C;  3S1M C;  1TWG C;  4YG2 A;  3HOV C;  3RZD K;  3M4O K;  4GZY A;  4A3L K;  3S14 C;  4G7H A;  2WB1 D;  3GTQ K;  3RZO K;  3I4N C;  4X6A K;  4A3D K;  5M3M K;  1TWH K;  2VUM C;  5IYD K;  4MEY A;  3S1R C;  4BXX C;  5C3E K;  4A3B K;  2NVY C;  2NVX C;  3HOW C;  4OIN A;  3EQL A;  3S16 C;  3S2H C;  4BBS K;  5C44 C;  5IYC K;  4A3E C;  1I50 K;  1Y1W K;  4OIQ A;  3GTK C;  3HOU C;  4BY7 K;  5C4X K;  2E2J K;  2A69 A;  4LK1 A;  3HOZ K;  4AYB L;  2E2I K;  3HOY C;  2JA6 C;  2JA5 C;  3PO2 C;  3GTJ K;  4JK1 A;  2NVQ K;  4A93 K;  4MEX A;  3I4M K;  4NOI A;  3WOD A;  4A3C C;  5M5W K;  4A3K C;  1I6H K;  1HQM A;  2PA8 D;  2JA8 C;  3H3V D;  3S1N K;  3HKZ L;  2R92 K;  1TWC C;  1K83 C;  3FKI C;  5M5X K;  2JA7 K;  4A3G K;  1TWF C;  2YU9 C;  4Y7N C;  4YFN A;  1R9T K;  3GTL K;  3GTO K;  1TWG K;  4XLP A;  3PO3 C;  3S2D C;  2R93 K;  1WCM C;  3K7A K;  3H0G C;  4A3M K;  3CQZ C;  2R7Z C;  5IP9 C;  2O5J A;  1ZYR A;  3S17 C;  2NVT C;  1TWA K;  4BBR C;  3S15 K;  1I3Q C;  1SFO K;  1YNN A;  3S16 K;  3S2H K;  3HOX K;  2A6H A;  4XLN A;  3GTP C;  5C44 K;  4KMU A;  4C2M K;  5IYB K;  1Y1V K;  5IP7 C;  3GTK K;  5C4J C;  3HOU K;  2Y0S L;  4BY1 C;  4A3I K;  5M3F K;  5TMC A;  3GTM C;  4OIP A; 
#chains in the Genus database with same CATH topology
 4KAW X;  1O26 A;  3GEE A;  3M3Y K;  1HI9 A;  3GTG C;  3QX3 A;  2VUM A;  3TFH A;  1IW7 A;  4A3F C;  4A3L C;  4KB4 A;  3GTQ C;  5D4D A;  3RZO C;  3GTP A;  2B63 K;  3AH5 A;  4GTB A;  4A3B C;  3AD8 C;  4G0U A;  1XPP A;  2NVT K;  4LJZ A;  4BBR K;  2JA5 A;  4AH6 A;  1VH2 A;  4BY7 C;  1L0W A;  3GTG A;  1GE9 A;  2E2J C;  2NVX K;  2PA8 L;  4YFX A;  4KN7 A;  3GTQ A;  5C4J K;  1TWF A;  4BKW A;  1DCO A;  1I6H C;  3HOY K;  4A3J C;  4A3C K;  4G0V A;  1R9T C;  1J6X A;  1O2A A;  1BDF A;  1SFO C;  1WCM K;  1WOP A;  3H3V L;  4C3H K;  4BBS C;  3HXA A;  1Y1V C;  3GIR A;  4Q5S A;  4A3I C;  1ZXO A;  3A8J A;  1RU0 A;  3GTJ C;  2NVQ C;  3GSI A;  4WJ4 A;  5M5Y K;  1SFO A;  4Q4Z A;  4QIW L;  1ZBS A;  4XSX A;  1EQR A;  4Y52 C;  1XXB A;  1Y1V A;  4A3L K;  3LPX A;  3GTQ K;  2WB1 D;  3RZO K;  3S14 C;  3GTJ A;  5C3E K;  4A3B K;  3HOW C;  5C44 C;  3Q3Q A;  3GTK C;  4BY7 K;  1JQW A;  1O25 A;  2E2J K;  4LK1 A;  3PO2 C;  1G51 A;  1PJ7 A;  1KQ4 A;  1I6H K;  4RMF A;  1HQM A;  3ORE A;  2JA7 K;  4A3G K;  1R9T K;  1O24 A;  1IQ0 A;  3GTK A;  1XXC A;  4BBR C;  2NVT C;  1SFO K;  2FQO A;  1WOO A;  1WSR A;  4KMU A;  1Y1V K;  5C4J C;  2PHC B;  2Y0S L;  4A3I K;  5M3F K;  2B63 A;  2Y3P A;  1USM A;  2RGR A;  1YCL A;  4KM8 A;  1WOR A;  3RZD C;  4FM9 A;  2NVX A;  4X6A C;  4Y52 K;  1VJE A;  3S14 K;  1O2B A;  5IP9 K;  4KMD A;  4C3H C;  4LLG A;  5IYC C;  2ZUE A;  4G7Z A;  3HOW K;  4GTD A;  1ISE A;  3A8I A;  5IYD C;  4A93 C;  5IP7 K;  3I4M C;  4BY1 K;  3PO2 K;  1WCM A;  2XCQ A;  1J6W A;  1O29 A;  3GEH A;  1USO A;  4KAR A;  4AYB D;  3FHZ A;  4C45 A;  4P5B A;  4A3M C;  1X31 C;  2EBB A;  3T02 A;  5EGE A;  4GTE A;  4LOW A;  2E2H K;  5C3E C;  1EFW A;  3L4J A;  3A8K A;  1WIH A;  4GTL A;  4OIR A;  4KB2 A;  4FZB A;  4GTA A;  2JA7 C;  4A3G C;  4MQ9 A;  4YG2 A;  3HOV C;  4P9S A;  3RZD K;  1B4A A;  3OPF A;  2JH3 A;  2P5M A;  4X6A K;  3BP3 A;  4BXX C;  3EQL A;  1F7U A;  5IYC K;  4A3E C;  1VGX A;  2CFA B;  5C4X K;  2JA7 A;  1R9T A;  2JA6 C;  4A93 K;  5IYD K;  4WJ3 M;  3I4M K;  5M5W K;  3FOF A;  3T00 A;  2JA8 C;  3BP8 C;  3S1N K;  1TWC C;  4BLB A;  2YU9 C;  4GFQ A;  1TWG K;  3PO3 C;  2CFA A;  3N0C A;  3H0G C;  3IPJ A;  3CQZ C;  4A3M K;  5IP9 C;  2ZUF A;  1ZYR A;  2JA6 A;  1YNN A;  3GEI A;  3S16 K;  2A6H A;  4XLN A;  2W7V A;  1O28 A;  3TTG A;  5IP7 C;  1TWC A;  4BY1 C;  3ADA C;  2YU9 A;  3GTM C;  4YFK A;  2WB1 L;  1WSV A;  4A3K K;  2WAQ D;  3M4O C;  1XZP B;  4A3D C;  2PMZ D;  3HOV K;  2E2H C;  1EH1 A;  5IOT A;  1XZQ B;  4QJV B;  1I50 C;  5L46 A;  1WQH A;  4LK0 A;  4BXX K;  4XSZ A;  2E2I C;  3SZY A;  5FJ8 K;  4A3E K;  1XZP A;  3AD9 C;  3TFJ A;  4ZH4 A;  2GSN A;  2JA6 K;  4J3N A;  2E2H A;  3GTL C;  1XZQ A;  4QJV A;  1J98 A;  3GTO C;  4KM9 A;  2R93 C;  2JA8 K;  1AB4 A;  2RH6 A;  1TWC K;  3AQP A;  2YU9 K;  1TWA C;  1ZVU A;  3S15 C;  3PO3 K;  2P8T A;  5CJ9 A;  1BGW A;  1I6V A;  3HKZ D;  3H0G K;  3CQZ K;  3HOX C;  3G4C A;  1O2F B;  1PJ5 A;  3N0B A;  5E68 A;  4C2M C;  5IYB C;  5JVO A;  5C4X C;  3GTL A;  3GTO A;  2R93 A;  1SMY A;  1UV7 A;  1YNJ A;  1TWA A;  4XCH A;  3S0X A;  5FLM C;  3GTM K;  3S1N C;  2GSU A;  4C3J C;  3S1M C;  1TWG C;  3M4O K;  1VRQ C;  4G7H A;  3I4N C;  4A3D K;  5M3M K;  3NUH A;  2VUM C;  4GT9 A;  3S1R C;  3N3Y A;  2NVY C;  2XCR B;  3S16 C;  1PJ6 A;  3ERE D;  1I50 K;  1Y1W K;  2GAH C;  3BUE A;  3SZZ A;  1TWG A;  4AYB L;  2E2I K;  2JA5 C;  4JK1 A;  4MEX A;  3WOD A;  2GSO A;  4A3K C;  1V5V A;  2ZFZ A;  2PA8 D;  4C3I C;  1K83 C;  2NVY A;  5EGH A;  3FOE A;  1TWF C;  4LR2 A;  3GTL K;  4YFN A;  3GTO K;  3S2D C;  2R93 K;  4KAS A;  4XLP A;  2R7Z C;  2O5J A;  3S17 C;  2V6S A;  3JST A;  1TWA K;  4PAB A;  3S15 K;  3VA7 A;  3CAG A;  4KMA A;  1I3Q C;  3S2H K;  3HOX K;  4C2M K;  1YX2 A;  5IYB K;  2D6F C;  1K83 A;  3HOU K;  2V6U A;  5CHP A;  1WQF A;  5TMC A;  3H3V D;  4OIP A;  3LAJ A;  2R7Z A;  4BLA A;  3S1Q C;  4WIL A;  5FLM K;  3AQO A;  1I3Q A;  1INN A;  4DDQ A;  3FKI K;  2A68 A;  4C3J K;  3MML B;  5TJ3 A;  4Y7N K;  1EI6 A;  1TWH C;  3TFI A;  3S1M K;  4QIW D;  3I4N K;  2CW0 A;  4PAA A;  4KN4 A;  1XXA A;  2VUM K;  1JOE A;  3S1R K;  2NVY K;  3HOZ C;  3GTP K;  3LAP A;  2A6E A;  1WOS A;  2PPB A;  1DCP A;  1TWH A;  2BE5 A;  2JA5 K;  3H0G A;  3CQZ A;  2R92 C;  3L4K A;  3GTG K;  3GDZ A;  4KDD A;  5HL8 A;  4C3I K;  1IE0 A;  4A3F K;  3K7A C;  1B4B A;  1K83 K;  5JFE A;  1C0A A;  1TWF K;  1BS2 A;  1VLO A;  5IOR A;  3S2D K;  4G7O A;  1IBA A;  2R7Z K;  4G0W A;  3S17 K;  3GTM A;  5TMF A;  1JVI A;  1Y1W C;  1I3Q K;  1IL2 A;  2R92 A;  4M1X A;  2WAQ L;  3DXJ A;  1IS1 A;  3M3Y C;  1J6V A;  2PMZ L;  4A3J K;  2O5I A;  3S1Q K;  2Y0S D;  4OIO A;  2B63 C;  1I50 A;  1Y1W A;  4GZY A;  2XCO A;  2E2I A;  1DD5 A;  4GTC A;  3G4A A;  1TWH K;  1O27 A;  4MEY A;  4P5A A;  2NVX C;  3S2H C;  4OIN A;  1F93 A;  2GAG C;  3V4G A;  4BBS K;  5IOS A;  4KC6 A;  3AD7 C;  3T01 A;  4OIQ A;  3HOU C;  4GTF A;  4KMH A;  3OEP A;  2A69 A;  3HOZ K;  3HOY C;  2KWA A;  3GTJ K;  2NVQ K;  1F9N A;  5IOQ A;  4NOI A;  4A3C C;  4KAT A;  3HKZ L;  2R92 K;  3FKI C;  5M5X K;  4LQY A;  4Y7N C;  1BJT A;  1EK8 A;  2FQT A;  1WCM C;  1F7V A;  3K7A K;  1DCH A;  1ZQ1 C;  2V6T A;  3GTP C;  4ILD A;  5C44 K;  3GTK K;  1WQG A;  3FKI A;  4O2D A; 
#chains in the Genus database with same CATH homology
 4YFK A;  3M3Y K;  2WB1 L;  3S1Q C;  3GTG C;  4A3K K;  5FLM K;  2WAQ D;  1IW7 A;  3RZD C;  3M4O C;  4A3F C;  4A3L C;  3GTQ C;  3FKI K;  2A68 A;  4C3J K;  5D4D A;  3RZO C;  4X6A C;  4Y52 K;  4A3D C;  2B63 K;  4Y7N K;  1TWH C;  2PMZ D;  3HOV K;  3S1M K;  4QIW D;  2E2H C;  3S14 K;  3I4N K;  4A3B C;  2CW0 A;  5IP9 K;  1XPP A;  2NVT K;  4LJZ A;  4BBR K;  4KN4 A;  4LLG A;  4QJV B;  1I50 C;  5IYC C;  2VUM K;  4BY7 C;  4LK0 A;  3S1R K;  4BXX K;  4G7Z A;  2NVY K;  2E2J C;  2NVX K;  3HOW K;  3HOZ C;  2PA8 L;  4XSZ A;  2E2I C;  3GTP K;  4YFX A;  5FJ8 K;  5IYD C;  4A3E K;  4KN7 A;  5IP7 K;  3I4M C;  4A93 C;  5C4J K;  2A6E A;  4BY1 K;  4ZH4 A;  1I6H C;  2PPB A;  3HOY K;  3PO2 K;  2BE5 A;  2JA5 K;  2JA6 K;  4A3J C;  2R92 C;  4A3C K;  3GTG K;  3GTL C;  4QJV A;  1R9T C;  3GTO C;  4AYB D;  2R93 C;  4C3I K;  2JA8 K;  4A3F K;  3K7A C;  1K83 K;  1TWC K;  4A3M C;  1TWF K;  1TWA C;  2YU9 K;  3S15 C;  3S2D K;  3PO3 K;  1BDF A;  1SFO C;  4G7O A;  1I6V A;  1WCM K;  3HKZ D;  3H0G K;  5C3E C;  3CQZ K;  2E2H K;  2R7Z K;  3HOX C;  3S17 K;  5TMF A;  3H3V L;  4C3H K;  4BBS C;  5IYB C;  1Y1V C;  1I3Q K;  1Y1W C;  4Q5S A;  5C4X C;  4A3I C;  1SMY A;  2WAQ L;  1YNJ A;  3DXJ A;  3GTJ C;  2NVQ C;  3M3Y C;  4OIR A;  5M5Y K;  5FLM C;  3GTM K;  2PMZ L;  4Q4Z A;  4A3J K;  2O5I A;  3S1N C;  4QIW L;  4XSX A;  3S1Q K;  2Y0S D;  2JA7 C;  4Y52 C;  4MQ9 A;  4OIO A;  4A3G C;  2B63 C;  3S1M C;  1TWG C;  4YG2 A;  3HOV C;  3RZD K;  3M4O K;  4GZY A;  4A3L K;  3S14 C;  4G7H A;  2WB1 D;  3GTQ K;  3RZO K;  3I4N C;  4X6A K;  4A3D K;  5M3M K;  1TWH K;  2VUM C;  5IYD K;  4MEY A;  3S1R C;  4BXX C;  5C3E K;  4A3B K;  2NVY C;  2NVX C;  3HOW C;  4OIN A;  3EQL A;  3S16 C;  3S2H C;  4BBS K;  5C44 C;  5IYC K;  4A3E C;  1I50 K;  1Y1W K;  4OIQ A;  3GTK C;  3HOU C;  4BY7 K;  5C4X K;  2E2J K;  2A69 A;  4LK1 A;  3HOZ K;  4AYB L;  2E2I K;  3HOY C;  2JA6 C;  2JA5 C;  3PO2 C;  3GTJ K;  4JK1 A;  2NVQ K;  4A93 K;  4MEX A;  3I4M K;  4NOI A;  3WOD A;  4A3C C;  5M5W K;  4A3K C;  1I6H K;  1HQM A;  2PA8 D;  2JA8 C;  3H3V D;  3S1N K;  3HKZ L;  2R92 K;  1TWC C;  1K83 C;  3FKI C;  5M5X K;  2JA7 K;  4A3G K;  1TWF C;  2YU9 C;  4Y7N C;  4YFN A;  1R9T K;  3GTL K;  3GTO K;  1TWG K;  4XLP A;  3PO3 C;  3S2D C;  2R93 K;  1WCM C;  3K7A K;  3H0G C;  4A3M K;  3CQZ C;  2R7Z C;  5IP9 C;  2O5J A;  1ZYR A;  3S17 C;  2NVT C;  1TWA K;  4BBR C;  3S15 K;  1I3Q C;  1SFO K;  1YNN A;  3S16 K;  3S2H K;  3HOX K;  2A6H A;  4XLN A;  3GTP C;  5C44 K;  4KMU A;  4C2M K;  5IYB K;  1Y1V K;  5IP7 C;  3GTK K;  5C4J C;  3HOU K;  2Y0S L;  4BY1 C;  4A3I K;  5M3F K;  5TMC A;  3GTM C;  4OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...