3S1QK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1qK00
4YFXA 5C4XK 5C44C 4A3IC 4A3KC 4LJZA 4XLPA 4BBSC 3H0GC 4XSZA 3S16K 4OIPA 4A3JK 4KN7A 3M3YC 3I4MC 1K83K 3GTJK 4MQ9A 1SFOC 1HQMA 3GTGK 5IP9K 3K7AK 4XLNA 4G7HA 1Y1WC 4OIRA 2NVYK 2WB1L 4GZYA 1WCMC 2PMZD 2E2IC 1I6HC 1TWHK 1I50K 2A68A 1IW7A 4QJVA 3S1MC 3S17K 4BBRC 5C3EC 4C3IK 1TWCK 5IYDK 4YFNA 3GTPK 2O5IA 2Y0SD 3I4NK 5FLMC 4A3MC 4QIWL 5C44K 4C2MK 2Y0SL 4Y7NC 3HOUC 4A3IK 4A3KK 4BBSK 5C4XC 1YNNA 3S16C 5IP7C 4A3EK 2NVQK 3PO2C 3HKZL 3HOZK 2VUMK 3S14C 3I4MK 5IYCC 3GTJC 3HKZD 2PA8L 2NVTC 4A3BC 3GTGC 3HOWC 1BDFA 1YNJA 3K7AC 2NVYC 3GTOK 2JA5K 4YFKA 4XSXA 2E2IK 4A3DK 1I50C 1R9TC 2O5JA 3RZOK 5TMCA 3S1MK 3S2DC 1I6VA 4BBRK 5C3EK 4A3CK 5IYDC 1TWAC 5FLMK 3RZDK 2WAQD 4QJVB 4AYBL 4Q4ZA 3H3VD 2R93C 4Y7NK 3HOUK 3GTLC 3S15C 5IP7K 4A3EC 2NVQC 3PO2K 4G7OA 3HOZC 2VUMC 3S14K 3GTQK 5IYCK 4OINA 4A3BK 2NVTK 4Q5SA 3HOWK 3M4OK 4ZH4A 3GTOC 2JA5C 4BXXC 3S1RK 5TMFA 2JA8C 3HOVC 4KN4A 4A3DC 3CQZK 2A6EA 2A69A 4LK1A 4OIOA 1R9TK 2NVXK 3RZOC 3S1QC 3S2DK 4A3GK 1Y1VC 3HOXC 1TWFC 4A3CC 2R92K 1TWAK 3DXJA 2JA6K 4A93C 4QIWD 4JK1A 3RZDC 3HOYC 3FKIK 4BY7K 2R93K 4X6AK 4LLGA 3EQLA 2E2HK 4BY1C 3GTLK 3S15K 5M3MK 3S2HC 3GTQC 2PA8D 2JA7K 5M5YK 4A3LC 5D4DA 3PO3C 5IYBC 3WODA 3M4OC 4BXXK 2A6HA 2YU9C 3S1RC 1I3QK 2JA8K 3HOVK 5C4JK 3CQZC 2NVXC 4MEYA 5M3FK 3S1QK 4A3GC 3GTMC 1Y1VK 4NOIA 1TWFK 3HOXK 4A3FK 2R92C 2R7ZC 2B63C 2JA6C 4A93K 4X6AC 1XPPA 3S1NK 3HOYK 3FKIC 2PMZL 5M5XK 4BY7C 2WB1D 2E2HC 4BY1K 1SMYA 1TWGC 4Y52C 2E2JC 3GTKC 4C3HK 3S2HK 2PPBA 4MEXA 2JA7C 4A3LK 3PO3K 3H0GK 5IYBK 4A3JC 4G7ZA 4OIQA 2YU9K 4C3JK 4KMUA 1I3QC 3M3YK 1K83C 4AYBD 2WAQL 1ZYRA 5M5WK 5C4JC 1SFOK 3H3VL 4YG2A 5IP9C 2CW0A 5FJ8K 3GTMK 1Y1WK 4A3FC 2R7ZK 2B63K 1WCMK 1I6HK 3S1NC 1TWHC 3S17C 4LK0A 1TWCC 1TWGK 2BE5A 2E2JK 3GTKK 3GTPC 3I4NC 4Y52K 4A3MK
chains in the Genus database with same CATH superfamily
4YFXA 5C4XK 5C44C 4C2MC 5E68A 2GSNA 2GSUA 3TFIA 3M3YC 1ISEA 3GTJK 1VLOA 3GTGK 1J6XA 4OIRA 4GTFA 1ZBSA 2PMZD 3V4GA 2E2IC 2A68A 4YFNA 3GTPK 2Y0SL 3HOUC 4BBSK 1TWCA 3S16C 4A3EK 3PO2C 4GTLA 1YNJA 3K7AC 1IE0A 2NVYC 3VA7A 4KATA 3QX3A 1DCHA 4A3DK 3S2DC 4BBRK 1WOPA 3TTGA 1WQHA 4QJVB 1DD5A 2R93C 1TWGA 1XZPB 2KWAA 3S15C 5IP7K 2NVQC 4KB4A 3S14K 2VUMC 1WSVA 2NVTK 4KASA 1VH2A 2D6FC 1GE9A 2EBBA 3GTOC 4G0WA 3GDZA 4P5AA 2A6EA 4OIOA 3S1QC 4A3GK 3T01A 5IOSA 1WOSA 4J3NA 2R92K 1J98A 1TWAK 4X6AK 3RZDC 3FKIK 4AH6A 1UV7A 3S2HC 5L46A 2R93A 3GTQC 1I3QA 5IYBC 2A6HA 3GTMA 4MEYA 1AB4A 3HOXK 3LAJA 4LOWA 2JA6C 4A93K 1XPPA 1USMA 3AQOA 3AQPA 4Y52C 3A8JA 4C3HK 2PPBA 4G0VA 1XXCA 1XXAA 1YX2A 1BJTA 4G7ZA 4BLAA 3GSIA 4WILA 5M5WK 1G51A 2FQOA 5IP9C 2CW0A 4KM9A 4A3FC 1JOEA 1TWFA 1O2AA 2B63K 4C45A 1XZQB 3ADAC 3A8KA 4LK0A 1TWGK 2XCQA 4BBSC 4GTAA 4LJZA 4BKWA 3H0GC 4XLPA 3S16K 4A3JK 4PABA 1K83K 4MQ9A 1KQ4A 1WCMC 2R92A 1TWAA 3S1MC 3S17K 4BBRC 2GSOA 5IYDK 5IORA 4A3MC 4QIWL 5EGHA 5IP7C 2NVQK 3S14C 3HKZD 1BDFA 4GTBA 3GTOK 2NVXA 4XSXA 1I50C 2RH6A 3SZYA 1TWAC 3RZDK 3GTPA 4Q4ZA 1EQRA 3GTLC 3GTGA 3GTQK 1EK8A 5IYCK 3AD9C 2ZFZA 5IOTA 4BLBA 4OINA 2XCRB 4Q5SA 1WORA 4GT9A 2JA5C 5TMFA 4KARA 1BGWA 4PAAA 1I50A 1VJEA 4A93C 1XZQA 2GAGC 2R93K 3N0CA 4LLGA 2JH3A 5CJ9A 5IOQA 4FZBA 5M3MK 1O27A 4C3HC 2E2HA 3JSTA 3WODA 4BXXK 4KC6A 4C3JC 3GEHA 5EGEA 3FOEA 5C4JK 3GTOA 3S1QK 4A3GC 1F7VA 2R92C 3S1NK 1F93A 3FKIC 2PMZL 5M5XK 3HOYK 3BUEA 2XCOA 2E2HC 1SMYA 1PJ5A 4LQYA 4P5BA 1TWGC 4GTDA 4KMDA 2JA7C 4A3LK 2RGRA 3H0GK 5IYBK 2V6UA 4A3JC 3OREA 1I3QC 1K83C 1ZQ1C 3GEEA 2NVYA 3GTMK 2V6TA 1DCPA 2R7ZK 1WCMK 4GTCA 3S17C 1O29A 1WQGA 2BE5A 3I4NC 4A3MK 3GTLA 4DDQA 4A3KC 3GTJA 1BS2A 4XSZA 4OIPA 4KN7A 1HI9A 1SFOC 1HQMA 5IP9K 4G7HA 1Y1WC 3L4JA 1F9NA 1TWHK 1I50K 2PHCB 1IW7A 4QJVA 4GFQA 1TWCK 4KDDA 2O5IA 5FLMC 1USOA 3G4CA 4A3IK 3HKZL 3HOZK 4WJ4A 1O28A 1XXBA 3I4MK 5IYCC 2PA8L 4A3BC 1WSRA 2R7ZA 3HOWC 2JA7A 1SFOA 4YFKA 2JA5K 2CFAA 1R9TC 1V5VA 5TMCA 1TWHA 3S1MK 1O25A 1WCMA 2CFAB 5C3EK 4A3CK 5IYDC 4P9SA 2WAQD 4AYBL 3H3VD 4Y7NK 4G7OA 1IQ0A 1PJ7A 4RMFA 3H0GA 3LPXA 4KB2A 4O2DA 4GTEA 1L0WA 4ZH4A 4BXXC 1O2FB 5JVOA 3S1RK 3HOVC 3HXAA 4KN4A 3CQZK 3GIRA 4LK1A 2NVXK 3N0BA 3RZOC 1Y1VC 1TWFC 3L4KA 4QIWD 3HOYC 1WOOA 3EQLA 2E2HK 3GTLK 3FKIA 1RU0A 3LAPA 3TFJA 2JA7K 2FQTA 4A3LC 3PO3C 1O26A 3M4OC 4G0UA 2JA8K 1I3QK 3SZZA 5M3FK 3GTMC 4NOIA 1VGXA 2R7ZC 4BY7C 3G4AA 2WB1D 4BY1K 4MEXA 1PJ6A 1J6WA 3CAGA 4OIQA 2YU9K 4C3JK 3ERED 3M3YK 2W7VA 3NUHA 5C4JC 1SFOK 2JA5A 3IPJA 4YG2A 1JQWA 1Y1WK 3S1NC 2ZUEA 1TWHC 2GAHC 3T02A 3AH5A 4ILDA 1TWCC 3T00A 2E2JK 3GTKK 3GTPC 3GEIA 1B4BA 4A3IC 1INNA 3OEPA 2VUMA 3I4MC 5HL8A 1O24A 3K7AK 4XLNA 4WJ3M 2NVYK 2WB1L 4GZYA 3BP8C 1I6HC 1J6VA 5C3EC 4C3IK 3AD7C 3I4NK 2Y0SD 5C44K 5C4XC 4C2MK 4Y7NC 2YU9A 4M1XA 4A3KK 1YNNA 4KAWX 5CHPA 1WQFA 3MMLB 1EFWA 5JFEA 2VUMK 2Y3PA 3GTJC 2NVTC 3GTGC 3FOFA 1EH1A 2E2IK 1IBAA 1YCLA 4LR2A 2O5JA 3BP3A 3N3YA 3RZOK 3Q3QA 3FHZA 1I6VA 2JA6A 1O2BA 5FLMK 2ZUFA 1Y1VA 3TFHA 3HOUK 3GTKA 1XZPA 1F7UA 4A3EC 3PO2K 3S0XA 3HOZC 1X31C 1JVIA 4FM9A 4A3BK 3HOWK 4KMHA 3M4OK 3GTQA 2JA8C 1Y1WA 4A3DC 3OPFA 2A69A 1R9TK 1B4AA 3S2DK 3HOXC 1WIHA 4A3CC 4KM8A 1C0AA 3DXJA 2JA6K 4JK1A 3A8IA 4BY7K 4BY1C 3S15K 1ZXOA 2P8TA 2PA8D 5M5YK 5D4DA 1ZVUA 2E2IA 2YU9C 3S1RC 3HOVK 3CQZC 2NVXC 2V6SA 3CQZA 1Y1VK 1K83A 1TWFK 2B63A 4A3FK 2B63C 4X6AC 2E2JC 3GTKC 3S2HK 5TJ3A 4XCHA 3PO3K 1VRQC 1IL2A 1R9TA 4KMUA 4KMAA 4AYBD 2WAQL 1ZYRA 3H3VL 5FJ8K 1EI6A 1I6HK 1DCOA 2P5MA 4C3IC 3AD8C 4Y52K 1IS1A
chains in the Genus database with same CATH topology
4YFXA 5C4XK 5C44C 4A3IC 4A3KC 4LJZA 4XLPA 4BBSC 3H0GC 4XSZA 3S16K 4OIPA 4A3JK 4KN7A 3M3YC 3I4MC 1K83K 3GTJK 4MQ9A 1SFOC 1HQMA 3GTGK 5IP9K 3K7AK 4XLNA 4G7HA 1Y1WC 4OIRA 2NVYK 2WB1L 4GZYA 1WCMC 2PMZD 2E2IC 1I6HC 1TWHK 1I50K 2A68A 1IW7A 4QJVA 3S1MC 3S17K 4BBRC 5C3EC 4C3IK 1TWCK 5IYDK 4YFNA 3GTPK 2O5IA 2Y0SD 3I4NK 5FLMC 4A3MC 4QIWL 5C44K 4C2MK 2Y0SL 4Y7NC 3HOUC 4A3IK 4A3KK 4BBSK 5C4XC 1YNNA 3S16C 5IP7C 4A3EK 2NVQK 3PO2C 3HKZL 3HOZK 2VUMK 3S14C 3I4MK 5IYCC 3GTJC 3HKZD 2PA8L 2NVTC 4A3BC 3GTGC 3HOWC 1BDFA 1YNJA 3K7AC 2NVYC 3GTOK 2JA5K 4YFKA 4XSXA 2E2IK 4A3DK 1I50C 1R9TC 2O5JA 3RZOK 5TMCA 3S1MK 3S2DC 1I6VA 4BBRK 5C3EK 4A3CK 5IYDC 1TWAC 5FLMK 3RZDK 2WAQD 4QJVB 4AYBL 4Q4ZA 3H3VD 2R93C 4Y7NK 3HOUK 3GTLC 3S15C 5IP7K 4A3EC 2NVQC 3PO2K 4G7OA 3HOZC 2VUMC 3S14K 3GTQK 5IYCK 4OINA 4A3BK 2NVTK 4Q5SA 3HOWK 3M4OK 4ZH4A 3GTOC 2JA5C 4BXXC 3S1RK 5TMFA 2JA8C 3HOVC 4KN4A 4A3DC 3CQZK 2A6EA 2A69A 4LK1A 4OIOA 1R9TK 2NVXK 3RZOC 3S1QC 3S2DK 4A3GK 1Y1VC 3HOXC 1TWFC 4A3CC 2R92K 1TWAK 3DXJA 2JA6K 4A93C 4QIWD 4JK1A 3RZDC 3HOYC 3FKIK 4BY7K 2R93K 4X6AK 4LLGA 3EQLA 2E2HK 4BY1C 3GTLK 3S15K 5M3MK 3S2HC 3GTQC 2PA8D 2JA7K 5M5YK 4A3LC 5D4DA 3PO3C 5IYBC 3WODA 3M4OC 4BXXK 2A6HA 2YU9C 3S1RC 1I3QK 2JA8K 3HOVK 5C4JK 3CQZC 2NVXC 4MEYA 5M3FK 3S1QK 4A3GC 3GTMC 1Y1VK 4NOIA 1TWFK 3HOXK 4A3FK 2R92C 2R7ZC 2B63C 2JA6C 4A93K 4X6AC 1XPPA 3S1NK 3HOYK 3FKIC 2PMZL 5M5XK 4BY7C 2WB1D 2E2HC 4BY1K 1SMYA 1TWGC 4Y52C 2E2JC 3GTKC 4C3HK 3S2HK 2PPBA 4MEXA 2JA7C 4A3LK 3PO3K 3H0GK 5IYBK 4A3JC 4G7ZA 4OIQA 2YU9K 4C3JK 4KMUA 1I3QC 3M3YK 1K83C 4AYBD 2WAQL 1ZYRA 5M5WK 5C4JC 1SFOK 3H3VL 4YG2A 5IP9C 2CW0A 5FJ8K 3GTMK 1Y1WK 4A3FC 2R7ZK 2B63K 1WCMK 1I6HK 3S1NC 1TWHC 3S17C 4LK0A 1TWCC 1TWGK 2BE5A 2E2JK 3GTKK 3GTPC 3I4NC 4Y52K 4A3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX A;  5C4X K;  5C44 C;  4A3I C;  4A3K C;  4LJZ A;  4XLP A;  4BBS C;  3H0G C;  4XSZ A;  3S16 K;  4OIP A;  4A3J K;  4KN7 A;  3M3Y C;  3I4M C;  1K83 K;  3GTJ K;  4MQ9 A;  1SFO C;  1HQM A;  3GTG K;  5IP9 K;  3K7A K;  4XLN A;  4G7H A;  1Y1W C;  4OIR A;  2NVY K;  2WB1 L;  4GZY A;  1WCM C;  2PMZ D;  2E2I C;  1I6H C;  1TWH K;  1I50 K;  2A68 A;  1IW7 A;  4QJV A;  3S1M C;  3S17 K;  4BBR C;  5C3E C;  4C3I K;  1TWC K;  5IYD K;  4YFN A;  3GTP K;  2O5I A;  2Y0S D;  3I4N K;  5FLM C;  4A3M C;  4QIW L;  5C44 K;  4C2M K;  2Y0S L;  4Y7N C;  3HOU C;  4A3I K;  4A3K K;  4BBS K;  5C4X C;  1YNN A;  3S16 C;  5IP7 C;  4A3E K;  2NVQ K;  3PO2 C;  3HKZ L;  3HOZ K;  2VUM K;  3S14 C;  3I4M K;  5IYC C;  3GTJ C;  3HKZ D;  2PA8 L;  2NVT C;  4A3B C;  3GTG C;  3HOW C;  1BDF A;  1YNJ A;  3K7A C;  2NVY C;  3GTO K;  2JA5 K;  4YFK A;  4XSX A;  2E2I K;  4A3D K;  1I50 C;  1R9T C;  2O5J A;  3RZO K;  5TMC A;  3S1M K;  3S2D C;  1I6V A;  4BBR K;  5C3E K;  4A3C K;  5IYD C;  1TWA C;  5FLM K;  3RZD K;  2WAQ D;  4QJV B;  4AYB L;  4Q4Z A;  3H3V D;  2R93 C;  4Y7N K;  3HOU K;  3GTL C;  3S15 C;  5IP7 K;  4A3E C;  2NVQ C;  3PO2 K;  4G7O A;  3HOZ C;  2VUM C;  3S14 K;  3GTQ K;  5IYC K;  4OIN A;  4A3B K;  2NVT K;  4Q5S A;  3HOW K;  3M4O K;  4ZH4 A;  3GTO C;  2JA5 C;  4BXX C;  3S1R K;  5TMF A;  2JA8 C;  3HOV C;  4KN4 A;  4A3D C;  3CQZ K;  2A6E A;  2A69 A;  4LK1 A;  4OIO A;  1R9T K;  2NVX K;  3RZO C;  3S1Q C;  3S2D K;  4A3G K;  1Y1V C;  3HOX C;  1TWF C;  4A3C C;  2R92 K;  1TWA K;  3DXJ A;  2JA6 K;  4A93 C;  4QIW D;  4JK1 A;  3RZD C;  3HOY C;  3FKI K;  4BY7 K;  2R93 K;  4X6A K;  4LLG A;  3EQL A;  2E2H K;  4BY1 C;  3GTL K;  3S15 K;  5M3M K;  3S2H C;  3GTQ C;  2PA8 D;  2JA7 K;  5M5Y K;  4A3L C;  5D4D A;  3PO3 C;  5IYB C;  3WOD A;  3M4O C;  4BXX K;  2A6H A;  2YU9 C;  3S1R C;  1I3Q K;  2JA8 K;  3HOV K;  5C4J K;  3CQZ C;  2NVX C;  4MEY A;  5M3F K;  3S1Q K;  4A3G C;  3GTM C;  1Y1V K;  4NOI A;  1TWF K;  3HOX K;  4A3F K;  2R92 C;  2R7Z C;  2B63 C;  2JA6 C;  4A93 K;  4X6A C;  1XPP A;  3S1N K;  3HOY K;  3FKI C;  2PMZ L;  5M5X K;  4BY7 C;  2WB1 D;  2E2H C;  4BY1 K;  1SMY A;  1TWG C;  4Y52 C;  2E2J C;  3GTK C;  4C3H K;  3S2H K;  2PPB A;  4MEX A;  2JA7 C;  4A3L K;  3PO3 K;  3H0G K;  5IYB K;  4A3J C;  4G7Z A;  4OIQ A;  2YU9 K;  4C3J K;  4KMU A;  1I3Q C;  3M3Y K;  1K83 C;  4AYB D;  2WAQ L;  1ZYR A;  5M5W K;  5C4J C;  1SFO K;  3H3V L;  4YG2 A;  5IP9 C;  2CW0 A;  5FJ8 K;  3GTM K;  1Y1W K;  4A3F C;  2R7Z K;  2B63 K;  1WCM K;  1I6H K;  3S1N C;  1TWH C;  3S17 C;  4LK0 A;  1TWC C;  1TWG K;  2BE5 A;  2E2J K;  3GTK K;  3GTP C;  3I4N C;  4Y52 K;  4A3M K; 
#chains in the Genus database with same CATH topology
 4YFX A;  5C4X K;  5C44 C;  4C2M C;  5E68 A;  2GSN A;  2GSU A;  3TFI A;  3M3Y C;  1ISE A;  3GTJ K;  1VLO A;  3GTG K;  1J6X A;  4OIR A;  4GTF A;  1ZBS A;  2PMZ D;  3V4G A;  2E2I C;  2A68 A;  4YFN A;  3GTP K;  2Y0S L;  3HOU C;  4BBS K;  1TWC A;  3S16 C;  4A3E K;  3PO2 C;  4GTL A;  1YNJ A;  3K7A C;  1IE0 A;  2NVY C;  3VA7 A;  4KAT A;  3QX3 A;  1DCH A;  4A3D K;  3S2D C;  4BBR K;  1WOP A;  3TTG A;  1WQH A;  4QJV B;  1DD5 A;  2R93 C;  1TWG A;  1XZP B;  2KWA A;  3S15 C;  5IP7 K;  2NVQ C;  4KB4 A;  3S14 K;  2VUM C;  1WSV A;  2NVT K;  4KAS A;  1VH2 A;  2D6F C;  1GE9 A;  2EBB A;  3GTO C;  4G0W A;  3GDZ A;  4P5A A;  2A6E A;  4OIO A;  3S1Q C;  4A3G K;  3T01 A;  5IOS A;  1WOS A;  4J3N A;  2R92 K;  1J98 A;  1TWA K;  4X6A K;  3RZD C;  3FKI K;  4AH6 A;  1UV7 A;  3S2H C;  5L46 A;  2R93 A;  3GTQ C;  1I3Q A;  5IYB C;  2A6H A;  3GTM A;  4MEY A;  1AB4 A;  3HOX K;  3LAJ A;  4LOW A;  2JA6 C;  4A93 K;  1XPP A;  1USM A;  3AQO A;  3AQP A;  4Y52 C;  3A8J A;  4C3H K;  2PPB A;  4G0V A;  1XXC A;  1XXA A;  1YX2 A;  1BJT A;  4G7Z A;  4BLA A;  3GSI A;  4WIL A;  5M5W K;  1G51 A;  2FQO A;  5IP9 C;  2CW0 A;  4KM9 A;  4A3F C;  1JOE A;  1TWF A;  1O2A A;  2B63 K;  4C45 A;  1XZQ B;  3ADA C;  3A8K A;  4LK0 A;  1TWG K;  2XCQ A;  4BBS C;  4GTA A;  4LJZ A;  4BKW A;  3H0G C;  4XLP A;  3S16 K;  4A3J K;  4PAB A;  1K83 K;  4MQ9 A;  1KQ4 A;  1WCM C;  2R92 A;  1TWA A;  3S1M C;  3S17 K;  4BBR C;  2GSO A;  5IYD K;  5IOR A;  4A3M C;  4QIW L;  5EGH A;  5IP7 C;  2NVQ K;  3S14 C;  3HKZ D;  1BDF A;  4GTB A;  3GTO K;  2NVX A;  4XSX A;  1I50 C;  2RH6 A;  3SZY A;  1TWA C;  3RZD K;  3GTP A;  4Q4Z A;  1EQR A;  3GTL C;  3GTG A;  3GTQ K;  1EK8 A;  5IYC K;  3AD9 C;  2ZFZ A;  5IOT A;  4BLB A;  4OIN A;  2XCR B;  4Q5S A;  1WOR A;  4GT9 A;  2JA5 C;  5TMF A;  4KAR A;  1BGW A;  4PAA A;  1I50 A;  1VJE A;  4A93 C;  1XZQ A;  2GAG C;  2R93 K;  3N0C A;  4LLG A;  2JH3 A;  5CJ9 A;  5IOQ A;  4FZB A;  5M3M K;  1O27 A;  4C3H C;  2E2H A;  3JST A;  3WOD A;  4BXX K;  4KC6 A;  4C3J C;  3GEH A;  5EGE A;  3FOE A;  5C4J K;  3GTO A;  3S1Q K;  4A3G C;  1F7V A;  2R92 C;  3S1N K;  1F93 A;  3FKI C;  2PMZ L;  5M5X K;  3HOY K;  3BUE A;  2XCO A;  2E2H C;  1SMY A;  1PJ5 A;  4LQY A;  4P5B A;  1TWG C;  4GTD A;  4KMD A;  2JA7 C;  4A3L K;  2RGR A;  3H0G K;  5IYB K;  2V6U A;  4A3J C;  3ORE A;  1I3Q C;  1K83 C;  1ZQ1 C;  3GEE A;  2NVY A;  3GTM K;  2V6T A;  1DCP A;  2R7Z K;  1WCM K;  4GTC A;  3S17 C;  1O29 A;  1WQG A;  2BE5 A;  3I4N C;  4A3M K;  3GTL A;  4DDQ A;  4A3K C;  3GTJ A;  1BS2 A;  4XSZ A;  4OIP A;  4KN7 A;  1HI9 A;  1SFO C;  1HQM A;  5IP9 K;  4G7H A;  1Y1W C;  3L4J A;  1F9N A;  1TWH K;  1I50 K;  2PHC B;  1IW7 A;  4QJV A;  4GFQ A;  1TWC K;  4KDD A;  2O5I A;  5FLM C;  1USO A;  3G4C A;  4A3I K;  3HKZ L;  3HOZ K;  4WJ4 A;  1O28 A;  1XXB A;  3I4M K;  5IYC C;  2PA8 L;  4A3B C;  1WSR A;  2R7Z A;  3HOW C;  2JA7 A;  1SFO A;  4YFK A;  2JA5 K;  2CFA A;  1R9T C;  1V5V A;  5TMC A;  1TWH A;  3S1M K;  1O25 A;  1WCM A;  2CFA B;  5C3E K;  4A3C K;  5IYD C;  4P9S A;  2WAQ D;  4AYB L;  3H3V D;  4Y7N K;  4G7O A;  1IQ0 A;  1PJ7 A;  4RMF A;  3H0G A;  3LPX A;  4KB2 A;  4O2D A;  4GTE A;  1L0W A;  4ZH4 A;  4BXX C;  1O2F B;  5JVO A;  3S1R K;  3HOV C;  3HXA A;  4KN4 A;  3CQZ K;  3GIR A;  4LK1 A;  2NVX K;  3N0B A;  3RZO C;  1Y1V C;  1TWF C;  3L4K A;  4QIW D;  3HOY C;  1WOO A;  3EQL A;  2E2H K;  3GTL K;  3FKI A;  1RU0 A;  3LAP A;  3TFJ A;  2JA7 K;  2FQT A;  4A3L C;  3PO3 C;  1O26 A;  3M4O C;  4G0U A;  2JA8 K;  1I3Q K;  3SZZ A;  5M3F K;  3GTM C;  4NOI A;  1VGX A;  2R7Z C;  4BY7 C;  3G4A A;  2WB1 D;  4BY1 K;  4MEX A;  1PJ6 A;  1J6W A;  3CAG A;  4OIQ A;  2YU9 K;  4C3J K;  3ERE D;  3M3Y K;  2W7V A;  3NUH A;  5C4J C;  1SFO K;  2JA5 A;  3IPJ A;  4YG2 A;  1JQW A;  1Y1W K;  3S1N C;  2ZUE A;  1TWH C;  2GAH C;  3T02 A;  3AH5 A;  4ILD A;  1TWC C;  3T00 A;  2E2J K;  3GTK K;  3GTP C;  3GEI A;  1B4B A;  4A3I C;  1INN A;  3OEP A;  2VUM A;  3I4M C;  5HL8 A;  1O24 A;  3K7A K;  4XLN A;  4WJ3 M;  2NVY K;  2WB1 L;  4GZY A;  3BP8 C;  1I6H C;  1J6V A;  5C3E C;  4C3I K;  3AD7 C;  3I4N K;  2Y0S D;  5C44 K;  5C4X C;  4C2M K;  4Y7N C;  2YU9 A;  4M1X A;  4A3K K;  1YNN A;  4KAW X;  5CHP A;  1WQF A;  3MML B;  1EFW A;  5JFE A;  2VUM K;  2Y3P A;  3GTJ C;  2NVT C;  3GTG C;  3FOF A;  1EH1 A;  2E2I K;  1IBA A;  1YCL A;  4LR2 A;  2O5J A;  3BP3 A;  3N3Y A;  3RZO K;  3Q3Q A;  3FHZ A;  1I6V A;  2JA6 A;  1O2B A;  5FLM K;  2ZUF A;  1Y1V A;  3TFH A;  3HOU K;  3GTK A;  1XZP A;  1F7U A;  4A3E C;  3PO2 K;  3S0X A;  3HOZ C;  1X31 C;  1JVI A;  4FM9 A;  4A3B K;  3HOW K;  4KMH A;  3M4O K;  3GTQ A;  2JA8 C;  1Y1W A;  4A3D C;  3OPF A;  2A69 A;  1R9T K;  1B4A A;  3S2D K;  3HOX C;  1WIH A;  4A3C C;  4KM8 A;  1C0A A;  3DXJ A;  2JA6 K;  4JK1 A;  3A8I A;  4BY7 K;  4BY1 C;  3S15 K;  1ZXO A;  2P8T A;  2PA8 D;  5M5Y K;  5D4D A;  1ZVU A;  2E2I A;  2YU9 C;  3S1R C;  3HOV K;  3CQZ C;  2NVX C;  2V6S A;  3CQZ A;  1Y1V K;  1K83 A;  1TWF K;  2B63 A;  4A3F K;  2B63 C;  4X6A C;  2E2J C;  3GTK C;  3S2H K;  5TJ3 A;  4XCH A;  3PO3 K;  1VRQ C;  1IL2 A;  1R9T A;  4KMU A;  4KMA A;  4AYB D;  2WAQ L;  1ZYR A;  3H3V L;  5FJ8 K;  1EI6 A;  1I6H K;  1DCO A;  2P5M A;  4C3I C;  3AD8 C;  4Y52 K;  1IS1 A; 
#chains in the Genus database with same CATH homology
 4YFX A;  5C4X K;  5C44 C;  4A3I C;  4A3K C;  4LJZ A;  4XLP A;  4BBS C;  3H0G C;  4XSZ A;  3S16 K;  4OIP A;  4A3J K;  4KN7 A;  3M3Y C;  3I4M C;  1K83 K;  3GTJ K;  4MQ9 A;  1SFO C;  1HQM A;  3GTG K;  5IP9 K;  3K7A K;  4XLN A;  4G7H A;  1Y1W C;  4OIR A;  2NVY K;  2WB1 L;  4GZY A;  1WCM C;  2PMZ D;  2E2I C;  1I6H C;  1TWH K;  1I50 K;  2A68 A;  1IW7 A;  4QJV A;  3S1M C;  3S17 K;  4BBR C;  5C3E C;  4C3I K;  1TWC K;  5IYD K;  4YFN A;  3GTP K;  2O5I A;  2Y0S D;  3I4N K;  5FLM C;  4A3M C;  4QIW L;  5C44 K;  4C2M K;  2Y0S L;  4Y7N C;  3HOU C;  4A3I K;  4A3K K;  4BBS K;  5C4X C;  1YNN A;  3S16 C;  5IP7 C;  4A3E K;  2NVQ K;  3PO2 C;  3HKZ L;  3HOZ K;  2VUM K;  3S14 C;  3I4M K;  5IYC C;  3GTJ C;  3HKZ D;  2PA8 L;  2NVT C;  4A3B C;  3GTG C;  3HOW C;  1BDF A;  1YNJ A;  3K7A C;  2NVY C;  3GTO K;  2JA5 K;  4YFK A;  4XSX A;  2E2I K;  4A3D K;  1I50 C;  1R9T C;  2O5J A;  3RZO K;  5TMC A;  3S1M K;  3S2D C;  1I6V A;  4BBR K;  5C3E K;  4A3C K;  5IYD C;  1TWA C;  5FLM K;  3RZD K;  2WAQ D;  4QJV B;  4AYB L;  4Q4Z A;  3H3V D;  2R93 C;  4Y7N K;  3HOU K;  3GTL C;  3S15 C;  5IP7 K;  4A3E C;  2NVQ C;  3PO2 K;  4G7O A;  3HOZ C;  2VUM C;  3S14 K;  3GTQ K;  5IYC K;  4OIN A;  4A3B K;  2NVT K;  4Q5S A;  3HOW K;  3M4O K;  4ZH4 A;  3GTO C;  2JA5 C;  4BXX C;  3S1R K;  5TMF A;  2JA8 C;  3HOV C;  4KN4 A;  4A3D C;  3CQZ K;  2A6E A;  2A69 A;  4LK1 A;  4OIO A;  1R9T K;  2NVX K;  3RZO C;  3S1Q C;  3S2D K;  4A3G K;  1Y1V C;  3HOX C;  1TWF C;  4A3C C;  2R92 K;  1TWA K;  3DXJ A;  2JA6 K;  4A93 C;  4QIW D;  4JK1 A;  3RZD C;  3HOY C;  3FKI K;  4BY7 K;  2R93 K;  4X6A K;  4LLG A;  3EQL A;  2E2H K;  4BY1 C;  3GTL K;  3S15 K;  5M3M K;  3S2H C;  3GTQ C;  2PA8 D;  2JA7 K;  5M5Y K;  4A3L C;  5D4D A;  3PO3 C;  5IYB C;  3WOD A;  3M4O C;  4BXX K;  2A6H A;  2YU9 C;  3S1R C;  1I3Q K;  2JA8 K;  3HOV K;  5C4J K;  3CQZ C;  2NVX C;  4MEY A;  5M3F K;  3S1Q K;  4A3G C;  3GTM C;  1Y1V K;  4NOI A;  1TWF K;  3HOX K;  4A3F K;  2R92 C;  2R7Z C;  2B63 C;  2JA6 C;  4A93 K;  4X6A C;  1XPP A;  3S1N K;  3HOY K;  3FKI C;  2PMZ L;  5M5X K;  4BY7 C;  2WB1 D;  2E2H C;  4BY1 K;  1SMY A;  1TWG C;  4Y52 C;  2E2J C;  3GTK C;  4C3H K;  3S2H K;  2PPB A;  4MEX A;  2JA7 C;  4A3L K;  3PO3 K;  3H0G K;  5IYB K;  4A3J C;  4G7Z A;  4OIQ A;  2YU9 K;  4C3J K;  4KMU A;  1I3Q C;  3M3Y K;  1K83 C;  4AYB D;  2WAQ L;  1ZYR A;  5M5W K;  5C4J C;  1SFO K;  3H3V L;  4YG2 A;  5IP9 C;  2CW0 A;  5FJ8 K;  3GTM K;  1Y1W K;  4A3F C;  2R7Z K;  2B63 K;  1WCM K;  1I6H K;  3S1N C;  1TWH C;  3S17 C;  4LK0 A;  1TWC C;  1TWG K;  2BE5 A;  2E2J K;  3GTK K;  3GTP C;  3I4N C;  4Y52 K;  4A3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...