3S1QK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1qK00
3H3VD 2A69A 4C2MK 2PA8L 3GTJK 2R92C 5IYCK 1TWGK 2A6EA 5IYBK 3GTKK 1I6HC 3GTOC 2BE5A 5C44C 2R7ZK 4LLGA 3H0GC 4Q4ZA 3S14K 4A3BK 1Y1VC 3RZDC 2JA7C 4A3GK 3WODA 5C3EK 4QIWD 5C4XK 4BY7K 4BBRK 2YU9K 5IYDK 3HKZD 4GZYA 5IP9K 4A3FK 3HOXK 4YFXA 2O5JA 4BBSK 2E2JK 2A68A 3CQZK 3S1RC 2R93C 2PMZL 1WCMC 4MQ9A 4A3JK 3HOZC 4A3IK 3S1QC 3K7AC 4KMUA 4YFNA 1K83K 3S1NK 1TWAC 2JA5K 5FLMK 1TWHK 2WAQL 3HOVK 2E2HC 2JA6C 1I50K 4C3HK 5M3FK 4AYBL 3S2HK 5M5WK 1Y1WK 5C4JK 3FKIC 3GTQC 3S15C 4OINA 2VUMK 3GTPK 1I3QK 4KN7A 3I4NC 4MEXA 4LK0A 3PO3C 2JA8C 3PO2K 5TMFA 3GTGC 4BY1K 3HOWK 1BDFA 2NVYC 3H3VL 2E2IC 4XSZA 5FJ8K 3HOYC 1R9TC 4A3LK 4Y52C 4A3DC 1SFOK 3S2DC 2NVXK 2CW0A 3GTMK 4A3EK 3S17K 3M4OK 4A3CK 4BXXC 2B63C 3S1MK 5IP7K 4KN4A 3HOUC 1YNNA 2R92K 2NVTC 3EQLA 4QIWL 4OIQA 3I4MC 3HKZL 4JK1A 1TWCC 4LJZA 1I6HK 3GTOK 5C44K 3GTLC 2NVQC 3H0GK 3M3YC 1Y1VK 3RZDK 4LK1A 2JA7K 3RZOC 1TWFC 4A3KC 1IW7A 2Y0SD 4Y7NC 3S16C 4XLNA 4X6AC 5D4DA 4A3MC 2WB1D 1YNJA 4C3IK 3S1RK 2R93K 3GTJC 1WCMK 3HOZK 5IYCC 1TWGC 3K7AK 4QJVB 2PPBA 5IYBC 5IYDC 3GTKC 4A3BC 3S1QK 2R7ZC 3S14C 1TWAK 4A3GC 4A93C 2E2HK 2PA8D 1SMYA 5C3EC 4OIOA 5M5YK 2JA6K 4XSXA 4BBRC 4G7HA 4BY7C 5C4XC 4YG2A 5IP9C 5M5XK 3HOXC 4A3FC 4BBSC 3FKIK 2E2JC 3CQZC 3GTQK 3S15K 4QJVA 1XPPA 4A3JC 4MEYA 4A3IC 4OIPA 3I4NK 1I6VA 3PO3K 1K83C 2JA8K 3S1NC 4G7ZA 2JA5C 4OIRA 3GTGK 5FLMC 1TWHC 1HQMA 3HOVC 4ZH4A 2PMZD 2A6HA 2NVYK 2O5IA 1I50C 1ZYRA 2E2IK 5M3MK 3HOYK 4A93K 1R9TK 3DXJA 3S2HC 4A3DK 4C3JK 3S2DK 1Y1WC 4Y52K 5C4JC 2WAQD 4BXXK 2B63K 2VUMC 3HOUK 3GTPC 1I3QC 4AYBD 2NVTK 4XLPA 4G7OA 4YFKA 3PO2C 2Y0SL 3I4MK 4BY1C 1TWCK 3HOWC 2WB1L 2YU9C 2NVQK 3GTLK 3M3YK 4Q5SA 4A3LC 3RZOK 1TWFK 1SFOC 5TMCA 4NOIA 4A3KK 4Y7NK 2NVXC 4A3EC 3GTMC 3S16K 3S17C 3M4OC 4A3CC 4X6AK 4A3MK 3S1MC 5IP7C
chains in the Genus database with same CATH superfamily
3H3VD 1TWCA 1TWGK 3GIRA 3GSIA 3GTKK 2BE5A 4Q4ZA 3MMLB 4PABA 1VRQC 5C4XK 2YU9K 4GZYA 4C3IC 4BBSK 1INNA 3S1RC 2R93C 1WCMC 2RH6A 4PAAA 2R7ZA 3HOZC 4A3IK 1PJ5A 2JA5K 1TWHK 2E2HC 1I50K 1UV7A 1PJ6A 4GTCA 2ZUEA 3S2HK 1B4BA 2V6UA 5C4JK 4OINA 1VJEA 4KMHA 3A8JA 2XCOA 2W7VA 4BLAA 4MEXA 1EFWA 4GTDA 5TMFA 3LAPA 3ERED 3OPFA 1HI9A 5IOSA 5FJ8K 2CW0A 3GTPA 4A3EK 2NVTC 3EQLA 3N3YA 1O2FB 3HKZL 1I6HK 4LJZA 3L4JA 1J6WA 1Y1VK 3RZDK 3AD8C 4GTEA 3S16C 1V5VA 3OREA 1YCLA 2EBBA 3LPXA 4RMFA 5IYDC 4A3BC 3QX3A 3OEPA 2JA6K 4BY7C 4YG2A 4A3FC 3TFHA 2GSNA 3FKIK 2E2JC 4GTAA 3S15K 4QJVA 1O2BA 1O24A 1XPPA 2GAHC 3PO3K 4KB2A 1HQMA 3T02A 1BS2A 2A6HA 2E2IK 4LOWA 3HOYK 4A3DK 2WAQD 3GTOA 3H0GA 1I3QC 2JA7A 4G7OA 3PO2C 3I4MK 3HOWC 2WB1L 2NVQK 5EGHA 1SFOC 5TJ3A 4A3KK 4A3CC 4KM8A 1WOPA 4C2MK 2PA8L 1DD5A 3GTJK 2R92C 1X31C 1KQ4A 5IYCK 2RGRA 3GEHA 1TWFA 3GTOC 1IE0A 3AQOA 4LLGA 3H0GC 2JA7C 1EK8A 4KC6A 5IOTA 4QIWD 4DDQA 4BBRK 3AQPA 3HOXK 3GTGA 1WORA 2A68A 3CQZK 3ADAC 3GTKA 4A3JK 3AH5A 4YFNA 3S1NK 2XCRB 1JVIA 1IL2A 3HOVK 5E68A 2B63A 1EH1A 1O29A 4C3HK 4AYBL 4GFQA 1IS1A 2VUMK 3GTLA 2JA5A 1TWHA 4LK0A 1C0AA 3GTGC 4BY1K 1O28A 3JSTA 2NVYC 3H3VL 4XSZA 4A3LK 1R9TC 1BJTA 4Y52C 3S2DC 2NVXK 2B63C 3S1MK 5IP7K 4KN4A 1YNNA 4P5BA 1XXAA 3TFIA 1TWCC 3GTLC 3M3YC 4LK1A 3RZOC 1IW7A 4KM9A 4Y7NC 5IORA 4A3MC 1K83A 1VGXA 1YNJA 4C3IK 3S1RK 2R93K 1WCMK 3L4KA 3HOZK 1Y1VA 4QJVB 5IYBC 1O26A 2P5MA 2R7ZC 3S14C 1Y1WA 4A3GC 2GSUA 2E2HK 5C3EC 5M5YK 4XSXA 3G4AA 4LR2A 2KWAA 5IP9C 4KDDA 3T01A 1XXBA 2CFAA 3AD7C 4OIPA 1BGWA 1I6VA 1K83C 4KB4A 4G7ZA 3GTMA 5FLMC 3SZYA 2PMZD 2FQTA 1Y1WC 3N0CA 1ZXOA 3FOFA 3GTPC 1VH2A 2NVTK 4GTFA 3G4CA 5TMCA 3M4OC 3GTMC 3S16K 3FOEA 3S17C 1XZQA 1TWAA 2A69A 3BP8C 4G0WA 2Y3PA 1USMA 1J6XA 1WSVA 4GTBA 4G0VA 5IYDK 4A3BK 5C44C 3GTQA 4BY7K 4WJ4A 2GSOA 3GTJA 4A3FK 4YFXA 1O25A 5IOQA 2E2JK 3GDZA 4FM9A 4MQ9A 3S1QC 3K7AC 1DCHA 1TWAC 2WAQL 4BKWA 3CQZA 4WJ3M 3AD9C 5M5WK 3GTQC 5JFEA 1I3QK 4KN7A 3I4NC 2JA8C 1ZVUA 3PO2K 1WIHA 3HOWK 1BDFA 4KAWX 3V4GA 1WQFA 4C3JC 1SFOK 4A3CK 1B4AA 3TTGA 3VA7A 1TWGA 4BXXC 3LAJA 3HOUC 2R92K 4QIWL 4P5AA 4OIQA 2YU9A 4ILDA 3GTOK 3H0GK 1IBAA 2JA7K 1TWFC 3CAGA 5L46A 4X6AC 2Y0SD 1XZPA 5D4DA 4AH6A 2D6FC 3HXAA 1I50A 1TWGC 2CFAB 3GTKC 1JOEA 4A93C 1ZBSA 1SMYA 4OIOA 5C4XC 1G51A 5JVOA 4BBSC 1DCPA 3A8IA 4A3IC 3FHZA 4J3NA 1F9NA 1WQHA 2E2HA 4GT9A 2JA5C 3GTGK 1TWHC 2NVYK 1EI6A 4FZBA 1I50C 3N0BA 4BLBA 3GEEA 4A93K 4GTLA 1R9TK 3S2HC 4Y52K 3S2DK 3IPJA 1EQRA 4XCHA 5C4JC 5CHPA 2B63K 1XZQB 3NUHA 4C45A 3T00A 3GEIA 1TWCK 2P8TA 3GTLK 3M3YK 4Q5SA 3RZOK 1WOOA 1DCOA 4NOIA 4Y7NK 4A3EC 4A3MK 1GE9A 1O27A 1WQGA 2JA6A 1J98A 1USOA 2A6EA 5IYBK 1I6HC 4KATA 2R7ZK 3S14K 3FKIA 4A3GK 2XCQA 1Y1VC 3RZDC 3WODA 5C3EK 1J6VA 3HKZD 5IP9K 2O5JA 2PMZL 4KMDA 2E2IA 2GAGC 4KMUA 4P9SA 1K83K 5CJ9A 1RU0A 3A8KA 5FLMK 2JA6C 1F7VA 2FQOA 5M3FK 1Y1WK 3FKIC 2V6SA 3S15C 4O2DA 3GTPK 3PO3C 1IQ0A 2ZFZA 4KARA 2E2IC 3HOYC 4LQYA 4A3DC 3M4OK 3GTMK 3S17K 4WILA 1I3QA 1XZPB 1ISEA 3I4MC 3BUEA 4JK1A 1VLOA 1JQWA 1SFOA 5C44K 2NVQC 1O2AA 1WSRA 4A3KC 4M1XA 4XLNA 5EGEA 2R92A 2WB1D 4KASA 4C2MC 3SZZA 3GTJC 5IYCC 2PPBA 3K7AK 3S1QK 1TWAK 2PHCB 2PA8D 2VUMA 4BBRC 4G7HA 1PJ7A 5M5XK 3HOXC 3GTQK 3CQZC 2ZUFA 4A3JC 4MEYA 3I4NK 2JA8K 3BP3A 3S1NC 2NVXA 4OIRA 1AB4A 3HOVC 4ZH4A 2O5IA 1ZYRA 4C3HC 1XXCA 5HL8A 5M3MK 3TFJA 3DXJA 1L0WA 4C3JK 3S0XA 4G0UA 4BXXK 2JH3A 2VUMC 3HOUK 4KMAA 4AYBD 2NVYA 4XLPA 1YX2A 1WOSA 2Y0SL 4YFKA 2V6TA 4BY1C 1R9TA 3Q3QA 2YU9C 1ZQ1C 4A3LC 2R93A 1TWFK 1WCMA 1F93A 2NVXC 4X6AK 1F7UA 3S1MC 5IP7C
chains in the Genus database with same CATH topology
3H3VD 2A69A 4C2MK 2PA8L 3GTJK 2R92C 5IYCK 1TWGK 2A6EA 5IYBK 3GTKK 1I6HC 3GTOC 2BE5A 5C44C 2R7ZK 4LLGA 3H0GC 4Q4ZA 3S14K 4A3BK 1Y1VC 3RZDC 2JA7C 4A3GK 3WODA 5C3EK 4QIWD 5C4XK 4BY7K 4BBRK 2YU9K 5IYDK 3HKZD 4GZYA 5IP9K 4A3FK 3HOXK 4YFXA 2O5JA 4BBSK 2E2JK 2A68A 3CQZK 3S1RC 2R93C 2PMZL 1WCMC 4MQ9A 4A3JK 3HOZC 4A3IK 3S1QC 3K7AC 4KMUA 4YFNA 1K83K 3S1NK 1TWAC 2JA5K 5FLMK 1TWHK 2WAQL 3HOVK 2E2HC 2JA6C 1I50K 4C3HK 5M3FK 4AYBL 3S2HK 5M5WK 1Y1WK 5C4JK 3FKIC 3GTQC 3S15C 4OINA 2VUMK 3GTPK 1I3QK 4KN7A 3I4NC 4MEXA 4LK0A 3PO3C 2JA8C 3PO2K 5TMFA 3GTGC 4BY1K 3HOWK 1BDFA 2NVYC 3H3VL 2E2IC 4XSZA 5FJ8K 3HOYC 1R9TC 4A3LK 4Y52C 4A3DC 1SFOK 3S2DC 2NVXK 2CW0A 3GTMK 4A3EK 3S17K 3M4OK 4A3CK 4BXXC 2B63C 3S1MK 5IP7K 4KN4A 3HOUC 1YNNA 2R92K 2NVTC 3EQLA 4QIWL 4OIQA 3I4MC 3HKZL 4JK1A 1TWCC 4LJZA 1I6HK 3GTOK 5C44K 3GTLC 2NVQC 3H0GK 3M3YC 1Y1VK 3RZDK 4LK1A 2JA7K 3RZOC 1TWFC 4A3KC 1IW7A 2Y0SD 4Y7NC 3S16C 4XLNA 4X6AC 5D4DA 4A3MC 2WB1D 1YNJA 4C3IK 3S1RK 2R93K 3GTJC 1WCMK 3HOZK 5IYCC 1TWGC 3K7AK 4QJVB 2PPBA 5IYBC 5IYDC 3GTKC 4A3BC 3S1QK 2R7ZC 3S14C 1TWAK 4A3GC 4A93C 2E2HK 2PA8D 1SMYA 5C3EC 4OIOA 5M5YK 2JA6K 4XSXA 4BBRC 4G7HA 4BY7C 5C4XC 4YG2A 5IP9C 5M5XK 3HOXC 4A3FC 4BBSC 3FKIK 2E2JC 3CQZC 3GTQK 3S15K 4QJVA 1XPPA 4A3JC 4MEYA 4A3IC 4OIPA 3I4NK 1I6VA 3PO3K 1K83C 2JA8K 3S1NC 4G7ZA 2JA5C 4OIRA 3GTGK 5FLMC 1TWHC 1HQMA 3HOVC 4ZH4A 2PMZD 2A6HA 2NVYK 2O5IA 1I50C 1ZYRA 2E2IK 5M3MK 3HOYK 4A93K 1R9TK 3DXJA 3S2HC 4A3DK 4C3JK 3S2DK 1Y1WC 4Y52K 5C4JC 2WAQD 4BXXK 2B63K 2VUMC 3HOUK 3GTPC 1I3QC 4AYBD 2NVTK 4XLPA 4G7OA 4YFKA 3PO2C 2Y0SL 3I4MK 4BY1C 1TWCK 3HOWC 2WB1L 2YU9C 2NVQK 3GTLK 3M3YK 4Q5SA 4A3LC 3RZOK 1TWFK 1SFOC 5TMCA 4NOIA 4A3KK 4Y7NK 2NVXC 4A3EC 3GTMC 3S16K 3S17C 3M4OC 4A3CC 4X6AK 4A3MK 3S1MC 5IP7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V D;  2A69 A;  4C2M K;  2PA8 L;  3GTJ K;  2R92 C;  5IYC K;  1TWG K;  2A6E A;  5IYB K;  3GTK K;  1I6H C;  3GTO C;  2BE5 A;  5C44 C;  2R7Z K;  4LLG A;  3H0G C;  4Q4Z A;  3S14 K;  4A3B K;  1Y1V C;  3RZD C;  2JA7 C;  4A3G K;  3WOD A;  5C3E K;  4QIW D;  5C4X K;  4BY7 K;  4BBR K;  2YU9 K;  5IYD K;  3HKZ D;  4GZY A;  5IP9 K;  4A3F K;  3HOX K;  4YFX A;  2O5J A;  4BBS K;  2E2J K;  2A68 A;  3CQZ K;  3S1R C;  2R93 C;  2PMZ L;  1WCM C;  4MQ9 A;  4A3J K;  3HOZ C;  4A3I K;  3S1Q C;  3K7A C;  4KMU A;  4YFN A;  1K83 K;  3S1N K;  1TWA C;  2JA5 K;  5FLM K;  1TWH K;  2WAQ L;  3HOV K;  2E2H C;  2JA6 C;  1I50 K;  4C3H K;  5M3F K;  4AYB L;  3S2H K;  5M5W K;  1Y1W K;  5C4J K;  3FKI C;  3GTQ C;  3S15 C;  4OIN A;  2VUM K;  3GTP K;  1I3Q K;  4KN7 A;  3I4N C;  4MEX A;  4LK0 A;  3PO3 C;  2JA8 C;  3PO2 K;  5TMF A;  3GTG C;  4BY1 K;  3HOW K;  1BDF A;  2NVY C;  3H3V L;  2E2I C;  4XSZ A;  5FJ8 K;  3HOY C;  1R9T C;  4A3L K;  4Y52 C;  4A3D C;  1SFO K;  3S2D C;  2NVX K;  2CW0 A;  3GTM K;  4A3E K;  3S17 K;  3M4O K;  4A3C K;  4BXX C;  2B63 C;  3S1M K;  5IP7 K;  4KN4 A;  3HOU C;  1YNN A;  2R92 K;  2NVT C;  3EQL A;  4QIW L;  4OIQ A;  3I4M C;  3HKZ L;  4JK1 A;  1TWC C;  4LJZ A;  1I6H K;  3GTO K;  5C44 K;  3GTL C;  2NVQ C;  3H0G K;  3M3Y C;  1Y1V K;  3RZD K;  4LK1 A;  2JA7 K;  3RZO C;  1TWF C;  4A3K C;  1IW7 A;  2Y0S D;  4Y7N C;  3S16 C;  4XLN A;  4X6A C;  5D4D A;  4A3M C;  2WB1 D;  1YNJ A;  4C3I K;  3S1R K;  2R93 K;  3GTJ C;  1WCM K;  3HOZ K;  5IYC C;  1TWG C;  3K7A K;  4QJV B;  2PPB A;  5IYB C;  5IYD C;  3GTK C;  4A3B C;  3S1Q K;  2R7Z C;  3S14 C;  1TWA K;  4A3G C;  4A93 C;  2E2H K;  2PA8 D;  1SMY A;  5C3E C;  4OIO A;  5M5Y K;  2JA6 K;  4XSX A;  4BBR C;  4G7H A;  4BY7 C;  5C4X C;  4YG2 A;  5IP9 C;  5M5X K;  3HOX C;  4A3F C;  4BBS C;  3FKI K;  2E2J C;  3CQZ C;  3GTQ K;  3S15 K;  4QJV A;  1XPP A;  4A3J C;  4MEY A;  4A3I C;  4OIP A;  3I4N K;  1I6V A;  3PO3 K;  1K83 C;  2JA8 K;  3S1N C;  4G7Z A;  2JA5 C;  4OIR A;  3GTG K;  5FLM C;  1TWH C;  1HQM A;  3HOV C;  4ZH4 A;  2PMZ D;  2A6H A;  2NVY K;  2O5I A;  1I50 C;  1ZYR A;  2E2I K;  5M3M K;  3HOY K;  4A93 K;  1R9T K;  3DXJ A;  3S2H C;  4A3D K;  4C3J K;  3S2D K;  1Y1W C;  4Y52 K;  5C4J C;  2WAQ D;  4BXX K;  2B63 K;  2VUM C;  3HOU K;  3GTP C;  1I3Q C;  4AYB D;  2NVT K;  4XLP A;  4G7O A;  4YFK A;  3PO2 C;  2Y0S L;  3I4M K;  4BY1 C;  1TWC K;  3HOW C;  2WB1 L;  2YU9 C;  2NVQ K;  3GTL K;  3M3Y K;  4Q5S A;  4A3L C;  3RZO K;  1TWF K;  1SFO C;  5TMC A;  4NOI A;  4A3K K;  4Y7N K;  2NVX C;  4A3E C;  3GTM C;  3S16 K;  3S17 C;  3M4O C;  4A3C C;  4X6A K;  4A3M K;  3S1M C;  5IP7 C; 
#chains in the Genus database with same CATH topology
 3H3V D;  1TWC A;  1TWG K;  3GIR A;  3GSI A;  3GTK K;  2BE5 A;  4Q4Z A;  3MML B;  4PAB A;  1VRQ C;  5C4X K;  2YU9 K;  4GZY A;  4C3I C;  4BBS K;  1INN A;  3S1R C;  2R93 C;  1WCM C;  2RH6 A;  4PAA A;  2R7Z A;  3HOZ C;  4A3I K;  1PJ5 A;  2JA5 K;  1TWH K;  2E2H C;  1I50 K;  1UV7 A;  1PJ6 A;  4GTC A;  2ZUE A;  3S2H K;  1B4B A;  2V6U A;  5C4J K;  4OIN A;  1VJE A;  4KMH A;  3A8J A;  2XCO A;  2W7V A;  4BLA A;  4MEX A;  1EFW A;  4GTD A;  5TMF A;  3LAP A;  3ERE D;  3OPF A;  1HI9 A;  5IOS A;  5FJ8 K;  2CW0 A;  3GTP A;  4A3E K;  2NVT C;  3EQL A;  3N3Y A;  1O2F B;  3HKZ L;  1I6H K;  4LJZ A;  3L4J A;  1J6W A;  1Y1V K;  3RZD K;  3AD8 C;  4GTE A;  3S16 C;  1V5V A;  3ORE A;  1YCL A;  2EBB A;  3LPX A;  4RMF A;  5IYD C;  4A3B C;  3QX3 A;  3OEP A;  2JA6 K;  4BY7 C;  4YG2 A;  4A3F C;  3TFH A;  2GSN A;  3FKI K;  2E2J C;  4GTA A;  3S15 K;  4QJV A;  1O2B A;  1O24 A;  1XPP A;  2GAH C;  3PO3 K;  4KB2 A;  1HQM A;  3T02 A;  1BS2 A;  2A6H A;  2E2I K;  4LOW A;  3HOY K;  4A3D K;  2WAQ D;  3GTO A;  3H0G A;  1I3Q C;  2JA7 A;  4G7O A;  3PO2 C;  3I4M K;  3HOW C;  2WB1 L;  2NVQ K;  5EGH A;  1SFO C;  5TJ3 A;  4A3K K;  4A3C C;  4KM8 A;  1WOP A;  4C2M K;  2PA8 L;  1DD5 A;  3GTJ K;  2R92 C;  1X31 C;  1KQ4 A;  5IYC K;  2RGR A;  3GEH A;  1TWF A;  3GTO C;  1IE0 A;  3AQO A;  4LLG A;  3H0G C;  2JA7 C;  1EK8 A;  4KC6 A;  5IOT A;  4QIW D;  4DDQ A;  4BBR K;  3AQP A;  3HOX K;  3GTG A;  1WOR A;  2A68 A;  3CQZ K;  3ADA C;  3GTK A;  4A3J K;  3AH5 A;  4YFN A;  3S1N K;  2XCR B;  1JVI A;  1IL2 A;  3HOV K;  5E68 A;  2B63 A;  1EH1 A;  1O29 A;  4C3H K;  4AYB L;  4GFQ A;  1IS1 A;  2VUM K;  3GTL A;  2JA5 A;  1TWH A;  4LK0 A;  1C0A A;  3GTG C;  4BY1 K;  1O28 A;  3JST A;  2NVY C;  3H3V L;  4XSZ A;  4A3L K;  1R9T C;  1BJT A;  4Y52 C;  3S2D C;  2NVX K;  2B63 C;  3S1M K;  5IP7 K;  4KN4 A;  1YNN A;  4P5B A;  1XXA A;  3TFI A;  1TWC C;  3GTL C;  3M3Y C;  4LK1 A;  3RZO C;  1IW7 A;  4KM9 A;  4Y7N C;  5IOR A;  4A3M C;  1K83 A;  1VGX A;  1YNJ A;  4C3I K;  3S1R K;  2R93 K;  1WCM K;  3L4K A;  3HOZ K;  1Y1V A;  4QJV B;  5IYB C;  1O26 A;  2P5M A;  2R7Z C;  3S14 C;  1Y1W A;  4A3G C;  2GSU A;  2E2H K;  5C3E C;  5M5Y K;  4XSX A;  3G4A A;  4LR2 A;  2KWA A;  5IP9 C;  4KDD A;  3T01 A;  1XXB A;  2CFA A;  3AD7 C;  4OIP A;  1BGW A;  1I6V A;  1K83 C;  4KB4 A;  4G7Z A;  3GTM A;  5FLM C;  3SZY A;  2PMZ D;  2FQT A;  1Y1W C;  3N0C A;  1ZXO A;  3FOF A;  3GTP C;  1VH2 A;  2NVT K;  4GTF A;  3G4C A;  5TMC A;  3M4O C;  3GTM C;  3S16 K;  3FOE A;  3S17 C;  1XZQ A;  1TWA A;  2A69 A;  3BP8 C;  4G0W A;  2Y3P A;  1USM A;  1J6X A;  1WSV A;  4GTB A;  4G0V A;  5IYD K;  4A3B K;  5C44 C;  3GTQ A;  4BY7 K;  4WJ4 A;  2GSO A;  3GTJ A;  4A3F K;  4YFX A;  1O25 A;  5IOQ A;  2E2J K;  3GDZ A;  4FM9 A;  4MQ9 A;  3S1Q C;  3K7A C;  1DCH A;  1TWA C;  2WAQ L;  4BKW A;  3CQZ A;  4WJ3 M;  3AD9 C;  5M5W K;  3GTQ C;  5JFE A;  1I3Q K;  4KN7 A;  3I4N C;  2JA8 C;  1ZVU A;  3PO2 K;  1WIH A;  3HOW K;  1BDF A;  4KAW X;  3V4G A;  1WQF A;  4C3J C;  1SFO K;  4A3C K;  1B4A A;  3TTG A;  3VA7 A;  1TWG A;  4BXX C;  3LAJ A;  3HOU C;  2R92 K;  4QIW L;  4P5A A;  4OIQ A;  2YU9 A;  4ILD A;  3GTO K;  3H0G K;  1IBA A;  2JA7 K;  1TWF C;  3CAG A;  5L46 A;  4X6A C;  2Y0S D;  1XZP A;  5D4D A;  4AH6 A;  2D6F C;  3HXA A;  1I50 A;  1TWG C;  2CFA B;  3GTK C;  1JOE A;  4A93 C;  1ZBS A;  1SMY A;  4OIO A;  5C4X C;  1G51 A;  5JVO A;  4BBS C;  1DCP A;  3A8I A;  4A3I C;  3FHZ A;  4J3N A;  1F9N A;  1WQH A;  2E2H A;  4GT9 A;  2JA5 C;  3GTG K;  1TWH C;  2NVY K;  1EI6 A;  4FZB A;  1I50 C;  3N0B A;  4BLB A;  3GEE A;  4A93 K;  4GTL A;  1R9T K;  3S2H C;  4Y52 K;  3S2D K;  3IPJ A;  1EQR A;  4XCH A;  5C4J C;  5CHP A;  2B63 K;  1XZQ B;  3NUH A;  4C45 A;  3T00 A;  3GEI A;  1TWC K;  2P8T A;  3GTL K;  3M3Y K;  4Q5S A;  3RZO K;  1WOO A;  1DCO A;  4NOI A;  4Y7N K;  4A3E C;  4A3M K;  1GE9 A;  1O27 A;  1WQG A;  2JA6 A;  1J98 A;  1USO A;  2A6E A;  5IYB K;  1I6H C;  4KAT A;  2R7Z K;  3S14 K;  3FKI A;  4A3G K;  2XCQ A;  1Y1V C;  3RZD C;  3WOD A;  5C3E K;  1J6V A;  3HKZ D;  5IP9 K;  2O5J A;  2PMZ L;  4KMD A;  2E2I A;  2GAG C;  4KMU A;  4P9S A;  1K83 K;  5CJ9 A;  1RU0 A;  3A8K A;  5FLM K;  2JA6 C;  1F7V A;  2FQO A;  5M3F K;  1Y1W K;  3FKI C;  2V6S A;  3S15 C;  4O2D A;  3GTP K;  3PO3 C;  1IQ0 A;  2ZFZ A;  4KAR A;  2E2I C;  3HOY C;  4LQY A;  4A3D C;  3M4O K;  3GTM K;  3S17 K;  4WIL A;  1I3Q A;  1XZP B;  1ISE A;  3I4M C;  3BUE A;  4JK1 A;  1VLO A;  1JQW A;  1SFO A;  5C44 K;  2NVQ C;  1O2A A;  1WSR A;  4A3K C;  4M1X A;  4XLN A;  5EGE A;  2R92 A;  2WB1 D;  4KAS A;  4C2M C;  3SZZ A;  3GTJ C;  5IYC C;  2PPB A;  3K7A K;  3S1Q K;  1TWA K;  2PHC B;  2PA8 D;  2VUM A;  4BBR C;  4G7H A;  1PJ7 A;  5M5X K;  3HOX C;  3GTQ K;  3CQZ C;  2ZUF A;  4A3J C;  4MEY A;  3I4N K;  2JA8 K;  3BP3 A;  3S1N C;  2NVX A;  4OIR A;  1AB4 A;  3HOV C;  4ZH4 A;  2O5I A;  1ZYR A;  4C3H C;  1XXC A;  5HL8 A;  5M3M K;  3TFJ A;  3DXJ A;  1L0W A;  4C3J K;  3S0X A;  4G0U A;  4BXX K;  2JH3 A;  2VUM C;  3HOU K;  4KMA A;  4AYB D;  2NVY A;  4XLP A;  1YX2 A;  1WOS A;  2Y0S L;  4YFK A;  2V6T A;  4BY1 C;  1R9T A;  3Q3Q A;  2YU9 C;  1ZQ1 C;  4A3L C;  2R93 A;  1TWF K;  1WCM A;  1F93 A;  2NVX C;  4X6A K;  1F7U A;  3S1M C;  5IP7 C; 
#chains in the Genus database with same CATH homology
 3H3V D;  2A69 A;  4C2M K;  2PA8 L;  3GTJ K;  2R92 C;  5IYC K;  1TWG K;  2A6E A;  5IYB K;  3GTK K;  1I6H C;  3GTO C;  2BE5 A;  5C44 C;  2R7Z K;  4LLG A;  3H0G C;  4Q4Z A;  3S14 K;  4A3B K;  1Y1V C;  3RZD C;  2JA7 C;  4A3G K;  3WOD A;  5C3E K;  4QIW D;  5C4X K;  4BY7 K;  4BBR K;  2YU9 K;  5IYD K;  3HKZ D;  4GZY A;  5IP9 K;  4A3F K;  3HOX K;  4YFX A;  2O5J A;  4BBS K;  2E2J K;  2A68 A;  3CQZ K;  3S1R C;  2R93 C;  2PMZ L;  1WCM C;  4MQ9 A;  4A3J K;  3HOZ C;  4A3I K;  3S1Q C;  3K7A C;  4KMU A;  4YFN A;  1K83 K;  3S1N K;  1TWA C;  2JA5 K;  5FLM K;  1TWH K;  2WAQ L;  3HOV K;  2E2H C;  2JA6 C;  1I50 K;  4C3H K;  5M3F K;  4AYB L;  3S2H K;  5M5W K;  1Y1W K;  5C4J K;  3FKI C;  3GTQ C;  3S15 C;  4OIN A;  2VUM K;  3GTP K;  1I3Q K;  4KN7 A;  3I4N C;  4MEX A;  4LK0 A;  3PO3 C;  2JA8 C;  3PO2 K;  5TMF A;  3GTG C;  4BY1 K;  3HOW K;  1BDF A;  2NVY C;  3H3V L;  2E2I C;  4XSZ A;  5FJ8 K;  3HOY C;  1R9T C;  4A3L K;  4Y52 C;  4A3D C;  1SFO K;  3S2D C;  2NVX K;  2CW0 A;  3GTM K;  4A3E K;  3S17 K;  3M4O K;  4A3C K;  4BXX C;  2B63 C;  3S1M K;  5IP7 K;  4KN4 A;  3HOU C;  1YNN A;  2R92 K;  2NVT C;  3EQL A;  4QIW L;  4OIQ A;  3I4M C;  3HKZ L;  4JK1 A;  1TWC C;  4LJZ A;  1I6H K;  3GTO K;  5C44 K;  3GTL C;  2NVQ C;  3H0G K;  3M3Y C;  1Y1V K;  3RZD K;  4LK1 A;  2JA7 K;  3RZO C;  1TWF C;  4A3K C;  1IW7 A;  2Y0S D;  4Y7N C;  3S16 C;  4XLN A;  4X6A C;  5D4D A;  4A3M C;  2WB1 D;  1YNJ A;  4C3I K;  3S1R K;  2R93 K;  3GTJ C;  1WCM K;  3HOZ K;  5IYC C;  1TWG C;  3K7A K;  4QJV B;  2PPB A;  5IYB C;  5IYD C;  3GTK C;  4A3B C;  3S1Q K;  2R7Z C;  3S14 C;  1TWA K;  4A3G C;  4A93 C;  2E2H K;  2PA8 D;  1SMY A;  5C3E C;  4OIO A;  5M5Y K;  2JA6 K;  4XSX A;  4BBR C;  4G7H A;  4BY7 C;  5C4X C;  4YG2 A;  5IP9 C;  5M5X K;  3HOX C;  4A3F C;  4BBS C;  3FKI K;  2E2J C;  3CQZ C;  3GTQ K;  3S15 K;  4QJV A;  1XPP A;  4A3J C;  4MEY A;  4A3I C;  4OIP A;  3I4N K;  1I6V A;  3PO3 K;  1K83 C;  2JA8 K;  3S1N C;  4G7Z A;  2JA5 C;  4OIR A;  3GTG K;  5FLM C;  1TWH C;  1HQM A;  3HOV C;  4ZH4 A;  2PMZ D;  2A6H A;  2NVY K;  2O5I A;  1I50 C;  1ZYR A;  2E2I K;  5M3M K;  3HOY K;  4A93 K;  1R9T K;  3DXJ A;  3S2H C;  4A3D K;  4C3J K;  3S2D K;  1Y1W C;  4Y52 K;  5C4J C;  2WAQ D;  4BXX K;  2B63 K;  2VUM C;  3HOU K;  3GTP C;  1I3Q C;  4AYB D;  2NVT K;  4XLP A;  4G7O A;  4YFK A;  3PO2 C;  2Y0S L;  3I4M K;  4BY1 C;  1TWC K;  3HOW C;  2WB1 L;  2YU9 C;  2NVQ K;  3GTL K;  3M3Y K;  4Q5S A;  4A3L C;  3RZO K;  1TWF K;  1SFO C;  5TMC A;  4NOI A;  4A3K K;  4Y7N K;  2NVX C;  4A3E C;  3GTM C;  3S16 K;  3S17 C;  3M4O C;  4A3C C;  4X6A K;  4A3M K;  3S1M C;  5IP7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...