4KARA

Crystal structure of fdts (tm0449) mutant (h53d) with fad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 75
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4karA00
4FZBA 5IOTA 3AH5A 2CFAA 4GTBA 4KARA 1KQ4A 3N0BA 4GTFA 4P5AA 1O28A 4GTLA 1O26A 5IOQA 3G4AA 1O2AA 3G4CA 1O25A 1O27A 5CHPA 3N3YA 5IOSA 5IORA 4P5BA 5JFEA 4KASA 4GTCA 1O29A 1O2BA 4GT9A 3N0CA 4KATA 4GTAA 2CFAB 1O24A 4GTDA 4GTEA
chains in the Genus database with same CATH superfamily
2BE5A 3GTKK 3Q3QA 1RU0A 1TWAA 1IW7A 3HOZC 1TWCK 1XZQB 1I3QK 4KMDA 4A3FC 1SFOA 1DCOA 5M5YK 4DDQA 2YU9C 4A3KK 1F7UA 1R9TC 2JA6K 4FM9A 3HOWC 2R92K 4BLAA 4YFNA 3I4NC 1HQMA 1PJ5A 4QIWL 1VRQC 1ZQ1C 2CFAB 3A8IA 3S1MK 1JQWA 3HXAA 3I4MK 4A93K 2GAGC 4KARA 3H0GC 5FJ8K 3GTJC 1IE0A 1IBAA 1K83A 1GE9A 3S16C 2B63K 1EH1A 4KC6A 4KASA 4ZH4A 3RZOK 3S1QK 1XZPB 1TWAC 1TWGA 3M3YK 2GAHC 2NVTC 3N0CA 5IP7K 1WOOA 2E2HA 4BY7C 4A3GK 4RMFA 5CHPA 3ADAC 3S2DK 4XCHA 4P9SA 4A3DC 3GTMC 2JA5A 2XCOA 5C4XC 1TWFA 1O2FB 1XPPA 2RGRA 4OIQA 1O25A 1F93A 2PMZL 5IORA 4BBRK 3HOWK 1K83C 3HOUC 1DCPA 4KM9A 4Y7NK 3FKIK 1B4BA 1VJEA 3CQZK 1C0AA 4G0WA 3LAPA 5C3EC 4A3EC 3GTLA 2E2HC 4LK1A 1BS2A 2E2JC 3RZDC 4XLNA 2GSUA 1YX2A 2V6UA 4AH6A 3S17K 4YFXA 2JA5C 1TWFC 2WB1D 1USOA 2FQOA 1ZXOA 3T02A 3BP8C 4A3BK 5M5XK 4BY1C 3S14C 2O5IA 3LPXA 1VGXA 3GSIA 2VUMK 3G4AA 2E2IA 4KMAA 1O27A 4KB2A 3GTQA 4OIOA 4Q4ZA 3S15C 3GTLC 2NVYA 1F9NA 1V5VA 3AD9C 2NVXK 1Y1WA 3GTOK 1O24A 5FLMC 3HOVK 3V4GA 4X6AK 1L0WA 5IYBC 5HL8A 1KQ4A 3GTGA 2P5MA 5IP9C 3S1NC 3MMLB 3PO3C 1BDFA 3TTGA 4OINA 5IYCK 2WAQD 2A6EA 4YG2A 4C3IK 3L4JA 1I6VA 1WCMA 4A3MK 5C44K 2D6FC 2E2IC 3GTQC 1WOSA 2NVYC 4XSZA 4A3JK 4LOWA 1Y1VA 4A3IC 2ZFZA 3GEHA 2A68A 2FQTA 2JA7K 1Y1WC 2JA8K 4BXXK 4G7HA 4G7ZA 3GTPK 4OIPA 4C3JK 4XLPA 3M4OK 4P5AA 4Y52K 1IQ0A 5M5WK 1I50A 3OREA 5IYDK 1SMYA 4G7OA 2R7ZA 2RH6A 3A8KA 4YFKA 5JFEA 5C4JC 3GTGC 2R93A 1TWHK 3TFJA 1O29A 2JH3A 4LR2A 1J6XA 1ZVUA 1IL2A 1SFOC 3S1RC 2ZUEA 4MQ9A 4A3LK 1WCMC 1WQHA 2V6TA 5IYBK 2NVQC 5L46A 1IS1A 4LLGA 1Y1VC 4A3CC 5E68A 4PAAA 1O2AA 3HOZK 2ZUFA 3PO2C 4LQYA 4P5BA 3GEIA 4A3FK 1WORA 3GIRA 2PA8D 3CAGA 4LK0A 2YU9K 3GTKA 1R9TK 2XCQA 1I50C 4JK1A 1DD5A 3I4NK 5EGEA 2R7ZC 2Y3PA 2R93C 3JSTA 1TWCA 4FZBA 1I3QA 1TWGC 3HOYC 5D4DA 2WAQL 4C2MC 4LJZA 2JA6A 1WIHA 3H0GK 2R92A 3GTJK 3SZZA 2EBBA 5JVOA 3S16K 3BUEA 3HOXC 4AYBD 3T01A 3WODA 1WQGA 4C3HC 1INNA 3IPJA 1TWAK 1HI9A 1EQRA 1YNJA 2NVTK 2GSNA 4BY7K 3L4KA 3GTKC 2B63A 1JOEA 3QX3A 4O2DA 4GTLA 4PABA 4A3DK 3GEEA 3AQOA 3GTMK 3H3VD 5C4XK 1TWCC 1I3QC 1ZYRA 4A3KC 1YCLA 2JA6C 3VA7A 1K83K 3HOUK 3FHZA 4KATA 3TFHA 1WQFA 4KMUA 4ILDA 3AQPA 4KM8A 3S1MC 3TFIA 1JVIA 1X31C 3I4MC 4A93C 3FOEA 1AB4A 3AD8C 2GSOA 5C3EK 4A3EK 5TMFA 2E2HK 2PA8L 2E2JK 3RZDK 2Y0SD 5TMCA 4M1XA 2B63C 1ZBSA 3FKIA 3CQZA 3RZOC 3S1QC 3ERED 3M3YC 2JA5K 1WOPA 1TWFK 2W7VA 4GT9A 5IP7C 3S2HC 4KN4A 4A3GC 4J3NA 4NOIA 4XSXA 3S2DC 3AH5A 1XXCA 4BY1K 3OEPA 1VLOA 4GTFA 1F7VA 3S14K 4AYBL 1O26A 1B4AA 4BKWA 2WB1L 1XXAA 3S15K 3GTLK 1I6HC 4BBRC 1O2BA 4GTAA 4Y7NC 3GTMA 3FKIC 3CQZC 4G0UA 2VUMA 3LAJA 3H3VL 4GTDA 5FLMK 4BLBA 3DXJA 4G0VA 2NVXA 5IP9K 3S1NK 3GTOA 3G4CA 3PO3K 1WSVA 3N3YA 2P8TA 1EFWA 3S17C 3K7AC 3BP3A 3T00A 1XZQA 3AD7C 4WILA 4GFQA 4KB4A 3S2HK 2E2IK 3GTQK 1EK8A 2NVYK 5M3FK 4A3BC 1XXBA 4GZYA 2A69A 4A3IK 2Y0SL 4GTEA 3HKZD 1Y1WK 4BBSC 2CFAA 1G51A 2A6HA 1BGWA 2VUMC 4MEYA 5IOSA 1I6HK 3GTGK 5C4JK 2JA7A 2NVXC 4GTCA 3GTPA 3A8JA 3GTOC 1XZPA 1PJ7A 1UV7A 3NUHA 1SFOK 3S1RK 3HOVC 1J6VA 1YNNA 2V6SA 4X6AC 1WCMK 5IOTA 1PJ6A 5CJ9A 4QJVB 4GTBA 3N0BA 2NVQK 1TWHA 4QIWD 1O28A 3S0XA 4KDDA 1Y1VK 4A3CK 1EI6A 5IYCC 4OIRA 3K7AK 3PO2K 4C3IC 2O5JA 4MEXA 4A3MC 5C44C 2R92C 4WJ3M 1I50K 1VH2A 1BJTA 2CW0A 1J6WA 4KMHA 4A3JC 2R7ZK 1ISEA 3OPFA 3SZYA 2JA8C 2JA7C 4KN7A 2R93K 1USMA 3GTPC 4BXXC 4C3JC 4BBSK 3M4OC 5TJ3A 1TWGK 3HOYK 4Y52C 2PPBA 1DCHA 5M3MK 4C2MK 2YU9A 2KWAA 1R9TA 4QJVA 3EQLA 5IOQA 4Q5SA 5IYDC 4WJ4A 4C45A 1TWHC 4KAWX 3HOXK 4C3HK 3HKZL 1J98A 2PMZD 2PHCB 3H0GA 5EGHA 2XCRB 3GTJA 4A3LC 3GDZA 1WSRA 3FOFA
chains in the Genus database with same CATH topology
4FZBA 1I3QA 4BLBA 3Q3QA 4G0VA 4C2MC 3LPXA 2NVXA 2JA6A 1WIHA 2R92A 1TWAA 3GTOA 3G4AA 3G4CA 2E2IA 4KMAA 1O27A 4KB2A 3N3YA 4KMDA 3GTQA 5JVOA 1SFOA 2NVYA 1F9NA 3BUEA 4DDQA 1WQGA 4C3HC 4FM9A 1Y1WA 4GFQA 4BLAA 4KB4A 2GSNA 1EK8A 3L4KA 1XXBA 2CFAB 1O24A 4GTEA 3V4GA 2CFAA 2B63A 3QX3A 4KARA 1KQ4A 3GTGA 2P5MA 4GTLA 3AQOA 3MMLB 1K83A 1BGWA 1GE9A 5IOSA 1EH1A 4KC6A 4KASA 2JA7A 3L4JA 4GTCA 3GTPA 1WCMA 1TWGA 3VA7A 3FHZA 3N0CA 4KATA 2E2HA 1WQFA 3NUHA 4ILDA 1Y1VA 2ZFZA 3AQPA 4KM8A 5CHPA 5IOTA 3FOEA 1AB4A 5CJ9A 2GSOA 4GTBA 3N0BA 4P5AA 1TWHA 1O28A 3S0XA 4KDDA 2JA5A 2XCOA 1TWFA 1I50A 3OREA 4M1XA 2RGRA 1O25A 1ZBSA 3FKIA 2R7ZA 5IORA 2RH6A 5JFEA 3CQZA 4C3IC 2R93A 3ERED 1O29A 2JH3A 4GT9A 4KM9A 4LR2A 1BJTA 1ZVUA 4KMHA 4J3NA 1ISEA 1B4BA 3OPFA 4G0WA 3LAPA 4C3JC 3AH5A 1WQHA 5TJ3A 1XXCA 3GTLA 3OEPA 1IS1A 4GTFA 2YU9A 2KWAA 1R9TA 1O26A 2GSUA 5IOQA 1O2AA 1B4AA 4BKWA 1XXAA 4LQYA 4P5BA 3CAGA 4KAWX 1O2BA 3GTKA 2XCQA 1DD5A 4GTAA 1ZXOA 5EGEA 3GTMA 2Y3PA 2PHCB 3H0GA 5EGHA 2XCRB 3GTJA 4G0UA 2VUMA 3LAJA 4GTDA 3FOFA 1TWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZB A;  5IOT A;  3AH5 A;  2CFA A;  4GTB A;  4KAR A;  1KQ4 A;  3N0B A;  4GTF A;  4P5A A;  1O28 A;  4GTL A;  1O26 A;  5IOQ A;  3G4A A;  1O2A A;  3G4C A;  1O25 A;  1O27 A;  5CHP A;  3N3Y A;  5IOS A;  5IOR A;  4P5B A;  5JFE A;  4KAS A;  4GTC A;  1O29 A;  1O2B A;  4GT9 A;  3N0C A;  4KAT A;  4GTA A;  2CFA B;  1O24 A;  4GTD A;  4GTE A; 
#chains in the Genus database with same CATH topology
 2BE5 A;  3GTK K;  3Q3Q A;  1RU0 A;  1TWA A;  1IW7 A;  3HOZ C;  1TWC K;  1XZQ B;  1I3Q K;  4KMD A;  4A3F C;  1SFO A;  1DCO A;  5M5Y K;  4DDQ A;  2YU9 C;  4A3K K;  1F7U A;  1R9T C;  2JA6 K;  4FM9 A;  3HOW C;  2R92 K;  4BLA A;  4YFN A;  3I4N C;  1HQM A;  1PJ5 A;  4QIW L;  1VRQ C;  1ZQ1 C;  2CFA B;  3A8I A;  3S1M K;  1JQW A;  3HXA A;  3I4M K;  4A93 K;  2GAG C;  4KAR A;  3H0G C;  5FJ8 K;  3GTJ C;  1IE0 A;  1IBA A;  1K83 A;  1GE9 A;  3S16 C;  2B63 K;  1EH1 A;  4KC6 A;  4KAS A;  4ZH4 A;  3RZO K;  3S1Q K;  1XZP B;  1TWA C;  1TWG A;  3M3Y K;  2GAH C;  2NVT C;  3N0C A;  5IP7 K;  1WOO A;  2E2H A;  4BY7 C;  4A3G K;  4RMF A;  5CHP A;  3ADA C;  3S2D K;  4XCH A;  4P9S A;  4A3D C;  3GTM C;  2JA5 A;  2XCO A;  5C4X C;  1TWF A;  1O2F B;  1XPP A;  2RGR A;  4OIQ A;  1O25 A;  1F93 A;  2PMZ L;  5IOR A;  4BBR K;  3HOW K;  1K83 C;  3HOU C;  1DCP A;  4KM9 A;  4Y7N K;  3FKI K;  1B4B A;  1VJE A;  3CQZ K;  1C0A A;  4G0W A;  3LAP A;  5C3E C;  4A3E C;  3GTL A;  2E2H C;  4LK1 A;  1BS2 A;  2E2J C;  3RZD C;  4XLN A;  2GSU A;  1YX2 A;  2V6U A;  4AH6 A;  3S17 K;  4YFX A;  2JA5 C;  1TWF C;  2WB1 D;  1USO A;  2FQO A;  1ZXO A;  3T02 A;  3BP8 C;  4A3B K;  5M5X K;  4BY1 C;  3S14 C;  2O5I A;  3LPX A;  1VGX A;  3GSI A;  2VUM K;  3G4A A;  2E2I A;  4KMA A;  1O27 A;  4KB2 A;  3GTQ A;  4OIO A;  4Q4Z A;  3S15 C;  3GTL C;  2NVY A;  1F9N A;  1V5V A;  3AD9 C;  2NVX K;  1Y1W A;  3GTO K;  1O24 A;  5FLM C;  3HOV K;  3V4G A;  4X6A K;  1L0W A;  5IYB C;  5HL8 A;  1KQ4 A;  3GTG A;  2P5M A;  5IP9 C;  3S1N C;  3MML B;  3PO3 C;  1BDF A;  3TTG A;  4OIN A;  5IYC K;  2WAQ D;  2A6E A;  4YG2 A;  4C3I K;  3L4J A;  1I6V A;  1WCM A;  4A3M K;  5C44 K;  2D6F C;  2E2I C;  3GTQ C;  1WOS A;  2NVY C;  4XSZ A;  4A3J K;  4LOW A;  1Y1V A;  4A3I C;  2ZFZ A;  3GEH A;  2A68 A;  2FQT A;  2JA7 K;  1Y1W C;  2JA8 K;  4BXX K;  4G7H A;  4G7Z A;  3GTP K;  4OIP A;  4C3J K;  4XLP A;  3M4O K;  4P5A A;  4Y52 K;  1IQ0 A;  5M5W K;  1I50 A;  3ORE A;  5IYD K;  1SMY A;  4G7O A;  2R7Z A;  2RH6 A;  3A8K A;  4YFK A;  5JFE A;  5C4J C;  3GTG C;  2R93 A;  1TWH K;  3TFJ A;  1O29 A;  2JH3 A;  4LR2 A;  1J6X A;  1ZVU A;  1IL2 A;  1SFO C;  3S1R C;  2ZUE A;  4MQ9 A;  4A3L K;  1WCM C;  1WQH A;  2V6T A;  5IYB K;  2NVQ C;  5L46 A;  1IS1 A;  4LLG A;  1Y1V C;  4A3C C;  5E68 A;  4PAA A;  1O2A A;  3HOZ K;  2ZUF A;  3PO2 C;  4LQY A;  4P5B A;  3GEI A;  4A3F K;  1WOR A;  3GIR A;  2PA8 D;  3CAG A;  4LK0 A;  2YU9 K;  3GTK A;  1R9T K;  2XCQ A;  1I50 C;  4JK1 A;  1DD5 A;  3I4N K;  5EGE A;  2R7Z C;  2Y3P A;  2R93 C;  3JST A;  1TWC A;  4FZB A;  1I3Q A;  1TWG C;  3HOY C;  5D4D A;  2WAQ L;  4C2M C;  4LJZ A;  2JA6 A;  1WIH A;  3H0G K;  2R92 A;  3GTJ K;  3SZZ A;  2EBB A;  5JVO A;  3S16 K;  3BUE A;  3HOX C;  4AYB D;  3T01 A;  3WOD A;  1WQG A;  4C3H C;  1INN A;  3IPJ A;  1TWA K;  1HI9 A;  1EQR A;  1YNJ A;  2NVT K;  2GSN A;  4BY7 K;  3L4K A;  3GTK C;  2B63 A;  1JOE A;  3QX3 A;  4O2D A;  4GTL A;  4PAB A;  4A3D K;  3GEE A;  3AQO A;  3GTM K;  3H3V D;  5C4X K;  1TWC C;  1I3Q C;  1ZYR A;  4A3K C;  1YCL A;  2JA6 C;  3VA7 A;  1K83 K;  3HOU K;  3FHZ A;  4KAT A;  3TFH A;  1WQF A;  4KMU A;  4ILD A;  3AQP A;  4KM8 A;  3S1M C;  3TFI A;  1JVI A;  1X31 C;  3I4M C;  4A93 C;  3FOE A;  1AB4 A;  3AD8 C;  2GSO A;  5C3E K;  4A3E K;  5TMF A;  2E2H K;  2PA8 L;  2E2J K;  3RZD K;  2Y0S D;  5TMC A;  4M1X A;  2B63 C;  1ZBS A;  3FKI A;  3CQZ A;  3RZO C;  3S1Q C;  3ERE D;  3M3Y C;  2JA5 K;  1WOP A;  1TWF K;  2W7V A;  4GT9 A;  5IP7 C;  3S2H C;  4KN4 A;  4A3G C;  4J3N A;  4NOI A;  4XSX A;  3S2D C;  3AH5 A;  1XXC A;  4BY1 K;  3OEP A;  1VLO A;  4GTF A;  1F7V A;  3S14 K;  4AYB L;  1O26 A;  1B4A A;  4BKW A;  2WB1 L;  1XXA A;  3S15 K;  3GTL K;  1I6H C;  4BBR C;  1O2B A;  4GTA A;  4Y7N C;  3GTM A;  3FKI C;  3CQZ C;  4G0U A;  2VUM A;  3LAJ A;  3H3V L;  4GTD A;  5FLM K;  4BLB A;  3DXJ A;  4G0V A;  2NVX A;  5IP9 K;  3S1N K;  3GTO A;  3G4C A;  3PO3 K;  1WSV A;  3N3Y A;  2P8T A;  1EFW A;  3S17 C;  3K7A C;  3BP3 A;  3T00 A;  1XZQ A;  3AD7 C;  4WIL A;  4GFQ A;  4KB4 A;  3S2H K;  2E2I K;  3GTQ K;  1EK8 A;  2NVY K;  5M3F K;  4A3B C;  1XXB A;  4GZY A;  2A69 A;  4A3I K;  2Y0S L;  4GTE A;  3HKZ D;  1Y1W K;  4BBS C;  2CFA A;  1G51 A;  2A6H A;  1BGW A;  2VUM C;  4MEY A;  5IOS A;  1I6H K;  3GTG K;  5C4J K;  2JA7 A;  2NVX C;  4GTC A;  3GTP A;  3A8J A;  3GTO C;  1XZP A;  1PJ7 A;  1UV7 A;  3NUH A;  1SFO K;  3S1R K;  3HOV C;  1J6V A;  1YNN A;  2V6S A;  4X6A C;  1WCM K;  5IOT A;  1PJ6 A;  5CJ9 A;  4QJV B;  4GTB A;  3N0B A;  2NVQ K;  1TWH A;  4QIW D;  1O28 A;  3S0X A;  4KDD A;  1Y1V K;  4A3C K;  1EI6 A;  5IYC C;  4OIR A;  3K7A K;  3PO2 K;  4C3I C;  2O5J A;  4MEX A;  4A3M C;  5C44 C;  2R92 C;  4WJ3 M;  1I50 K;  1VH2 A;  1BJT A;  2CW0 A;  1J6W A;  4KMH A;  4A3J C;  2R7Z K;  1ISE A;  3OPF A;  3SZY A;  2JA8 C;  2JA7 C;  4KN7 A;  2R93 K;  1USM A;  3GTP C;  4BXX C;  4C3J C;  4BBS K;  3M4O C;  5TJ3 A;  1TWG K;  3HOY K;  4Y52 C;  2PPB A;  1DCH A;  5M3M K;  4C2M K;  2YU9 A;  2KWA A;  1R9T A;  4QJV A;  3EQL A;  5IOQ A;  4Q5S A;  5IYD C;  4WJ4 A;  4C45 A;  1TWH C;  4KAW X;  3HOX K;  4C3H K;  3HKZ L;  1J98 A;  2PMZ D;  2PHC B;  3H0G A;  5EGH A;  2XCR B;  3GTJ A;  4A3L C;  3GDZ A;  1WSR A;  3FOF A; 
#chains in the Genus database with same CATH homology
 4FZB A;  1I3Q A;  4BLB A;  3Q3Q A;  4G0V A;  4C2M C;  3LPX A;  2NVX A;  2JA6 A;  1WIH A;  2R92 A;  1TWA A;  3GTO A;  3G4A A;  3G4C A;  2E2I A;  4KMA A;  1O27 A;  4KB2 A;  3N3Y A;  4KMD A;  3GTQ A;  5JVO A;  1SFO A;  2NVY A;  1F9N A;  3BUE A;  4DDQ A;  1WQG A;  4C3H C;  4FM9 A;  1Y1W A;  4GFQ A;  4BLA A;  4KB4 A;  2GSN A;  1EK8 A;  3L4K A;  1XXB A;  2CFA B;  1O24 A;  4GTE A;  3V4G A;  2CFA A;  2B63 A;  3QX3 A;  4KAR A;  1KQ4 A;  3GTG A;  2P5M A;  4GTL A;  3AQO A;  3MML B;  1K83 A;  1BGW A;  1GE9 A;  5IOS A;  1EH1 A;  4KC6 A;  4KAS A;  2JA7 A;  3L4J A;  4GTC A;  3GTP A;  1WCM A;  1TWG A;  3VA7 A;  3FHZ A;  3N0C A;  4KAT A;  2E2H A;  1WQF A;  3NUH A;  4ILD A;  1Y1V A;  2ZFZ A;  3AQP A;  4KM8 A;  5CHP A;  5IOT A;  3FOE A;  1AB4 A;  5CJ9 A;  2GSO A;  4GTB A;  3N0B A;  4P5A A;  1TWH A;  1O28 A;  3S0X A;  4KDD A;  2JA5 A;  2XCO A;  1TWF A;  1I50 A;  3ORE A;  4M1X A;  2RGR A;  1O25 A;  1ZBS A;  3FKI A;  2R7Z A;  5IOR A;  2RH6 A;  5JFE A;  3CQZ A;  4C3I C;  2R93 A;  3ERE D;  1O29 A;  2JH3 A;  4GT9 A;  4KM9 A;  4LR2 A;  1BJT A;  1ZVU A;  4KMH A;  4J3N A;  1ISE A;  1B4B A;  3OPF A;  4G0W A;  3LAP A;  4C3J C;  3AH5 A;  1WQH A;  5TJ3 A;  1XXC A;  3GTL A;  3OEP A;  1IS1 A;  4GTF A;  2YU9 A;  2KWA A;  1R9T A;  1O26 A;  2GSU A;  5IOQ A;  1O2A A;  1B4A A;  4BKW A;  1XXA A;  4LQY A;  4P5B A;  3CAG A;  4KAW X;  1O2B A;  3GTK A;  2XCQ A;  1DD5 A;  4GTA A;  1ZXO A;  5EGE A;  3GTM A;  2Y3P A;  2PHC B;  3H0G A;  5EGH A;  2XCR B;  3GTJ A;  4G0U A;  2VUM A;  3LAJ A;  4GTD A;  3FOF A;  1TWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...