4KARA

Crystal structure of fdts (tm0449) mutant (h53d) with fad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Thymidylate synthase
total genus 75
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4karA00
5IORA 1KQ4A 2CFAA 3G4AA 1O24A 1O26A 4P5BA 5IOTA 5JFEA 4GTFA 5IOSA 2CFAB 4GTBA 1O28A 1O2AA 4GTCA 4KARA 3G4CA 3N0CA 1O29A 4GTAA 3N3YA 4GTEA 4KASA 1O2BA 4GTDA 4P5AA 4KATA 1O27A 4GT9A 3N0BA 3AH5A 5IOQA 4GTLA 1O25A 4FZBA 5CHPA
chains in the Genus database with same CATH superfamily
3GTQA 3GTKA 2KWAA 3EQLA 4A3DC 5C4XK 1WCMC 3CQZA 5IP9K 1TWHK 4KN4A 1DCPA 1J6XA 2GSUA 4GFQA 4MEYA 4MEXA 4GTBA 4KARA 2JA5K 2JA5A 1VRQC 1J6VA 3V4GA 3GTGA 5M5YK 3GEHA 1IQ0A 2WB1L 2D6FC 1JOEA 1DCHA 1O24A 1GE9A 1EK8A 1IS1A 3GTOK 5IYBK 2A68A 4QJVA 3GTJK 5TJ3A 1O2AA 2PA8L 3TFIA 3Q3QA 1VLOA 4KDDA 1VGXA 3GTJC 4OINA 1XPPA 3S1QC 4BLAA 4KMDA 5IYDK 3BUEA 1HI9A 4YFNA 2E2HA 4C45A 3WODA 1WSRA 3FOEA 3T00A 5IOSA 3AQOA 4LQYA 1F7VA 2B63K 4PABA 3HOYC 3SZYA 2Y3PA 3N0CA 5C3EK 5IYDC 3GEEA 1I6VA 3BP3A 2NVYC 2A6EA 4A3CC 1J98A 1I6HC 4XLNA 4J3NA 1DCOA 2VUMC 4GTLA 3HOUK 3H3VD 4A3JC 1VJEA 1I3QA 4G7ZA 4AYBL 5IYBC 1WCMK 1UV7A 1ZYRA 2GSOA 4A3EC 3S1NC 2CFAB 1O28A 2E2JK 2XCOA 3GEIA 4XCHA 4G7HA 3GTGK 1WIHA 3K7AK 2RGRA 3T01A 3HKZL 1TWGA 2ZUEA 3GTPA 2R92K 1TWGC 3GTPC 4OIOA 1B4AA 5IOQA 3MMLB 1O25A 4A3GK 2WAQL 2PHCB 1O26A 2NVXC 3PO3C 1XXCA 3GTKK 1USOA 1K83K 4A3IK 4BBSC 4BXXC 1SFOA 3HOWK 5L46A 4GTCA 3FOFA 3AQPA 4YG2A 4KC6A 1F9NA 1TWGK 3GTPK 1WOOA 4KM8A 1IE0A 1TWFC 2Y0SL 4OIRA 2JA6C 1XZPA 2XCQA 4A3JK 1TWAC 3RZDC 3HOWC 2CFAA 4A3KK 1XZQB 3S1MK 3I4MC 5C44K 3ERED 3GTQC 3M3YC 2R93K 1I3QK 5FLMC 3GDZA 2PA8D 3S15C 3S1RC 4Y7NC 4BY1C 3G4CA 2A6HA 3M4OK 1BJTA 1TWCK 1Y1VC 3GTMK 4WJ4A 1IBAA 2ZFZA 3GTQK 2R93C 2NVXK 5EGEA 2ZUFA 2B63A 4BBRK 3ADAC 3GIRA 3IPJA 4Y7NK 2GAHC 3HOXC 2NVTK 1JQWA 1HQMA 3L4KA 4MQ9A 4G0VA 1Y1WK 5JFEA 3FKIK 3H3VL 4O2DA 2E2HK 3CAGA 4A3LC 3S17C 4XSXA 1TWFK 3GTLC 4OIPA 1Y1VK 1X31C 3S0XA 2JA6A 2WAQD 3A8JA 4KATA 3BP8C 3HXAA 2P5MA 3T02A 3GTOC 2E2IK 4A3DK 4WILA 1XXBA 1ZBSA 3S1MC 3OPFA 3H0GK 3S2HK 2P8TA 3RZDK 4C3IC 3LAJA 4A3LK 4M1XA 5FLMK 2E2IC 3PO3K 3HOVK 1PJ6A 1ZQ1C 4KB4A 3CQZC 1B4BA 3HOUC 4OIQA 1AB4A 4AH6A 3GTMA 3S2HC 4X6AC 1SMYA 1RU0A 2R7ZC 3HOVC 2E2IA 3N0BA 1Y1WC 2JA8C 2V6SA 2R93A 2PPBA 1ZVUA 1TWHA 5D4DA 3CQZK 5TMFA 4LJZA 1F93A 5IP9C 1Y1VA 4LOWA 1I3QC 4G7OA 2WB1D 4A3KC 1VH2A 4LK0A 5EGHA 3FKIA 1Y1WA 2GAGC 4QIWL 4BKWA 3S1RK 4GTEA 3S1QK 4YFKA 4XLPA 1SFOK 3GTKC 1O27A 1R9TA 4GT9A 3S16C 5M3FK 3AD8C 4BBRC 1TWAK 2JA7C 4KMUA 4A3MC 1XZQA 2NVYK 4A3FC 2R7ZK 4ILDA 3GTGC 5CJ9A 2VUMK 2JA7A 1O29A 1XZPB 2JA8K 3GTLK 4A3CK 1K83C 4BBSK 4P5AA 3S2DK 4JK1A 2BE5A 1R9TC 3M4OC 1INNA 3NUHA 4C3HK 2V6UA 2E2JC 4A3IC 5IYCK 4P5BA 3LAPA 1I50C 1EFWA 4Q5SA 1K83A 3A8IA 1YCLA 1WSVA 1WORA 1ZXOA 2O5IA 3TTGA 2JA6K 5M5XK 3OREA 3S16K 1PJ7A 1O2FB 1I50K 2JA7K 2CW0A 1TWCC 1DD5A 3HKZD 2R7ZA 1I50A 2NVYA 3HOZC 3H0GC 3TFHA 1XXAA 4A3EK 3S1NK 4GTFA 5C4JC 1WQHA 1F7UA 4DDQA 1TWAA 3AD7C 2PMZL 2YU9C 1TWCA 5HL8A 3RZOC 3S14C 4A93C 1O2BA 4GTDA 3S2DC 4A3BK 2R92A 3AD9C 1J6WA 4XSZA 4G0WA 1PJ5A 3GTOA 1WOSA 4KM9A 5C3EC 3HOZK 4LLGA 1C0AA 2FQTA 4RMFA 2JA5C 3A8KA 5CHPA 5IORA 4Q4ZA 3GTLA 1WCMA 4C3IK 4AYBD 3GTMC 1G51A 4LR2A 3JSTA 4KB2A 4LK1A 3HOYK 1V5VA 1EI6A 2RH6A 2V6TA 4P9SA 3FKIC 4PAAA 4X6AK 2NVQK 4C3HC 1KQ4A 3G4AA 1R9TK 1I6HK 1TWHC 3S17K 3VA7A 3I4NC 1YNJA 5C4XC 2FQOA 5C44C 4C2MC 2VUMA 4QIWD 5IYCC 4QJVB 3GTJA 4A3GC 4KN7A 2NVQC 4BY1K 3SZZA 1ISEA 4Y52K 3LPXA 4A3MK 4BY7K 4C3JK 3I4NK 2XCRB 5E68A 1BGWA 3QX3A 2NVTC 4FZBA 1TWFA 3L4JA 4GZYA 5IOTA 1IL2A 4C2MK 2E2HC 4BY7C 3FHZA 5M5WK 1BS2A 1WOPA 1SFOC 3OEPA 3K7AC 5IP7C 1IW7A 5TMCA 2YU9K 3RZOK 3S14K 2NVXA 3N3YA 2YU9A 4C3JC 4KASA 3S15K 4KMAA 1YX2A 2A69A 2Y0SD 3AH5A 5M3MK 3PO2C 2GSNA 4KMHA 3H0GA 3TFJA 1WQGA 5IP7K 4FM9A 4BXXK 1USMA 4NOIA 1JVIA 4A3FK 2B63C 5FJ8K 2W7VA 1EQRA 5C4JK 2EBBA 4G0UA 2PMZD 4WJ3M 3GSIA 4Y52C 3HOXK 1YNNA 1EH1A 5JVOA 3PO2K 1WQFA 4GTAA 4ZH4A 2R92C 4BLBA 4YFXA 1BDFA 3DXJA 1L0WA 4A3BC 3I4MK 3M3YK 4A93K 2O5JA 4KAWX 2JH3A
chains in the Genus database with same CATH topology
5IORA 3GTQA 2PHCB 3GTKA 1O26A 2KWAA 1Y1VA 1XXCA 3GTLA 3CQZA 1WCMA 2GSUA 4GFQA 1SFOA 5EGHA 4GTBA 4KARA 3FKIA 4GTCA 3FOFA 4LR2A 3AQPA 1Y1WA 4KB2A 4KC6A 1F9NA 4BKWA 4KM8A 2JA5A 4GTEA 3V4GA 1O27A 1R9TA 2RH6A 4GT9A 3GTGA 2XCQA 4C3HC 1KQ4A 2CFAA 3G4AA 1O24A 1GE9A 3VA7A 3ERED 1TWHA 1EK8A 1IS1A 4C2MC 2VUMA 3GTJA 4ILDA 5TJ3A 1O2AA 3G4CA 5CJ9A 2JA7A 3Q3QA 1BJTA 1O29A 1ISEA 4KDDA 4P5AA 3LPXA 2ZFZA 2XCRB 1BGWA 4BLAA 4KMDA 5EGEA 3QX3A 4FZBA 3NUHA 3BUEA 2B63A 1TWFA 2E2HA 3L4JA 3L4KA 5IOTA 3FOEA 4P5BA 3LAPA 4G0VA 5JFEA 5IOSA 3FHZA 3AQOA 1K83A 3CAGA 3OEPA 4LQYA 2Y3PA 3S0XA 2JA6A 2NVXA 3N0CA 1ZXOA 3N3YA 2YU9A 4C3JC 4KASA 3OREA 4KATA 4KMAA 2P5MA 1XXBA 1ZBSA 3OPFA 3AH5A 1DD5A 4J3NA 2GSNA 4GTLA 4KMHA 3H0GA 2R7ZA 1WQGA 1I50A 4C3IC 2NVYA 3LAJA 4FM9A 1I3QA 4M1XA 1XXAA 4GTFA 1WQHA 4G0UA 2GSOA 4DDQA 1TWAA 5CHPA 2CFAB 4KB4A 1O28A 1B4BA 2XCOA 1EH1A 1AB4A 1TWCA 5JVOA 3GTMA 1WQFA 4GTAA 1WIHA 4BLBA 1O2BA 4GTDA 2RGRA 2R92A 1TWGA 3GTPA 2E2IA 3N0BA 4G0WA 3GTOA 4KM9A 5IOQA 1B4AA 2R93A 3MMLB 1O25A 4KAWX 1ZVUA 2JH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOR A;  1KQ4 A;  2CFA A;  3G4A A;  1O24 A;  1O26 A;  4P5B A;  5IOT A;  5JFE A;  4GTF A;  5IOS A;  2CFA B;  4GTB A;  1O28 A;  1O2A A;  4GTC A;  4KAR A;  3G4C A;  3N0C A;  1O29 A;  4GTA A;  3N3Y A;  4GTE A;  4KAS A;  1O2B A;  4GTD A;  4P5A A;  4KAT A;  1O27 A;  4GT9 A;  3N0B A;  3AH5 A;  5IOQ A;  4GTL A;  1O25 A;  4FZB A;  5CHP A; 
#chains in the Genus database with same CATH topology
 3GTQ A;  3GTK A;  2KWA A;  3EQL A;  4A3D C;  5C4X K;  1WCM C;  3CQZ A;  5IP9 K;  1TWH K;  4KN4 A;  1DCP A;  1J6X A;  2GSU A;  4GFQ A;  4MEY A;  4MEX A;  4GTB A;  4KAR A;  2JA5 K;  2JA5 A;  1VRQ C;  1J6V A;  3V4G A;  3GTG A;  5M5Y K;  3GEH A;  1IQ0 A;  2WB1 L;  2D6F C;  1JOE A;  1DCH A;  1O24 A;  1GE9 A;  1EK8 A;  1IS1 A;  3GTO K;  5IYB K;  2A68 A;  4QJV A;  3GTJ K;  5TJ3 A;  1O2A A;  2PA8 L;  3TFI A;  3Q3Q A;  1VLO A;  4KDD A;  1VGX A;  3GTJ C;  4OIN A;  1XPP A;  3S1Q C;  4BLA A;  4KMD A;  5IYD K;  3BUE A;  1HI9 A;  4YFN A;  2E2H A;  4C45 A;  3WOD A;  1WSR A;  3FOE A;  3T00 A;  5IOS A;  3AQO A;  4LQY A;  1F7V A;  2B63 K;  4PAB A;  3HOY C;  3SZY A;  2Y3P A;  3N0C A;  5C3E K;  5IYD C;  3GEE A;  1I6V A;  3BP3 A;  2NVY C;  2A6E A;  4A3C C;  1J98 A;  1I6H C;  4XLN A;  4J3N A;  1DCO A;  2VUM C;  4GTL A;  3HOU K;  3H3V D;  4A3J C;  1VJE A;  1I3Q A;  4G7Z A;  4AYB L;  5IYB C;  1WCM K;  1UV7 A;  1ZYR A;  2GSO A;  4A3E C;  3S1N C;  2CFA B;  1O28 A;  2E2J K;  2XCO A;  3GEI A;  4XCH A;  4G7H A;  3GTG K;  1WIH A;  3K7A K;  2RGR A;  3T01 A;  3HKZ L;  1TWG A;  2ZUE A;  3GTP A;  2R92 K;  1TWG C;  3GTP C;  4OIO A;  1B4A A;  5IOQ A;  3MML B;  1O25 A;  4A3G K;  2WAQ L;  2PHC B;  1O26 A;  2NVX C;  3PO3 C;  1XXC A;  3GTK K;  1USO A;  1K83 K;  4A3I K;  4BBS C;  4BXX C;  1SFO A;  3HOW K;  5L46 A;  4GTC A;  3FOF A;  3AQP A;  4YG2 A;  4KC6 A;  1F9N A;  1TWG K;  3GTP K;  1WOO A;  4KM8 A;  1IE0 A;  1TWF C;  2Y0S L;  4OIR A;  2JA6 C;  1XZP A;  2XCQ A;  4A3J K;  1TWA C;  3RZD C;  3HOW C;  2CFA A;  4A3K K;  1XZQ B;  3S1M K;  3I4M C;  5C44 K;  3ERE D;  3GTQ C;  3M3Y C;  2R93 K;  1I3Q K;  5FLM C;  3GDZ A;  2PA8 D;  3S15 C;  3S1R C;  4Y7N C;  4BY1 C;  3G4C A;  2A6H A;  3M4O K;  1BJT A;  1TWC K;  1Y1V C;  3GTM K;  4WJ4 A;  1IBA A;  2ZFZ A;  3GTQ K;  2R93 C;  2NVX K;  5EGE A;  2ZUF A;  2B63 A;  4BBR K;  3ADA C;  3GIR A;  3IPJ A;  4Y7N K;  2GAH C;  3HOX C;  2NVT K;  1JQW A;  1HQM A;  3L4K A;  4MQ9 A;  4G0V A;  1Y1W K;  5JFE A;  3FKI K;  3H3V L;  4O2D A;  2E2H K;  3CAG A;  4A3L C;  3S17 C;  4XSX A;  1TWF K;  3GTL C;  4OIP A;  1Y1V K;  1X31 C;  3S0X A;  2JA6 A;  2WAQ D;  3A8J A;  4KAT A;  3BP8 C;  3HXA A;  2P5M A;  3T02 A;  3GTO C;  2E2I K;  4A3D K;  4WIL A;  1XXB A;  1ZBS A;  3S1M C;  3OPF A;  3H0G K;  3S2H K;  2P8T A;  3RZD K;  4C3I C;  3LAJ A;  4A3L K;  4M1X A;  5FLM K;  2E2I C;  3PO3 K;  3HOV K;  1PJ6 A;  1ZQ1 C;  4KB4 A;  3CQZ C;  1B4B A;  3HOU C;  4OIQ A;  1AB4 A;  4AH6 A;  3GTM A;  3S2H C;  4X6A C;  1SMY A;  1RU0 A;  2R7Z C;  3HOV C;  2E2I A;  3N0B A;  1Y1W C;  2JA8 C;  2V6S A;  2R93 A;  2PPB A;  1ZVU A;  1TWH A;  5D4D A;  3CQZ K;  5TMF A;  4LJZ A;  1F93 A;  5IP9 C;  1Y1V A;  4LOW A;  1I3Q C;  4G7O A;  2WB1 D;  4A3K C;  1VH2 A;  4LK0 A;  5EGH A;  3FKI A;  1Y1W A;  2GAG C;  4QIW L;  4BKW A;  3S1R K;  4GTE A;  3S1Q K;  4YFK A;  4XLP A;  1SFO K;  3GTK C;  1O27 A;  1R9T A;  4GT9 A;  3S16 C;  5M3F K;  3AD8 C;  4BBR C;  1TWA K;  2JA7 C;  4KMU A;  4A3M C;  1XZQ A;  2NVY K;  4A3F C;  2R7Z K;  4ILD A;  3GTG C;  5CJ9 A;  2VUM K;  2JA7 A;  1O29 A;  1XZP B;  2JA8 K;  3GTL K;  4A3C K;  1K83 C;  4BBS K;  4P5A A;  3S2D K;  4JK1 A;  2BE5 A;  1R9T C;  3M4O C;  1INN A;  3NUH A;  4C3H K;  2V6U A;  2E2J C;  4A3I C;  5IYC K;  4P5B A;  3LAP A;  1I50 C;  1EFW A;  4Q5S A;  1K83 A;  3A8I A;  1YCL A;  1WSV A;  1WOR A;  1ZXO A;  2O5I A;  3TTG A;  2JA6 K;  5M5X K;  3ORE A;  3S16 K;  1PJ7 A;  1O2F B;  1I50 K;  2JA7 K;  2CW0 A;  1TWC C;  1DD5 A;  3HKZ D;  2R7Z A;  1I50 A;  2NVY A;  3HOZ C;  3H0G C;  3TFH A;  1XXA A;  4A3E K;  3S1N K;  4GTF A;  5C4J C;  1WQH A;  1F7U A;  4DDQ A;  1TWA A;  3AD7 C;  2PMZ L;  2YU9 C;  1TWC A;  5HL8 A;  3RZO C;  3S14 C;  4A93 C;  1O2B A;  4GTD A;  3S2D C;  4A3B K;  2R92 A;  3AD9 C;  1J6W A;  4XSZ A;  4G0W A;  1PJ5 A;  3GTO A;  1WOS A;  4KM9 A;  5C3E C;  3HOZ K;  4LLG A;  1C0A A;  2FQT A;  4RMF A;  2JA5 C;  3A8K A;  5CHP A;  5IOR A;  4Q4Z A;  3GTL A;  1WCM A;  4C3I K;  4AYB D;  3GTM C;  1G51 A;  4LR2 A;  3JST A;  4KB2 A;  4LK1 A;  3HOY K;  1V5V A;  1EI6 A;  2RH6 A;  2V6T A;  4P9S A;  3FKI C;  4PAA A;  4X6A K;  2NVQ K;  4C3H C;  1KQ4 A;  3G4A A;  1R9T K;  1I6H K;  1TWH C;  3S17 K;  3VA7 A;  3I4N C;  1YNJ A;  5C4X C;  2FQO A;  5C44 C;  4C2M C;  2VUM A;  4QIW D;  5IYC C;  4QJV B;  3GTJ A;  4A3G C;  4KN7 A;  2NVQ C;  4BY1 K;  3SZZ A;  1ISE A;  4Y52 K;  3LPX A;  4A3M K;  4BY7 K;  4C3J K;  3I4N K;  2XCR B;  5E68 A;  1BGW A;  3QX3 A;  2NVT C;  4FZB A;  1TWF A;  3L4J A;  4GZY A;  5IOT A;  1IL2 A;  4C2M K;  2E2H C;  4BY7 C;  3FHZ A;  5M5W K;  1BS2 A;  1WOP A;  1SFO C;  3OEP A;  3K7A C;  5IP7 C;  1IW7 A;  5TMC A;  2YU9 K;  3RZO K;  3S14 K;  2NVX A;  3N3Y A;  2YU9 A;  4C3J C;  4KAS A;  3S15 K;  4KMA A;  1YX2 A;  2A69 A;  2Y0S D;  3AH5 A;  5M3M K;  3PO2 C;  2GSN A;  4KMH A;  3H0G A;  3TFJ A;  1WQG A;  5IP7 K;  4FM9 A;  4BXX K;  1USM A;  4NOI A;  1JVI A;  4A3F K;  2B63 C;  5FJ8 K;  2W7V A;  1EQR A;  5C4J K;  2EBB A;  4G0U A;  2PMZ D;  4WJ3 M;  3GSI A;  4Y52 C;  3HOX K;  1YNN A;  1EH1 A;  5JVO A;  3PO2 K;  1WQF A;  4GTA A;  4ZH4 A;  2R92 C;  4BLB A;  4YFX A;  1BDF A;  3DXJ A;  1L0W A;  4A3B C;  3I4M K;  3M3Y K;  4A93 K;  2O5J A;  4KAW X;  2JH3 A; 
#chains in the Genus database with same CATH homology
 5IOR A;  3GTQ A;  2PHC B;  3GTK A;  1O26 A;  2KWA A;  1Y1V A;  1XXC A;  3GTL A;  3CQZ A;  1WCM A;  2GSU A;  4GFQ A;  1SFO A;  5EGH A;  4GTB A;  4KAR A;  3FKI A;  4GTC A;  3FOF A;  4LR2 A;  3AQP A;  1Y1W A;  4KB2 A;  4KC6 A;  1F9N A;  4BKW A;  4KM8 A;  2JA5 A;  4GTE A;  3V4G A;  1O27 A;  1R9T A;  2RH6 A;  4GT9 A;  3GTG A;  2XCQ A;  4C3H C;  1KQ4 A;  2CFA A;  3G4A A;  1O24 A;  1GE9 A;  3VA7 A;  3ERE D;  1TWH A;  1EK8 A;  1IS1 A;  4C2M C;  2VUM A;  3GTJ A;  4ILD A;  5TJ3 A;  1O2A A;  3G4C A;  5CJ9 A;  2JA7 A;  3Q3Q A;  1BJT A;  1O29 A;  1ISE A;  4KDD A;  4P5A A;  3LPX A;  2ZFZ A;  2XCR B;  1BGW A;  4BLA A;  4KMD A;  5EGE A;  3QX3 A;  4FZB A;  3NUH A;  3BUE A;  2B63 A;  1TWF A;  2E2H A;  3L4J A;  3L4K A;  5IOT A;  3FOE A;  4P5B A;  3LAP A;  4G0V A;  5JFE A;  5IOS A;  3FHZ A;  3AQO A;  1K83 A;  3CAG A;  3OEP A;  4LQY A;  2Y3P A;  3S0X A;  2JA6 A;  2NVX A;  3N0C A;  1ZXO A;  3N3Y A;  2YU9 A;  4C3J C;  4KAS A;  3ORE A;  4KAT A;  4KMA A;  2P5M A;  1XXB A;  1ZBS A;  3OPF A;  3AH5 A;  1DD5 A;  4J3N A;  2GSN A;  4GTL A;  4KMH A;  3H0G A;  2R7Z A;  1WQG A;  1I50 A;  4C3I C;  2NVY A;  3LAJ A;  4FM9 A;  1I3Q A;  4M1X A;  1XXA A;  4GTF A;  1WQH A;  4G0U A;  2GSO A;  4DDQ A;  1TWA A;  5CHP A;  2CFA B;  4KB4 A;  1O28 A;  1B4B A;  2XCO A;  1EH1 A;  1AB4 A;  1TWC A;  5JVO A;  3GTM A;  1WQF A;  4GTA A;  1WIH A;  4BLB A;  1O2B A;  4GTD A;  2RGR A;  2R92 A;  1TWG A;  3GTP A;  2E2I A;  3N0B A;  4G0W A;  3GTO A;  4KM9 A;  5IOQ A;  1B4A A;  2R93 A;  3MML B;  1O25 A;  4KAW X;  1ZVU A;  2JH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...