4KARA

Crystal structure of fdts (tm0449) mutant (h53d) with fad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 75
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4karA00
3AH5A 4P5AA 4GTEA 5IOQA 2CFAB 4KASA 4KATA 3N0BA 4FZBA 1O27A 1O25A 4GT9A 4KARA 5JFEA 5IORA 4GTBA 1O29A 5IOTA 1O28A 3N0CA 3G4AA 4GTDA 4GTLA 1KQ4A 3N3YA 1O26A 4GTAA 4GTFA 1O2BA 2CFAA 5IOSA 1O2AA 5CHPA 1O24A 4P5BA 4GTCA 3G4CA
chains in the Genus database with same CATH superfamily
1ZBSA 1USMA 3GEEA 3HOXC 1IL2A 2R92C 3CQZC 1USOA 2ZFZA 3TFJA 3GTOA 2PA8D 1ZQ1C 2GSNA 1I6VA 3HOYK 4A3EC 3RZOC 4G7OA 2ZUEA 2V6UA 3HOZK 3GTOC 5M3FK 3GEIA 2CFAA 5M5YK 1IQ0A 1I50C 2A6EA 1YX2A 4BXXK 1Y1VA 1J6VA 1V5VA 4QJVA 5M5XK 3H3VD 1ZXOA 3K7AK 4BY7K 4KDDA 4G0VA 3S16K 3S14C 2R93A 1Y1VC 4GTAA 3SZYA 1G51A 2A69A 1PJ7A 1WCMA 1VGXA 1XXBA 3PO2C 1I3QC 4LK1A 5FLMK 3GTQK 3S1MK 4A3DK 1TWAA 4A3JK 2JA6C 3CAGA 1EH1A 1WCMC 3GTLK 3OREA 1Y1WK 5TJ3A 2ZUFA 4YFXA 5M3MK 2WAQD 4XSZA 1ISEA 1O2FB 1XZPB 3GTJC 4M1XA 3ERED 3HOVK 5IP9K 1RU0A 4A3BC 2JA7C 5IYDK 1C0AA 1K83K 5JVOA 1VRQC 3S2DK 1WSVA 1UV7A 5C4JK 2V6TA 1TWHK 2PHCB 4GT9A 2NVTK 2JA5K 5JFEA 1VJEA 4Y52C 4A3CC 4KAWX 3I4NC 5C3EC 2E2IK 4XLPA 2B63K 3TFHA 1J98A 1KQ4A 3S1RK 3H0GA 4LLGA 4O2DA 3GIRA 1R9TK 3M3YK 1IE0A 2R7ZA 1YNNA 2NVYA 3FHZA 3H3VL 3GTGA 2YU9K 4A3LK 1YNJA 1HI9A 2Y3PA 2O5JA 4LK0A 4P5BA 4A3KK 1BGWA 3H0GC 1TWGK 3T01A 4P5AA 4C3JK 4KASA 4A3GC 1EQRA 1WQFA 2NVYC 4C2MC 4BBSC 4A3IK 4GZYA 1WOSA 1WSRA 5C4XK 4A93C 2V6SA 3S0XA 3AD7C 4GTBA 2NVXK 2E2HK 2E2JK 2VUMC 3GTMC 1XZQA 1F9NA 3GTKK 4KN4A 1TWFC 5FJ8K 1B4AA 3WODA 1AB4A 3BP3A 4J3NA 2PPBA 3N0BA 2WAQL 4OIPA 1EFWA 1IW7A 3VA7A 3QX3A 1L0WA 4MEXA 2NVQK 5IOTA 4YG2A 4KM9A 2P5MA 1J6XA 1VLOA 3ADAC 2Y0SL 5L46A 1BDFA 4AYBD 3HOXK 2R92K 3I4MK 2PMZD 3DXJA 3Q3QA 3TTGA 3HKZL 1F7VA 2CFAB 1I6HC 1YCLA 3LPXA 1EK8A 2WB1D 5IYCC 4KB2A 4A3EK 3RZOK 2KWAA 3LAJA 4QJVB 5IP7C 3M4OC 2GSUA 3FKIA 4KMAA 1ZVUA 3N3YA 5C44C 4GTFA 1I50K 3S16C 1O2BA 4A3MC 4NOIA 1BJTA 4WJ3M 3GTQA 1DCPA 2R93C 5CHPA 3FKIC 3FOFA 3S1NC 3S17K 3GTLA 4WJ4A 1Y1WA 4LR2A 1TWCK 1INNA 4QIWL 4BY1C 5IYBC 1TWAC 1Y1WC 1I3QK 1SFOA 4Y7NK 4LOWA 1GE9A 4C3IC 4C3HC 1K83A 1DD5A 2JA6K 4KMDA 1WCMK 3G4CA 4KMUA 3S2HK 4LQYA 2PA8L 1TWHA 1SFOC 4MQ9A 3GDZA 5IYDC 3L4KA 2JA5A 1PJ5A 3S2DC 2E2IA 3GTJK 5C4JC 2B63A 3V4GA 1JQWA 4A3BK 4A3FK 2JA7K 2PMZL 1R9TA 3FOEA 1O26A 2YU9A 2XCQA 1F7UA 1WIHA 1TWGA 4PABA 3MMLB 3HXAA 4A3CK 4Y52K 3I4NK 1DCHA 5C3EK 2YU9C 2BE5A 3PO3C 3NUHA 4G7ZA 2R7ZC 2CW0A 1O25A 4Q4ZA 3S1QK 3GTGC 2JA8K 4FM9A 2NVXA 4XCHA 3GTPA 2E2HA 4YFKA 3N0CA 3A8IA 4BBRC 3GTKA 3HOUK 3GTPC 4A3GK 2E2HC 1XZQB 4G7HA 2NVYK 4C2MK 1O2AA 4A93K 4AH6A 4OIRA 3OPFA 4RMFA 4DDQA 3S15C 2VUMK 4BLAA 3GTMK 1EI6A 1J6WA 3HOWK 5M5WK 4X6AK 4OIQA 3G4AA 1ZYRA 1TWFK 4KMHA 4PAAA 3RZDK 2R92A 2XCRB 3HOYC 1DCOA 3SZZA 3TFIA 5TMFA 3HOZC 3CQZK 5HL8A 4Q5SA 3AH5A 5IOQA 1HQMA 1IS1A 3AD8C 3I4MC 2XCOA 1WOPA 4BXXC 2GAGC 3GTOK 1O28A 2W7VA 2RGRA 1WQGA 4GTDA 1I50A 1B4BA 4OIOA 3K7AC 4BY7C 3GEHA 3AQPA 1X31C 1I6HK 4LJZA 3LAPA 4XSXA 5IYCK 3EQLA 1TWCA 4MEYA 4KATA 5IP7K 2FQTA 1SMYA 3S14K 3M4OK 1O27A 1Y1VK 5C44K 4KARA 5FLMC 3GTQC 3S17C 3S1MC 4A3DC 5EGHA 5EGEA 4A3MK 1TWCC 4A3JC 2EBBA 1I3QA 3RZDC 1WQHA 4GTLA 2GAHC 2RH6A 3GTLC 2R93K 3JSTA 3FKIK 3PO2K 1JVIA 3S1NK 2JA6A 4BKWA 4C45A 2P8TA 1PJ6A 4Y7NC 4BY1K 4XLNA 3HOVC 5IP9C 5IYBK 4FZBA 1TWAK 3BUEA 3T02A 3GTJA 1K83C 3S2HC 2A6HA 5E68A 1XXAA 4KN7A 2JA7A 1O29A 3AD9C 4C3IK 1XXCA 1XZPA 4GFQA 1TWHC 4AYBL 4C3HK 4OINA 2NVTC 2JA5C 4G0WA 1SFOK 4YFNA 2E2IC 4A3FC 2GSOA 2WB1L 2B63C 1VH2A 3S1RC 4ZH4A 1O24A 1F93A 4P9SA 1R9TC 3M3YC 4GTEA 2Y0SD 4A3LC 4WILA 4A3KC 1TWGC 4C3JC 4KC6A 3HKZD 4BLBA 3S1QC 3GSIA 4A3IC 2JA8C 5C4XC 3A8KA 4ILDA 3BP8C 1JOEA 3H0GK 4KM8A 2NVXC 3PO3K 2R7ZK 2E2JC 3HOUC 3A8JA 4BBSK 2D6FC 4GTCA 3GTGK 3GTKC 1BS2A 3L4JA 1WOOA 2VUMA 3GTMA 1WORA 3IPJA 5TMCA 4BBRK 4KB4A 4JK1A 3AQOA 1IBAA 5IORA 4G0UA 1XPPA 1TWFA 3GTPK 4QIWD 3HOWC 4X6AC 3OEPA 2A68A 2NVQC 2FQOA 5CJ9A 5D4DA 2O5IA 3CQZA 5IOSA 3S15K 2JH3A 3T00A
chains in the Genus database with same CATH topology
1ZBSA 1TWHA 1TWCA 4P5AA 4KASA 4KATA 3L4KA 1WQFA 2JA5A 4C2MC 1O27A 4KARA 2ZFZA 3GTOA 2E2IA 3S0XA 5EGHA 5EGEA 2B63A 3V4GA 4GTBA 2GSNA 1I3QA 1WQHA 4GTLA 1R9TA 2RH6A 3FOEA 1O26A 1F9NA 2YU9A 2JA6A 4BKWA 2XCQA 2CFAA 1B4AA 1WIHA 1TWGA 1AB4A 3MMLB 4J3NA 1Y1VA 3N0BA 4FZBA 3NUHA 3BUEA 3GTJA 1O25A 1ZXOA 1XXAA 4FM9A 2NVXA 3VA7A 3QX3A 3GTPA 4KDDA 4G0VA 2E2HA 2JA7A 1O29A 5IOTA 2R93A 1XXCA 4GFQA 3N0CA 3GTKA 4KM9A 2P5MA 4GTAA 4G0WA 2GSOA 1WCMA 1O2AA 1XXBA 1O24A 3Q3QA 3OPFA 4GTEA 1TWAA 2CFAB 4DDQA 3LPXA 1EK8A 3CAGA 1EH1A 4KB2A 3OREA 4BLAA 2KWAA 4C3JC 3LAJA 4KC6A 4BLBA 5TJ3A 3G4AA 2GSUA 3FKIA 4KMAA 1ZVUA 3N3YA 1ISEA 4KMHA 4GTFA 4ILDA 1O2BA 4M1XA 3ERED 4KM8A 1BJTA 2R92A 2XCRB 3GTQA 5CHPA 4GTCA 5JVOA 3FOFA 3AH5A 5IOQA 3L4JA 3GTLA 2VUMA 1Y1WA 1IS1A 4LR2A 3GTMA 2PHCB 4GT9A 4KB4A 5JFEA 2XCOA 4KAWX 3AQOA 5IORA 4G0UA 1TWFA 1O28A 2RGRA 1WQGA 4GTDA 1I50A 1B4BA 1KQ4A 3H0GA 1SFOA 3OEPA 1GE9A 2R7ZA 3AQPA 4C3IC 5CJ9A 2NVYA 4C3HC 3FHZA 1K83A 3GTGA 1DD5A 3CQZA 4KMDA 5IOSA 2Y3PA 3LAPA 2JH3A 4P5BA 3G4CA 1BGWA 4LQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH5 A;  4P5A A;  4GTE A;  5IOQ A;  2CFA B;  4KAS A;  4KAT A;  3N0B A;  4FZB A;  1O27 A;  1O25 A;  4GT9 A;  4KAR A;  5JFE A;  5IOR A;  4GTB A;  1O29 A;  5IOT A;  1O28 A;  3N0C A;  3G4A A;  4GTD A;  4GTL A;  1KQ4 A;  3N3Y A;  1O26 A;  4GTA A;  4GTF A;  1O2B A;  2CFA A;  5IOS A;  1O2A A;  5CHP A;  1O24 A;  4P5B A;  4GTC A;  3G4C A; 
#chains in the Genus database with same CATH topology
 1ZBS A;  1USM A;  3GEE A;  3HOX C;  1IL2 A;  2R92 C;  3CQZ C;  1USO A;  2ZFZ A;  3TFJ A;  3GTO A;  2PA8 D;  1ZQ1 C;  2GSN A;  1I6V A;  3HOY K;  4A3E C;  3RZO C;  4G7O A;  2ZUE A;  2V6U A;  3HOZ K;  3GTO C;  5M3F K;  3GEI A;  2CFA A;  5M5Y K;  1IQ0 A;  1I50 C;  2A6E A;  1YX2 A;  4BXX K;  1Y1V A;  1J6V A;  1V5V A;  4QJV A;  5M5X K;  3H3V D;  1ZXO A;  3K7A K;  4BY7 K;  4KDD A;  4G0V A;  3S16 K;  3S14 C;  2R93 A;  1Y1V C;  4GTA A;  3SZY A;  1G51 A;  2A69 A;  1PJ7 A;  1WCM A;  1VGX A;  1XXB A;  3PO2 C;  1I3Q C;  4LK1 A;  5FLM K;  3GTQ K;  3S1M K;  4A3D K;  1TWA A;  4A3J K;  2JA6 C;  3CAG A;  1EH1 A;  1WCM C;  3GTL K;  3ORE A;  1Y1W K;  5TJ3 A;  2ZUF A;  4YFX A;  5M3M K;  2WAQ D;  4XSZ A;  1ISE A;  1O2F B;  1XZP B;  3GTJ C;  4M1X A;  3ERE D;  3HOV K;  5IP9 K;  1RU0 A;  4A3B C;  2JA7 C;  5IYD K;  1C0A A;  1K83 K;  5JVO A;  1VRQ C;  3S2D K;  1WSV A;  1UV7 A;  5C4J K;  2V6T A;  1TWH K;  2PHC B;  4GT9 A;  2NVT K;  2JA5 K;  5JFE A;  1VJE A;  4Y52 C;  4A3C C;  4KAW X;  3I4N C;  5C3E C;  2E2I K;  4XLP A;  2B63 K;  3TFH A;  1J98 A;  1KQ4 A;  3S1R K;  3H0G A;  4LLG A;  4O2D A;  3GIR A;  1R9T K;  3M3Y K;  1IE0 A;  2R7Z A;  1YNN A;  2NVY A;  3FHZ A;  3H3V L;  3GTG A;  2YU9 K;  4A3L K;  1YNJ A;  1HI9 A;  2Y3P A;  2O5J A;  4LK0 A;  4P5B A;  4A3K K;  1BGW A;  3H0G C;  1TWG K;  3T01 A;  4P5A A;  4C3J K;  4KAS A;  4A3G C;  1EQR A;  1WQF A;  2NVY C;  4C2M C;  4BBS C;  4A3I K;  4GZY A;  1WOS A;  1WSR A;  5C4X K;  4A93 C;  2V6S A;  3S0X A;  3AD7 C;  4GTB A;  2NVX K;  2E2H K;  2E2J K;  2VUM C;  3GTM C;  1XZQ A;  1F9N A;  3GTK K;  4KN4 A;  1TWF C;  5FJ8 K;  1B4A A;  3WOD A;  1AB4 A;  3BP3 A;  4J3N A;  2PPB A;  3N0B A;  2WAQ L;  4OIP A;  1EFW A;  1IW7 A;  3VA7 A;  3QX3 A;  1L0W A;  4MEX A;  2NVQ K;  5IOT A;  4YG2 A;  4KM9 A;  2P5M A;  1J6X A;  1VLO A;  3ADA C;  2Y0S L;  5L46 A;  1BDF A;  4AYB D;  3HOX K;  2R92 K;  3I4M K;  2PMZ D;  3DXJ A;  3Q3Q A;  3TTG A;  3HKZ L;  1F7V A;  2CFA B;  1I6H C;  1YCL A;  3LPX A;  1EK8 A;  2WB1 D;  5IYC C;  4KB2 A;  4A3E K;  3RZO K;  2KWA A;  3LAJ A;  4QJV B;  5IP7 C;  3M4O C;  2GSU A;  3FKI A;  4KMA A;  1ZVU A;  3N3Y A;  5C44 C;  4GTF A;  1I50 K;  3S16 C;  1O2B A;  4A3M C;  4NOI A;  1BJT A;  4WJ3 M;  3GTQ A;  1DCP A;  2R93 C;  5CHP A;  3FKI C;  3FOF A;  3S1N C;  3S17 K;  3GTL A;  4WJ4 A;  1Y1W A;  4LR2 A;  1TWC K;  1INN A;  4QIW L;  4BY1 C;  5IYB C;  1TWA C;  1Y1W C;  1I3Q K;  1SFO A;  4Y7N K;  4LOW A;  1GE9 A;  4C3I C;  4C3H C;  1K83 A;  1DD5 A;  2JA6 K;  4KMD A;  1WCM K;  3G4C A;  4KMU A;  3S2H K;  4LQY A;  2PA8 L;  1TWH A;  1SFO C;  4MQ9 A;  3GDZ A;  5IYD C;  3L4K A;  2JA5 A;  1PJ5 A;  3S2D C;  2E2I A;  3GTJ K;  5C4J C;  2B63 A;  3V4G A;  1JQW A;  4A3B K;  4A3F K;  2JA7 K;  2PMZ L;  1R9T A;  3FOE A;  1O26 A;  2YU9 A;  2XCQ A;  1F7U A;  1WIH A;  1TWG A;  4PAB A;  3MML B;  3HXA A;  4A3C K;  4Y52 K;  3I4N K;  1DCH A;  5C3E K;  2YU9 C;  2BE5 A;  3PO3 C;  3NUH A;  4G7Z A;  2R7Z C;  2CW0 A;  1O25 A;  4Q4Z A;  3S1Q K;  3GTG C;  2JA8 K;  4FM9 A;  2NVX A;  4XCH A;  3GTP A;  2E2H A;  4YFK A;  3N0C A;  3A8I A;  4BBR C;  3GTK A;  3HOU K;  3GTP C;  4A3G K;  2E2H C;  1XZQ B;  4G7H A;  2NVY K;  4C2M K;  1O2A A;  4A93 K;  4AH6 A;  4OIR A;  3OPF A;  4RMF A;  4DDQ A;  3S15 C;  2VUM K;  4BLA A;  3GTM K;  1EI6 A;  1J6W A;  3HOW K;  5M5W K;  4X6A K;  4OIQ A;  3G4A A;  1ZYR A;  1TWF K;  4KMH A;  4PAA A;  3RZD K;  2R92 A;  2XCR B;  3HOY C;  1DCO A;  3SZZ A;  3TFI A;  5TMF A;  3HOZ C;  3CQZ K;  5HL8 A;  4Q5S A;  3AH5 A;  5IOQ A;  1HQM A;  1IS1 A;  3AD8 C;  3I4M C;  2XCO A;  1WOP A;  4BXX C;  2GAG C;  3GTO K;  1O28 A;  2W7V A;  2RGR A;  1WQG A;  4GTD A;  1I50 A;  1B4B A;  4OIO A;  3K7A C;  4BY7 C;  3GEH A;  3AQP A;  1X31 C;  1I6H K;  4LJZ A;  3LAP A;  4XSX A;  5IYC K;  3EQL A;  1TWC A;  4MEY A;  4KAT A;  5IP7 K;  2FQT A;  1SMY A;  3S14 K;  3M4O K;  1O27 A;  1Y1V K;  5C44 K;  4KAR A;  5FLM C;  3GTQ C;  3S17 C;  3S1M C;  4A3D C;  5EGH A;  5EGE A;  4A3M K;  1TWC C;  4A3J C;  2EBB A;  1I3Q A;  3RZD C;  1WQH A;  4GTL A;  2GAH C;  2RH6 A;  3GTL C;  2R93 K;  3JST A;  3FKI K;  3PO2 K;  1JVI A;  3S1N K;  2JA6 A;  4BKW A;  4C45 A;  2P8T A;  1PJ6 A;  4Y7N C;  4BY1 K;  4XLN A;  3HOV C;  5IP9 C;  5IYB K;  4FZB A;  1TWA K;  3BUE A;  3T02 A;  3GTJ A;  1K83 C;  3S2H C;  2A6H A;  5E68 A;  1XXA A;  4KN7 A;  2JA7 A;  1O29 A;  3AD9 C;  4C3I K;  1XXC A;  1XZP A;  4GFQ A;  1TWH C;  4AYB L;  4C3H K;  4OIN A;  2NVT C;  2JA5 C;  4G0W A;  1SFO K;  4YFN A;  2E2I C;  4A3F C;  2GSO A;  2WB1 L;  2B63 C;  1VH2 A;  3S1R C;  4ZH4 A;  1O24 A;  1F93 A;  4P9S A;  1R9T C;  3M3Y C;  4GTE A;  2Y0S D;  4A3L C;  4WIL A;  4A3K C;  1TWG C;  4C3J C;  4KC6 A;  3HKZ D;  4BLB A;  3S1Q C;  3GSI A;  4A3I C;  2JA8 C;  5C4X C;  3A8K A;  4ILD A;  3BP8 C;  1JOE A;  3H0G K;  4KM8 A;  2NVX C;  3PO3 K;  2R7Z K;  2E2J C;  3HOU C;  3A8J A;  4BBS K;  2D6F C;  4GTC A;  3GTG K;  3GTK C;  1BS2 A;  3L4J A;  1WOO A;  2VUM A;  3GTM A;  1WOR A;  3IPJ A;  5TMC A;  4BBR K;  4KB4 A;  4JK1 A;  3AQO A;  1IBA A;  5IOR A;  4G0U A;  1XPP A;  1TWF A;  3GTP K;  4QIW D;  3HOW C;  4X6A C;  3OEP A;  2A68 A;  2NVQ C;  2FQO A;  5CJ9 A;  5D4D A;  2O5I A;  3CQZ A;  5IOS A;  3S15 K;  2JH3 A;  3T00 A; 
#chains in the Genus database with same CATH homology
 1ZBS A;  1TWH A;  1TWC A;  4P5A A;  4KAS A;  4KAT A;  3L4K A;  1WQF A;  2JA5 A;  4C2M C;  1O27 A;  4KAR A;  2ZFZ A;  3GTO A;  2E2I A;  3S0X A;  5EGH A;  5EGE A;  2B63 A;  3V4G A;  4GTB A;  2GSN A;  1I3Q A;  1WQH A;  4GTL A;  1R9T A;  2RH6 A;  3FOE A;  1O26 A;  1F9N A;  2YU9 A;  2JA6 A;  4BKW A;  2XCQ A;  2CFA A;  1B4A A;  1WIH A;  1TWG A;  1AB4 A;  3MML B;  4J3N A;  1Y1V A;  3N0B A;  4FZB A;  3NUH A;  3BUE A;  3GTJ A;  1O25 A;  1ZXO A;  1XXA A;  4FM9 A;  2NVX A;  3VA7 A;  3QX3 A;  3GTP A;  4KDD A;  4G0V A;  2E2H A;  2JA7 A;  1O29 A;  5IOT A;  2R93 A;  1XXC A;  4GFQ A;  3N0C A;  3GTK A;  4KM9 A;  2P5M A;  4GTA A;  4G0W A;  2GSO A;  1WCM A;  1O2A A;  1XXB A;  1O24 A;  3Q3Q A;  3OPF A;  4GTE A;  1TWA A;  2CFA B;  4DDQ A;  3LPX A;  1EK8 A;  3CAG A;  1EH1 A;  4KB2 A;  3ORE A;  4BLA A;  2KWA A;  4C3J C;  3LAJ A;  4KC6 A;  4BLB A;  5TJ3 A;  3G4A A;  2GSU A;  3FKI A;  4KMA A;  1ZVU A;  3N3Y A;  1ISE A;  4KMH A;  4GTF A;  4ILD A;  1O2B A;  4M1X A;  3ERE D;  4KM8 A;  1BJT A;  2R92 A;  2XCR B;  3GTQ A;  5CHP A;  4GTC A;  5JVO A;  3FOF A;  3AH5 A;  5IOQ A;  3L4J A;  3GTL A;  2VUM A;  1Y1W A;  1IS1 A;  4LR2 A;  3GTM A;  2PHC B;  4GT9 A;  4KB4 A;  5JFE A;  2XCO A;  4KAW X;  3AQO A;  5IOR A;  4G0U A;  1TWF A;  1O28 A;  2RGR A;  1WQG A;  4GTD A;  1I50 A;  1B4B A;  1KQ4 A;  3H0G A;  1SFO A;  3OEP A;  1GE9 A;  2R7Z A;  3AQP A;  4C3I C;  5CJ9 A;  2NVY A;  4C3H C;  3FHZ A;  1K83 A;  3GTG A;  1DD5 A;  3CQZ A;  4KMD A;  5IOS A;  2Y3P A;  3LAP A;  2JH3 A;  4P5B A;  3G4C A;  1BGW A;  4LQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...