4KARA

Crystal structure of fdts (tm0449) mutant (h53d) with fad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Thymidylate synthase
total genus 75
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4karA00
3G4CA 4FZBA 1KQ4A 3G4AA 3AH5A 5CHPA 5IOQA 2CFAA 4GTFA 1O29A 4KARA 5IORA 4KASA 1O25A 1O2BA 3N0CA 5IOSA 1O2AA 4KATA 4GTLA 4GT9A 2CFAB 3N3YA 4P5BA 4GTAA 1O28A 4GTEA 1O24A 1O27A 5IOTA 4GTDA 4GTCA 3N0BA 4P5AA 1O26A 5JFEA 4GTBA
chains in the Genus database with same CATH superfamily
2W7VA 3GTJC 3NUHA 4G7OA 3GTGA 4WJ4A 2VUMK 3K7AC 3PO3K 3PO3C 4KASA 4FM9A 1TWAC 1ZQ1C 2JA7C 3GDZA 4PABA 2A68A 3GEEA 3HKZD 3OEPA 2NVQK 1UV7A 4QIWL 5M5XK 2ZFZA 3AD9C 1Y1WA 1O26A 4BKWA 2B63C 4A3LK 2WAQL 4A3CK 3GEIA 1YCLA 1ISEA 4J3NA 1USMA 1G51A 4AYBD 1ZBSA 1R9TA 3GTPC 3GIRA 4KB2A 4A3FK 1IBAA 3CAGA 2ZUEA 4LJZA 1SFOA 3PO2C 3V4GA 1YNJA 2CW0A 4GTEA 5EGHA 1AB4A 2NVXA 3S17C 5IOTA 4A3KK 3L4JA 3S17K 3GTPA 5D4DA 4KMHA 2FQTA 1I6HK 3HXAA 4A3MC 1SMYA 3GTJA 1K83K 2V6UA 3BP3A 2R7ZC 3GTGC 3JSTA 4X6AC 5IORA 4OIOA 2JA8K 5IOSA 1B4BA 1WOPA 4KMUA 4XCHA 3OREA 3HOWC 2JA7A 1V5VA 4AYBL 2E2JK 4C2MK 1ZYRA 2A69A 2PA8D 5JFEA 4QIWD 1O2FB 5IYBC 3CQZC 2P5MA 1WQHA 3A8JA 3CQZK 1DD5A 1WCMA 3M4OC 3GTGK 1I50K 3H0GA 3GTQC 1IW7A 2JA5C 4G7ZA 2JA5K 1SFOC 4A3DK 3CQZA 1DCHA 4G0UA 3GTMK 1INNA 4GTAA 1XXAA 1EQRA 3HOVC 3TFJA 3HOZK 4A3IK 3S15K 4A3IC 1TWAK 1KQ4A 3HOXC 2R7ZA 4BY7C 1O29A 3Q3QA 1TWFA 2NVYA 5L46A 1I6HC 1RU0A 1F7UA 4Q4ZA 1B4AA 3LAPA 4C3IK 4C3JK 2B63K 1XZQB 4YFXA 3M4OK 4KC6A 1IE0A 1PJ6A 4Y7NK 3GTKK 5C4JK 3AQPA 1ZXOA 5IP7C 5JVOA 4A3CC 1F93A 3GTOK 1TWFC 2NVYC 2GSUA 2PA8L 1IS1A 4KMAA 1GE9A 5IYCK 3T02A 3L4KA 4BBRK 1Y1WK 3GTPK 3HOVK 3AD7C 4A3BC 4A3BK 2PPBA 4KB4A 1WCMC 1BDFA 3H0GC 4A3EK 3GTQA 2O5JA 2JA5A 5IYBK 2D6FC 4BY1K 4ZH4A 4BY1C 4PAAA 3S2DK 4C3HC 4OIRA 2R7ZK 4X6AK 3A8KA 2YU9K 2A6HA 3H3VL 3G4CA 5CHPA 4LQYA 5IYDC 1JVIA 4BLBA 1YX2A 3QX3A 2R92A 1WIHA 3ADAC 3S1RK 2JA7K 2P8TA 4YFNA 4BLAA 1O28A 5M3MK 4G0WA 2E2HA 3GEHA 2R92K 2R92C 3T01A 3FKIK 2GSNA 3VA7A 1EFWA 4Y7NC 4A3LC 3GSIA 1WOSA 3S2HK 2E2HC 4BBSC 2WB1L 1O2BA 4GFQA 3TFIA 3S1QK 5C4XK 1I6VA 5C4XC 4P9SA 3H3VD 3I4MK 5TMCA 1O24A 3GTMA 3RZDK 4BY7K 3GTKA 5M5YK 2Y0SD 2NVQC 1X31C 4WJ3M 4KMDA 4LR2A 1WSRA 1EH1A 1EI6A 5IP9C 5C44C 4LOWA 1IQ0A 2XCQA 3FKIC 3FOFA 4GZYA 2Y0SL 3GTKC 2EBBA 1F7VA 3OPFA 3HOYK 4KDDA 4NOIA 1O2AA 4YG2A 3TFHA 1VGXA 2O5IA 1TWCK 4MEXA 5IYCC 4BBSK 4GT9A 1WQGA 4C2MC 5IYDK 4JK1A 2ZUFA 3AD8C 3GTOA 1I3QC 3I4NK 2R93K 2NVTC 1I3QK 3I4NC 3H0GK 1I50A 1YNNA 2E2IK 4A3EC 2GAHC 5M3FK 4O2DA 3S14K 3SZYA 1BS2A 1VLOA 2GSOA 3N0CA 1I50C 3GTQK 4KAWX 1WORA 2BE5A 4G7HA 2JA8C 3FOEA 1VJEA 3FHZA 3GTMC 3LAJA 2Y3PA 3M3YC 1SFOK 3S1QC 1EK8A 1WQFA 1C0AA 1XZPA 3I4MC 3AH5A 3FKIA 2R93C 1J6VA 1Y1VC 2VUMC 1TWGK 5C3EK 5C3EC 3S15C 4XSXA 3S1NC 3A8IA 4C3JC 2JA6A 1J6XA 2VUMA 1HI9A 2A6EA 5C4JC 4MEYA 4A3MK 3GTOC 1HQMA 3S2HC 1I3QA 5FJ8K 1XZPB 1USOA 4BBRC 3M3YK 5TMFA 3S1MC 2XCRB 4A3FC 2JA6C 3LPXA 4A3JK 4A3JC 2V6SA 3RZDC 3AQOA 4Y52C 2KWAA 4QJVA 4OIPA 1O27A 1R9TK 4C3HK 2V6TA 1VH2A 1L0WA 4A3GC 1TWFK 2NVYK 4ILDA 3HOYC 2R93A 1WOOA 1Y1VA 4YFKA 4GTFA 2NVXK 4XSZA 4BXXC 4LK0A 5HL8A 1O25A 4A3DC 1XXCA 2WB1D 3TTGA 2NVTK 1K83A 1TWHK 2WAQD 5E68A 4MQ9A 2YU9A 4G0VA 4GTDA 3S14C 1PJ7A 4AH6A 1DCPA 3HKZL 3BUEA 3G4AA 2CFAA 4WILA 5TJ3A 3S16K 2JH3A 5M5WK 3S0XA 1F9NA 4KATA 5CJ9A 4DDQA 4GTLA 2CFAB 2E2HK 3HOXK 1TWHC 3HOUK 1TWGC 1BJTA 3MMLB 1J6WA 1Y1VK 4LLGA 3HOUC 4GTCA 4OINA 4OIQA 4P5AA 3HOZC 4Y52K 1BGWA 4GTBA 3PO2K 3EQLA 3GTLC 3RZOC 4Q5SA 3GTLK 3RZOK 2FQOA 5IP9K 1JOEA 1TWCA 3S1NK 4M1XA 2GAGC 4A3KC 1TWHA 4KARA 5FLMC 5FLMK 5IP7K 5C44K 2PHCB 4A3GK 1TWAA 4C3IC 1K83C 2E2IA 3BP8C 1TWCC 1J98A 2YU9C 4KM9A 4LK1A 3DXJA 2JA6K 4BXXK 3S1MK 3ERED 2PMZL 1XZQA 2PMZD 3WODA 1VRQC 1XXBA 3GTJK 1IL2A 3HOWK 2E2JC 1Y1WC 2B63A 1ZVUA 2E2IC 1WSVA 3K7AK 1JQWA 4FZBA 4QJVB 4C45A 5IOQA 4A93C 4A93K 1WCMK 4KM8A 3S1RC 1R9TC 4KN7A 5EGEA 1PJ5A 3SZZA 2RGRA 4RMFA 3N3YA 4XLPA 3IPJA 3S16C 4XLNA 4P5BA 3S2DC 2XCOA 1TWGA 3T00A 2NVXC 1DCOA 3N0BA 4KN4A 1XPPA 3GTLA 2RH6A
chains in the Genus database with same CATH topology
1KQ4A 4ILDA 2R93A 2R7ZA 3NUHA 2XCQA 1Y1VA 3FOFA 3GTGA 4GTFA 1O29A 3Q3QA 1TWFA 2NVYA 4KASA 1O25A 1XXCA 3OPFA 4FM9A 4KDDA 1O2AA 1B4AA 3LAPA 1K83A 4KC6A 4GT9A 3OEPA 1WQGA 3AQPA 1ZXOA 4C2MC 5JVOA 2YU9A 2GSUA 4G0VA 4GTDA 3GTOA 1IS1A 4KMAA 2ZFZA 1GE9A 1Y1WA 1O26A 4BKWA 1I50A 3L4KA 3BUEA 3G4AA 1ISEA 4J3NA 4KB4A 2CFAA 5TJ3A 1ZBSA 2JH3A 1R9TA 3GTQA 2GSOA 3N0CA 4KB2A 2JA5A 4KAWX 3S0XA 3CAGA 1F9NA 4KATA 5CJ9A 4DDQA 1SFOA 4GTLA 2CFAB 3FOEA 3V4GA 4GTEA 3FHZA 4C3HC 5EGHA 1AB4A 3LAJA 2NVXA 5IOTA 3GTPA 1BJTA 3MMLB 2Y3PA 3L4JA 4GTCA 4KMHA 4P5AA 1BGWA 4GTBA 1EK8A 1WQFA 3G4CA 3GTJA 1TWCA 3AH5A 3FKIA 4M1XA 5CHPA 1TWHA 4KARA 5IORA 4LQYA 4BLBA 5IOSA 2PHCB 1B4BA 3QX3A 2R92A 1WIHA 1TWAA 3OREA 4C3IC 2JA7A 2E2IA 4C3JC 2JA6A 2VUMA 4BLAA 1O28A 4KM9A 3ERED 4G0WA 2E2HA 1I3QA 1XXBA 5JFEA 2GSNA 3VA7A 2B63A 1ZVUA 4FZBA 2XCRB 2P5MA 3LPXA 1WQHA 5IOQA 4KM8A 1DD5A 1WCMA 4GFQA 1O2BA 3H0GA 5EGEA 3AQOA 2RGRA 2KWAA 3CQZA 3N3YA 4G0UA 4P5BA 4GTAA 2XCOA 1O24A 3GTMA 1O27A 1XXAA 1TWGA 3GTKA 3N0BA 4KMDA 4LR2A 3GTLA 2RH6A 1EH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4C A;  4FZB A;  1KQ4 A;  3G4A A;  3AH5 A;  5CHP A;  5IOQ A;  2CFA A;  4GTF A;  1O29 A;  4KAR A;  5IOR A;  4KAS A;  1O25 A;  1O2B A;  3N0C A;  5IOS A;  1O2A A;  4KAT A;  4GTL A;  4GT9 A;  2CFA B;  3N3Y A;  4P5B A;  4GTA A;  1O28 A;  4GTE A;  1O24 A;  1O27 A;  5IOT A;  4GTD A;  4GTC A;  3N0B A;  4P5A A;  1O26 A;  5JFE A;  4GTB A; 
#chains in the Genus database with same CATH topology
 2W7V A;  3GTJ C;  3NUH A;  4G7O A;  3GTG A;  4WJ4 A;  2VUM K;  3K7A C;  3PO3 K;  3PO3 C;  4KAS A;  4FM9 A;  1TWA C;  1ZQ1 C;  2JA7 C;  3GDZ A;  4PAB A;  2A68 A;  3GEE A;  3HKZ D;  3OEP A;  2NVQ K;  1UV7 A;  4QIW L;  5M5X K;  2ZFZ A;  3AD9 C;  1Y1W A;  1O26 A;  4BKW A;  2B63 C;  4A3L K;  2WAQ L;  4A3C K;  3GEI A;  1YCL A;  1ISE A;  4J3N A;  1USM A;  1G51 A;  4AYB D;  1ZBS A;  1R9T A;  3GTP C;  3GIR A;  4KB2 A;  4A3F K;  1IBA A;  3CAG A;  2ZUE A;  4LJZ A;  1SFO A;  3PO2 C;  3V4G A;  1YNJ A;  2CW0 A;  4GTE A;  5EGH A;  1AB4 A;  2NVX A;  3S17 C;  5IOT A;  4A3K K;  3L4J A;  3S17 K;  3GTP A;  5D4D A;  4KMH A;  2FQT A;  1I6H K;  3HXA A;  4A3M C;  1SMY A;  3GTJ A;  1K83 K;  2V6U A;  3BP3 A;  2R7Z C;  3GTG C;  3JST A;  4X6A C;  5IOR A;  4OIO A;  2JA8 K;  5IOS A;  1B4B A;  1WOP A;  4KMU A;  4XCH A;  3ORE A;  3HOW C;  2JA7 A;  1V5V A;  4AYB L;  2E2J K;  4C2M K;  1ZYR A;  2A69 A;  2PA8 D;  5JFE A;  4QIW D;  1O2F B;  5IYB C;  3CQZ C;  2P5M A;  1WQH A;  3A8J A;  3CQZ K;  1DD5 A;  1WCM A;  3M4O C;  3GTG K;  1I50 K;  3H0G A;  3GTQ C;  1IW7 A;  2JA5 C;  4G7Z A;  2JA5 K;  1SFO C;  4A3D K;  3CQZ A;  1DCH A;  4G0U A;  3GTM K;  1INN A;  4GTA A;  1XXA A;  1EQR A;  3HOV C;  3TFJ A;  3HOZ K;  4A3I K;  3S15 K;  4A3I C;  1TWA K;  1KQ4 A;  3HOX C;  2R7Z A;  4BY7 C;  1O29 A;  3Q3Q A;  1TWF A;  2NVY A;  5L46 A;  1I6H C;  1RU0 A;  1F7U A;  4Q4Z A;  1B4A A;  3LAP A;  4C3I K;  4C3J K;  2B63 K;  1XZQ B;  4YFX A;  3M4O K;  4KC6 A;  1IE0 A;  1PJ6 A;  4Y7N K;  3GTK K;  5C4J K;  3AQP A;  1ZXO A;  5IP7 C;  5JVO A;  4A3C C;  1F93 A;  3GTO K;  1TWF C;  2NVY C;  2GSU A;  2PA8 L;  1IS1 A;  4KMA A;  1GE9 A;  5IYC K;  3T02 A;  3L4K A;  4BBR K;  1Y1W K;  3GTP K;  3HOV K;  3AD7 C;  4A3B C;  4A3B K;  2PPB A;  4KB4 A;  1WCM C;  1BDF A;  3H0G C;  4A3E K;  3GTQ A;  2O5J A;  2JA5 A;  5IYB K;  2D6F C;  4BY1 K;  4ZH4 A;  4BY1 C;  4PAA A;  3S2D K;  4C3H C;  4OIR A;  2R7Z K;  4X6A K;  3A8K A;  2YU9 K;  2A6H A;  3H3V L;  3G4C A;  5CHP A;  4LQY A;  5IYD C;  1JVI A;  4BLB A;  1YX2 A;  3QX3 A;  2R92 A;  1WIH A;  3ADA C;  3S1R K;  2JA7 K;  2P8T A;  4YFN A;  4BLA A;  1O28 A;  5M3M K;  4G0W A;  2E2H A;  3GEH A;  2R92 K;  2R92 C;  3T01 A;  3FKI K;  2GSN A;  3VA7 A;  1EFW A;  4Y7N C;  4A3L C;  3GSI A;  1WOS A;  3S2H K;  2E2H C;  4BBS C;  2WB1 L;  1O2B A;  4GFQ A;  3TFI A;  3S1Q K;  5C4X K;  1I6V A;  5C4X C;  4P9S A;  3H3V D;  3I4M K;  5TMC A;  1O24 A;  3GTM A;  3RZD K;  4BY7 K;  3GTK A;  5M5Y K;  2Y0S D;  2NVQ C;  1X31 C;  4WJ3 M;  4KMD A;  4LR2 A;  1WSR A;  1EH1 A;  1EI6 A;  5IP9 C;  5C44 C;  4LOW A;  1IQ0 A;  2XCQ A;  3FKI C;  3FOF A;  4GZY A;  2Y0S L;  3GTK C;  2EBB A;  1F7V A;  3OPF A;  3HOY K;  4KDD A;  4NOI A;  1O2A A;  4YG2 A;  3TFH A;  1VGX A;  2O5I A;  1TWC K;  4MEX A;  5IYC C;  4BBS K;  4GT9 A;  1WQG A;  4C2M C;  5IYD K;  4JK1 A;  2ZUF A;  3AD8 C;  3GTO A;  1I3Q C;  3I4N K;  2R93 K;  2NVT C;  1I3Q K;  3I4N C;  3H0G K;  1I50 A;  1YNN A;  2E2I K;  4A3E C;  2GAH C;  5M3F K;  4O2D A;  3S14 K;  3SZY A;  1BS2 A;  1VLO A;  2GSO A;  3N0C A;  1I50 C;  3GTQ K;  4KAW X;  1WOR A;  2BE5 A;  4G7H A;  2JA8 C;  3FOE A;  1VJE A;  3FHZ A;  3GTM C;  3LAJ A;  2Y3P A;  3M3Y C;  1SFO K;  3S1Q C;  1EK8 A;  1WQF A;  1C0A A;  1XZP A;  3I4M C;  3AH5 A;  3FKI A;  2R93 C;  1J6V A;  1Y1V C;  2VUM C;  1TWG K;  5C3E K;  5C3E C;  3S15 C;  4XSX A;  3S1N C;  3A8I A;  4C3J C;  2JA6 A;  1J6X A;  2VUM A;  1HI9 A;  2A6E A;  5C4J C;  4MEY A;  4A3M K;  3GTO C;  1HQM A;  3S2H C;  1I3Q A;  5FJ8 K;  1XZP B;  1USO A;  4BBR C;  3M3Y K;  5TMF A;  3S1M C;  2XCR B;  4A3F C;  2JA6 C;  3LPX A;  4A3J K;  4A3J C;  2V6S A;  3RZD C;  3AQO A;  4Y52 C;  2KWA A;  4QJV A;  4OIP A;  1O27 A;  1R9T K;  4C3H K;  2V6T A;  1VH2 A;  1L0W A;  4A3G C;  1TWF K;  2NVY K;  4ILD A;  3HOY C;  2R93 A;  1WOO A;  1Y1V A;  4YFK A;  4GTF A;  2NVX K;  4XSZ A;  4BXX C;  4LK0 A;  5HL8 A;  1O25 A;  4A3D C;  1XXC A;  2WB1 D;  3TTG A;  2NVT K;  1K83 A;  1TWH K;  2WAQ D;  5E68 A;  4MQ9 A;  2YU9 A;  4G0V A;  4GTD A;  3S14 C;  1PJ7 A;  4AH6 A;  1DCP A;  3HKZ L;  3BUE A;  3G4A A;  2CFA A;  4WIL A;  5TJ3 A;  3S16 K;  2JH3 A;  5M5W K;  3S0X A;  1F9N A;  4KAT A;  5CJ9 A;  4DDQ A;  4GTL A;  2CFA B;  2E2H K;  3HOX K;  1TWH C;  3HOU K;  1TWG C;  1BJT A;  3MML B;  1J6W A;  1Y1V K;  4LLG A;  3HOU C;  4GTC A;  4OIN A;  4OIQ A;  4P5A A;  3HOZ C;  4Y52 K;  1BGW A;  4GTB A;  3PO2 K;  3EQL A;  3GTL C;  3RZO C;  4Q5S A;  3GTL K;  3RZO K;  2FQO A;  5IP9 K;  1JOE A;  1TWC A;  3S1N K;  4M1X A;  2GAG C;  4A3K C;  1TWH A;  4KAR A;  5FLM C;  5FLM K;  5IP7 K;  5C44 K;  2PHC B;  4A3G K;  1TWA A;  4C3I C;  1K83 C;  2E2I A;  3BP8 C;  1TWC C;  1J98 A;  2YU9 C;  4KM9 A;  4LK1 A;  3DXJ A;  2JA6 K;  4BXX K;  3S1M K;  3ERE D;  2PMZ L;  1XZQ A;  2PMZ D;  3WOD A;  1VRQ C;  1XXB A;  3GTJ K;  1IL2 A;  3HOW K;  2E2J C;  1Y1W C;  2B63 A;  1ZVU A;  2E2I C;  1WSV A;  3K7A K;  1JQW A;  4FZB A;  4QJV B;  4C45 A;  5IOQ A;  4A93 C;  4A93 K;  1WCM K;  4KM8 A;  3S1R C;  1R9T C;  4KN7 A;  5EGE A;  1PJ5 A;  3SZZ A;  2RGR A;  4RMF A;  3N3Y A;  4XLP A;  3IPJ A;  3S16 C;  4XLN A;  4P5B A;  3S2D C;  2XCO A;  1TWG A;  3T00 A;  2NVX C;  1DCO A;  3N0B A;  4KN4 A;  1XPP A;  3GTL A;  2RH6 A; 
#chains in the Genus database with same CATH homology
 1KQ4 A;  4ILD A;  2R93 A;  2R7Z A;  3NUH A;  2XCQ A;  1Y1V A;  3FOF A;  3GTG A;  4GTF A;  1O29 A;  3Q3Q A;  1TWF A;  2NVY A;  4KAS A;  1O25 A;  1XXC A;  3OPF A;  4FM9 A;  4KDD A;  1O2A A;  1B4A A;  3LAP A;  1K83 A;  4KC6 A;  4GT9 A;  3OEP A;  1WQG A;  3AQP A;  1ZXO A;  4C2M C;  5JVO A;  2YU9 A;  2GSU A;  4G0V A;  4GTD A;  3GTO A;  1IS1 A;  4KMA A;  2ZFZ A;  1GE9 A;  1Y1W A;  1O26 A;  4BKW A;  1I50 A;  3L4K A;  3BUE A;  3G4A A;  1ISE A;  4J3N A;  4KB4 A;  2CFA A;  5TJ3 A;  1ZBS A;  2JH3 A;  1R9T A;  3GTQ A;  2GSO A;  3N0C A;  4KB2 A;  2JA5 A;  4KAW X;  3S0X A;  3CAG A;  1F9N A;  4KAT A;  5CJ9 A;  4DDQ A;  1SFO A;  4GTL A;  2CFA B;  3FOE A;  3V4G A;  4GTE A;  3FHZ A;  4C3H C;  5EGH A;  1AB4 A;  3LAJ A;  2NVX A;  5IOT A;  3GTP A;  1BJT A;  3MML B;  2Y3P A;  3L4J A;  4GTC A;  4KMH A;  4P5A A;  1BGW A;  4GTB A;  1EK8 A;  1WQF A;  3G4C A;  3GTJ A;  1TWC A;  3AH5 A;  3FKI A;  4M1X A;  5CHP A;  1TWH A;  4KAR A;  5IOR A;  4LQY A;  4BLB A;  5IOS A;  2PHC B;  1B4B A;  3QX3 A;  2R92 A;  1WIH A;  1TWA A;  3ORE A;  4C3I C;  2JA7 A;  2E2I A;  4C3J C;  2JA6 A;  2VUM A;  4BLA A;  1O28 A;  4KM9 A;  3ERE D;  4G0W A;  2E2H A;  1I3Q A;  1XXB A;  5JFE A;  2GSN A;  3VA7 A;  2B63 A;  1ZVU A;  4FZB A;  2XCR B;  2P5M A;  3LPX A;  1WQH A;  5IOQ A;  4KM8 A;  1DD5 A;  1WCM A;  4GFQ A;  1O2B A;  3H0G A;  5EGE A;  3AQO A;  2RGR A;  2KWA A;  3CQZ A;  3N3Y A;  4G0U A;  4P5B A;  4GTA A;  2XCO A;  1O24 A;  3GTM A;  1O27 A;  1XXA A;  1TWG A;  3GTK A;  3N0B A;  4KMD A;  4LR2 A;  3GTL A;  2RH6 A;  1EH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...