1O2AA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad at 1.8 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
211
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 78
structure length 211
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2aA00
1O2BA 1O29A 4P5BA 1O28A 4KATA 4FZBA 2CFAB 1O2AA 1O24A 4GTAA 4GTLA 3AH5A 3G4CA 3N0BA 5IOQA 2CFAA 5IOTA 3N0CA 5CHPA 1KQ4A 5IOSA 4KASA 1O26A 4GTDA 5IORA 5JFEA 4KARA 1O25A 1O27A 4GT9A 4GTEA 4GTFA 3N3YA 4GTCA 4GTBA 4P5AA 3G4AA
chains in the Genus database with same CATH superfamily
1Y1WA 3I4NC 3FOFA 1O2BA 3HOYC 1BGWA 4AH6A 4KATA 4Y7NK 4A3FC 1I50C 4C3IC 5IOQA 1R9TC 2D6FC 2CFAA 4Y52K 3GTPC 4KC6A 1ZYRA 4A3KK 1BDFA 5CHPA 4KM9A 3GTOC 1HQMA 4G7ZA 3VA7A 2Y3PA 4Y7NC 3M3YK 1I6VA 1XXCA 2PA8L 2R7ZA 1TWAK 4GTFA 1DD5A 3GTJK 1UV7A 4Y52C 4A3KC 2Y0SL 3S1NK 2EBBA 2PMZL 4X6AK 1WIHA 4AYBD 3M3YC 4BY7K 3GEIA 2R93K 1XXAA 1TWAC 1PJ7A 3GTJC 2E2HK 3GTLA 3S1RK 1TWCA 2ZUFA 3S1NC 5IYCK 1XZPB 3TFIA 1WQHA 3TTGA 3JSTA 4X6AC 4MEXA 2R92A 1IS1A 4BY7C 2R93C 4XLNA 3BP3A 3OPFA 2E2HC 3S1RC 4OINA 4FZBA 5IYCC 4KN4A 5EGEA 2WAQL 4BBRK 1XXBA 3H3VD 3TFHA 3GTKK 2JA5A 3RZDK 1B4BA 1YNNA 4ZH4A 4G7OA 5EGHA 3AD7C 4QIWD 2JA6A 4BY1K 3N3YA 1WOPA 4BBRC 4WJ3M 3GTKC 4C3JK 4J3NA 1DCPA 3RZDC 2O5IA 3AQOA 3L4JA 3A8IA 3AD8C 1V5VA 4RMFA 1DCOA 4KMAA 4YFKA 4A3EK 4BY1C 3HOZK 4A3MK 1SFOK 4LJZA 3HOWK 3PO2K 4C3JC 3GTGA 2Y0SD 3GDZA 1IQ0A 1WSVA 4A3EC 3HOZC 4A3MC 1SFOC 3HOWC 1IW7A 1WSRA 3PO2C 2VUMK 2E2IA 4PAAA 4DDQA 5L46A 4G0WA 3BUEA 2CW0A 3T00A 4KN7A 3S15K 1J6XA 3FKIA 3N0CA 2FQTA 1DCHA 3HOYK 3HOVK 1TWGA 1XZQA 3ADAC 1ZVUA 2VUMC 5M5XK 2NVYK 1USMA 3S15C 4P5BA 1WQGA 5FJ8K 1O28A 3HOVC 1Y1WK 2E2JK 1I50A 3NUHA 3AH5A 1HI9A 4WILA 2NVYC 4C45A 3Q3QA 3CQZA 1O26A 4BBSK 3S14K 3AD9C 4KARA 1Y1WC 2E2JC 4KAWX 3PO3K 4C2MK 3GTOA 3DXJA 3T02A 4A3LK 1I6HK 2A68A 1TWHA 1ZXOA 2R7ZK 1WCMA 1F7UA 1XPPA 4BBSC 3S14C 1K83K 3PO3C 4C2MC 1I6HC 1YNJA 2NVTK 4A3LC 1WOOA 3GSIA 4QJVB 2R7ZC 4G7HA 2WB1L 4Q5SA 1YX2A 4A3DK 3WODA 1O25A 4XCHA 4XLPA 4PABA 4LLGA 1K83C 1F7VA 2JA7A 3HKZL 3CAGA 2NVTC 3G4AA 5FLMK 2R92K 4XSZA 1I3QA 4XSXA 4A3DC 2V6TA 3G4CA 3S1MK 4JK1A 4KMUA 2V6UA 5FLMC 2R92C 3LPXA 2KWAA 2JA5K 5IORA 4C3HK 4GTEA 3LAPA 3GTMA 3S1MC 4BLBA 4Q4ZA 2A6EA 1RU0A 4KMDA 2JA5C 2ZUEA 4OIRA 4A3IK 4A3JK 1VGXA 2YU9A 4C3HC 2JA6C 3HXAA 2PA8D 3A8JA 2JA8K 5M5WK 4OIOA 5JFEA 4QJVA 3GTGK 4A3IC 4A3JC 3BP8C 4GT9A 2XCRB 1J98A 3GEEA 4YG2A 2PMZD 1XZPA 3TFJA 1BS2A 1F9NA 2RGRA 4O2DA 3QX3A 3H0GK 4LK0A 4YFNA 3OREA 2W7VA 2JA8C 1TWFK 2CFAB 1ZQ1C 2E2IK 3GTGC 5M3FK 2P5MA 3SZYA 2GSOA 5JVOA 3AQPA 2B63A 3H0GC 1F93A 1Y1VA 4AYBL 4FM9A 5C44K 1TWFC 1TWGK 3LAJA 2E2IC 4GTCA 2NVQK 2VUMA 1IL2A 2WAQD 1X31C 5TJ3A 4M1XA 1WQFA 2XCQA 4LQYA 1O29A 3GTQA 4NOIA 2NVXK 3FKIC 5C44C 4GTAA 1TWGC 4GTLA 4KB4A 5C4XK 1C0AA 3HOXK 2NVQC 5IOTA 1JVIA 3GIRA 3K7AK 1R9TA 2NVXC 3CQZK 3GTPA 1J6WA 5C4XC 5IP7K 3HOXC 4QIWL 4BKWA 5TMFA 1TWHK 4GFQA 5D4DA 3K7AC 1WCMK 5IP9C 1L0WA 3T01A 3M4OK 4WJ4A 5IYDK 3CQZC 3IPJA 3RZOC 1EI6A 4YFXA 3ERED 5IP7C 2PHCB 1TWHC 1VJEA 3I4MK 1TWAA 3GTLK 3M4OC 1WCMC 3MMLB 3GTJA 1EQRA 1TWCK 4A3BK 5IYDC 1JOEA 4P5AA 4KDDA 4OIQA 4LK1A 2JA7K 3S16K 5HL8A 1K83A 1VRQC 4G0VA 1I3QK 1IBAA 2R93A 3I4MC 3GTLC 1O2FB 1EK8A 1TWCC 4OIPA 4A3BC 2E2HA 2V6SA 2JH3A 4A3CK 1ISEA 2JA7C 3S16C 4GTDA 1SMYA 2A69A 1I3QC 1O27A 5C4JK 4P9SA 1PJ5A 2JA6K 1ZBSA 2XCOA 3GTMK 4A3CC 3S1QK 1G51A 3V4GA 2FQOA 1O24A 2GAGC 3EQLA 3GTKA 5E68A 2GSNA 5C4JC 1XZQB 2YU9K 4A3GK 4MEYA 3SZZA 1KQ4A 5IOSA 3GTMC 3S1QC 5TMCA 3FHZA 2RH6A 2GSUA 4GTBA 4LOWA 2YU9C 4A3GC 3S0XA 5C3EK 1EFWA 3L4KA 1AB4A 1JQWA 1INNA 2ZFZA 1SFOA 2WB1D 3A8KA 3FOEA 2BE5A 4G0UA 5IYBK 5C3EC 4KASA 3HKZD 2B63K 3FKIK 4MQ9A 4A93K 1Y1VK 3HOUK 5CJ9A 1EH1A 3H0GA 4BXXK 2A6HA 4KM8A 2O5JA 1TWFA 2P8TA 3S2DK 1IE0A 4KB2A 2PPBA 1WOSA 1GE9A 5IYBC 1WORA 3GEHA 3S2HK 1O2AA 2B63C 3GTQK 3S17C 4ILDA 4KMHA 4A93C 1Y1VC 3N0BA 5M3MK 3HOUC 1J6VA 1I50K 3S17K 3RZOK 4BXXC 3I4NK 2GAHC 3S2DC 1YCLA 1B4AA 4A3FK 4C3IK 5IP9K 1VH2A 2NVYA 3H3VL 3S2HC 3GTQC 3OEPA 1R9TK 1PJ6A 4GZYA 1VLOA 3GTPK 5M5YK 2NVXA 1BJTA 4LR2A 4BLAA 3GTOK 1USOA
chains in the Genus database with same CATH topology
1Y1WA 3FOFA 1O2BA 1K83A 1BGWA 2E2IA 4KMDA 4KATA 4DDQA 4G0VA 4G0WA 2R93A 4C3IC 3BUEA 2YU9A 5IOQA 4C3HC 1EK8A 2E2HA 2CFAA 4KC6A 2JH3A 3FKIA 3N0CA 5CHPA 4KM9A 1ISEA 1TWGA 1ZVUA 3VA7A 4GTDA 5JFEA 2Y3PA 1O27A 1XXCA 4GT9A 2XCRB 2R7ZA 4GTFA 1DD5A 1ZBSA 1F9NA 2RGRA 3QX3A 2XCOA 4P5BA 1WQGA 3OREA 1O28A 3V4GA 2CFAB 1I50A 3NUHA 1O24A 3GTKA 1WIHA 2P5MA 2GSNA 3AH5A 1XXAA 2GSOA 5JVOA 3AQPA 2B63A 1KQ4A 5IOSA 3GTLA 3Q3QA 1TWCA 3CQZA 1Y1VA 1O26A 4FM9A 1WQHA 4KARA 4KAWX 3LAJA 3FHZA 2RH6A 3GTOA 2R92A 1IS1A 4GTCA 2VUMA 1TWHA 2GSUA 4GTBA 1ZXOA 5TJ3A 4M1XA 2XCQA 1WQFA 4LQYA 3S0XA 3L4KA 1AB4A 1O29A 1WCMA 3OPFA 3GTQA 2ZFZA 4FZBA 5EGEA 4GTAA 1SFOA 4GTLA 4KB4A 1XXBA 4C2MC 3FOEA 2JA5A 5IOTA 4G0UA 1B4BA 4KASA 5EGHA 1R9TA 2JA6A 1O25A 3GTPA 5CJ9A 1EH1A 3H0GA 3N3YA 2JA7A 3CAGA 4KM8A 1TWFA 3G4AA 4KB2A 4BKWA 4J3NA 1GE9A 4GFQA 1I3QA 3AQOA 3L4JA 1O2AA 4ILDA 4KMHA 3G4CA 3N0BA 4KMAA 3ERED 2PHCB 1B4AA 3LPXA 4C3JC 2KWAA 3GTGA 5IORA 1TWAA 2NVYA 3MMLB 3OEPA 3GTJA 4GTEA 3LAPA 3GTMA 2NVXA 4P5AA 1BJTA 4KDDA 4LR2A 4BLBA 4BLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2B A;  1O29 A;  4P5B A;  1O28 A;  4KAT A;  4FZB A;  2CFA B;  1O2A A;  1O24 A;  4GTA A;  4GTL A;  3AH5 A;  3G4C A;  3N0B A;  5IOQ A;  2CFA A;  5IOT A;  3N0C A;  5CHP A;  1KQ4 A;  5IOS A;  4KAS A;  1O26 A;  4GTD A;  5IOR A;  5JFE A;  4KAR A;  1O25 A;  1O27 A;  4GT9 A;  4GTE A;  4GTF A;  3N3Y A;  4GTC A;  4GTB A;  4P5A A;  3G4A A; 
#chains in the Genus database with same CATH topology
 1Y1W A;  3I4N C;  3FOF A;  1O2B A;  3HOY C;  1BGW A;  4AH6 A;  4KAT A;  4Y7N K;  4A3F C;  1I50 C;  4C3I C;  5IOQ A;  1R9T C;  2D6F C;  2CFA A;  4Y52 K;  3GTP C;  4KC6 A;  1ZYR A;  4A3K K;  1BDF A;  5CHP A;  4KM9 A;  3GTO C;  1HQM A;  4G7Z A;  3VA7 A;  2Y3P A;  4Y7N C;  3M3Y K;  1I6V A;  1XXC A;  2PA8 L;  2R7Z A;  1TWA K;  4GTF A;  1DD5 A;  3GTJ K;  1UV7 A;  4Y52 C;  4A3K C;  2Y0S L;  3S1N K;  2EBB A;  2PMZ L;  4X6A K;  1WIH A;  4AYB D;  3M3Y C;  4BY7 K;  3GEI A;  2R93 K;  1XXA A;  1TWA C;  1PJ7 A;  3GTJ C;  2E2H K;  3GTL A;  3S1R K;  1TWC A;  2ZUF A;  3S1N C;  5IYC K;  1XZP B;  3TFI A;  1WQH A;  3TTG A;  3JST A;  4X6A C;  4MEX A;  2R92 A;  1IS1 A;  4BY7 C;  2R93 C;  4XLN A;  3BP3 A;  3OPF A;  2E2H C;  3S1R C;  4OIN A;  4FZB A;  5IYC C;  4KN4 A;  5EGE A;  2WAQ L;  4BBR K;  1XXB A;  3H3V D;  3TFH A;  3GTK K;  2JA5 A;  3RZD K;  1B4B A;  1YNN A;  4ZH4 A;  4G7O A;  5EGH A;  3AD7 C;  4QIW D;  2JA6 A;  4BY1 K;  3N3Y A;  1WOP A;  4BBR C;  4WJ3 M;  3GTK C;  4C3J K;  4J3N A;  1DCP A;  3RZD C;  2O5I A;  3AQO A;  3L4J A;  3A8I A;  3AD8 C;  1V5V A;  4RMF A;  1DCO A;  4KMA A;  4YFK A;  4A3E K;  4BY1 C;  3HOZ K;  4A3M K;  1SFO K;  4LJZ A;  3HOW K;  3PO2 K;  4C3J C;  3GTG A;  2Y0S D;  3GDZ A;  1IQ0 A;  1WSV A;  4A3E C;  3HOZ C;  4A3M C;  1SFO C;  3HOW C;  1IW7 A;  1WSR A;  3PO2 C;  2VUM K;  2E2I A;  4PAA A;  4DDQ A;  5L46 A;  4G0W A;  3BUE A;  2CW0 A;  3T00 A;  4KN7 A;  3S15 K;  1J6X A;  3FKI A;  3N0C A;  2FQT A;  1DCH A;  3HOY K;  3HOV K;  1TWG A;  1XZQ A;  3ADA C;  1ZVU A;  2VUM C;  5M5X K;  2NVY K;  1USM A;  3S15 C;  4P5B A;  1WQG A;  5FJ8 K;  1O28 A;  3HOV C;  1Y1W K;  2E2J K;  1I50 A;  3NUH A;  3AH5 A;  1HI9 A;  4WIL A;  2NVY C;  4C45 A;  3Q3Q A;  3CQZ A;  1O26 A;  4BBS K;  3S14 K;  3AD9 C;  4KAR A;  1Y1W C;  2E2J C;  4KAW X;  3PO3 K;  4C2M K;  3GTO A;  3DXJ A;  3T02 A;  4A3L K;  1I6H K;  2A68 A;  1TWH A;  1ZXO A;  2R7Z K;  1WCM A;  1F7U A;  1XPP A;  4BBS C;  3S14 C;  1K83 K;  3PO3 C;  4C2M C;  1I6H C;  1YNJ A;  2NVT K;  4A3L C;  1WOO A;  3GSI A;  4QJV B;  2R7Z C;  4G7H A;  2WB1 L;  4Q5S A;  1YX2 A;  4A3D K;  3WOD A;  1O25 A;  4XCH A;  4XLP A;  4PAB A;  4LLG A;  1K83 C;  1F7V A;  2JA7 A;  3HKZ L;  3CAG A;  2NVT C;  3G4A A;  5FLM K;  2R92 K;  4XSZ A;  1I3Q A;  4XSX A;  4A3D C;  2V6T A;  3G4C A;  3S1M K;  4JK1 A;  4KMU A;  2V6U A;  5FLM C;  2R92 C;  3LPX A;  2KWA A;  2JA5 K;  5IOR A;  4C3H K;  4GTE A;  3LAP A;  3GTM A;  3S1M C;  4BLB A;  4Q4Z A;  2A6E A;  1RU0 A;  4KMD A;  2JA5 C;  2ZUE A;  4OIR A;  4A3I K;  4A3J K;  1VGX A;  2YU9 A;  4C3H C;  2JA6 C;  3HXA A;  2PA8 D;  3A8J A;  2JA8 K;  5M5W K;  4OIO A;  5JFE A;  4QJV A;  3GTG K;  4A3I C;  4A3J C;  3BP8 C;  4GT9 A;  2XCR B;  1J98 A;  3GEE A;  4YG2 A;  2PMZ D;  1XZP A;  3TFJ A;  1BS2 A;  1F9N A;  2RGR A;  4O2D A;  3QX3 A;  3H0G K;  4LK0 A;  4YFN A;  3ORE A;  2W7V A;  2JA8 C;  1TWF K;  2CFA B;  1ZQ1 C;  2E2I K;  3GTG C;  5M3F K;  2P5M A;  3SZY A;  2GSO A;  5JVO A;  3AQP A;  2B63 A;  3H0G C;  1F93 A;  1Y1V A;  4AYB L;  4FM9 A;  5C44 K;  1TWF C;  1TWG K;  3LAJ A;  2E2I C;  4GTC A;  2NVQ K;  2VUM A;  1IL2 A;  2WAQ D;  1X31 C;  5TJ3 A;  4M1X A;  1WQF A;  2XCQ A;  4LQY A;  1O29 A;  3GTQ A;  4NOI A;  2NVX K;  3FKI C;  5C44 C;  4GTA A;  1TWG C;  4GTL A;  4KB4 A;  5C4X K;  1C0A A;  3HOX K;  2NVQ C;  5IOT A;  1JVI A;  3GIR A;  3K7A K;  1R9T A;  2NVX C;  3CQZ K;  3GTP A;  1J6W A;  5C4X C;  5IP7 K;  3HOX C;  4QIW L;  4BKW A;  5TMF A;  1TWH K;  4GFQ A;  5D4D A;  3K7A C;  1WCM K;  5IP9 C;  1L0W A;  3T01 A;  3M4O K;  4WJ4 A;  5IYD K;  3CQZ C;  3IPJ A;  3RZO C;  1EI6 A;  4YFX A;  3ERE D;  5IP7 C;  2PHC B;  1TWH C;  1VJE A;  3I4M K;  1TWA A;  3GTL K;  3M4O C;  1WCM C;  3MML B;  3GTJ A;  1EQR A;  1TWC K;  4A3B K;  5IYD C;  1JOE A;  4P5A A;  4KDD A;  4OIQ A;  4LK1 A;  2JA7 K;  3S16 K;  5HL8 A;  1K83 A;  1VRQ C;  4G0V A;  1I3Q K;  1IBA A;  2R93 A;  3I4M C;  3GTL C;  1O2F B;  1EK8 A;  1TWC C;  4OIP A;  4A3B C;  2E2H A;  2V6S A;  2JH3 A;  4A3C K;  1ISE A;  2JA7 C;  3S16 C;  4GTD A;  1SMY A;  2A69 A;  1I3Q C;  1O27 A;  5C4J K;  4P9S A;  1PJ5 A;  2JA6 K;  1ZBS A;  2XCO A;  3GTM K;  4A3C C;  3S1Q K;  1G51 A;  3V4G A;  2FQO A;  1O24 A;  2GAG C;  3EQL A;  3GTK A;  5E68 A;  2GSN A;  5C4J C;  1XZQ B;  2YU9 K;  4A3G K;  4MEY A;  3SZZ A;  1KQ4 A;  5IOS A;  3GTM C;  3S1Q C;  5TMC A;  3FHZ A;  2RH6 A;  2GSU A;  4GTB A;  4LOW A;  2YU9 C;  4A3G C;  3S0X A;  5C3E K;  1EFW A;  3L4K A;  1AB4 A;  1JQW A;  1INN A;  2ZFZ A;  1SFO A;  2WB1 D;  3A8K A;  3FOE A;  2BE5 A;  4G0U A;  5IYB K;  5C3E C;  4KAS A;  3HKZ D;  2B63 K;  3FKI K;  4MQ9 A;  4A93 K;  1Y1V K;  3HOU K;  5CJ9 A;  1EH1 A;  3H0G A;  4BXX K;  2A6H A;  4KM8 A;  2O5J A;  1TWF A;  2P8T A;  3S2D K;  1IE0 A;  4KB2 A;  2PPB A;  1WOS A;  1GE9 A;  5IYB C;  1WOR A;  3GEH A;  3S2H K;  1O2A A;  2B63 C;  3GTQ K;  3S17 C;  4ILD A;  4KMH A;  4A93 C;  1Y1V C;  3N0B A;  5M3M K;  3HOU C;  1J6V A;  1I50 K;  3S17 K;  3RZO K;  4BXX C;  3I4N K;  2GAH C;  3S2D C;  1YCL A;  1B4A A;  4A3F K;  4C3I K;  5IP9 K;  1VH2 A;  2NVY A;  3H3V L;  3S2H C;  3GTQ C;  3OEP A;  1R9T K;  1PJ6 A;  4GZY A;  1VLO A;  3GTP K;  5M5Y K;  2NVX A;  1BJT A;  4LR2 A;  4BLA A;  3GTO K;  1USO A; 
#chains in the Genus database with same CATH homology
 1Y1W A;  3FOF A;  1O2B A;  1K83 A;  1BGW A;  2E2I A;  4KMD A;  4KAT A;  4DDQ A;  4G0V A;  4G0W A;  2R93 A;  4C3I C;  3BUE A;  2YU9 A;  5IOQ A;  4C3H C;  1EK8 A;  2E2H A;  2CFA A;  4KC6 A;  2JH3 A;  3FKI A;  3N0C A;  5CHP A;  4KM9 A;  1ISE A;  1TWG A;  1ZVU A;  3VA7 A;  4GTD A;  5JFE A;  2Y3P A;  1O27 A;  1XXC A;  4GT9 A;  2XCR B;  2R7Z A;  4GTF A;  1DD5 A;  1ZBS A;  1F9N A;  2RGR A;  3QX3 A;  2XCO A;  4P5B A;  1WQG A;  3ORE A;  1O28 A;  3V4G A;  2CFA B;  1I50 A;  3NUH A;  1O24 A;  3GTK A;  1WIH A;  2P5M A;  2GSN A;  3AH5 A;  1XXA A;  2GSO A;  5JVO A;  3AQP A;  2B63 A;  1KQ4 A;  5IOS A;  3GTL A;  3Q3Q A;  1TWC A;  3CQZ A;  1Y1V A;  1O26 A;  4FM9 A;  1WQH A;  4KAR A;  4KAW X;  3LAJ A;  3FHZ A;  2RH6 A;  3GTO A;  2R92 A;  1IS1 A;  4GTC A;  2VUM A;  1TWH A;  2GSU A;  4GTB A;  1ZXO A;  5TJ3 A;  4M1X A;  2XCQ A;  1WQF A;  4LQY A;  3S0X A;  3L4K A;  1AB4 A;  1O29 A;  1WCM A;  3OPF A;  3GTQ A;  2ZFZ A;  4FZB A;  5EGE A;  4GTA A;  1SFO A;  4GTL A;  4KB4 A;  1XXB A;  4C2M C;  3FOE A;  2JA5 A;  5IOT A;  4G0U A;  1B4B A;  4KAS A;  5EGH A;  1R9T A;  2JA6 A;  1O25 A;  3GTP A;  5CJ9 A;  1EH1 A;  3H0G A;  3N3Y A;  2JA7 A;  3CAG A;  4KM8 A;  1TWF A;  3G4A A;  4KB2 A;  4BKW A;  4J3N A;  1GE9 A;  4GFQ A;  1I3Q A;  3AQO A;  3L4J A;  1O2A A;  4ILD A;  4KMH A;  3G4C A;  3N0B A;  4KMA A;  3ERE D;  2PHC B;  1B4A A;  3LPX A;  4C3J C;  2KWA A;  3GTG A;  5IOR A;  1TWA A;  2NVY A;  3MML B;  3OEP A;  3GTJ A;  4GTE A;  3LAP A;  3GTM A;  2NVX A;  4P5A A;  1BJT A;  4KDD A;  4LR2 A;  4BLB A;  4BLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...