1O2AA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad at 1.8 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
211
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 78
structure length 211
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2aA00
4KARA 4GTEA 2CFAB 3G4AA 4GTBA 1KQ4A 3AH5A 1O26A 4GTAA 1O27A 5IOQA 5IOSA 4P5BA 3G4CA 4P5AA 4KATA 1O25A 1O29A 3N0CA 4KASA 5CHPA 4GTLA 1O2AA 1O28A 1O2BA 2CFAA 3N3YA 1O24A 4FZBA 4GTFA 4GT9A 3N0BA 5JFEA 4GTDA 4GTCA 5IORA 5IOTA
chains in the Genus database with same CATH superfamily
5FJ8K 1TWAK 4LK0A 3T02A 1I50C 2PPBA 2A6HA 4KM8A 5IYDC 3GTJA 4KDDA 4XCHA 1I6VA 3H0GA 4KATA 1JOEA 5IP7C 4XLPA 3GTKK 1I6HC 3HOWK 1DCHA 3H3VL 1XXBA 4LQYA 4GT9A 3WODA 4XSZA 1WCMK 1WSVA 3PO2C 5EGHA 3Q3QA 3GTKA 4J3NA 3IPJA 4A3LK 2E2JC 2NVYC 3CQZK 3HOYK 4BBSC 5IYCC 4KMUA 4A3EC 2R93A 2GSOA 4KMDA 4QIWL 2E2IK 4C45A 1XZPA 1VJEA 1ZYRA 1O25A 3BP3A 4KASA 4C2MK 1Y1VA 1J98A 4GTLA 4C3JK 4LR2A 4BXXC 1X31C 1YCLA 1EH1A 1DCPA 3GTMK 5IP9C 3S17C 1WQHA 3GTPK 4Y7NC 1R9TK 2FQOA 1WCMC 2CW0A 5HL8A 2VUMC 2YU9K 1TWGC 3M3YK 3S1QC 2PA8L 4A3FC 3DXJA 3GTMA 1O27A 1TWHA 3ERED 1EFWA 3S16C 3I4NC 4A3MC 3SZZA 1F7UA 1PJ7A 4A3CC 1RU0A 1K83K 5M5XK 2JA7K 3HOXK 4YG2A 5TMCA 4Y52C 3T00A 1SMYA 1F7VA 2R92C 3GTGC 1GE9A 2JA6C 3S14K 4A3DC 2E2HC 3GTOC 4A3BK 1YNJA 1IE0A 2XCQA 2RGRA 3M3YC 1VRQC 5IOQA 3HOZC 4KB2A 3H3VD 4A3JC 4BY1K 4WJ3M 2P5MA 4KMHA 1J6WA 3LPXA 1L0WA 4KN7A 3HOUK 3FKIA 3L4KA 2B63A 3S2DC 2NVXA 4WJ4A 1XXAA 3M4OC 3K7AK 3LAPA 3AD8C 1YX2A 2R7ZA 4QIWD 1F9NA 1C0AA 3G4AA 1O26A 1TWFA 3OPFA 2GAGC 4RMFA 1J6VA 1WORA 3S2HC 4LLGA 4O2DA 2CFAA 3S1MK 1UV7A 4GTFA 5C4JC 2A69A 1JVIA 3TFHA 3S15K 4LOWA 2PA8D 5IYBK 1BDFA 3GTJK 1G51A 1Y1WC 1F93A 3H0GK 4KARA 4MEXA 4ILDA 2NVTK 4XSXA 2WAQL 4A93K 3N0CA 1I50A 3PO3C 4A3KK 3BUEA 2W7VA 3CAGA 1O24A 2PMZL 4C3HK 2R93K 2JA5C 3S1NK 3SZYA 1IL2A 5C4XK 3AD9C 1SFOC 1EI6A 4G0VA 1VLOA 4OIRA 1Y1VK 1JQWA 3GTLC 3A8KA 2NVTC 1TWAC 2GSNA 1PJ6A 3GDZA 3GTKC 4A3IK 3A8JA 3HOWC 4X6AK 4GFQA 3TFIA 2WB1L 5M5WK 1TWHK 4GTCA 5IORA 5IOTA 2R93C 4ZH4A 4A3LC 3OREA 3CQZC 3TTGA 3HOYC 2VUMA 5IOSA 1TWGA 1ZVUA 4AH6A 4Q4ZA 2E2IC 4AYBL 4BLAA 2RH6A 1HQMA 1O28A 4C2MC 3LAJA 4C3JC 3N0BA 4G7ZA 3I4MK 5C3EK 1XZPB 3GTQA 3GTMC 3GTPC 1R9TC 2WAQD 2R92A 1I3QA 2JA8K 3GTGA 3TFJA 4BBRK 3V4GA 2YU9C 3S1RK 2JA6A 1KQ4A 4GTAA 2O5IA 4QJVB 1EQRA 3GTOA 2E2HA 4PAAA 2V6TA 3FKIK 3A8IA 2B63K 3RZOK 5CHPA 1VH2A 1B4BA 2NVXK 2PMZD 2R7ZK 1O2BA 4A3GK 2JH3A 1K83C 3NUHA 2JA7C 3HOXC 1V5VA 2PHCB 1TWFK 1XZQB 3FOFA 2NVQK 5E68A 1IW7A 4BY7K 3AQPA 4MEYA 2GSUA 3S14C 2Y3PA 4WILA 4A3BC 2P8TA 5FLMK 4P5BA 1O2FB 3FKIC 3HOVK 1WQGA 4MQ9A 4XLNA 4C3IK 4BY1C 2WB1D 2R7ZC 1AB4A 4LK1A 2D6FC 4G7OA 1J6XA 3HOUC 1ZBSA 1TWFC 4KB4A 4YFKA 3K7AC 1I50K 1TWCA 4KN4A 5IYDK 1Y1WA 3AH5A 3S0XA 3OEPA 4AYBD 5IP7K 1VGXA 4G7HA 5FLMC 2Y0SL 1I6HK 1IS1A 3ADAC 2GAHC 4OIQA 3HOVC 1WOOA 3RZDK 3QX3A 4OIPA 3PO2K 1BS2A 3S1MC 2E2JK 4P9SA 2NVYK 3S15C 4BBSK 5IYCK 1HI9A 5IYBC 3GTJC 4A3EK 2JA5A 2CFAB 3H0GC 5CJ9A 1SFOA 2NVYA 3HKZD 1ISEA 4A93C 2ZUFA 3GTLA 1TWAA 4BXXK 1USMA 1EK8A 3MMLB 4A3KC 5IP9K 3S17K 3N3YA 4KMAA 4Y7NK 1WQFA 2BE5A 3RZDC 2VUMK 1TWGK 4YFNA 3S1QK 4C3HC 4A3FK 3S1NC 5C4XC 5M3FK 3S16K 3GEHA 3I4NK 1WCMA 1WSRA 4A3MK 1Y1VC 3GSIA 1YNNA 4A3CK 3CQZA 5EGEA 3GTQK 4Y52K 2E2IA 2R92K 1I3QK 1XXCA 4QJVA 3GTGK 4A3IC 2JA6K 4X6AC 4A3DK 2A68A 2E2HK 3GTOK 2ZUEA 3FOEA 5C44K 1TWHC 5TMFA 1ZXOA 4JK1A 3EQLA 4KC6A 2Y0SD 4GTBA 3GTPA 4FM9A 2ZFZA 1R9TA 1WOPA 3HOZK 1XZQA 3G4CA 4A3JK 2YU9A 4Q5SA 3HKZL 1DCOA 3GTQC 3GEIA 1WOSA 1O2AA 4M1XA 4PABA 2KWAA 1USOA 1I3QC 3T01A 3M4OK 4OIOA 3S2DK 4GZYA 5JFEA 4YFXA 3I4MC 5C3EC 1K83A 1B4AA 4DDQA 1XPPA 2JA7A 5C44C 2A6EA 1WIHA 5TJ3A 3L4JA 2JA8C 5L46A 4BBRC 2V6UA 3S1RC 2V6SA 4OINA 3AQOA 3S2HK 4NOIA 1IBAA 3JSTA 2B63C 5C4JK 1PJ5A 3RZOC 2NVXC 2O5JA 1TWCK 1Y1WK 4A3GC 5M3MK 2EBBA 5D4DA 4GTDA 4KAWX 3AD7C 1BGWA 1INNA 4KM9A 4G0WA 2NVQC 4BKWA 4GTEA 3BP8C 3GEEA 4BY7C 4LJZA 3HXAA 3FHZA 4P5AA 3PO3K 1O29A 1BJTA 3GIRA 1IQ0A 4BLBA 2XCOA 4G0UA 4FZBA 2JA5K 4C3IC 1ZQ1C 3VA7A 1TWCC 5M5YK 1SFOK 2XCRB 1DD5A 2FQTA 5JVOA 3GTLK
chains in the Genus database with same CATH topology
3V4GA 3G4AA 1I3QA 1KQ4A 1WCMA 1O26A 1TWFA 4GTAA 2JA6A 3OPFA 4KM8A 3GTJA 3GTOA 4KDDA 2E2HA 3CQZA 3H0GA 4KATA 5EGEA 5CHPA 1B4BA 2E2IA 1O2BA 1XXBA 2CFAA 2JH3A 4LQYA 1XXCA 3NUHA 4GTFA 4GT9A 2PHCB 3FOFA 5EGHA 3Q3QA 3GTKA 4J3NA 3FOEA 3AQPA 1ZXOA 2GSUA 2Y3PA 4KARA 4ILDA 4KC6A 4GTBA 3GTPA 2R93A 2GSOA 4FM9A 2ZFZA 1R9TA 4KMDA 4P5BA 3G4CA 2YU9A 1O25A 3N0CA 1I50A 4KASA 1WQGA 1Y1VA 3BUEA 4GTLA 1O2AA 4LR2A 1AB4A 4M1XA 3CAGA 1O24A 2KWAA 1EH1A 1WQHA 5JFEA 1ZBSA 1K83A 1B4AA 4DDQA 4KB4A 2JA7A 4G0VA 1TWCA 1Y1WA 1WIHA 5TJ3A 3AH5A 3S0XA 3L4JA 3GTMA 3OEPA 1O27A 1TWHA 3ERED 2GSNA 3AQOA 1IS1A 3QX3A 4GFQA 1GE9A 4GTDA 4GTCA 5IORA 5IOTA 4KAWX 1BGWA 4KM9A 4G0WA 2JA5A 4BKWA 3OREA 4GTEA 2CFAB 2RGRA 2XCQA 5CJ9A 2VUMA 1SFOA 5IOQA 2NVYA 1TWGA 5IOSA 3FHZA 1ISEA 1ZVUA 4P5AA 4KB2A 1O29A 3GTLA 4BLAA 1BJTA 1TWAA 2P5MA 2RH6A 4KMHA 1EK8A 3MMLB 3LPXA 1O28A 4C2MC 4BLBA 3N3YA 2XCOA 4KMAA 4FZBA 1WQFA 4C3JC 3N0BA 3LAJA 4G0UA 3FKIA 4C3IC 3L4KA 2B63A 3VA7A 3GTQA 2NVXA 1XXAA 2XCRB 3LAPA 4C3HC 2R7ZA 1DD5A 5JVOA 2R92A 1F9NA 3GTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAR A;  4GTE A;  2CFA B;  3G4A A;  4GTB A;  1KQ4 A;  3AH5 A;  1O26 A;  4GTA A;  1O27 A;  5IOQ A;  5IOS A;  4P5B A;  3G4C A;  4P5A A;  4KAT A;  1O25 A;  1O29 A;  3N0C A;  4KAS A;  5CHP A;  4GTL A;  1O2A A;  1O28 A;  1O2B A;  2CFA A;  3N3Y A;  1O24 A;  4FZB A;  4GTF A;  4GT9 A;  3N0B A;  5JFE A;  4GTD A;  4GTC A;  5IOR A;  5IOT A; 
#chains in the Genus database with same CATH topology
 5FJ8 K;  1TWA K;  4LK0 A;  3T02 A;  1I50 C;  2PPB A;  2A6H A;  4KM8 A;  5IYD C;  3GTJ A;  4KDD A;  4XCH A;  1I6V A;  3H0G A;  4KAT A;  1JOE A;  5IP7 C;  4XLP A;  3GTK K;  1I6H C;  3HOW K;  1DCH A;  3H3V L;  1XXB A;  4LQY A;  4GT9 A;  3WOD A;  4XSZ A;  1WCM K;  1WSV A;  3PO2 C;  5EGH A;  3Q3Q A;  3GTK A;  4J3N A;  3IPJ A;  4A3L K;  2E2J C;  2NVY C;  3CQZ K;  3HOY K;  4BBS C;  5IYC C;  4KMU A;  4A3E C;  2R93 A;  2GSO A;  4KMD A;  4QIW L;  2E2I K;  4C45 A;  1XZP A;  1VJE A;  1ZYR A;  1O25 A;  3BP3 A;  4KAS A;  4C2M K;  1Y1V A;  1J98 A;  4GTL A;  4C3J K;  4LR2 A;  4BXX C;  1X31 C;  1YCL A;  1EH1 A;  1DCP A;  3GTM K;  5IP9 C;  3S17 C;  1WQH A;  3GTP K;  4Y7N C;  1R9T K;  2FQO A;  1WCM C;  2CW0 A;  5HL8 A;  2VUM C;  2YU9 K;  1TWG C;  3M3Y K;  3S1Q C;  2PA8 L;  4A3F C;  3DXJ A;  3GTM A;  1O27 A;  1TWH A;  3ERE D;  1EFW A;  3S16 C;  3I4N C;  4A3M C;  3SZZ A;  1F7U A;  1PJ7 A;  4A3C C;  1RU0 A;  1K83 K;  5M5X K;  2JA7 K;  3HOX K;  4YG2 A;  5TMC A;  4Y52 C;  3T00 A;  1SMY A;  1F7V A;  2R92 C;  3GTG C;  1GE9 A;  2JA6 C;  3S14 K;  4A3D C;  2E2H C;  3GTO C;  4A3B K;  1YNJ A;  1IE0 A;  2XCQ A;  2RGR A;  3M3Y C;  1VRQ C;  5IOQ A;  3HOZ C;  4KB2 A;  3H3V D;  4A3J C;  4BY1 K;  4WJ3 M;  2P5M A;  4KMH A;  1J6W A;  3LPX A;  1L0W A;  4KN7 A;  3HOU K;  3FKI A;  3L4K A;  2B63 A;  3S2D C;  2NVX A;  4WJ4 A;  1XXA A;  3M4O C;  3K7A K;  3LAP A;  3AD8 C;  1YX2 A;  2R7Z A;  4QIW D;  1F9N A;  1C0A A;  3G4A A;  1O26 A;  1TWF A;  3OPF A;  2GAG C;  4RMF A;  1J6V A;  1WOR A;  3S2H C;  4LLG A;  4O2D A;  2CFA A;  3S1M K;  1UV7 A;  4GTF A;  5C4J C;  2A69 A;  1JVI A;  3TFH A;  3S15 K;  4LOW A;  2PA8 D;  5IYB K;  1BDF A;  3GTJ K;  1G51 A;  1Y1W C;  1F93 A;  3H0G K;  4KAR A;  4MEX A;  4ILD A;  2NVT K;  4XSX A;  2WAQ L;  4A93 K;  3N0C A;  1I50 A;  3PO3 C;  4A3K K;  3BUE A;  2W7V A;  3CAG A;  1O24 A;  2PMZ L;  4C3H K;  2R93 K;  2JA5 C;  3S1N K;  3SZY A;  1IL2 A;  5C4X K;  3AD9 C;  1SFO C;  1EI6 A;  4G0V A;  1VLO A;  4OIR A;  1Y1V K;  1JQW A;  3GTL C;  3A8K A;  2NVT C;  1TWA C;  2GSN A;  1PJ6 A;  3GDZ A;  3GTK C;  4A3I K;  3A8J A;  3HOW C;  4X6A K;  4GFQ A;  3TFI A;  2WB1 L;  5M5W K;  1TWH K;  4GTC A;  5IOR A;  5IOT A;  2R93 C;  4ZH4 A;  4A3L C;  3ORE A;  3CQZ C;  3TTG A;  3HOY C;  2VUM A;  5IOS A;  1TWG A;  1ZVU A;  4AH6 A;  4Q4Z A;  2E2I C;  4AYB L;  4BLA A;  2RH6 A;  1HQM A;  1O28 A;  4C2M C;  3LAJ A;  4C3J C;  3N0B A;  4G7Z A;  3I4M K;  5C3E K;  1XZP B;  3GTQ A;  3GTM C;  3GTP C;  1R9T C;  2WAQ D;  2R92 A;  1I3Q A;  2JA8 K;  3GTG A;  3TFJ A;  4BBR K;  3V4G A;  2YU9 C;  3S1R K;  2JA6 A;  1KQ4 A;  4GTA A;  2O5I A;  4QJV B;  1EQR A;  3GTO A;  2E2H A;  4PAA A;  2V6T A;  3FKI K;  3A8I A;  2B63 K;  3RZO K;  5CHP A;  1VH2 A;  1B4B A;  2NVX K;  2PMZ D;  2R7Z K;  1O2B A;  4A3G K;  2JH3 A;  1K83 C;  3NUH A;  2JA7 C;  3HOX C;  1V5V A;  2PHC B;  1TWF K;  1XZQ B;  3FOF A;  2NVQ K;  5E68 A;  1IW7 A;  4BY7 K;  3AQP A;  4MEY A;  2GSU A;  3S14 C;  2Y3P A;  4WIL A;  4A3B C;  2P8T A;  5FLM K;  4P5B A;  1O2F B;  3FKI C;  3HOV K;  1WQG A;  4MQ9 A;  4XLN A;  4C3I K;  4BY1 C;  2WB1 D;  2R7Z C;  1AB4 A;  4LK1 A;  2D6F C;  4G7O A;  1J6X A;  3HOU C;  1ZBS A;  1TWF C;  4KB4 A;  4YFK A;  3K7A C;  1I50 K;  1TWC A;  4KN4 A;  5IYD K;  1Y1W A;  3AH5 A;  3S0X A;  3OEP A;  4AYB D;  5IP7 K;  1VGX A;  4G7H A;  5FLM C;  2Y0S L;  1I6H K;  1IS1 A;  3ADA C;  2GAH C;  4OIQ A;  3HOV C;  1WOO A;  3RZD K;  3QX3 A;  4OIP A;  3PO2 K;  1BS2 A;  3S1M C;  2E2J K;  4P9S A;  2NVY K;  3S15 C;  4BBS K;  5IYC K;  1HI9 A;  5IYB C;  3GTJ C;  4A3E K;  2JA5 A;  2CFA B;  3H0G C;  5CJ9 A;  1SFO A;  2NVY A;  3HKZ D;  1ISE A;  4A93 C;  2ZUF A;  3GTL A;  1TWA A;  4BXX K;  1USM A;  1EK8 A;  3MML B;  4A3K C;  5IP9 K;  3S17 K;  3N3Y A;  4KMA A;  4Y7N K;  1WQF A;  2BE5 A;  3RZD C;  2VUM K;  1TWG K;  4YFN A;  3S1Q K;  4C3H C;  4A3F K;  3S1N C;  5C4X C;  5M3F K;  3S16 K;  3GEH A;  3I4N K;  1WCM A;  1WSR A;  4A3M K;  1Y1V C;  3GSI A;  1YNN A;  4A3C K;  3CQZ A;  5EGE A;  3GTQ K;  4Y52 K;  2E2I A;  2R92 K;  1I3Q K;  1XXC A;  4QJV A;  3GTG K;  4A3I C;  2JA6 K;  4X6A C;  4A3D K;  2A68 A;  2E2H K;  3GTO K;  2ZUE A;  3FOE A;  5C44 K;  1TWH C;  5TMF A;  1ZXO A;  4JK1 A;  3EQL A;  4KC6 A;  2Y0S D;  4GTB A;  3GTP A;  4FM9 A;  2ZFZ A;  1R9T A;  1WOP A;  3HOZ K;  1XZQ A;  3G4C A;  4A3J K;  2YU9 A;  4Q5S A;  3HKZ L;  1DCO A;  3GTQ C;  3GEI A;  1WOS A;  1O2A A;  4M1X A;  4PAB A;  2KWA A;  1USO A;  1I3Q C;  3T01 A;  3M4O K;  4OIO A;  3S2D K;  4GZY A;  5JFE A;  4YFX A;  3I4M C;  5C3E C;  1K83 A;  1B4A A;  4DDQ A;  1XPP A;  2JA7 A;  5C44 C;  2A6E A;  1WIH A;  5TJ3 A;  3L4J A;  2JA8 C;  5L46 A;  4BBR C;  2V6U A;  3S1R C;  2V6S A;  4OIN A;  3AQO A;  3S2H K;  4NOI A;  1IBA A;  3JST A;  2B63 C;  5C4J K;  1PJ5 A;  3RZO C;  2NVX C;  2O5J A;  1TWC K;  1Y1W K;  4A3G C;  5M3M K;  2EBB A;  5D4D A;  4GTD A;  4KAW X;  3AD7 C;  1BGW A;  1INN A;  4KM9 A;  4G0W A;  2NVQ C;  4BKW A;  4GTE A;  3BP8 C;  3GEE A;  4BY7 C;  4LJZ A;  3HXA A;  3FHZ A;  4P5A A;  3PO3 K;  1O29 A;  1BJT A;  3GIR A;  1IQ0 A;  4BLB A;  2XCO A;  4G0U A;  4FZB A;  2JA5 K;  4C3I C;  1ZQ1 C;  3VA7 A;  1TWC C;  5M5Y K;  1SFO K;  2XCR B;  1DD5 A;  2FQT A;  5JVO A;  3GTL K; 
#chains in the Genus database with same CATH homology
 3V4G A;  3G4A A;  1I3Q A;  1KQ4 A;  1WCM A;  1O26 A;  1TWF A;  4GTA A;  2JA6 A;  3OPF A;  4KM8 A;  3GTJ A;  3GTO A;  4KDD A;  2E2H A;  3CQZ A;  3H0G A;  4KAT A;  5EGE A;  5CHP A;  1B4B A;  2E2I A;  1O2B A;  1XXB A;  2CFA A;  2JH3 A;  4LQY A;  1XXC A;  3NUH A;  4GTF A;  4GT9 A;  2PHC B;  3FOF A;  5EGH A;  3Q3Q A;  3GTK A;  4J3N A;  3FOE A;  3AQP A;  1ZXO A;  2GSU A;  2Y3P A;  4KAR A;  4ILD A;  4KC6 A;  4GTB A;  3GTP A;  2R93 A;  2GSO A;  4FM9 A;  2ZFZ A;  1R9T A;  4KMD A;  4P5B A;  3G4C A;  2YU9 A;  1O25 A;  3N0C A;  1I50 A;  4KAS A;  1WQG A;  1Y1V A;  3BUE A;  4GTL A;  1O2A A;  4LR2 A;  1AB4 A;  4M1X A;  3CAG A;  1O24 A;  2KWA A;  1EH1 A;  1WQH A;  5JFE A;  1ZBS A;  1K83 A;  1B4A A;  4DDQ A;  4KB4 A;  2JA7 A;  4G0V A;  1TWC A;  1Y1W A;  1WIH A;  5TJ3 A;  3AH5 A;  3S0X A;  3L4J A;  3GTM A;  3OEP A;  1O27 A;  1TWH A;  3ERE D;  2GSN A;  3AQO A;  1IS1 A;  3QX3 A;  4GFQ A;  1GE9 A;  4GTD A;  4GTC A;  5IOR A;  5IOT A;  4KAW X;  1BGW A;  4KM9 A;  4G0W A;  2JA5 A;  4BKW A;  3ORE A;  4GTE A;  2CFA B;  2RGR A;  2XCQ A;  5CJ9 A;  2VUM A;  1SFO A;  5IOQ A;  2NVY A;  1TWG A;  5IOS A;  3FHZ A;  1ISE A;  1ZVU A;  4P5A A;  4KB2 A;  1O29 A;  3GTL A;  4BLA A;  1BJT A;  1TWA A;  2P5M A;  2RH6 A;  4KMH A;  1EK8 A;  3MML B;  3LPX A;  1O28 A;  4C2M C;  4BLB A;  3N3Y A;  2XCO A;  4KMA A;  4FZB A;  1WQF A;  4C3J C;  3N0B A;  3LAJ A;  4G0U A;  3FKI A;  4C3I C;  3L4K A;  2B63 A;  3VA7 A;  3GTQ A;  2NVX A;  1XXA A;  2XCR B;  3LAP A;  4C3H C;  2R7Z A;  1DD5 A;  5JVO A;  2R92 A;  1F9N A;  3GTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...