1O2AA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad at 1.8 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
211
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 78
structure length 211
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2aA00
1O2BA 1O25A 5IOQA 5CHPA 4P5AA 3N0BA 5IOTA 1O29A 4GTAA 4GTCA 1O27A 1O2AA 4GTLA 2CFAA 4GTDA 4KARA 3N0CA 5JFEA 1O24A 1O26A 4P5BA 4KATA 3N3YA 4GTEA 2CFAB 4FZBA 3G4AA 5IOSA 3G4CA 4GTBA 1O28A 1KQ4A 3AH5A 4GT9A 4GTFA 4KASA 5IORA
chains in the Genus database with same CATH superfamily
1WCMC 4A93K 3FOFA 5C44C 4BLBA 2V6SA 2NVQK 2YU9A 1DD5A 3Q3QA 3H0GA 3HOVC 4XSXA 3AD9C 2D6FC 1IQ0A 3S1MC 4A3MC 3S0XA 3CAGA 3IPJA 4LK1A 2VUMA 1IL2A 1K83A 3PO2C 2JA8C 3GTKA 3AD8C 3FKIK 5C3EK 2ZUEA 3M4OC 2B63K 2WB1L 1O29A 1Y1VA 4GZYA 1L0WA 5M5XK 1USMA 4C45A 4A3LC 5TMFA 1BDFA 1TWFA 2Y3PA 3GTOC 4BY7K 2GSOA 4QIWL 3N0CA 1DCOA 4A3FK 4GTEA 3S1QK 4WILA 1O28A 3CQZC 4KC6A 2A68A 1ZYRA 1X31C 2XCRB 3HOZK 4Y7NK 2JH3A 1IW7A 5CHPA 3GTGC 3S1NC 1IS1A 1ZVUA 4GTDA 3GTMC 1K83K 3M3YC 2FQTA 4LOWA 3GTJC 2A6EA 5TMCA 1TWGK 3LPXA 3GTJK 4BY1K 1I50A 3BP8C 3RZOC 1R9TA 2P8TA 4JK1A 1WOSA 4Y52K 2WAQL 5IYBC 1B4BA 4P5AA 4P9SA 1VJEA 5FLMC 5HL8A 2JA6A 1DCHA 4KMAA 1SFOK 3GTGK 3S1NK 4QJVB 3HOZC 2NVXA 4GTLA 3MMLB 1TWGC 5C4JK 1EQRA 2E2HC 2RGRA 5IP7C 1USOA 1JQWA 3S17C 1O26A 5C4XC 3QX3A 3CQZK 1VH2A 2R93A 4G0VA 2JA7A 4G7ZA 2NVYK 4XSZA 1TWHK 2XCOA 2ZFZA 1BJTA 2R7ZA 1R9TC 5IOQA 1TWFC 5JVOA 2O5IA 1TWHC 3S16C 4KB2A 4Y52C 1I6VA 1HI9A 2CFAA 5C4XK 3S1QC 3HOXC 3FKIC 2JA8K 1WQGA 2JA7C 5M5WK 1SFOC 3L4KA 4KMUA 2R92K 4KM8A 4FM9A 4XCHA 3V4GA 4A3BC 3RZOK 1I3QC 1Y1WC 4KN7A 3VA7A 1XPPA 3GTPA 1I50K 3JSTA 3PO2K 1WCMK 1TWAA 2GAHC 1TWAC 4OIQA 3OPFA 3FHZA 3GTPC 4A3JK 2R93K 3N3YA 3HOUC 3H3VD 3TTGA 3G4AA 4A3KK 1XXCA 1ISEA 1YNJA 4KDDA 3ERED 2PMZL 4GTFA 3S15K 4Y7NC 3HKZD 4C3IC 1VRQC 5C44K 1J98A 1O25A 3HOYC 4OIOA 2PMZD 3M4OK 3HOWK 3FKIA 4OIRA 2PHCB 4G0WA 1TWGA 1RU0A 2GAGC 4BKWA 2CFAB 4LK0A 2R7ZC 5IYDK 1BGWA 3I4MK 4KMDA 1F93A 4BBRK 1UV7A 2YU9K 2A69A 4A3IK 4KAWX 1AB4A 3GSIA 2GSNA 4MQ9A 4A3GC 2BE5A 3RZDK 3SZZA 2VUMK 1JVIA 2PA8D 3G4CA 5EGHA 1KQ4A 2VUMC 3HOUK 4LQYA 3GEEA 2R93C 1WCMA 3GTPK 4A3GK 1F9NA 1J6WA 4KMHA 1I50C 1PJ6A 1O2FB 5IOTA 1XXBA 4GTAA 4C3IK 3GIRA 1ZQ1C 4A3IC 1XZQA 4ILDA 2RH6A 1I3QK 1Y1WK 4A3BK 4BBSK 3GEIA 2R92C 4P5BA 4QJVA 2E2HA 3RZDC 4A3JC 4ZH4A 1TWAK 1J6XA 4GT9A 5E68A 2NVXK 3S14C 1SFOA 3BUEA 4NOIA 3HOWC 1YX2A 3GTKC 2YU9C 4BBRC 4DDQA 4YFXA 4GTCA 1O27A 2FQOA 5IYDC 2R7ZK 1Y1VC 4LR2A 3GTJA 1TWHA 4KB4A 3GTOA 2JA7K 4A3KC 2V6TA 3ADAC 5CJ9A 3BP3A 5TJ3A 4A3DC 3CQZA 2E2IC 3S2DK 4G7HA 5IYCC 1EFWA 1EI6A 1XZQB 4YG2A 3I4NK 3HOYK 1EK8A 1WORA 4XLNA 2Y0SL 3S2HC 3L4JA 1I6HK 3S1RK 4Q4ZA 4KN4A 2CW0A 1YCLA 3H3VL 3EQLA 4PAAA 1B4AA 1O2AA 4KARA 4A3CK 4QIWD 5EGEA 1XXAA 1YNNA 5FJ8K 4X6AK 4BY1C 3AD7C 3AQOA 2E2HK 4GTBA 4J3NA 5C4JC 3HOXK 4LLGA 4G7OA 1F7VA 3GTGA 4M1XA 1WSRA 1I3QA 2JA6K 1Y1WA 4OIPA 5L46A 5FLMK 3GTQK 2B63A 1R9TK 2JA6C 4RMFA 4LJZA 1I6HC 1HQMA 4C3HC 2JA5C 1J6VA 4BXXK 2A6HA 2P5MA 1K83C 3A8JA 1TWCA 4BXXC 4A3CC 3GTMK 5IP7K 1EH1A 3S17K 2JA5K 4A3DK 4C3HK 3S16K 1WSVA 4A3FC 1INNA 4O2DA 1TWFK 3S1RC 1O2BA 3HXAA 3T00A 1XZPA 1Y1VK 2GSUA 5M3MK 5IYBK 2NVYC 1ZBSA 3TFIA 2PA8L 3GTQC 4WJ4A 3I4NC 4MEXA 3GTKK 2JA5A 2W7VA 3S2DC 4XLPA 1JOEA 2NVXC 3S14K 3A8IA 3LAPA 3DXJA 3LAJA 4GFQA 4MEYA 3T02A 5IORA 1WOPA 1WIHA 3TFJA 3GDZA 5M3FK 4PABA 2NVQC 5D4DA 5C3EC 4X6AC 3SZYA 3M3YK 5IYCK 1XZPB 5JFEA 2EBBA 3GTMA 2E2IK 1TWCK 4AYBL 3AQPA 2E2JK 3GTLA 4G0UA 3S1MK 4YFKA 3HOVK 1V5VA 3AH5A 4BY7C 3H0GK 3GTOK 3GTLC 3PO3K 3GEHA 1VLOA 1SMYA 2Y0SD 3NUHA 3S2HK 4A3LK 3WODA 3OREA 3A8KA 2XCQA 4A3EC 4OINA 2KWAA 1VGXA 4C3JC 2B63C 3GTQA 1PJ7A 1PJ5A 2NVYA 4KM9A 3K7AC 2R92A 2WAQD 1O24A 1WQFA 2O5JA 1WOOA 1IBAA 5IOSA 4A3MK 3OEPA 1ZXOA 2WB1D 4C2MK 1IE0A 3K7AK 1GE9A 3N0BA 4A93C 3FOEA 1G51A 1F7UA 4C2MC 2PPBA 3T01A 4A3EK 3TFHA 5IP9K 1DCPA 3HKZL 2NVTC 3I4MC 4BLAA 4KATA 3S15C 3GTLK 3PO3C 4BBSC 3H0GC 2V6UA 4YFNA 4FZBA 4AH6A 5M5YK 2E2IA 1WQHA 2NVTK 2E2JC 5IP9C 1C0AA 4AYBD 1TWCC 1BS2A 4KASA 2ZUFA 4Q5SA 4WJ3M 4C3JK
chains in the Genus database with same CATH topology
1O2BA 4KMHA 5IOQA 5JVOA 3FOFA 2GSUA 5IOTA 1XXBA 1ZBSA 4GTAA 4KB2A 4BLBA 4ILDA 2RH6A 2YU9A 1DD5A 3Q3QA 3H0GA 2JA5A 2CFAA 4P5BA 3S0XA 3CAGA 2E2HA 1WQGA 2VUMA 3LAPA 1K83A 4GT9A 3L4KA 3LAJA 1SFOA 4GFQA 5IORA 3GTKA 3BUEA 4KM8A 1WIHA 4FM9A 3V4GA 4DDQA 1O29A 1Y1VA 4GTCA 3VA7A 1O27A 1TWFA 3GTPA 2Y3PA 4LR2A 3GTJA 1TWHA 4KB4A 1TWAA 3GTOA 2GSOA 3N0CA 3OPFA 5JFEA 3FHZA 3GTMA 5CJ9A 3N3YA 5TJ3A 4GTEA 3AQPA 3CQZA 3GTLA 4G0UA 3G4AA 1O28A 1ISEA 1XXCA 4KDDA 3ERED 3AH5A 4KC6A 4GTFA 2XCRB 3NUHA 1EK8A 4C3IC 3OREA 1O25A 3L4JA 2JH3A 5CHPA 2XCQA 2KWAA 4C3JC 1IS1A 3GTQA 3FKIA 2NVYA 1B4AA 4KM9A 2R92A 1O2AA 1ZVUA 2PHCB 4G0WA 4GTDA 4KARA 1TWGA 1O24A 1WQFA 5EGEA 4BKWA 1XXAA 2CFAB 3AQOA 1BGWA 5IOSA 3OEPA 4GTBA 4J3NA 3LPXA 4KMDA 1I50A 1ZXOA 3GTGA 4M1XA 1I3QA 1R9TA 1Y1WA 1B4BA 4P5AA 1GE9A 3N0BA 4KAWX 2B63A 1AB4A 3FOEA 2GSNA 4C2MC 2JA6A 4KMAA 2NVXA 4GTLA 3MMLB 4C3HC 2RGRA 4BLAA 1O26A 3QX3A 4KATA 2P5MA 1TWCA 2R93A 4FZBA 2E2IA 3G4CA 5EGHA 4G0VA 1KQ4A 1EH1A 1WQHA 2JA7A 4LQYA 1WCMA 2XCOA 2ZFZA 4KASA 1BJTA 2R7ZA 1F9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2B A;  1O25 A;  5IOQ A;  5CHP A;  4P5A A;  3N0B A;  5IOT A;  1O29 A;  4GTA A;  4GTC A;  1O27 A;  1O2A A;  4GTL A;  2CFA A;  4GTD A;  4KAR A;  3N0C A;  5JFE A;  1O24 A;  1O26 A;  4P5B A;  4KAT A;  3N3Y A;  4GTE A;  2CFA B;  4FZB A;  3G4A A;  5IOS A;  3G4C A;  4GTB A;  1O28 A;  1KQ4 A;  3AH5 A;  4GT9 A;  4GTF A;  4KAS A;  5IOR A; 
#chains in the Genus database with same CATH topology
 1WCM C;  4A93 K;  3FOF A;  5C44 C;  4BLB A;  2V6S A;  2NVQ K;  2YU9 A;  1DD5 A;  3Q3Q A;  3H0G A;  3HOV C;  4XSX A;  3AD9 C;  2D6F C;  1IQ0 A;  3S1M C;  4A3M C;  3S0X A;  3CAG A;  3IPJ A;  4LK1 A;  2VUM A;  1IL2 A;  1K83 A;  3PO2 C;  2JA8 C;  3GTK A;  3AD8 C;  3FKI K;  5C3E K;  2ZUE A;  3M4O C;  2B63 K;  2WB1 L;  1O29 A;  1Y1V A;  4GZY A;  1L0W A;  5M5X K;  1USM A;  4C45 A;  4A3L C;  5TMF A;  1BDF A;  1TWF A;  2Y3P A;  3GTO C;  4BY7 K;  2GSO A;  4QIW L;  3N0C A;  1DCO A;  4A3F K;  4GTE A;  3S1Q K;  4WIL A;  1O28 A;  3CQZ C;  4KC6 A;  2A68 A;  1ZYR A;  1X31 C;  2XCR B;  3HOZ K;  4Y7N K;  2JH3 A;  1IW7 A;  5CHP A;  3GTG C;  3S1N C;  1IS1 A;  1ZVU A;  4GTD A;  3GTM C;  1K83 K;  3M3Y C;  2FQT A;  4LOW A;  3GTJ C;  2A6E A;  5TMC A;  1TWG K;  3LPX A;  3GTJ K;  4BY1 K;  1I50 A;  3BP8 C;  3RZO C;  1R9T A;  2P8T A;  4JK1 A;  1WOS A;  4Y52 K;  2WAQ L;  5IYB C;  1B4B A;  4P5A A;  4P9S A;  1VJE A;  5FLM C;  5HL8 A;  2JA6 A;  1DCH A;  4KMA A;  1SFO K;  3GTG K;  3S1N K;  4QJV B;  3HOZ C;  2NVX A;  4GTL A;  3MML B;  1TWG C;  5C4J K;  1EQR A;  2E2H C;  2RGR A;  5IP7 C;  1USO A;  1JQW A;  3S17 C;  1O26 A;  5C4X C;  3QX3 A;  3CQZ K;  1VH2 A;  2R93 A;  4G0V A;  2JA7 A;  4G7Z A;  2NVY K;  4XSZ A;  1TWH K;  2XCO A;  2ZFZ A;  1BJT A;  2R7Z A;  1R9T C;  5IOQ A;  1TWF C;  5JVO A;  2O5I A;  1TWH C;  3S16 C;  4KB2 A;  4Y52 C;  1I6V A;  1HI9 A;  2CFA A;  5C4X K;  3S1Q C;  3HOX C;  3FKI C;  2JA8 K;  1WQG A;  2JA7 C;  5M5W K;  1SFO C;  3L4K A;  4KMU A;  2R92 K;  4KM8 A;  4FM9 A;  4XCH A;  3V4G A;  4A3B C;  3RZO K;  1I3Q C;  1Y1W C;  4KN7 A;  3VA7 A;  1XPP A;  3GTP A;  1I50 K;  3JST A;  3PO2 K;  1WCM K;  1TWA A;  2GAH C;  1TWA C;  4OIQ A;  3OPF A;  3FHZ A;  3GTP C;  4A3J K;  2R93 K;  3N3Y A;  3HOU C;  3H3V D;  3TTG A;  3G4A A;  4A3K K;  1XXC A;  1ISE A;  1YNJ A;  4KDD A;  3ERE D;  2PMZ L;  4GTF A;  3S15 K;  4Y7N C;  3HKZ D;  4C3I C;  1VRQ C;  5C44 K;  1J98 A;  1O25 A;  3HOY C;  4OIO A;  2PMZ D;  3M4O K;  3HOW K;  3FKI A;  4OIR A;  2PHC B;  4G0W A;  1TWG A;  1RU0 A;  2GAG C;  4BKW A;  2CFA B;  4LK0 A;  2R7Z C;  5IYD K;  1BGW A;  3I4M K;  4KMD A;  1F93 A;  4BBR K;  1UV7 A;  2YU9 K;  2A69 A;  4A3I K;  4KAW X;  1AB4 A;  3GSI A;  2GSN A;  4MQ9 A;  4A3G C;  2BE5 A;  3RZD K;  3SZZ A;  2VUM K;  1JVI A;  2PA8 D;  3G4C A;  5EGH A;  1KQ4 A;  2VUM C;  3HOU K;  4LQY A;  3GEE A;  2R93 C;  1WCM A;  3GTP K;  4A3G K;  1F9N A;  1J6W A;  4KMH A;  1I50 C;  1PJ6 A;  1O2F B;  5IOT A;  1XXB A;  4GTA A;  4C3I K;  3GIR A;  1ZQ1 C;  4A3I C;  1XZQ A;  4ILD A;  2RH6 A;  1I3Q K;  1Y1W K;  4A3B K;  4BBS K;  3GEI A;  2R92 C;  4P5B A;  4QJV A;  2E2H A;  3RZD C;  4A3J C;  4ZH4 A;  1TWA K;  1J6X A;  4GT9 A;  5E68 A;  2NVX K;  3S14 C;  1SFO A;  3BUE A;  4NOI A;  3HOW C;  1YX2 A;  3GTK C;  2YU9 C;  4BBR C;  4DDQ A;  4YFX A;  4GTC A;  1O27 A;  2FQO A;  5IYD C;  2R7Z K;  1Y1V C;  4LR2 A;  3GTJ A;  1TWH A;  4KB4 A;  3GTO A;  2JA7 K;  4A3K C;  2V6T A;  3ADA C;  5CJ9 A;  3BP3 A;  5TJ3 A;  4A3D C;  3CQZ A;  2E2I C;  3S2D K;  4G7H A;  5IYC C;  1EFW A;  1EI6 A;  1XZQ B;  4YG2 A;  3I4N K;  3HOY K;  1EK8 A;  1WOR A;  4XLN A;  2Y0S L;  3S2H C;  3L4J A;  1I6H K;  3S1R K;  4Q4Z A;  4KN4 A;  2CW0 A;  1YCL A;  3H3V L;  3EQL A;  4PAA A;  1B4A A;  1O2A A;  4KAR A;  4A3C K;  4QIW D;  5EGE A;  1XXA A;  1YNN A;  5FJ8 K;  4X6A K;  4BY1 C;  3AD7 C;  3AQO A;  2E2H K;  4GTB A;  4J3N A;  5C4J C;  3HOX K;  4LLG A;  4G7O A;  1F7V A;  3GTG A;  4M1X A;  1WSR A;  1I3Q A;  2JA6 K;  1Y1W A;  4OIP A;  5L46 A;  5FLM K;  3GTQ K;  2B63 A;  1R9T K;  2JA6 C;  4RMF A;  4LJZ A;  1I6H C;  1HQM A;  4C3H C;  2JA5 C;  1J6V A;  4BXX K;  2A6H A;  2P5M A;  1K83 C;  3A8J A;  1TWC A;  4BXX C;  4A3C C;  3GTM K;  5IP7 K;  1EH1 A;  3S17 K;  2JA5 K;  4A3D K;  4C3H K;  3S16 K;  1WSV A;  4A3F C;  1INN A;  4O2D A;  1TWF K;  3S1R C;  1O2B A;  3HXA A;  3T00 A;  1XZP A;  1Y1V K;  2GSU A;  5M3M K;  5IYB K;  2NVY C;  1ZBS A;  3TFI A;  2PA8 L;  3GTQ C;  4WJ4 A;  3I4N C;  4MEX A;  3GTK K;  2JA5 A;  2W7V A;  3S2D C;  4XLP A;  1JOE A;  2NVX C;  3S14 K;  3A8I A;  3LAP A;  3DXJ A;  3LAJ A;  4GFQ A;  4MEY A;  3T02 A;  5IOR A;  1WOP A;  1WIH A;  3TFJ A;  3GDZ A;  5M3F K;  4PAB A;  2NVQ C;  5D4D A;  5C3E C;  4X6A C;  3SZY A;  3M3Y K;  5IYC K;  1XZP B;  5JFE A;  2EBB A;  3GTM A;  2E2I K;  1TWC K;  4AYB L;  3AQP A;  2E2J K;  3GTL A;  4G0U A;  3S1M K;  4YFK A;  3HOV K;  1V5V A;  3AH5 A;  4BY7 C;  3H0G K;  3GTO K;  3GTL C;  3PO3 K;  3GEH A;  1VLO A;  1SMY A;  2Y0S D;  3NUH A;  3S2H K;  4A3L K;  3WOD A;  3ORE A;  3A8K A;  2XCQ A;  4A3E C;  4OIN A;  2KWA A;  1VGX A;  4C3J C;  2B63 C;  3GTQ A;  1PJ7 A;  1PJ5 A;  2NVY A;  4KM9 A;  3K7A C;  2R92 A;  2WAQ D;  1O24 A;  1WQF A;  2O5J A;  1WOO A;  1IBA A;  5IOS A;  4A3M K;  3OEP A;  1ZXO A;  2WB1 D;  4C2M K;  1IE0 A;  3K7A K;  1GE9 A;  3N0B A;  4A93 C;  3FOE A;  1G51 A;  1F7U A;  4C2M C;  2PPB A;  3T01 A;  4A3E K;  3TFH A;  5IP9 K;  1DCP A;  3HKZ L;  2NVT C;  3I4M C;  4BLA A;  4KAT A;  3S15 C;  3GTL K;  3PO3 C;  4BBS C;  3H0G C;  2V6U A;  4YFN A;  4FZB A;  4AH6 A;  5M5Y K;  2E2I A;  1WQH A;  2NVT K;  2E2J C;  5IP9 C;  1C0A A;  4AYB D;  1TWC C;  1BS2 A;  4KAS A;  2ZUF A;  4Q5S A;  4WJ3 M;  4C3J K; 
#chains in the Genus database with same CATH homology
 1O2B A;  4KMH A;  5IOQ A;  5JVO A;  3FOF A;  2GSU A;  5IOT A;  1XXB A;  1ZBS A;  4GTA A;  4KB2 A;  4BLB A;  4ILD A;  2RH6 A;  2YU9 A;  1DD5 A;  3Q3Q A;  3H0G A;  2JA5 A;  2CFA A;  4P5B A;  3S0X A;  3CAG A;  2E2H A;  1WQG A;  2VUM A;  3LAP A;  1K83 A;  4GT9 A;  3L4K A;  3LAJ A;  1SFO A;  4GFQ A;  5IOR A;  3GTK A;  3BUE A;  4KM8 A;  1WIH A;  4FM9 A;  3V4G A;  4DDQ A;  1O29 A;  1Y1V A;  4GTC A;  3VA7 A;  1O27 A;  1TWF A;  3GTP A;  2Y3P A;  4LR2 A;  3GTJ A;  1TWH A;  4KB4 A;  1TWA A;  3GTO A;  2GSO A;  3N0C A;  3OPF A;  5JFE A;  3FHZ A;  3GTM A;  5CJ9 A;  3N3Y A;  5TJ3 A;  4GTE A;  3AQP A;  3CQZ A;  3GTL A;  4G0U A;  3G4A A;  1O28 A;  1ISE A;  1XXC A;  4KDD A;  3ERE D;  3AH5 A;  4KC6 A;  4GTF A;  2XCR B;  3NUH A;  1EK8 A;  4C3I C;  3ORE A;  1O25 A;  3L4J A;  2JH3 A;  5CHP A;  2XCQ A;  2KWA A;  4C3J C;  1IS1 A;  3GTQ A;  3FKI A;  2NVY A;  1B4A A;  4KM9 A;  2R92 A;  1O2A A;  1ZVU A;  2PHC B;  4G0W A;  4GTD A;  4KAR A;  1TWG A;  1O24 A;  1WQF A;  5EGE A;  4BKW A;  1XXA A;  2CFA B;  3AQO A;  1BGW A;  5IOS A;  3OEP A;  4GTB A;  4J3N A;  3LPX A;  4KMD A;  1I50 A;  1ZXO A;  3GTG A;  4M1X A;  1I3Q A;  1R9T A;  1Y1W A;  1B4B A;  4P5A A;  1GE9 A;  3N0B A;  4KAW X;  2B63 A;  1AB4 A;  3FOE A;  2GSN A;  4C2M C;  2JA6 A;  4KMA A;  2NVX A;  4GTL A;  3MML B;  4C3H C;  2RGR A;  4BLA A;  1O26 A;  3QX3 A;  4KAT A;  2P5M A;  1TWC A;  2R93 A;  4FZB A;  2E2I A;  3G4C A;  5EGH A;  4G0V A;  1KQ4 A;  1EH1 A;  1WQH A;  2JA7 A;  4LQY A;  1WCM A;  2XCO A;  2ZFZ A;  4KAS A;  1BJT A;  2R7Z A;  1F9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...