1O2AA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad at 1.8 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
211
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 78
structure length 211
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2aA00
1O28A 4FZBA 4GTEA 5JFEA 1O2AA 3N3YA 4GTAA 2CFAA 1KQ4A 3G4CA 5CHPA 4KATA 5IOQA 1O29A 1O27A 4GTCA 5IORA 3N0BA 3G4AA 4KARA 1O2BA 2CFAB 3N0CA 3AH5A 1O26A 5IOTA 4GTBA 4GT9A 4P5BA 1O25A 4GTDA 4GTFA 4GTLA 4P5AA 5IOSA 4KASA 1O24A
chains in the Genus database with same CATH superfamily
4GTEA 2O5IA 3S1NK 1WORA 4KM9A 5C4XC 2CFAA 2JA5C 1I6HK 4Y52C 3DXJA 3TFIA 2NVXA 1I3QK 1VJEA 4KN7A 3FHZA 3GEHA 1ZYRA 3GTOC 1WSVA 3A8IA 5M5XK 3HOZK 3AQPA 1TWAA 4LJZA 3N0CA 1I50A 3GTQC 5IP7C 4AH6A 4JK1A 4X6AC 3GTGA 4KB2A 4KMHA 4PAAA 2E2IC 4A3DK 2GAHC 2PHCB 4KASA 3GTMK 1I3QA 3HOYC 5JFEA 1KQ4A 5IP9C 4KATA 4C2MC 5IOQA 3LAPA 4G0VA 4QIWD 3LAJA 4A3CK 4BKWA 1EFWA 2NVQK 1J6WA 3A8JA 4BXXK 5TMCA 3FOFA 1SMYA 4GFQA 3GTMA 2GAGC 5FLMK 1F7UA 4XSXA 1TWGC 1TWCC 4Y7NK 2R7ZA 2GSUA 3RZDC 5CHPA 3GDZA 1XPPA 3V4GA 4J3NA 4A3JK 3PO3C 1R9TK 2JA8K 2E2HA 1YCLA 2Y0SL 1TWHA 3WODA 1JQWA 4YFNA 3RZOK 5FJ8K 2P5MA 2WB1D 4BY7K 4GTLA 2E2JC 3T02A 1VRQC 1XXAA 5C44K 3GTPK 4OIOA 4BLBA 1Y1VA 3S14C 1EK8A 1G51A 1O2AA 3GTKC 4PABA 1R9TA 3ERED 1XZQA 5IYBC 1O27A 1EH1A 3OEPA 3H0GK 3M4OK 4QJVB 1PJ7A 3S16C 1O2BA 1EI6A 4OIPA 3FOEA 1XZPB 3I4MC 3S15K 3I4NK 2WAQD 4A3MC 3GTPA 4C3JK 5L46A 3GEIA 3M3YC 4KAWX 4P5AA 4A3IK 3HOWC 3GTJC 3IPJA 4G0WA 4QIWL 1O24A 3H0GA 4A93K 4KMUA 4KMAA 1ZBSA 4BBRK 3HOXC 1F93A 4LK1A 5M5YK 4A3KC 4WILA 3TTGA 5C4XK 3AD9C 2VUMC 4A3BC 2JA6A 2JA5K 2NVXK 4Y52K 4A3GC 1K83A 4AYBL 4BBSC 5EGHA 4GTBA 3PO2C 1DCOA 4GT9A 4BY1C 3SZYA 3NUHA 3HOVK 3GTOK 1TWAK 4Q5SA 3GTQK 5IP7K 1EQRA 1L0WA 3GTGK 1Y1WA 4X6AK 1USOA 2BE5A 2ZUFA 3T01A 1WOPA 2JA5A 2E2IK 4KDDA 2O5JA 3OPFA 3HOYK 2WB1L 3HKZD 3OREA 3GTOA 1VGXA 4C2MK 2XCQA 4KMDA 4LOWA 3GIRA 3GTQA 1SFOC 1WQGA 3AD8C 2Y3PA 1IBAA 1WIHA 5IOSA 2E2IA 3S1QC 4C3HC 3VA7A 4RMFA 3CQZC 1JVIA 1WCMC 3BUEA 1DCPA 4G0UA 1TWGK 5IYCC 1J6VA 3BP3A 2R7ZK 1TWCK 2WAQL 4G7ZA 5M5WK 1C0AA 5IYDK 3TFHA 1XXCA 3HOUC 1RU0A 4C3IC 2E2HK 4GZYA 1O2FB 3PO3K 1TWHK 2RGRA 3A8KA 4WJ4A 3S2HC 4AYBD 1TWGA 3K7AK 3HOZC 4G7HA 2R92C 1TWCA 1INNA 3L4KA 4A3EC 1Y1VK 5JVOA 3G4AA 2XCRB 2PMZD 3S14K 1J6XA 3FKIC 1DCHA 5IYBK 4Q4ZA 5IOTA 3QX3A 4DDQA 3AD7C 1O25A 3S16K 1B4BA 2NVQC 2A6HA 1GE9A 4A3MK 3G4CA 3HKZL 1DD5A 1O29A 2ZFZA 2B63C 2XCOA 4OIRA 3GTKA 4MQ9A 3HOWK 5IORA 3GTJK 5FLMC 2FQTA 2JA7C 1VH2A 3H3VL 3HOXK 2GSNA 2JA6K 2VUMK 4A3BK 3SZZA 1K83K 2JA8C 4BBSK 3GTJA 3PO2K 2NVTK 4XSZA 1V5VA 1WOOA 4MEYA 2V6TA 3L4JA 3HXAA 3S1RC 1JOEA 3LPXA 4ILDA 1Y1WK 1WOSA 1BDFA 2KWAA 5C44C 4FM9A 5TJ3A 3GTLC 2VUMA 4XLNA 2FQOA 3M4OC 2PA8D 4GTFA 1IL2A 4A3LC 4OINA 2R93C 1WQFA 5C3EC 4G7OA 2PMZL 1SFOK 1TWFC 4P9SA 3I4NC 1BJTA 2YU9C 4XLPA 1UV7A 3S1QK 4C3HK 4YFXA 1XZQB 5IP9K 3S17C 5C4JC 2NVYC 4P5BA 5HL8A 5IYCK 4KB4A 4GTDA 2RH6A 2EBBA 1SFOA 2CW0A 3H3VD 1PJ5A 3S2DC 3HOUK 2NVXC 4XCHA 4C3IK 4A3FC 4YG2A 3CQZA 3HOVC 3JSTA 1BGWA 1TWAC 1WCMA 3S2HK 5D4DA 1I50C 2R92K 5M3MK 4KC6A 3RZDK 3S1MC 4LLGA 1ZVUA 3GTGC 4A3EK 3S1NC 3GEEA 4M1XA 4LK0A 1I6HC 1IS1A 5E68A 1I3QC 4QJVA 2ZUEA 3FKIK 3BP8C 1HQMA 3T00A 4GTAA 2R92A 1XZPA 1BS2A 5EGEA 2E2JK 2PPBA 4OIQA 3N0BA 4NOIA 1VLOA 5M3FK 4A3DC 2PA8L 1YNNA 2CFAB 3GTMC 3AH5A 3GTKK 2B63K 3FKIA 5CJ9A 4BLAA 3ADAC 2JA7K 2R7ZC 3S0XA 4A3CC 1B4AA 1J98A 5IYDC 3I4MK 4C45A 1XXBA 1HI9A 2GSOA 4BXXC 1AB4A 4O2DA 4GTCA 3M3YK 2E2HC 2B63A 3CAGA 1TWHC 3K7AC 2A69A 1ISEA 4Y7NC 2JA7A 1WQHA 3S1RK 1ZXOA 4A3KK 4YFKA 2A68A 1Y1VC 1ZQ1C 4A3JC 1PJ6A 3GTLK 1YNJA 1R9TC 4A3GK 1F9NA 1F7VA 1X31C 2A6EA 2JH3A 4BY1K 2W7VA 3AQOA 4ZH4A 4A3LK 3RZOC 4BY7C 2R93K 5C3EK 4LQYA 4KN4A 1TWFK 1O26A 3EQLA 3GTPC 3TFJA 2YU9K 1YX2A 3GTLA 4WJ3M 1IQ0A 3GSIA 4MEXA 3H0GC 2V6SA 3S17K 1O28A 4FZBA 2V6UA 5C4JK 2NVYK 3N3YA 2R93A 3S15C 1IW7A 5TMFA 1TWFA 2JA6C 1I6VA 4C3JC 2YU9A 2P8TA 3S2DK 4KARA 1IE0A 1K83C 4A3IC 4LR2A 2D6FC 4KM8A 4A3FK 3CQZK 1USMA 2NVTC 1WCMK 1WSRA 4A93C 2NVYA 1I50K 2Y0SD 4BBRC 3Q3QA 3MMLB 3S1MK 1Y1WC
chains in the Genus database with same CATH topology
3H0GA 4GTEA 4KM9A 1GE9A 4GTAA 2CFAA 3G4CA 4KMAA 2R92A 1DD5A 1O29A 2ZFZA 3GTKA 1ZBSA 2XCOA 5EGEA 2NVXA 5IORA 3FHZA 3N0BA 3AQPA 1TWAA 2JA6A 2CFAB 3N0CA 3AH5A 1I50A 1K83A 5EGHA 4GTBA 4GT9A 2GSNA 3FKIA 5CJ9A 3GTGA 4KB2A 3NUHA 4BLAA 4KMHA 3S0XA 2PHCB 1B4AA 4KASA 1I3QA 5JFEA 3GTJA 1XXBA 1Y1WA 1KQ4A 2GSOA 4KATA 4C2MC 1AB4A 5IOQA 3LAPA 4G0VA 3L4JA 2JA5A 4KDDA 4GTCA 3OPFA 3LAJA 3LPXA 4BKWA 2B63A 3CAGA 4ILDA 3OREA 2KWAA 3GTOA 4FM9A 3FOFA 2XCQA 5TJ3A 4KMDA 2VUMA 1ISEA 2JA7A 1WQHA 4GFQA 3GTMA 1ZXOA 3GTQA 1WQGA 4GTFA 2Y3PA 1WIHA 5IOSA 2E2IA 2R7ZA 1WQFA 2GSUA 1F9NA 4C3HC 3VA7A 5CHPA 2JH3A 1BJTA 3AQOA 3BUEA 3V4GA 4G0UA 4J3NA 2E2HA 4LQYA 1TWHA 1O26A 1XXCA 3GTLA 4P5BA 4C3IC 2P5MA 4KB4A 4GTDA 2RH6A 4GTLA 1SFOA 2RGRA 1XXAA 1O28A 4FZBA 1TWGA 4BLBA 1Y1VA 1EK8A 1O2AA 3N3YA 1TWCA 2R93A 1R9TA 3ERED 3L4KA 1O27A 1EH1A 3OEPA 1TWFA 3CQZA 1BGWA 1WCMA 4C3JC 5JVOA 3G4AA 2YU9A 2XCRB 4KARA 1O2BA 4KC6A 4LR2A 3FOEA 4KM8A 1ZVUA 5IOTA 3QX3A 4M1XA 4DDQA 3GTPA 1IS1A 1O25A 2NVYA 4KAWX 3Q3QA 4P5AA 3MMLB 1B4BA 4G0WA 1O24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O28 A;  4FZB A;  4GTE A;  5JFE A;  1O2A A;  3N3Y A;  4GTA A;  2CFA A;  1KQ4 A;  3G4C A;  5CHP A;  4KAT A;  5IOQ A;  1O29 A;  1O27 A;  4GTC A;  5IOR A;  3N0B A;  3G4A A;  4KAR A;  1O2B A;  2CFA B;  3N0C A;  3AH5 A;  1O26 A;  5IOT A;  4GTB A;  4GT9 A;  4P5B A;  1O25 A;  4GTD A;  4GTF A;  4GTL A;  4P5A A;  5IOS A;  4KAS A;  1O24 A; 
#chains in the Genus database with same CATH topology
 4GTE A;  2O5I A;  3S1N K;  1WOR A;  4KM9 A;  5C4X C;  2CFA A;  2JA5 C;  1I6H K;  4Y52 C;  3DXJ A;  3TFI A;  2NVX A;  1I3Q K;  1VJE A;  4KN7 A;  3FHZ A;  3GEH A;  1ZYR A;  3GTO C;  1WSV A;  3A8I A;  5M5X K;  3HOZ K;  3AQP A;  1TWA A;  4LJZ A;  3N0C A;  1I50 A;  3GTQ C;  5IP7 C;  4AH6 A;  4JK1 A;  4X6A C;  3GTG A;  4KB2 A;  4KMH A;  4PAA A;  2E2I C;  4A3D K;  2GAH C;  2PHC B;  4KAS A;  3GTM K;  1I3Q A;  3HOY C;  5JFE A;  1KQ4 A;  5IP9 C;  4KAT A;  4C2M C;  5IOQ A;  3LAP A;  4G0V A;  4QIW D;  3LAJ A;  4A3C K;  4BKW A;  1EFW A;  2NVQ K;  1J6W A;  3A8J A;  4BXX K;  5TMC A;  3FOF A;  1SMY A;  4GFQ A;  3GTM A;  2GAG C;  5FLM K;  1F7U A;  4XSX A;  1TWG C;  1TWC C;  4Y7N K;  2R7Z A;  2GSU A;  3RZD C;  5CHP A;  3GDZ A;  1XPP A;  3V4G A;  4J3N A;  4A3J K;  3PO3 C;  1R9T K;  2JA8 K;  2E2H A;  1YCL A;  2Y0S L;  1TWH A;  3WOD A;  1JQW A;  4YFN A;  3RZO K;  5FJ8 K;  2P5M A;  2WB1 D;  4BY7 K;  4GTL A;  2E2J C;  3T02 A;  1VRQ C;  1XXA A;  5C44 K;  3GTP K;  4OIO A;  4BLB A;  1Y1V A;  3S14 C;  1EK8 A;  1G51 A;  1O2A A;  3GTK C;  4PAB A;  1R9T A;  3ERE D;  1XZQ A;  5IYB C;  1O27 A;  1EH1 A;  3OEP A;  3H0G K;  3M4O K;  4QJV B;  1PJ7 A;  3S16 C;  1O2B A;  1EI6 A;  4OIP A;  3FOE A;  1XZP B;  3I4M C;  3S15 K;  3I4N K;  2WAQ D;  4A3M C;  3GTP A;  4C3J K;  5L46 A;  3GEI A;  3M3Y C;  4KAW X;  4P5A A;  4A3I K;  3HOW C;  3GTJ C;  3IPJ A;  4G0W A;  4QIW L;  1O24 A;  3H0G A;  4A93 K;  4KMU A;  4KMA A;  1ZBS A;  4BBR K;  3HOX C;  1F93 A;  4LK1 A;  5M5Y K;  4A3K C;  4WIL A;  3TTG A;  5C4X K;  3AD9 C;  2VUM C;  4A3B C;  2JA6 A;  2JA5 K;  2NVX K;  4Y52 K;  4A3G C;  1K83 A;  4AYB L;  4BBS C;  5EGH A;  4GTB A;  3PO2 C;  1DCO A;  4GT9 A;  4BY1 C;  3SZY A;  3NUH A;  3HOV K;  3GTO K;  1TWA K;  4Q5S A;  3GTQ K;  5IP7 K;  1EQR A;  1L0W A;  3GTG K;  1Y1W A;  4X6A K;  1USO A;  2BE5 A;  2ZUF A;  3T01 A;  1WOP A;  2JA5 A;  2E2I K;  4KDD A;  2O5J A;  3OPF A;  3HOY K;  2WB1 L;  3HKZ D;  3ORE A;  3GTO A;  1VGX A;  4C2M K;  2XCQ A;  4KMD A;  4LOW A;  3GIR A;  3GTQ A;  1SFO C;  1WQG A;  3AD8 C;  2Y3P A;  1IBA A;  1WIH A;  5IOS A;  2E2I A;  3S1Q C;  4C3H C;  3VA7 A;  4RMF A;  3CQZ C;  1JVI A;  1WCM C;  3BUE A;  1DCP A;  4G0U A;  1TWG K;  5IYC C;  1J6V A;  3BP3 A;  2R7Z K;  1TWC K;  2WAQ L;  4G7Z A;  5M5W K;  1C0A A;  5IYD K;  3TFH A;  1XXC A;  3HOU C;  1RU0 A;  4C3I C;  2E2H K;  4GZY A;  1O2F B;  3PO3 K;  1TWH K;  2RGR A;  3A8K A;  4WJ4 A;  3S2H C;  4AYB D;  1TWG A;  3K7A K;  3HOZ C;  4G7H A;  2R92 C;  1TWC A;  1INN A;  3L4K A;  4A3E C;  1Y1V K;  5JVO A;  3G4A A;  2XCR B;  2PMZ D;  3S14 K;  1J6X A;  3FKI C;  1DCH A;  5IYB K;  4Q4Z A;  5IOT A;  3QX3 A;  4DDQ A;  3AD7 C;  1O25 A;  3S16 K;  1B4B A;  2NVQ C;  2A6H A;  1GE9 A;  4A3M K;  3G4C A;  3HKZ L;  1DD5 A;  1O29 A;  2ZFZ A;  2B63 C;  2XCO A;  4OIR A;  3GTK A;  4MQ9 A;  3HOW K;  5IOR A;  3GTJ K;  5FLM C;  2FQT A;  2JA7 C;  1VH2 A;  3H3V L;  3HOX K;  2GSN A;  2JA6 K;  2VUM K;  4A3B K;  3SZZ A;  1K83 K;  2JA8 C;  4BBS K;  3GTJ A;  3PO2 K;  2NVT K;  4XSZ A;  1V5V A;  1WOO A;  4MEY A;  2V6T A;  3L4J A;  3HXA A;  3S1R C;  1JOE A;  3LPX A;  4ILD A;  1Y1W K;  1WOS A;  1BDF A;  2KWA A;  5C44 C;  4FM9 A;  5TJ3 A;  3GTL C;  2VUM A;  4XLN A;  2FQO A;  3M4O C;  2PA8 D;  4GTF A;  1IL2 A;  4A3L C;  4OIN A;  2R93 C;  1WQF A;  5C3E C;  4G7O A;  2PMZ L;  1SFO K;  1TWF C;  4P9S A;  3I4N C;  1BJT A;  2YU9 C;  4XLP A;  1UV7 A;  3S1Q K;  4C3H K;  4YFX A;  1XZQ B;  5IP9 K;  3S17 C;  5C4J C;  2NVY C;  4P5B A;  5HL8 A;  5IYC K;  4KB4 A;  4GTD A;  2RH6 A;  2EBB A;  1SFO A;  2CW0 A;  3H3V D;  1PJ5 A;  3S2D C;  3HOU K;  2NVX C;  4XCH A;  4C3I K;  4A3F C;  4YG2 A;  3CQZ A;  3HOV C;  3JST A;  1BGW A;  1TWA C;  1WCM A;  3S2H K;  5D4D A;  1I50 C;  2R92 K;  5M3M K;  4KC6 A;  3RZD K;  3S1M C;  4LLG A;  1ZVU A;  3GTG C;  4A3E K;  3S1N C;  3GEE A;  4M1X A;  4LK0 A;  1I6H C;  1IS1 A;  5E68 A;  1I3Q C;  4QJV A;  2ZUE A;  3FKI K;  3BP8 C;  1HQM A;  3T00 A;  4GTA A;  2R92 A;  1XZP A;  1BS2 A;  5EGE A;  2E2J K;  2PPB A;  4OIQ A;  3N0B A;  4NOI A;  1VLO A;  5M3F K;  4A3D C;  2PA8 L;  1YNN A;  2CFA B;  3GTM C;  3AH5 A;  3GTK K;  2B63 K;  3FKI A;  5CJ9 A;  4BLA A;  3ADA C;  2JA7 K;  2R7Z C;  3S0X A;  4A3C C;  1B4A A;  1J98 A;  5IYD C;  3I4M K;  4C45 A;  1XXB A;  1HI9 A;  2GSO A;  4BXX C;  1AB4 A;  4O2D A;  4GTC A;  3M3Y K;  2E2H C;  2B63 A;  3CAG A;  1TWH C;  3K7A C;  2A69 A;  1ISE A;  4Y7N C;  2JA7 A;  1WQH A;  3S1R K;  1ZXO A;  4A3K K;  4YFK A;  2A68 A;  1Y1V C;  1ZQ1 C;  4A3J C;  1PJ6 A;  3GTL K;  1YNJ A;  1R9T C;  4A3G K;  1F9N A;  1F7V A;  1X31 C;  2A6E A;  2JH3 A;  4BY1 K;  2W7V A;  3AQO A;  4ZH4 A;  4A3L K;  3RZO C;  4BY7 C;  2R93 K;  5C3E K;  4LQY A;  4KN4 A;  1TWF K;  1O26 A;  3EQL A;  3GTP C;  3TFJ A;  2YU9 K;  1YX2 A;  3GTL A;  4WJ3 M;  1IQ0 A;  3GSI A;  4MEX A;  3H0G C;  2V6S A;  3S17 K;  1O28 A;  4FZB A;  2V6U A;  5C4J K;  2NVY K;  3N3Y A;  2R93 A;  3S15 C;  1IW7 A;  5TMF A;  1TWF A;  2JA6 C;  1I6V A;  4C3J C;  2YU9 A;  2P8T A;  3S2D K;  4KAR A;  1IE0 A;  1K83 C;  4A3I C;  4LR2 A;  2D6F C;  4KM8 A;  4A3F K;  3CQZ K;  1USM A;  2NVT C;  1WCM K;  1WSR A;  4A93 C;  2NVY A;  1I50 K;  2Y0S D;  4BBR C;  3Q3Q A;  3MML B;  3S1M K;  1Y1W C; 
#chains in the Genus database with same CATH homology
 3H0G A;  4GTE A;  4KM9 A;  1GE9 A;  4GTA A;  2CFA A;  3G4C A;  4KMA A;  2R92 A;  1DD5 A;  1O29 A;  2ZFZ A;  3GTK A;  1ZBS A;  2XCO A;  5EGE A;  2NVX A;  5IOR A;  3FHZ A;  3N0B A;  3AQP A;  1TWA A;  2JA6 A;  2CFA B;  3N0C A;  3AH5 A;  1I50 A;  1K83 A;  5EGH A;  4GTB A;  4GT9 A;  2GSN A;  3FKI A;  5CJ9 A;  3GTG A;  4KB2 A;  3NUH A;  4BLA A;  4KMH A;  3S0X A;  2PHC B;  1B4A A;  4KAS A;  1I3Q A;  5JFE A;  3GTJ A;  1XXB A;  1Y1W A;  1KQ4 A;  2GSO A;  4KAT A;  4C2M C;  1AB4 A;  5IOQ A;  3LAP A;  4G0V A;  3L4J A;  2JA5 A;  4KDD A;  4GTC A;  3OPF A;  3LAJ A;  3LPX A;  4BKW A;  2B63 A;  3CAG A;  4ILD A;  3ORE A;  2KWA A;  3GTO A;  4FM9 A;  3FOF A;  2XCQ A;  5TJ3 A;  4KMD A;  2VUM A;  1ISE A;  2JA7 A;  1WQH A;  4GFQ A;  3GTM A;  1ZXO A;  3GTQ A;  1WQG A;  4GTF A;  2Y3P A;  1WIH A;  5IOS A;  2E2I A;  2R7Z A;  1WQF A;  2GSU A;  1F9N A;  4C3H C;  3VA7 A;  5CHP A;  2JH3 A;  1BJT A;  3AQO A;  3BUE A;  3V4G A;  4G0U A;  4J3N A;  2E2H A;  4LQY A;  1TWH A;  1O26 A;  1XXC A;  3GTL A;  4P5B A;  4C3I C;  2P5M A;  4KB4 A;  4GTD A;  2RH6 A;  4GTL A;  1SFO A;  2RGR A;  1XXA A;  1O28 A;  4FZB A;  1TWG A;  4BLB A;  1Y1V A;  1EK8 A;  1O2A A;  3N3Y A;  1TWC A;  2R93 A;  1R9T A;  3ERE D;  3L4K A;  1O27 A;  1EH1 A;  3OEP A;  1TWF A;  3CQZ A;  1BGW A;  1WCM A;  4C3J C;  5JVO A;  3G4A A;  2YU9 A;  2XCR B;  4KAR A;  1O2B A;  4KC6 A;  4LR2 A;  3FOE A;  4KM8 A;  1ZVU A;  5IOT A;  3QX3 A;  4M1X A;  4DDQ A;  3GTP A;  1IS1 A;  1O25 A;  2NVY A;  4KAW X;  3Q3Q A;  4P5A A;  3MML B;  1B4B A;  4G0W A;  1O24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...