4BXXK

Arrested rna polymerase ii-bye1 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bxxK00
4G7HA 3S1QK 4BY1K 5IP9K 3GTGK 3S16C 4OIQA 2NVQC 3GTJC 4LK1A 3HOYK 2WB1L 4YG2A 4A3IC 4A3FK 3GTLK 3S16K 4BBRK 1SFOC 4A3GK 4Y52C 4BY1C 3GTGC 1WCMC 4YFXA 1WCMK 5M5YK 4A3KK 2JA6K 4A3GC 5C4JK 1I3QK 1K83C 3RZOC 3S15C 1XPPA 4G7ZA 3DXJA 4AYBD 3S2DC 4MQ9A 5IYCK 3GTJK 3S14C 2NVYC 5IYDC 2JA7C 3WODA 4A3MK 4A3DC 2VUMC 1I6HC 2E2HK 3S2HC 5IP9C 3S1QC 4YFKA 2JA8K 1IW7A 5C4XC 2CW0A 3S1MC 4Q5SA 2JA5K 2R7ZC 3HOWK 3GTQK 1TWFK 3PO2C 1I50C 5FJ8K 4A3BC 4BBSC 1YNNA 3GTKC 5FLMK 2B63K 3S1RK 4QIWD 3RZDC 2NVXC 5M3MK 2NVXK 2YU9K 1HQMA 5FLMC 5M3FK 2A6EA 4LK0A 4QJVB 2PMZL 4XLPA 4OIRA 4A93K 3HOVC 3PO2K 2JA5C 2PPBA 4BXXC 2PMZD 1Y1VC 5M5XK 4KN7A 4QJVA 2BE5A 1TWCC 2E2HC 3I4MC 4A3MC 1I6HK 1Y1WK 3PO3K 2JA7K 3RZDK 2B63C 5IYCC 4YFNA 4GZYA 4A3JK 4BBSK 4Y7NK 1TWFC 3I4NC 2R7ZK 3EQLA 3M3YC 3H3VL 4OIPA 1I3QC 1K83K 5C44K 3S1MK 3S2DK 5C4XK 4A3KC 2JA8C 3K7AC 3H0GC 4ZH4A 4A3EC 2E2IC 4XLNA 2E2JK 5IP7C 4A3DK 1SFOK 4QIWL 3GTMC 2PA8L 4Y52K 2NVYK 4C3IK 2WB1D 3HOZK 3M4OC 4A3IK 5IYDK 4A3LC 3FKIK 3HOYC 4NOIA 1BDFA 4A3LK 1YNJA 3HOZC 3M4OK 1TWGK 3GTMK 3RZOK 3S15K 4G7OA 5IP7K 4MEYA 3H0GK 2E2IK 3K7AK 4LJZA 3CQZC 3HOUK 2A69A 5C44C 4BBRC 1TWGC 3GTPK 4A3FC 3GTLC 4C3JK 1TWHC 1TWAK 3FKIC 2A6HA 4OIOA 4AYBL 2NVQK 2WAQD 5C3EK 1Y1WC 3I4MK 2E2JC 4A3EK 4XSZA 5C4JC 4Q4ZA 4JK1A 4A3CK 1Y1VK 3HKZL 2R92C 3M3YK 2R93C 4BY7K 3I4NK 3HOUC 4Y7NC 4KN4A 3GTOK 4A3JC 4C2MK 4MEXA 4LLGA 3S17C 3S1NC 1R9TC 3PO3C 3S1RC 4X6AC 2Y0SD 1TWCK 3GTKK 4XSXA 4A3BK 5D4DA 3HOXK 3GTOC 4OINA 2A68A 2O5IA 3GTQC 4BY7C 3HKZD 5TMFA 5IYBK 2NVTK 5IYBC 2NVTC 5M5WK 2R92K 4BXXK 3HOVK 2PA8D 4A93C 3HOXC 3S2HK 2VUMK 4X6AK 2Y0SL 2YU9C 1R9TK 5C3EC 1SMYA 3S14K 3S17K 3S1NK 4KMUA 5TMCA 1TWAC 1I6VA 4C3HK 3H3VD 1TWHK 1I50K 2WAQL 3HOWC 2R93K 3GTPC 2O5JA 1ZYRA 3CQZK 4A3CC 2JA6C
chains in the Genus database with same CATH superfamily
3TTGA 3T02A 1R9TA 2V6TA 4LK1A 4YG2A 1WSRA 3S16K 2R92A 4KM8A 1K83C 3RZOC 3SZZA 1XPPA 1KQ4A 4BKWA 2RGRA 2NVYC 3WODA 1IW7A 3A8IA 3GIRA 4GTBA 4C3HC 3GEHA 5FLMK 2NVXK 4KB4A 2YU9K 1HQMA 1HI9A 4OIRA 3HOVC 4GTEA 1ZBSA 1ISEA 2PMZD 5M5XK 3GTOA 1O2BA 3CQZA 1TWCC 3VA7A 3PO3K 5L46A 2JA7K 2B63C 3Q3QA 3GTJA 3GSIA 1ZQ1C 2R7ZK 4OIPA 1I3QC 3S1MK 3AD8C 1F7UA 5C4XK 4A3KC 4KM9A 4ZH4A 4A3EC 2E2IC 4Y52K 5IP7C 4A3DK 1SFOK 4QIWL 5IYDK 4C3IK 3AQPA 1O27A 4C3JC 1DD5A 5IP7K 3GTMA 2E2IK 4WJ4A 4G0WA 3CQZC 3HOUK 2NVXA 1INNA 4KARA 1TWGC 4A3FC 3LPXA 3AD7C 5CJ9A 1O25A 1TWHC 3FOFA 2A6HA 4OIOA 1IS1A 4AYBL 2WAQD 4J3NA 2NVQK 1K83A 2RH6A 4XSZA 4JK1A 1B4AA 2JA7A 1BGWA 2R92C 2R93C 3I4NK 2FQTA 1WQFA 4Y7NC 4KN4A 3GTOK 1WOSA 1B4BA 4C2MK 4FZBA 3S17C 3MMLB 1IE0A 1UV7A 3L4KA 4BY7C 3LAJA 3A8JA 3CAGA 4XCHA 1O2AA 1EFWA 3AD9C 5JVOA 1SMYA 3S17K 4C2MC 1I6VA 1I50K 2R93K 2O5JA 1ZYRA 4G7HA 1J98A 3S16C 2NVQC 4ILDA 3HOYK 2WB1L 3GDZA 4A3FK 4A3GK 1J6WA 1WCMC 2D6FC 1ZVUA 5IORA 2XCOA 4G7ZA 1EK8A 4AYBD 5CHPA 4MQ9A 1USMA 5IYDC 4A3MK 4A3DC 2VUMC 4LOWA 1WOOA 5C4XC 3L4JA 2CW0A 3S1MC 4Q5SA 2JA5K 2R7ZC 3GTQK 1F93A 1XZPA 2B63K 3S1RK 1IQ0A 3V4GA 5M3FK 4LK0A 2GSUA 4A93K 3PO2K 4BXXC 3TFHA 1Y1VC 3GTQA 4KN7A 4QJVA 2E2HC 2JH3A 1I6HK 1J6XA 5IYCC 4GZYA 4A3JK 1TWHA 3S2DK 5C44K 3K7AC 3GTMC 2PA8L 2NVYK 2WB1D 4A3IK 3FKIK 1BDFA 1YNJA 3HOZC 3M4OK 3BUEA 3RZOK 2CFAB 4G7OA 3ERED 4LR2A 2A69A 3FKIA 1Y1VA 1TWFA 2XCQA 3A8KA 1V5VA 2V6SA 5C3EK 1YCLA 2E2JC 4Q4ZA 2R93A 1BJTA 2W7VA 3M3YK 3JSTA 4BLBA 4RMFA 1C0AA 4KB2A 4MEXA 4LLGA 1O24A 3N3YA 1XXBA 3H0GA 4X6AC 4G0VA 2Y0SD 3GTKK 1O2FB 4A3BK 2O5IA 1VJEA 5IYBC 3AQOA 2B63A 3S2HK 3OEPA 5C3EC 3GTGA 3S14K 4KMUA 5EGHA 1XZPB 3HOWC 3SZYA 5C4JC 4A3CC 2JA6C 3S1QK 3GTGK 5IP9K 4P5AA 1I3QA 1WQHA 3N0BA 3GTJC 4A3IC 3GTLK 1VH2A 2FQOA 4BY1C 3GTKA 4YFXA 1WORA 1X31C 2P8TA 4WILA 3S2DC 3DXJA 1EQRA 2XCRB 4KDDA 5IYCK 3GTJK 4KMHA 1I6HC 2E2HK 5IP9C 3S1QC 2GAGC 4YFKA 2EBBA 3HOWK 3PO2C 5FJ8K 4DDQA 1YNNA 2PHCB 1WCMA 4LQYA 2A6EA 4QJVB 2JA5C 2PPBA 3TFJA 2YU9A 2BE5A 3I4MC 4A3MC 1Y1WK 3ADAC 3RZDK 4FM9A 4YFNA 4BBSK 1YX2A 3FHZA 1TWFC 3M3YC 3H3VL 2JA8C 1XZQA 3H0GC 2JA6A 2E2JK 1Y1WA 3OREA 4G0UA 3OPFA 4A3LC 3HOYC 4NOIA 4A3LK 1TWGA 1PJ6A 3G4CA 3S15K 1VGXA 1F7VA 3H0GK 4GTAA 3BP3A 4LJZA 2CFAA 4BBRC 4KMAA 2NVYA 1RU0A 1F9NA 2JA5A 3FKIC 1Y1WC 5EGEA 4M1XA 3I4MK 2E2HA 2VUMA 4GTCA 1WOPA 1JVIA 4BY7K 5E68A 1EI6A 2ZFZA 4A3JC 3S1NC 1WIHA 3LAPA 1R9TC 4PABA 1TWCA 4XSXA 5IOSA 5D4DA 3HOXK 3GTOC 4OINA 3HXAA 1EH1A 5IOTA 3GTLA 3HKZD 2NVTK 2R92K 2NVTC 4BXXK 2PA8D 4A93C 3HOXC 1O28A 1VRQC 2Y0SL 1R9TK 3S1NK 1PJ5A 3G4AA 1TWHK 2WAQL 2ZUEA 3CQZK 3HOUC 1DCOA 3AH5A 4BY1K 1IL2A 4KMDA 4P9SA 4KAWX 4OIQA 3BP8C 4GTFA 3GTPA 4C3IC 1WQGA 4BBRK 1SFOC 2ZUFA 4Y52C 3GTGC 5M5YK 1WCMK 4A3KK 4GTLA 2JA6K 1DCPA 2V6UA 5C4JK 4A3GC 1I3QK 3S15C 1IBAA 1ZXOA 3IPJA 4KATA 3S14C 2JA7C 3S2HC 1XZQB 1I50A 2JA8K 1AB4A 1L0WA 3TFIA 2R7ZA 1TWFK 1I50C 4GFQA 1TWAA 4A3BC 5JFEA 4BBSC 4P5BA 3GTKC 4QIWD 3RZDC 2NVXC 5M3MK 2KWAA 5FLMC 5HL8A 4XLPA 2PMZL 1VLOA 1O26A 1XXAA 1XXCA 4BLAA 3N0CA 1SFOA 4PAAA 3GEEA 4O2DA 2GSNA 3QX3A 4Y7NK 3I4NC 3EQLA 4WJ3M 3NUHA 1K83K 1G51A 4XLNA 2GSOA 4KASA 3HOZK 3M4OC 5TJ3A 1TWGK 3GTMK 4MEYA 3K7AK 2P5MA 2GAHC 5C44C 4GTDA 3GTPK 1WSVA 3GTLC 4C3JK 1USOA 2Y3PA 1TWAK 3FOEA 5IOQA 4A3EK 4A3CK 1Y1VK 3HKZL 1GE9A 4AH6A 3S0XA 3T01A 1BS2A 3GEIA 3T00A 4GT9A 2E2IA 4KC6A 3PO3C 1DCHA 3S1RC 1TWCK 2A68A 4C45A 3GTQC 5TMFA 5IYBK 5M5WK 3HOVK 1JQWA 2VUMK 1J6VA 4X6AK 2YU9C 1PJ7A 5TMCA 1TWAC 4C3HK 3H3VD 1O29A 1JOEA 3GTPC
chains in the Genus database with same CATH topology
4G7HA 3S1QK 4BY1K 5IP9K 3GTGK 3S16C 4OIQA 2NVQC 3GTJC 4LK1A 3HOYK 2WB1L 4YG2A 4A3IC 4A3FK 3GTLK 3S16K 4BBRK 1SFOC 4A3GK 4Y52C 4BY1C 3GTGC 1WCMC 4YFXA 1WCMK 5M5YK 4A3KK 2JA6K 4A3GC 5C4JK 1I3QK 1K83C 3RZOC 3S15C 1XPPA 4G7ZA 3DXJA 4AYBD 3S2DC 4MQ9A 5IYCK 3GTJK 3S14C 2NVYC 5IYDC 2JA7C 3WODA 4A3MK 4A3DC 2VUMC 1I6HC 2E2HK 3S2HC 5IP9C 3S1QC 4YFKA 2JA8K 1IW7A 5C4XC 2CW0A 3S1MC 4Q5SA 2JA5K 2R7ZC 3HOWK 3GTQK 1TWFK 3PO2C 1I50C 5FJ8K 4A3BC 4BBSC 1YNNA 3GTKC 5FLMK 2B63K 3S1RK 4QIWD 3RZDC 2NVXC 5M3MK 2NVXK 2YU9K 1HQMA 5FLMC 5M3FK 2A6EA 4LK0A 4QJVB 2PMZL 4XLPA 4OIRA 4A93K 3HOVC 3PO2K 2JA5C 2PPBA 4BXXC 2PMZD 1Y1VC 5M5XK 4KN7A 4QJVA 2BE5A 1TWCC 2E2HC 3I4MC 4A3MC 1I6HK 1Y1WK 3PO3K 2JA7K 3RZDK 2B63C 5IYCC 4YFNA 4GZYA 4A3JK 4BBSK 4Y7NK 1TWFC 3I4NC 2R7ZK 3EQLA 3M3YC 3H3VL 4OIPA 1I3QC 1K83K 5C44K 3S1MK 3S2DK 5C4XK 4A3KC 2JA8C 3K7AC 3H0GC 4ZH4A 4A3EC 2E2IC 4XLNA 2E2JK 5IP7C 4A3DK 1SFOK 4QIWL 3GTMC 2PA8L 4Y52K 2NVYK 4C3IK 2WB1D 3HOZK 3M4OC 4A3IK 5IYDK 4A3LC 3FKIK 3HOYC 4NOIA 1BDFA 4A3LK 1YNJA 3HOZC 3M4OK 1TWGK 3GTMK 3RZOK 3S15K 4G7OA 5IP7K 4MEYA 3H0GK 2E2IK 3K7AK 4LJZA 3CQZC 3HOUK 2A69A 5C44C 4BBRC 1TWGC 3GTPK 4A3FC 3GTLC 4C3JK 1TWHC 1TWAK 3FKIC 2A6HA 4OIOA 4AYBL 2NVQK 2WAQD 5C3EK 1Y1WC 3I4MK 2E2JC 4A3EK 4XSZA 5C4JC 4Q4ZA 4JK1A 4A3CK 1Y1VK 3HKZL 2R92C 3M3YK 2R93C 4BY7K 3I4NK 3HOUC 4Y7NC 4KN4A 3GTOK 4A3JC 4C2MK 4MEXA 4LLGA 3S17C 3S1NC 1R9TC 3PO3C 3S1RC 4X6AC 2Y0SD 1TWCK 3GTKK 4XSXA 4A3BK 5D4DA 3HOXK 3GTOC 4OINA 2A68A 2O5IA 3GTQC 4BY7C 3HKZD 5TMFA 5IYBK 2NVTK 5IYBC 2NVTC 5M5WK 2R92K 4BXXK 3HOVK 2PA8D 4A93C 3HOXC 3S2HK 2VUMK 4X6AK 2Y0SL 2YU9C 1R9TK 5C3EC 1SMYA 3S14K 3S17K 3S1NK 4KMUA 5TMCA 1TWAC 1I6VA 4C3HK 3H3VD 1TWHK 1I50K 2WAQL 3HOWC 2R93K 3GTPC 2O5JA 1ZYRA 3CQZK 4A3CC 2JA6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H A;  3S1Q K;  4BY1 K;  5IP9 K;  3GTG K;  3S16 C;  4OIQ A;  2NVQ C;  3GTJ C;  4LK1 A;  3HOY K;  2WB1 L;  4YG2 A;  4A3I C;  4A3F K;  3GTL K;  3S16 K;  4BBR K;  1SFO C;  4A3G K;  4Y52 C;  4BY1 C;  3GTG C;  1WCM C;  4YFX A;  1WCM K;  5M5Y K;  4A3K K;  2JA6 K;  4A3G C;  5C4J K;  1I3Q K;  1K83 C;  3RZO C;  3S15 C;  1XPP A;  4G7Z A;  3DXJ A;  4AYB D;  3S2D C;  4MQ9 A;  5IYC K;  3GTJ K;  3S14 C;  2NVY C;  5IYD C;  2JA7 C;  3WOD A;  4A3M K;  4A3D C;  2VUM C;  1I6H C;  2E2H K;  3S2H C;  5IP9 C;  3S1Q C;  4YFK A;  2JA8 K;  1IW7 A;  5C4X C;  2CW0 A;  3S1M C;  4Q5S A;  2JA5 K;  2R7Z C;  3HOW K;  3GTQ K;  1TWF K;  3PO2 C;  1I50 C;  5FJ8 K;  4A3B C;  4BBS C;  1YNN A;  3GTK C;  5FLM K;  2B63 K;  3S1R K;  4QIW D;  3RZD C;  2NVX C;  5M3M K;  2NVX K;  2YU9 K;  1HQM A;  5FLM C;  5M3F K;  2A6E A;  4LK0 A;  4QJV B;  2PMZ L;  4XLP A;  4OIR A;  4A93 K;  3HOV C;  3PO2 K;  2JA5 C;  2PPB A;  4BXX C;  2PMZ D;  1Y1V C;  5M5X K;  4KN7 A;  4QJV A;  2BE5 A;  1TWC C;  2E2H C;  3I4M C;  4A3M C;  1I6H K;  1Y1W K;  3PO3 K;  2JA7 K;  3RZD K;  2B63 C;  5IYC C;  4YFN A;  4GZY A;  4A3J K;  4BBS K;  4Y7N K;  1TWF C;  3I4N C;  2R7Z K;  3EQL A;  3M3Y C;  3H3V L;  4OIP A;  1I3Q C;  1K83 K;  5C44 K;  3S1M K;  3S2D K;  5C4X K;  4A3K C;  2JA8 C;  3K7A C;  3H0G C;  4ZH4 A;  4A3E C;  2E2I C;  4XLN A;  2E2J K;  5IP7 C;  4A3D K;  1SFO K;  4QIW L;  3GTM C;  2PA8 L;  4Y52 K;  2NVY K;  4C3I K;  2WB1 D;  3HOZ K;  3M4O C;  4A3I K;  5IYD K;  4A3L C;  3FKI K;  3HOY C;  4NOI A;  1BDF A;  4A3L K;  1YNJ A;  3HOZ C;  3M4O K;  1TWG K;  3GTM K;  3RZO K;  3S15 K;  4G7O A;  5IP7 K;  4MEY A;  3H0G K;  2E2I K;  3K7A K;  4LJZ A;  3CQZ C;  3HOU K;  2A69 A;  5C44 C;  4BBR C;  1TWG C;  3GTP K;  4A3F C;  3GTL C;  4C3J K;  1TWH C;  1TWA K;  3FKI C;  2A6H A;  4OIO A;  4AYB L;  2NVQ K;  2WAQ D;  5C3E K;  1Y1W C;  3I4M K;  2E2J C;  4A3E K;  4XSZ A;  5C4J C;  4Q4Z A;  4JK1 A;  4A3C K;  1Y1V K;  3HKZ L;  2R92 C;  3M3Y K;  2R93 C;  4BY7 K;  3I4N K;  3HOU C;  4Y7N C;  4KN4 A;  3GTO K;  4A3J C;  4C2M K;  4MEX A;  4LLG A;  3S17 C;  3S1N C;  1R9T C;  3PO3 C;  3S1R C;  4X6A C;  2Y0S D;  1TWC K;  3GTK K;  4XSX A;  4A3B K;  5D4D A;  3HOX K;  3GTO C;  4OIN A;  2A68 A;  2O5I A;  3GTQ C;  4BY7 C;  3HKZ D;  5TMF A;  5IYB K;  2NVT K;  5IYB C;  2NVT C;  5M5W K;  2R92 K;  4BXX K;  3HOV K;  2PA8 D;  4A93 C;  3HOX C;  3S2H K;  2VUM K;  4X6A K;  2Y0S L;  2YU9 C;  1R9T K;  5C3E C;  1SMY A;  3S14 K;  3S17 K;  3S1N K;  4KMU A;  5TMC A;  1TWA C;  1I6V A;  4C3H K;  3H3V D;  1TWH K;  1I50 K;  2WAQ L;  3HOW C;  2R93 K;  3GTP C;  2O5J A;  1ZYR A;  3CQZ K;  4A3C C;  2JA6 C; 
#chains in the Genus database with same CATH topology
 3TTG A;  3T02 A;  1R9T A;  2V6T A;  4LK1 A;  4YG2 A;  1WSR A;  3S16 K;  2R92 A;  4KM8 A;  1K83 C;  3RZO C;  3SZZ A;  1XPP A;  1KQ4 A;  4BKW A;  2RGR A;  2NVY C;  3WOD A;  1IW7 A;  3A8I A;  3GIR A;  4GTB A;  4C3H C;  3GEH A;  5FLM K;  2NVX K;  4KB4 A;  2YU9 K;  1HQM A;  1HI9 A;  4OIR A;  3HOV C;  4GTE A;  1ZBS A;  1ISE A;  2PMZ D;  5M5X K;  3GTO A;  1O2B A;  3CQZ A;  1TWC C;  3VA7 A;  3PO3 K;  5L46 A;  2JA7 K;  2B63 C;  3Q3Q A;  3GTJ A;  3GSI A;  1ZQ1 C;  2R7Z K;  4OIP A;  1I3Q C;  3S1M K;  3AD8 C;  1F7U A;  5C4X K;  4A3K C;  4KM9 A;  4ZH4 A;  4A3E C;  2E2I C;  4Y52 K;  5IP7 C;  4A3D K;  1SFO K;  4QIW L;  5IYD K;  4C3I K;  3AQP A;  1O27 A;  4C3J C;  1DD5 A;  5IP7 K;  3GTM A;  2E2I K;  4WJ4 A;  4G0W A;  3CQZ C;  3HOU K;  2NVX A;  1INN A;  4KAR A;  1TWG C;  4A3F C;  3LPX A;  3AD7 C;  5CJ9 A;  1O25 A;  1TWH C;  3FOF A;  2A6H A;  4OIO A;  1IS1 A;  4AYB L;  2WAQ D;  4J3N A;  2NVQ K;  1K83 A;  2RH6 A;  4XSZ A;  4JK1 A;  1B4A A;  2JA7 A;  1BGW A;  2R92 C;  2R93 C;  3I4N K;  2FQT A;  1WQF A;  4Y7N C;  4KN4 A;  3GTO K;  1WOS A;  1B4B A;  4C2M K;  4FZB A;  3S17 C;  3MML B;  1IE0 A;  1UV7 A;  3L4K A;  4BY7 C;  3LAJ A;  3A8J A;  3CAG A;  4XCH A;  1O2A A;  1EFW A;  3AD9 C;  5JVO A;  1SMY A;  3S17 K;  4C2M C;  1I6V A;  1I50 K;  2R93 K;  2O5J A;  1ZYR A;  4G7H A;  1J98 A;  3S16 C;  2NVQ C;  4ILD A;  3HOY K;  2WB1 L;  3GDZ A;  4A3F K;  4A3G K;  1J6W A;  1WCM C;  2D6F C;  1ZVU A;  5IOR A;  2XCO A;  4G7Z A;  1EK8 A;  4AYB D;  5CHP A;  4MQ9 A;  1USM A;  5IYD C;  4A3M K;  4A3D C;  2VUM C;  4LOW A;  1WOO A;  5C4X C;  3L4J A;  2CW0 A;  3S1M C;  4Q5S A;  2JA5 K;  2R7Z C;  3GTQ K;  1F93 A;  1XZP A;  2B63 K;  3S1R K;  1IQ0 A;  3V4G A;  5M3F K;  4LK0 A;  2GSU A;  4A93 K;  3PO2 K;  4BXX C;  3TFH A;  1Y1V C;  3GTQ A;  4KN7 A;  4QJV A;  2E2H C;  2JH3 A;  1I6H K;  1J6X A;  5IYC C;  4GZY A;  4A3J K;  1TWH A;  3S2D K;  5C44 K;  3K7A C;  3GTM C;  2PA8 L;  2NVY K;  2WB1 D;  4A3I K;  3FKI K;  1BDF A;  1YNJ A;  3HOZ C;  3M4O K;  3BUE A;  3RZO K;  2CFA B;  4G7O A;  3ERE D;  4LR2 A;  2A69 A;  3FKI A;  1Y1V A;  1TWF A;  2XCQ A;  3A8K A;  1V5V A;  2V6S A;  5C3E K;  1YCL A;  2E2J C;  4Q4Z A;  2R93 A;  1BJT A;  2W7V A;  3M3Y K;  3JST A;  4BLB A;  4RMF A;  1C0A A;  4KB2 A;  4MEX A;  4LLG A;  1O24 A;  3N3Y A;  1XXB A;  3H0G A;  4X6A C;  4G0V A;  2Y0S D;  3GTK K;  1O2F B;  4A3B K;  2O5I A;  1VJE A;  5IYB C;  3AQO A;  2B63 A;  3S2H K;  3OEP A;  5C3E C;  3GTG A;  3S14 K;  4KMU A;  5EGH A;  1XZP B;  3HOW C;  3SZY A;  5C4J C;  4A3C C;  2JA6 C;  3S1Q K;  3GTG K;  5IP9 K;  4P5A A;  1I3Q A;  1WQH A;  3N0B A;  3GTJ C;  4A3I C;  3GTL K;  1VH2 A;  2FQO A;  4BY1 C;  3GTK A;  4YFX A;  1WOR A;  1X31 C;  2P8T A;  4WIL A;  3S2D C;  3DXJ A;  1EQR A;  2XCR B;  4KDD A;  5IYC K;  3GTJ K;  4KMH A;  1I6H C;  2E2H K;  5IP9 C;  3S1Q C;  2GAG C;  4YFK A;  2EBB A;  3HOW K;  3PO2 C;  5FJ8 K;  4DDQ A;  1YNN A;  2PHC B;  1WCM A;  4LQY A;  2A6E A;  4QJV B;  2JA5 C;  2PPB A;  3TFJ A;  2YU9 A;  2BE5 A;  3I4M C;  4A3M C;  1Y1W K;  3ADA C;  3RZD K;  4FM9 A;  4YFN A;  4BBS K;  1YX2 A;  3FHZ A;  1TWF C;  3M3Y C;  3H3V L;  2JA8 C;  1XZQ A;  3H0G C;  2JA6 A;  2E2J K;  1Y1W A;  3ORE A;  4G0U A;  3OPF A;  4A3L C;  3HOY C;  4NOI A;  4A3L K;  1TWG A;  1PJ6 A;  3G4C A;  3S15 K;  1VGX A;  1F7V A;  3H0G K;  4GTA A;  3BP3 A;  4LJZ A;  2CFA A;  4BBR C;  4KMA A;  2NVY A;  1RU0 A;  1F9N A;  2JA5 A;  3FKI C;  1Y1W C;  5EGE A;  4M1X A;  3I4M K;  2E2H A;  2VUM A;  4GTC A;  1WOP A;  1JVI A;  4BY7 K;  5E68 A;  1EI6 A;  2ZFZ A;  4A3J C;  3S1N C;  1WIH A;  3LAP A;  1R9T C;  4PAB A;  1TWC A;  4XSX A;  5IOS A;  5D4D A;  3HOX K;  3GTO C;  4OIN A;  3HXA A;  1EH1 A;  5IOT A;  3GTL A;  3HKZ D;  2NVT K;  2R92 K;  2NVT C;  4BXX K;  2PA8 D;  4A93 C;  3HOX C;  1O28 A;  1VRQ C;  2Y0S L;  1R9T K;  3S1N K;  1PJ5 A;  3G4A A;  1TWH K;  2WAQ L;  2ZUE A;  3CQZ K;  3HOU C;  1DCO A;  3AH5 A;  4BY1 K;  1IL2 A;  4KMD A;  4P9S A;  4KAW X;  4OIQ A;  3BP8 C;  4GTF A;  3GTP A;  4C3I C;  1WQG A;  4BBR K;  1SFO C;  2ZUF A;  4Y52 C;  3GTG C;  5M5Y K;  1WCM K;  4A3K K;  4GTL A;  2JA6 K;  1DCP A;  2V6U A;  5C4J K;  4A3G C;  1I3Q K;  3S15 C;  1IBA A;  1ZXO A;  3IPJ A;  4KAT A;  3S14 C;  2JA7 C;  3S2H C;  1XZQ B;  1I50 A;  2JA8 K;  1AB4 A;  1L0W A;  3TFI A;  2R7Z A;  1TWF K;  1I50 C;  4GFQ A;  1TWA A;  4A3B C;  5JFE A;  4BBS C;  4P5B A;  3GTK C;  4QIW D;  3RZD C;  2NVX C;  5M3M K;  2KWA A;  5FLM C;  5HL8 A;  4XLP A;  2PMZ L;  1VLO A;  1O26 A;  1XXA A;  1XXC A;  4BLA A;  3N0C A;  1SFO A;  4PAA A;  3GEE A;  4O2D A;  2GSN A;  3QX3 A;  4Y7N K;  3I4N C;  3EQL A;  4WJ3 M;  3NUH A;  1K83 K;  1G51 A;  4XLN A;  2GSO A;  4KAS A;  3HOZ K;  3M4O C;  5TJ3 A;  1TWG K;  3GTM K;  4MEY A;  3K7A K;  2P5M A;  2GAH C;  5C44 C;  4GTD A;  3GTP K;  1WSV A;  3GTL C;  4C3J K;  1USO A;  2Y3P A;  1TWA K;  3FOE A;  5IOQ A;  4A3E K;  4A3C K;  1Y1V K;  3HKZ L;  1GE9 A;  4AH6 A;  3S0X A;  3T01 A;  1BS2 A;  3GEI A;  3T00 A;  4GT9 A;  2E2I A;  4KC6 A;  3PO3 C;  1DCH A;  3S1R C;  1TWC K;  2A68 A;  4C45 A;  3GTQ C;  5TMF A;  5IYB K;  5M5W K;  3HOV K;  1JQW A;  2VUM K;  1J6V A;  4X6A K;  2YU9 C;  1PJ7 A;  5TMC A;  1TWA C;  4C3H K;  3H3V D;  1O29 A;  1JOE A;  3GTP C; 
#chains in the Genus database with same CATH homology
 4G7H A;  3S1Q K;  4BY1 K;  5IP9 K;  3GTG K;  3S16 C;  4OIQ A;  2NVQ C;  3GTJ C;  4LK1 A;  3HOY K;  2WB1 L;  4YG2 A;  4A3I C;  4A3F K;  3GTL K;  3S16 K;  4BBR K;  1SFO C;  4A3G K;  4Y52 C;  4BY1 C;  3GTG C;  1WCM C;  4YFX A;  1WCM K;  5M5Y K;  4A3K K;  2JA6 K;  4A3G C;  5C4J K;  1I3Q K;  1K83 C;  3RZO C;  3S15 C;  1XPP A;  4G7Z A;  3DXJ A;  4AYB D;  3S2D C;  4MQ9 A;  5IYC K;  3GTJ K;  3S14 C;  2NVY C;  5IYD C;  2JA7 C;  3WOD A;  4A3M K;  4A3D C;  2VUM C;  1I6H C;  2E2H K;  3S2H C;  5IP9 C;  3S1Q C;  4YFK A;  2JA8 K;  1IW7 A;  5C4X C;  2CW0 A;  3S1M C;  4Q5S A;  2JA5 K;  2R7Z C;  3HOW K;  3GTQ K;  1TWF K;  3PO2 C;  1I50 C;  5FJ8 K;  4A3B C;  4BBS C;  1YNN A;  3GTK C;  5FLM K;  2B63 K;  3S1R K;  4QIW D;  3RZD C;  2NVX C;  5M3M K;  2NVX K;  2YU9 K;  1HQM A;  5FLM C;  5M3F K;  2A6E A;  4LK0 A;  4QJV B;  2PMZ L;  4XLP A;  4OIR A;  4A93 K;  3HOV C;  3PO2 K;  2JA5 C;  2PPB A;  4BXX C;  2PMZ D;  1Y1V C;  5M5X K;  4KN7 A;  4QJV A;  2BE5 A;  1TWC C;  2E2H C;  3I4M C;  4A3M C;  1I6H K;  1Y1W K;  3PO3 K;  2JA7 K;  3RZD K;  2B63 C;  5IYC C;  4YFN A;  4GZY A;  4A3J K;  4BBS K;  4Y7N K;  1TWF C;  3I4N C;  2R7Z K;  3EQL A;  3M3Y C;  3H3V L;  4OIP A;  1I3Q C;  1K83 K;  5C44 K;  3S1M K;  3S2D K;  5C4X K;  4A3K C;  2JA8 C;  3K7A C;  3H0G C;  4ZH4 A;  4A3E C;  2E2I C;  4XLN A;  2E2J K;  5IP7 C;  4A3D K;  1SFO K;  4QIW L;  3GTM C;  2PA8 L;  4Y52 K;  2NVY K;  4C3I K;  2WB1 D;  3HOZ K;  3M4O C;  4A3I K;  5IYD K;  4A3L C;  3FKI K;  3HOY C;  4NOI A;  1BDF A;  4A3L K;  1YNJ A;  3HOZ C;  3M4O K;  1TWG K;  3GTM K;  3RZO K;  3S15 K;  4G7O A;  5IP7 K;  4MEY A;  3H0G K;  2E2I K;  3K7A K;  4LJZ A;  3CQZ C;  3HOU K;  2A69 A;  5C44 C;  4BBR C;  1TWG C;  3GTP K;  4A3F C;  3GTL C;  4C3J K;  1TWH C;  1TWA K;  3FKI C;  2A6H A;  4OIO A;  4AYB L;  2NVQ K;  2WAQ D;  5C3E K;  1Y1W C;  3I4M K;  2E2J C;  4A3E K;  4XSZ A;  5C4J C;  4Q4Z A;  4JK1 A;  4A3C K;  1Y1V K;  3HKZ L;  2R92 C;  3M3Y K;  2R93 C;  4BY7 K;  3I4N K;  3HOU C;  4Y7N C;  4KN4 A;  3GTO K;  4A3J C;  4C2M K;  4MEX A;  4LLG A;  3S17 C;  3S1N C;  1R9T C;  3PO3 C;  3S1R C;  4X6A C;  2Y0S D;  1TWC K;  3GTK K;  4XSX A;  4A3B K;  5D4D A;  3HOX K;  3GTO C;  4OIN A;  2A68 A;  2O5I A;  3GTQ C;  4BY7 C;  3HKZ D;  5TMF A;  5IYB K;  2NVT K;  5IYB C;  2NVT C;  5M5W K;  2R92 K;  4BXX K;  3HOV K;  2PA8 D;  4A93 C;  3HOX C;  3S2H K;  2VUM K;  4X6A K;  2Y0S L;  2YU9 C;  1R9T K;  5C3E C;  1SMY A;  3S14 K;  3S17 K;  3S1N K;  4KMU A;  5TMC A;  1TWA C;  1I6V A;  4C3H K;  3H3V D;  1TWH K;  1I50 K;  2WAQ L;  3HOW C;  2R93 K;  3GTP C;  2O5J A;  1ZYR A;  3CQZ K;  4A3C C;  2JA6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...