4BXXK

Arrested rna polymerase ii-bye1 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bxxK00
3S2DC 4BBSK 4LK0A 1I50C 4YFKA 5C3EC 3S1MK 2PPBA 4A3CC 3GTKC 4BXXK 4A3FK 2JA5K 4BXXC 2A6EA 2JA5C 1TWCK 3H3VL 1TWCC 1K83C 4C3JK 4OIOA 4A3KC 4X6AC 3HOVC 5IYDK 3K7AK 4A3IK 4A3IC 1I6HK 5IYCC 1Y1WK 3S15C 4BBRC 5C4JK 4LJZA 2R7ZK 1HQMA 4OIQA 1ZYRA 1TWHK 2Y0SD 3S2HK 3S2HC 1TWHC 3PO3K 3I4NK 3PO3C 3GTMK 5IYBK 4MEXA 4Q5SA 4G7HA 2NVXK 2NVXC 2E2IK 4A3LK 2WAQD 5D4DA 2PMZL 3S1RC 4BY7K 3HKZD 3GTLK 3DXJA 4BY7C 4Y7NK 5M3MK 5FLMK 4Y7NC 3HKZL 5FLMC 4QJVB 3RZOC 3S1QC 3RZDK 3RZDC 4BBSC 3S16K 5M5WK 2E2HK 3S1MC 1I6VA 2E2HC 3H3VD 1WCMK 3GTGK 4C3HK 1WCMC 3FKIK 4A3FC 4ZH4A 4AYBD 4A3JK 5IP7K 2E2JK 2E2JC 3GTGC 3I4MK 3H0GK 4AYBL 3GTQK 4BY1K 3H0GC 3I4MC 1XPPA 3S1NC 5IP9K 3S1NK 5IP9C 5IYDC 3HOZK 2VUMK 3K7AC 4YFNA 5M5YK 3HOZC 1TWAK 3PO2K 1I6HC 2O5IA 1Y1WC 3PO2C 5C4JC 2R7ZC 1YNNA 5C44K 2NVQK 3HOXK 5C44C 2NVQC 3I4NC 4A3GK 3GTMC 1TWFK 5IYBC 4A3GC 1R9TK 4G7ZA 4A3EK 1R9TC 4A3EC 2R93K 4A93K 2PMZD 2E2IC 3HOWK 4A3DK 2R93C 4A3LC 4C2MK 3M4OK 4Y52K 5M5XK 2JA6K 2A68A 4KN4A 2JA8K 2A69A 2NVYK 5TMFA 3GTLC 2BE5A 2NVYC 1TWGK 3HOYK 5C4XK 1TWGC 3HOYC 4C3IK 3HOUK 1IW7A 3WODA 3HOUC 3S16C 4A3BK 4A3BC 2YU9K 2WB1D 3FKIC 4YFXA 5M3FK 4A3JC 2YU9C 5IP7C 3GTOC 3GTOK 2WB1L 4KN7A 1I3QK 3GTQC 4BY1C 1I3QC 4YG2A 1BDFA 1SMYA 4LK1A 3M3YK 2O5JA 4G7OA 2VUMC 3M3YC 1TWAC 3GTPK 4A3MK 4OIPA 4A3MC 2CW0A 2JA7K 4GZYA 2JA7C 2PA8L 3HOXC 3CQZK 3CQZC 1TWFC 4NOIA 3HOWC 3S2DK 4A93C 1I50K 5C3EK 4Y52C 3M4OC 4A3CK 4A3DC 3GTKK 4XSXA 2JA6C 3S14K 1Y1VK 3S14C 2JA8C 1Y1VC 4JK1A 4QJVA 1K83K 4QIWD 5C4XC 3GTJK 4A3KK 4X6AK 3GTJC 4QIWL 3HOVK 1SFOK 1SFOC 5IYCK 5FJ8K 3S15K 3EQLA 4BBRK 4Q4ZA 4LLGA 2Y0SL 3S17K 3S17C 4OINA 2B63K 2B63C 4KMUA 3GTPC 4XSZA 2A6HA 2PA8D 4MQ9A 4MEYA 2NVTK 2NVTC 4XLNA 2R92K 3S1RK 2WAQL 2R92C 1YNJA 3RZOK 3S1QK 4OIRA 5TMCA 4XLPA
chains in the Genus database with same CATH superfamily
4LK0A 1I50C 3NUHA 4A3CC 2YU9A 4A3FK 1VRQC 4KB4A 3H3VL 1BJTA 5IOTA 4A3IC 3S15C 5C4JK 2JA7A 3V4GA 2D6FC 3I4NK 3PO3C 4OIRA 3GEEA 4GTLA 3S0XA 2PMZL 3QX3A 3A8IA 3HKZD 3DXJA 3MMLB 4Y7NK 4BY7C 3LAJA 4QJVB 3RZDK 5E68A 4BBSC 5IOQA 1X31C 1SFOA 3S1MC 4KATA 1DCOA 1WCMK 3GTGK 3ERED 1WSRA 5IP7K 4AYBL 4C3JC 1F7VA 4BY1K 3GTQK 1XPPA 3S1NC 3G4CA 4GTEA 2B63A 5M5YK 4XCHA 1Y1WC 2ZUEA 3PO2C 4KC6A 5C44K 3GEHA 4A3GK 3GTMC 1TWFK 3LPXA 5EGHA 4A3EC 4A93K 1WOPA 4A3DK 2R93C 3GTKA 4LOWA 2JA6K 4GTDA 4GTFA 2A69A 2NVYC 4AH6A 1TWGC 3HOYC 4C3IK 4BKWA 4A3BK 2WB1D 2YU9C 3GTOK 4A3JC 1JVIA 1I3QK 3JSTA 2O5JA 1DCHA 4A3MK 4OIPA 2JA7C 4FZBA 4NOIA 1EFWA 1V5VA 1WCMA 4XSXA 3GTGA 1INNA 1K83K 2Y3PA 3HOVK 3Q3QA 1SFOC 1ISEA 3T00A 1O29A 5JFEA 1IQ0A 3L4KA 1TWFA 5JVOA 3OEPA 2B63C 4KMUA 2P5MA 2PA8D 4MQ9A 1XZQA 4KMAA 3GTLA 1YNJA 3RZOK 4WJ3M 4XLPA 3S2DC 1BGWA 1O2FB 2XCOA 4YFKA 2PPBA 3BP8C 3L4JA 4M1XA 3GTKC 3FKIA 3GTOA 1IBAA 1TWCK 1J98A 1I3QA 4OIOA 3FOEA 4KM9A 4BBRC 3T02A 2R7ZK 4OIQA 1L0WA 3OPFA 4MEXA 1B4BA 1J6WA 2RH6A 2NVXK 1DD5A 1O27A 3HXAA 5IORA 2E2IK 2PHCB 1HI9A 1XXAA 4Y7NC 1K83A 4GTCA 2GSUA 3RZDC 2CFAA 4C3HK 1WCMC 2E2JK 3GTGC 4ZH4A 3FOFA 2V6SA 3I4MK 5IP9K 5IYDC 2VUMK 3K7AC 4YFNA 3GTPA 1TWAK 1IE0A 1I6HC 3AD8C 1YNNA 1XXCA 2NVQK 5C44C 2FQOA 1XZPB 5IYBC 4A3GC 1WORA 4Y52K 4A3LC 3ADAC 5M5XK 3TFIA 3FHZA 2A68A 4KN4A 2JA8K 1F7UA 3GTLC 5TMFA 1TWCA 4KM8A 4C3IC 3S16C 4A3BC 1PJ5A 3FKIC 4YFXA 5M3FK 3GTOC 1J6VA 1I3QC 3M3YK 2NVXA 4A3MC 4DDQA 4KDDA 2PA8L 3HOXC 1C0AA 3CQZK 3LAPA 3HOWC 1I50K 1WSVA 4C2MC 3M4OC 4A3CK 1O2BA 3GEIA 3VA7A 1Y1VK 1EH1A 4QJVA 4RMFA 5C4XC 3GTJK 4QIWL 1O25A 5IOSA 3S15K 3EQLA 4LLGA 2P8TA 1WOOA 3IPJA 3G4AA 4GTAA 3S17K 1YX2A 3GTPC 1USMA 4G0UA 4XSZA 3SZZA 4MEYA 4BBSK 1G51A 5C3EC 3S1MK 2GSOA 2XCQA 4BXXK 2JA5K 4KAWX 4LR2A 3GTQA 1TWCC 4C3JK 1WQGA 1F9NA 4A3KC 4X6AC 2FQTA 1VJEA 2JH3A 5IYCC 1Y1WK 4LJZA 3S2HK 1HQMA 1TWHK 3BUEA 4PAAA 3CQZA 3GTMK 1VGXA 1USOA 3A8JA 4GT9A 2NVXC 2WAQD 3AH5A 2JA6A 1Y1VA 3S1RC 1ZVUA 5FLMK 4G0WA 3HKZL 3S1QC 1XXBA 3GTJA 1B4AA 5M5WK 1VH2A 2E2HK 4A3FC 4AYBD 4C3HC 4A3JK 2E2JC 3I4MC 3H0GK 5IP9C 4J3NA 3HOZK 1AB4A 5C4JC 2NVQC 3I4NC 3CAGA 1R9TK 4KB2A 1J6XA 1IL2A 2JA5A 3GIRA 3N3YA 4PABA 1O26A 5L46A 3HOUK 2GAGC 1F93A 2XCRB 4GTBA 5HL8A 1YCLA 2EBBA 5IP7C 1TWHA 1PJ7A 2WB1L 3GTQC 4BY1C 3AQPA 4WJ4A 4YG2A 1SMYA 4G7OA 3M3YC 2CW0A 1KQ4A 3CQZC 1TWFC 1GE9A 4A93C 3S2DK 4A3DC 2E2HA 3GTKK 2JA6C 3S14K 1Y1VC 1EK8A 3H0GA 3GTJC 1WQFA 2R7ZA 4BBRK 3T01A 1O2AA 1ZXOA 4P5BA 1R9TA 3S17C 2E2IA 4BLAA 2NVTK 4C45A 2V6UA 4XLNA 1XZPA 2R92K 1WQHA 2WAQL 2GSNA 5TMCA 3BP3A 4KMHA 4BLBA 4BXXC 2A6EA 2JA5C 1EQRA 1K83C 3HOVC 5IYDK 2VUMA 3K7AK 4A3IK 1TWAA 1I6HK 3AD9C 1ZYRA 3S2HC 2Y0SD 1TWHC 3PO3K 5IYBK 4Q5SA 4G7HA 3N0BA 4A3LK 5D4DA 4G0VA 4BY7K 3GTLK 5M3MK 3RZOC 5FLMC 1UV7A 2KWAA 5CJ9A 3S16K 4KARA 1I6VA 2E2HC 3H3VD 2V6TA 1WIHA 3FKIK 3TTGA 3S1NK 3H0GC 3HOZC 3TFHA 3PO2K 2O5IA 1IS1A 2R7ZC 1XZQB 3GDZA 3HOXK 2R92A 4O2DA 4G7ZA 4A3EK 3GSIA 1R9TC 2R93K 1DCPA 2PMZD 1I50A 2E2IC 3HOWK 4C2MK 3M4OK 3A8KA 2NVYK 4P5AA 2BE5A 1TWGK 3HOYK 5C4XK 1O28A 2GAHC 1IW7A 3WODA 3HOUC 2YU9K 3AD7C 5CHPA 4KN7A 1RU0A 1BDFA 4LK1A 2VUMC 2W7VA 1TWAC 3GTPK 2JA7K 4GZYA 4KASA 1WOSA 1VLOA 2ZFZA 2ZUFA 3OREA 4Y52C 5C3EK 2CFAB 1EI6A 3S14C 2JA8C 4JK1A 1BS2A 4QIWD 5EGEA 1O24A 4A3KK 4X6AK 4P9SA 1SFOK 1Y1WA 5IYCK 4KMDA 5FJ8K 1PJ6A 4Q4ZA 3N0CA 2RGRA 1JQWA 3AQOA 1ZQ1C 3SZYA 3GTMA 4LQYA 2Y0SL 4FM9A 4OINA 2B63K 2R93A 3TFJA 2A6HA 2NVTC 5TJ3A 4GFQA 3S1RK 2R92C 2NVYA 1JOEA 4ILDA 3S1QK 1TWGA 1ZBSA 4WILA
chains in the Genus database with same CATH topology
3S2DC 4BBSK 4LK0A 1I50C 4YFKA 5C3EC 3S1MK 2PPBA 4A3CC 3GTKC 4BXXK 4A3FK 2JA5K 4BXXC 2A6EA 2JA5C 1TWCK 3H3VL 1TWCC 1K83C 4C3JK 4OIOA 4A3KC 4X6AC 3HOVC 5IYDK 3K7AK 4A3IK 4A3IC 1I6HK 5IYCC 1Y1WK 3S15C 4BBRC 5C4JK 4LJZA 2R7ZK 1HQMA 4OIQA 1ZYRA 1TWHK 2Y0SD 3S2HK 3S2HC 1TWHC 3PO3K 3I4NK 3PO3C 3GTMK 5IYBK 4MEXA 4Q5SA 4G7HA 2NVXK 2NVXC 2E2IK 4A3LK 2WAQD 5D4DA 2PMZL 3S1RC 4BY7K 3HKZD 3GTLK 3DXJA 4BY7C 4Y7NK 5M3MK 5FLMK 4Y7NC 3HKZL 5FLMC 4QJVB 3RZOC 3S1QC 3RZDK 3RZDC 4BBSC 3S16K 5M5WK 2E2HK 3S1MC 1I6VA 2E2HC 3H3VD 1WCMK 3GTGK 4C3HK 1WCMC 3FKIK 4A3FC 4ZH4A 4AYBD 4A3JK 5IP7K 2E2JK 2E2JC 3GTGC 3I4MK 3H0GK 4AYBL 3GTQK 4BY1K 3H0GC 3I4MC 1XPPA 3S1NC 5IP9K 3S1NK 5IP9C 5IYDC 3HOZK 2VUMK 3K7AC 4YFNA 5M5YK 3HOZC 1TWAK 3PO2K 1I6HC 2O5IA 1Y1WC 3PO2C 5C4JC 2R7ZC 1YNNA 5C44K 2NVQK 3HOXK 5C44C 2NVQC 3I4NC 4A3GK 3GTMC 1TWFK 5IYBC 4A3GC 1R9TK 4G7ZA 4A3EK 1R9TC 4A3EC 2R93K 4A93K 2PMZD 2E2IC 3HOWK 4A3DK 2R93C 4A3LC 4C2MK 3M4OK 4Y52K 5M5XK 2JA6K 2A68A 4KN4A 2JA8K 2A69A 2NVYK 5TMFA 3GTLC 2BE5A 2NVYC 1TWGK 3HOYK 5C4XK 1TWGC 3HOYC 4C3IK 3HOUK 1IW7A 3WODA 3HOUC 3S16C 4A3BK 4A3BC 2YU9K 2WB1D 3FKIC 4YFXA 5M3FK 4A3JC 2YU9C 5IP7C 3GTOC 3GTOK 2WB1L 4KN7A 1I3QK 3GTQC 4BY1C 1I3QC 4YG2A 1BDFA 1SMYA 4LK1A 3M3YK 2O5JA 4G7OA 2VUMC 3M3YC 1TWAC 3GTPK 4A3MK 4OIPA 4A3MC 2CW0A 2JA7K 4GZYA 2JA7C 2PA8L 3HOXC 3CQZK 3CQZC 1TWFC 4NOIA 3HOWC 3S2DK 4A93C 1I50K 5C3EK 4Y52C 3M4OC 4A3CK 4A3DC 3GTKK 4XSXA 2JA6C 3S14K 1Y1VK 3S14C 2JA8C 1Y1VC 4JK1A 4QJVA 1K83K 4QIWD 5C4XC 3GTJK 4A3KK 4X6AK 3GTJC 4QIWL 3HOVK 1SFOK 1SFOC 5IYCK 5FJ8K 3S15K 3EQLA 4BBRK 4Q4ZA 4LLGA 2Y0SL 3S17K 3S17C 4OINA 2B63K 2B63C 4KMUA 3GTPC 4XSZA 2A6HA 2PA8D 4MQ9A 4MEYA 2NVTK 2NVTC 4XLNA 2R92K 3S1RK 2WAQL 2R92C 1YNJA 3RZOK 3S1QK 4OIRA 5TMCA 4XLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D C;  4BBS K;  4LK0 A;  1I50 C;  4YFK A;  5C3E C;  3S1M K;  2PPB A;  4A3C C;  3GTK C;  4BXX K;  4A3F K;  2JA5 K;  4BXX C;  2A6E A;  2JA5 C;  1TWC K;  3H3V L;  1TWC C;  1K83 C;  4C3J K;  4OIO A;  4A3K C;  4X6A C;  3HOV C;  5IYD K;  3K7A K;  4A3I K;  4A3I C;  1I6H K;  5IYC C;  1Y1W K;  3S15 C;  4BBR C;  5C4J K;  4LJZ A;  2R7Z K;  1HQM A;  4OIQ A;  1ZYR A;  1TWH K;  2Y0S D;  3S2H K;  3S2H C;  1TWH C;  3PO3 K;  3I4N K;  3PO3 C;  3GTM K;  5IYB K;  4MEX A;  4Q5S A;  4G7H A;  2NVX K;  2NVX C;  2E2I K;  4A3L K;  2WAQ D;  5D4D A;  2PMZ L;  3S1R C;  4BY7 K;  3HKZ D;  3GTL K;  3DXJ A;  4BY7 C;  4Y7N K;  5M3M K;  5FLM K;  4Y7N C;  3HKZ L;  5FLM C;  4QJV B;  3RZO C;  3S1Q C;  3RZD K;  3RZD C;  4BBS C;  3S16 K;  5M5W K;  2E2H K;  3S1M C;  1I6V A;  2E2H C;  3H3V D;  1WCM K;  3GTG K;  4C3H K;  1WCM C;  3FKI K;  4A3F C;  4ZH4 A;  4AYB D;  4A3J K;  5IP7 K;  2E2J K;  2E2J C;  3GTG C;  3I4M K;  3H0G K;  4AYB L;  3GTQ K;  4BY1 K;  3H0G C;  3I4M C;  1XPP A;  3S1N C;  5IP9 K;  3S1N K;  5IP9 C;  5IYD C;  3HOZ K;  2VUM K;  3K7A C;  4YFN A;  5M5Y K;  3HOZ C;  1TWA K;  3PO2 K;  1I6H C;  2O5I A;  1Y1W C;  3PO2 C;  5C4J C;  2R7Z C;  1YNN A;  5C44 K;  2NVQ K;  3HOX K;  5C44 C;  2NVQ C;  3I4N C;  4A3G K;  3GTM C;  1TWF K;  5IYB C;  4A3G C;  1R9T K;  4G7Z A;  4A3E K;  1R9T C;  4A3E C;  2R93 K;  4A93 K;  2PMZ D;  2E2I C;  3HOW K;  4A3D K;  2R93 C;  4A3L C;  4C2M K;  3M4O K;  4Y52 K;  5M5X K;  2JA6 K;  2A68 A;  4KN4 A;  2JA8 K;  2A69 A;  2NVY K;  5TMF A;  3GTL C;  2BE5 A;  2NVY C;  1TWG K;  3HOY K;  5C4X K;  1TWG C;  3HOY C;  4C3I K;  3HOU K;  1IW7 A;  3WOD A;  3HOU C;  3S16 C;  4A3B K;  4A3B C;  2YU9 K;  2WB1 D;  3FKI C;  4YFX A;  5M3F K;  4A3J C;  2YU9 C;  5IP7 C;  3GTO C;  3GTO K;  2WB1 L;  4KN7 A;  1I3Q K;  3GTQ C;  4BY1 C;  1I3Q C;  4YG2 A;  1BDF A;  1SMY A;  4LK1 A;  3M3Y K;  2O5J A;  4G7O A;  2VUM C;  3M3Y C;  1TWA C;  3GTP K;  4A3M K;  4OIP A;  4A3M C;  2CW0 A;  2JA7 K;  4GZY A;  2JA7 C;  2PA8 L;  3HOX C;  3CQZ K;  3CQZ C;  1TWF C;  4NOI A;  3HOW C;  3S2D K;  4A93 C;  1I50 K;  5C3E K;  4Y52 C;  3M4O C;  4A3C K;  4A3D C;  3GTK K;  4XSX A;  2JA6 C;  3S14 K;  1Y1V K;  3S14 C;  2JA8 C;  1Y1V C;  4JK1 A;  4QJV A;  1K83 K;  4QIW D;  5C4X C;  3GTJ K;  4A3K K;  4X6A K;  3GTJ C;  4QIW L;  3HOV K;  1SFO K;  1SFO C;  5IYC K;  5FJ8 K;  3S15 K;  3EQL A;  4BBR K;  4Q4Z A;  4LLG A;  2Y0S L;  3S17 K;  3S17 C;  4OIN A;  2B63 K;  2B63 C;  4KMU A;  3GTP C;  4XSZ A;  2A6H A;  2PA8 D;  4MQ9 A;  4MEY A;  2NVT K;  2NVT C;  4XLN A;  2R92 K;  3S1R K;  2WAQ L;  2R92 C;  1YNJ A;  3RZO K;  3S1Q K;  4OIR A;  5TMC A;  4XLP A; 
#chains in the Genus database with same CATH topology
 4LK0 A;  1I50 C;  3NUH A;  4A3C C;  2YU9 A;  4A3F K;  1VRQ C;  4KB4 A;  3H3V L;  1BJT A;  5IOT A;  4A3I C;  3S15 C;  5C4J K;  2JA7 A;  3V4G A;  2D6F C;  3I4N K;  3PO3 C;  4OIR A;  3GEE A;  4GTL A;  3S0X A;  2PMZ L;  3QX3 A;  3A8I A;  3HKZ D;  3DXJ A;  3MML B;  4Y7N K;  4BY7 C;  3LAJ A;  4QJV B;  3RZD K;  5E68 A;  4BBS C;  5IOQ A;  1X31 C;  1SFO A;  3S1M C;  4KAT A;  1DCO A;  1WCM K;  3GTG K;  3ERE D;  1WSR A;  5IP7 K;  4AYB L;  4C3J C;  1F7V A;  4BY1 K;  3GTQ K;  1XPP A;  3S1N C;  3G4C A;  4GTE A;  2B63 A;  5M5Y K;  4XCH A;  1Y1W C;  2ZUE A;  3PO2 C;  4KC6 A;  5C44 K;  3GEH A;  4A3G K;  3GTM C;  1TWF K;  3LPX A;  5EGH A;  4A3E C;  4A93 K;  1WOP A;  4A3D K;  2R93 C;  3GTK A;  4LOW A;  2JA6 K;  4GTD A;  4GTF A;  2A69 A;  2NVY C;  4AH6 A;  1TWG C;  3HOY C;  4C3I K;  4BKW A;  4A3B K;  2WB1 D;  2YU9 C;  3GTO K;  4A3J C;  1JVI A;  1I3Q K;  3JST A;  2O5J A;  1DCH A;  4A3M K;  4OIP A;  2JA7 C;  4FZB A;  4NOI A;  1EFW A;  1V5V A;  1WCM A;  4XSX A;  3GTG A;  1INN A;  1K83 K;  2Y3P A;  3HOV K;  3Q3Q A;  1SFO C;  1ISE A;  3T00 A;  1O29 A;  5JFE A;  1IQ0 A;  3L4K A;  1TWF A;  5JVO A;  3OEP A;  2B63 C;  4KMU A;  2P5M A;  2PA8 D;  4MQ9 A;  1XZQ A;  4KMA A;  3GTL A;  1YNJ A;  3RZO K;  4WJ3 M;  4XLP A;  3S2D C;  1BGW A;  1O2F B;  2XCO A;  4YFK A;  2PPB A;  3BP8 C;  3L4J A;  4M1X A;  3GTK C;  3FKI A;  3GTO A;  1IBA A;  1TWC K;  1J98 A;  1I3Q A;  4OIO A;  3FOE A;  4KM9 A;  4BBR C;  3T02 A;  2R7Z K;  4OIQ A;  1L0W A;  3OPF A;  4MEX A;  1B4B A;  1J6W A;  2RH6 A;  2NVX K;  1DD5 A;  1O27 A;  3HXA A;  5IOR A;  2E2I K;  2PHC B;  1HI9 A;  1XXA A;  4Y7N C;  1K83 A;  4GTC A;  2GSU A;  3RZD C;  2CFA A;  4C3H K;  1WCM C;  2E2J K;  3GTG C;  4ZH4 A;  3FOF A;  2V6S A;  3I4M K;  5IP9 K;  5IYD C;  2VUM K;  3K7A C;  4YFN A;  3GTP A;  1TWA K;  1IE0 A;  1I6H C;  3AD8 C;  1YNN A;  1XXC A;  2NVQ K;  5C44 C;  2FQO A;  1XZP B;  5IYB C;  4A3G C;  1WOR A;  4Y52 K;  4A3L C;  3ADA C;  5M5X K;  3TFI A;  3FHZ A;  2A68 A;  4KN4 A;  2JA8 K;  1F7U A;  3GTL C;  5TMF A;  1TWC A;  4KM8 A;  4C3I C;  3S16 C;  4A3B C;  1PJ5 A;  3FKI C;  4YFX A;  5M3F K;  3GTO C;  1J6V A;  1I3Q C;  3M3Y K;  2NVX A;  4A3M C;  4DDQ A;  4KDD A;  2PA8 L;  3HOX C;  1C0A A;  3CQZ K;  3LAP A;  3HOW C;  1I50 K;  1WSV A;  4C2M C;  3M4O C;  4A3C K;  1O2B A;  3GEI A;  3VA7 A;  1Y1V K;  1EH1 A;  4QJV A;  4RMF A;  5C4X C;  3GTJ K;  4QIW L;  1O25 A;  5IOS A;  3S15 K;  3EQL A;  4LLG A;  2P8T A;  1WOO A;  3IPJ A;  3G4A A;  4GTA A;  3S17 K;  1YX2 A;  3GTP C;  1USM A;  4G0U A;  4XSZ A;  3SZZ A;  4MEY A;  4BBS K;  1G51 A;  5C3E C;  3S1M K;  2GSO A;  2XCQ A;  4BXX K;  2JA5 K;  4KAW X;  4LR2 A;  3GTQ A;  1TWC C;  4C3J K;  1WQG A;  1F9N A;  4A3K C;  4X6A C;  2FQT A;  1VJE A;  2JH3 A;  5IYC C;  1Y1W K;  4LJZ A;  3S2H K;  1HQM A;  1TWH K;  3BUE A;  4PAA A;  3CQZ A;  3GTM K;  1VGX A;  1USO A;  3A8J A;  4GT9 A;  2NVX C;  2WAQ D;  3AH5 A;  2JA6 A;  1Y1V A;  3S1R C;  1ZVU A;  5FLM K;  4G0W A;  3HKZ L;  3S1Q C;  1XXB A;  3GTJ A;  1B4A A;  5M5W K;  1VH2 A;  2E2H K;  4A3F C;  4AYB D;  4C3H C;  4A3J K;  2E2J C;  3I4M C;  3H0G K;  5IP9 C;  4J3N A;  3HOZ K;  1AB4 A;  5C4J C;  2NVQ C;  3I4N C;  3CAG A;  1R9T K;  4KB2 A;  1J6X A;  1IL2 A;  2JA5 A;  3GIR A;  3N3Y A;  4PAB A;  1O26 A;  5L46 A;  3HOU K;  2GAG C;  1F93 A;  2XCR B;  4GTB A;  5HL8 A;  1YCL A;  2EBB A;  5IP7 C;  1TWH A;  1PJ7 A;  2WB1 L;  3GTQ C;  4BY1 C;  3AQP A;  4WJ4 A;  4YG2 A;  1SMY A;  4G7O A;  3M3Y C;  2CW0 A;  1KQ4 A;  3CQZ C;  1TWF C;  1GE9 A;  4A93 C;  3S2D K;  4A3D C;  2E2H A;  3GTK K;  2JA6 C;  3S14 K;  1Y1V C;  1EK8 A;  3H0G A;  3GTJ C;  1WQF A;  2R7Z A;  4BBR K;  3T01 A;  1O2A A;  1ZXO A;  4P5B A;  1R9T A;  3S17 C;  2E2I A;  4BLA A;  2NVT K;  4C45 A;  2V6U A;  4XLN A;  1XZP A;  2R92 K;  1WQH A;  2WAQ L;  2GSN A;  5TMC A;  3BP3 A;  4KMH A;  4BLB A;  4BXX C;  2A6E A;  2JA5 C;  1EQR A;  1K83 C;  3HOV C;  5IYD K;  2VUM A;  3K7A K;  4A3I K;  1TWA A;  1I6H K;  3AD9 C;  1ZYR A;  3S2H C;  2Y0S D;  1TWH C;  3PO3 K;  5IYB K;  4Q5S A;  4G7H A;  3N0B A;  4A3L K;  5D4D A;  4G0V A;  4BY7 K;  3GTL K;  5M3M K;  3RZO C;  5FLM C;  1UV7 A;  2KWA A;  5CJ9 A;  3S16 K;  4KAR A;  1I6V A;  2E2H C;  3H3V D;  2V6T A;  1WIH A;  3FKI K;  3TTG A;  3S1N K;  3H0G C;  3HOZ C;  3TFH A;  3PO2 K;  2O5I A;  1IS1 A;  2R7Z C;  1XZQ B;  3GDZ A;  3HOX K;  2R92 A;  4O2D A;  4G7Z A;  4A3E K;  3GSI A;  1R9T C;  2R93 K;  1DCP A;  2PMZ D;  1I50 A;  2E2I C;  3HOW K;  4C2M K;  3M4O K;  3A8K A;  2NVY K;  4P5A A;  2BE5 A;  1TWG K;  3HOY K;  5C4X K;  1O28 A;  2GAH C;  1IW7 A;  3WOD A;  3HOU C;  2YU9 K;  3AD7 C;  5CHP A;  4KN7 A;  1RU0 A;  1BDF A;  4LK1 A;  2VUM C;  2W7V A;  1TWA C;  3GTP K;  2JA7 K;  4GZY A;  4KAS A;  1WOS A;  1VLO A;  2ZFZ A;  2ZUF A;  3ORE A;  4Y52 C;  5C3E K;  2CFA B;  1EI6 A;  3S14 C;  2JA8 C;  4JK1 A;  1BS2 A;  4QIW D;  5EGE A;  1O24 A;  4A3K K;  4X6A K;  4P9S A;  1SFO K;  1Y1W A;  5IYC K;  4KMD A;  5FJ8 K;  1PJ6 A;  4Q4Z A;  3N0C A;  2RGR A;  1JQW A;  3AQO A;  1ZQ1 C;  3SZY A;  3GTM A;  4LQY A;  2Y0S L;  4FM9 A;  4OIN A;  2B63 K;  2R93 A;  3TFJ A;  2A6H A;  2NVT C;  5TJ3 A;  4GFQ A;  3S1R K;  2R92 C;  2NVY A;  1JOE A;  4ILD A;  3S1Q K;  1TWG A;  1ZBS A;  4WIL A; 
#chains in the Genus database with same CATH homology
 3S2D C;  4BBS K;  4LK0 A;  1I50 C;  4YFK A;  5C3E C;  3S1M K;  2PPB A;  4A3C C;  3GTK C;  4BXX K;  4A3F K;  2JA5 K;  4BXX C;  2A6E A;  2JA5 C;  1TWC K;  3H3V L;  1TWC C;  1K83 C;  4C3J K;  4OIO A;  4A3K C;  4X6A C;  3HOV C;  5IYD K;  3K7A K;  4A3I K;  4A3I C;  1I6H K;  5IYC C;  1Y1W K;  3S15 C;  4BBR C;  5C4J K;  4LJZ A;  2R7Z K;  1HQM A;  4OIQ A;  1ZYR A;  1TWH K;  2Y0S D;  3S2H K;  3S2H C;  1TWH C;  3PO3 K;  3I4N K;  3PO3 C;  3GTM K;  5IYB K;  4MEX A;  4Q5S A;  4G7H A;  2NVX K;  2NVX C;  2E2I K;  4A3L K;  2WAQ D;  5D4D A;  2PMZ L;  3S1R C;  4BY7 K;  3HKZ D;  3GTL K;  3DXJ A;  4BY7 C;  4Y7N K;  5M3M K;  5FLM K;  4Y7N C;  3HKZ L;  5FLM C;  4QJV B;  3RZO C;  3S1Q C;  3RZD K;  3RZD C;  4BBS C;  3S16 K;  5M5W K;  2E2H K;  3S1M C;  1I6V A;  2E2H C;  3H3V D;  1WCM K;  3GTG K;  4C3H K;  1WCM C;  3FKI K;  4A3F C;  4ZH4 A;  4AYB D;  4A3J K;  5IP7 K;  2E2J K;  2E2J C;  3GTG C;  3I4M K;  3H0G K;  4AYB L;  3GTQ K;  4BY1 K;  3H0G C;  3I4M C;  1XPP A;  3S1N C;  5IP9 K;  3S1N K;  5IP9 C;  5IYD C;  3HOZ K;  2VUM K;  3K7A C;  4YFN A;  5M5Y K;  3HOZ C;  1TWA K;  3PO2 K;  1I6H C;  2O5I A;  1Y1W C;  3PO2 C;  5C4J C;  2R7Z C;  1YNN A;  5C44 K;  2NVQ K;  3HOX K;  5C44 C;  2NVQ C;  3I4N C;  4A3G K;  3GTM C;  1TWF K;  5IYB C;  4A3G C;  1R9T K;  4G7Z A;  4A3E K;  1R9T C;  4A3E C;  2R93 K;  4A93 K;  2PMZ D;  2E2I C;  3HOW K;  4A3D K;  2R93 C;  4A3L C;  4C2M K;  3M4O K;  4Y52 K;  5M5X K;  2JA6 K;  2A68 A;  4KN4 A;  2JA8 K;  2A69 A;  2NVY K;  5TMF A;  3GTL C;  2BE5 A;  2NVY C;  1TWG K;  3HOY K;  5C4X K;  1TWG C;  3HOY C;  4C3I K;  3HOU K;  1IW7 A;  3WOD A;  3HOU C;  3S16 C;  4A3B K;  4A3B C;  2YU9 K;  2WB1 D;  3FKI C;  4YFX A;  5M3F K;  4A3J C;  2YU9 C;  5IP7 C;  3GTO C;  3GTO K;  2WB1 L;  4KN7 A;  1I3Q K;  3GTQ C;  4BY1 C;  1I3Q C;  4YG2 A;  1BDF A;  1SMY A;  4LK1 A;  3M3Y K;  2O5J A;  4G7O A;  2VUM C;  3M3Y C;  1TWA C;  3GTP K;  4A3M K;  4OIP A;  4A3M C;  2CW0 A;  2JA7 K;  4GZY A;  2JA7 C;  2PA8 L;  3HOX C;  3CQZ K;  3CQZ C;  1TWF C;  4NOI A;  3HOW C;  3S2D K;  4A93 C;  1I50 K;  5C3E K;  4Y52 C;  3M4O C;  4A3C K;  4A3D C;  3GTK K;  4XSX A;  2JA6 C;  3S14 K;  1Y1V K;  3S14 C;  2JA8 C;  1Y1V C;  4JK1 A;  4QJV A;  1K83 K;  4QIW D;  5C4X C;  3GTJ K;  4A3K K;  4X6A K;  3GTJ C;  4QIW L;  3HOV K;  1SFO K;  1SFO C;  5IYC K;  5FJ8 K;  3S15 K;  3EQL A;  4BBR K;  4Q4Z A;  4LLG A;  2Y0S L;  3S17 K;  3S17 C;  4OIN A;  2B63 K;  2B63 C;  4KMU A;  3GTP C;  4XSZ A;  2A6H A;  2PA8 D;  4MQ9 A;  4MEY A;  2NVT K;  2NVT C;  4XLN A;  2R92 K;  3S1R K;  2WAQ L;  2R92 C;  1YNJ A;  3RZO K;  3S1Q K;  4OIR A;  5TMC A;  4XLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...