4BXXK

Arrested rna polymerase ii-bye1 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bxxK00
3HOZC 2E2IK 3HOUK 3WODA 2E2JC 5C3EK 1HQMA 4G7ZA 3S1MK 2E2IC 2JA6K 3HOUC 3GTQK 3S1MC 5C3EC 3M3YK 3H0GK 2R7ZK 3I4MK 3GTQC 3S17K 3EQLA 3H0GC 5FJ8K 2CW0A 1R9TK 2JA8K 2PPBA 3I4NK 3I4MC 2R92K 3S17C 3S2HC 1TWFK 1R9TC 2JA8C 3I4NC 2B63K 3GTJK 4G7HA 2R92C 4KN7A 3FKIK 2WB1D 4MEYA 4Q4ZA 3S1RK 3GTJC 2B63C 4Y7NK 1K83K 3FKIC 4GZYA 3S1RC 4A3EK 2JA7K 3S2DK 4Y7NC 1K83C 3S1QK 3HOYC 2JA7C 3HKZL 4A3EC 3HOWK 3S2DC 3S1QC 2A6HA 3HOWC 5C4XK 3PO2K 3GTGK 3GTKK 4C3IK 3M4OK 4LLGA 5C4XC 3PO2C 3GTKC 1WCMK 3GTGC 4A3CK 2Y0SD 1TWGK 3M4OC 4Q5SA 2BE5A 4NOIA 1WCMC 4AYBL 4A3CC 4XLPA 3GTLK 4X6AK 2WAQL 1TWGC 3S14K 5M3FK 3GTLC 3S2HK 3S14C 5IYDK 2A6EA 4QJVA 2O5JA 4OIOA 1ZYRA 2PMZD 5IYDC 4C3HK 3CQZK 1I6HK 3H3VD 4YFKA 4A3BK 3GTMC 2A68A 4C3JK 1YNNA 3CQZC 5C4JK 1Y1WK 2NVQK 3S1NC 1I6HC 1Y1VK 1TWHK 2JA5K 4JK1A 4A3BC 5IP7K 1Y1WC 4OINA 3HKZD 5C4JC 2NVQC 3HOVK 3HOYK 4Y52K 1Y1VC 1TWHC 2JA5C 4A3GK 3DXJA 4LK0A 4Y52C 5IP7C 3HOVC 4X6AC 2NVYK 5D4DA 5C44K 2E2JK 4A3GC 4A3IK 3K7AK 2NVYC 3GTOK 5C44C 3RZOK 1I6VA 4A3IC 4KN4A 3K7AC 3GTOC 4A3DK 4LJZA 5TMFA 4QJVB 4LK1A 4AYBD 3RZOC 4A3DC 3S16K 2VUMK 2PA8L 2R93C 1SMYA 3S16C 2VUMC 4A93K 4YFNA 5M3MK 4KMUA 4QIWL 4A93C 5IP9K 5M5YK 1YNJA 3GTMK 4BXXC 5IP9C 3S1NK 3S15K 2WB1L 1TWAK 4YG2A 1TWCK 1I50K 2E2HK 2NVXK 3GTPK 3S15C 1TWAC 4C2MK 1TWCC 4OIRA 1I50C 2E2HC 2NVXC 3GTPC 4XLNA 4BY7K 4A3LK 1BDFA 4MEXA 4BBSK 2YU9K 4BY7C 4A3LC 5IYCK 3RZDK 5IYBK 4BBSC 3HOXK 2YU9C 5TMCA 5IYCC 3RZDC 5IYBC 2NVTK 2PA8D 5FLMK 3HOXC 1SFOK 4OIQA 2Y0SL 2R93K 2JA6C 2WAQD 2NVTC 5FLMC 1SFOC 3M3YC 2R7ZC 4A3MK 1XPPA 4QIWD 1I3QK 4A3MC 4OIPA 2O5IA 5M5WK 4A3KK 4G7OA 4BXXK 3PO3K 1I3QC 1TWFC 2PMZL 4A3KC 3H3VL 3PO3C 4YFXA 4XSZA 4BY1K 4A3JK 1IW7A 4BBRK 4A3FK 4MQ9A 4BY1C 4A3JC 4BBRC 4A3FC 2A69A 5M5XK 3HOZK 4ZH4A 4XSXA
chains in the Genus database with same CATH superfamily
3LPXA 3HOZC 1UV7A 3HOUK 2P8TA 4GT9A 3WODA 1WOSA 5IOTA 3HOUC 5L46A 3H0GK 1WIHA 5FJ8K 3H0GC 2JA8K 3I4NK 2XCQA 2VUMA 3S2HC 3OEPA 2JA8C 3I4NC 3GTJK 3FKIK 1BJTA 2WB1D 4MEYA 4Q4ZA 4LOWA 4P9SA 3S1RK 3GTJC 3FKIC 3T02A 3S1RC 5IORA 3HKZL 1TWCA 5TJ3A 4C45A 3M4OK 4LLGA 4A3CK 3A8JA 2Y0SD 1L0WA 2YU9A 3N0BA 4DDQA 3M4OC 3OREA 3Q3QA 4NOIA 4A3CC 2WAQL 3S14K 3S14C 2A6EA 2O5JA 1WSRA 3AD8C 1ZYRA 1VGXA 1XZPA 4GTBA 3CQZK 4C3HK 1WSVA 3H3VD 4A3BK 2GSNA 4C3JK 4C3HC 3CQZC 4FM9A 4A3BC 3L4JA 4C3JC 3HOYK 4A3GK 4LK0A 2GAGC 4P5BA 1B4BA 1WOOA 4A3GC 4A3IK 3FOFA 3IPJA 1G51A 4A3IC 4GTDA 4KN4A 1XZQB 3JSTA 3BUEA 2R93C 4YFNA 1KQ4A 4QIWL 2ZUFA 3G4CA 3GTMK 1IS1A 1TWAK 4YG2A 1I50K 2E2HK 1TWAC 1O24A 1I50C 2GSUA 2E2HC 5E68A 1ISEA 3LAJA 2JA7A 4KDDA 5FLMK 2JA6C 5FLMC 3M3YC 1WCMA 1YCLA 1WORA 4KAWX 4KM9A 4G7OA 3GTLA 2PMZL 3BP8C 3QX3A 1ZVUA 4KATA 2ZFZA 3GTMA 1ZBSA 4A3JK 1IW7A 1WOPA 3N3YA 1O27A 4A3JC 2ZUEA 1AB4A 4ZH4A 1XXBA 2E2JK 1PJ6A 2E2IK 5CHPA 2E2JC 1EH1A 1HQMA 4C3IC 5C3EK 1GE9A 2E2IC 5EGEA 5C3EC 2R7ZK 2V6TA 1USMA 2CW0A 1EI6A 2R92K 4G7HA 2R92C 4KN7A 4G0VA 4A3EK 2PHCB 1JVIA 1JOEA 3HOWK 4A3EC 3GTPA 4P5AA 2A6HA 4GTLA 1V5VA 3HOWC 5C4XK 3PO2K 3GTKK 2CFAA 5C4XC 3PO2C 3GTKC 1TWGK 4WJ3M 4AYBL 1TWGC 5M3FK 3S2HK 2R7ZA 5IYDK 4QJVA 1WQGA 4OIOA 4RMFA 5IYDC 2A68A 5C4JK 3S1NC 1Y1VK 1TWHK 3T01A 3HKZD 5C4JC 1Y1VC 1TWHC 3GEIA 3TFIA 2NVYK 2NVYC 1BS2A 3GIRA 1F7VA 5TMFA 5CJ9A 4LK1A 1IQ0A 4GFQA 4A93K 5M3MK 4BKWA 1PJ7A 3H0GA 4A93C 5IP9K 5M5YK 1YNJA 5IP9C 3AD9C 1ZQ1C 2WB1L 3GTJA 2NVXK 5HL8A 3FKIA 2NVXC 4XLNA 4A3LK 3AH5A 1BDFA 4KMHA 3TFHA 4BBSK 4A3LC 5IYBK 4BBSC 1O25A 2GAHC 2XCOA 5IYBC 1SFOK 2Y0SL 2R93K 1SFOC 4QIWD 1I3QK 2O5IA 3HXAA 1I3QC 1TWFC 4KB2A 3H3VL 1EQRA 1J6WA 1C0AA 4GTFA 4WILA 2D6FC 3CQZA 1O2BA 2P5MA 3A8IA 4KARA 3T00A 1J98A 1ZXOA 4QJVB 4PAAA 2XCRB 3TTGA 4G7ZA 3BP3A 2JA6K 3GTQK 3M3YK 3I4MK 3V4GA 3GTQC 1R9TK 3I4MC 2R93A 2PPBA 1R9TC 1VRQC 2B63K 1B4AA 3FOEA 2B63C 1K83K 4GZYA 1USOA 3S2DK 1K83C 4LQYA 3S1QK 5EGHA 1TWAA 3S2DC 3S1QC 1DCOA 1I50A 2E2HA 1XXCA 3GTGK 4C3IK 3GTGC 1XZPB 3GSIA 3GEEA 3AQPA 2JA6A 3SZYA 3ADAC 4GTCA 4YFKA 1J6XA 1Y1WK 2NVQK 2JA5K 4Y52K 3HOVK 1Y1WC 2NVQC 3GDZA 3VA7A 2JA5C 3DXJA 4Y52C 3HOVC 3L4KA 5D4DA 3RZOK 3OPFA 2GSOA 4LJZA 4AYBD 3RZOC 3S16K 2VUMK 2V6SA 2E2IA 1O2FB 2PA8L 3S16C 2VUMC 4KMUA 1HI9A 1IL2A 1VJEA 1XZQA 1X31C 4BXXC 3S1NK 2R92A 1TWCK 4C2MK 1TWCC 2FQOA 1VH2A 4AH6A 3AQOA 2JA5A 4C2MC 4BY7K 4MEXA 2YU9K 4BY7C 4XCHA 3RZDK 5IOQA 2EBBA 2YU9C 5TMCA 3RZDC 3GTKA 4KMDA 2WAQD 1XPPA 4ILDA 3A8KA 3AD7C 5JVOA 1TWGA 1F9NA 1EFWA 3CAGA 4BLAA 5M5WK 1WQFA 4YFXA 1BGWA 4XSZA 2JH3A 3N0CA 5JFEA 4BBRK 4A3FK 2Y3PA 2RH6A 4MQ9A 4BBRC 4A3FC 1Y1VA 1TWHA 4J3NA 5M5XK 5IOSA 4XLPA 2NVYA 3S1MK 1F7UA 3S1MC 2V6UA 4GTEA 4KB4A 3S17K 3EQLA 4G0WA 1EK8A 3S17C 1TWFK 3TFJA 3SZZA 4Y7NK 4BLBA 2CFAB 2JA7K 1O2AA 4Y7NC 1IE0A 1XXAA 3HOYC 2JA7C 3GEHA 1PJ5A 2NVXA 4LR2A 4KMAA 3S0XA 1DCPA 4KASA 1YX2A 1WCMK 4Q5SA 2BE5A 1WCMC 3GTLK 1SFOA 3GTLC 2PMZD 1I6HK 1O28A 3GTMC 1INNA 1TWFA 1J6VA 1YNNA 1I3QA 1I6HC 4JK1A 4X6AK 1O26A 5IP7K 4OINA 4KM8A 4X6AC 5IP7C 1WQHA 5C44K 4O2DA 3ERED 3K7AK 4GTAA 1VLOA 2KWAA 5C44C 3GTOK 1I6VA 3K7AC 3GTOC 4A3DK 1DD5A 4A3DC 1SMYA 3GTQA 4PABA 2W7VA 1R9TA 2RGRA 3S15K 4FZBA 1JQWA 4G0UA 1IBAA 4M1XA 3GTPK 3S15C 2B63A 4OIRA 3GTPC 3G4AA 1K83A 3LAPA 5IYCK 3NUHA 3HOXK 5IYCC 3GTOA 2NVTK 2PA8D 4OIQA 3HOXC 3GTGA 1F93A 3FHZA 2NVTC 2R7ZC 4A3MK 4A3MC 1RU0A 4OIPA 4A3KK 4BXXK 3PO3K 4A3KC 3PO3C 3MMLB 4BY1K 2FQTA 4BY1C 1Y1WA 1DCHA 2A69A 1O29A 4KC6A 3HOZK 4XSXA 4WJ4A
chains in the Genus database with same CATH topology
3HOZC 2E2IK 3HOUK 3WODA 2E2JC 5C3EK 1HQMA 4G7ZA 3S1MK 2E2IC 2JA6K 3HOUC 3GTQK 3S1MC 5C3EC 3M3YK 3H0GK 2R7ZK 3I4MK 3GTQC 3S17K 3EQLA 3H0GC 5FJ8K 2CW0A 1R9TK 2JA8K 2PPBA 3I4NK 3I4MC 2R92K 3S17C 3S2HC 1TWFK 1R9TC 2JA8C 3I4NC 2B63K 3GTJK 4G7HA 2R92C 4KN7A 3FKIK 2WB1D 4MEYA 4Q4ZA 3S1RK 3GTJC 2B63C 4Y7NK 1K83K 3FKIC 4GZYA 3S1RC 4A3EK 2JA7K 3S2DK 4Y7NC 1K83C 3S1QK 3HOYC 2JA7C 3HKZL 4A3EC 3HOWK 3S2DC 3S1QC 2A6HA 3HOWC 5C4XK 3PO2K 3GTGK 3GTKK 4C3IK 3M4OK 4LLGA 5C4XC 3PO2C 3GTKC 1WCMK 3GTGC 4A3CK 2Y0SD 1TWGK 3M4OC 4Q5SA 2BE5A 4NOIA 1WCMC 4AYBL 4A3CC 4XLPA 3GTLK 4X6AK 2WAQL 1TWGC 3S14K 5M3FK 3GTLC 3S2HK 3S14C 5IYDK 2A6EA 4QJVA 2O5JA 4OIOA 1ZYRA 2PMZD 5IYDC 4C3HK 3CQZK 1I6HK 3H3VD 4YFKA 4A3BK 3GTMC 2A68A 4C3JK 1YNNA 3CQZC 5C4JK 1Y1WK 2NVQK 3S1NC 1I6HC 1Y1VK 1TWHK 2JA5K 4JK1A 4A3BC 5IP7K 1Y1WC 4OINA 3HKZD 5C4JC 2NVQC 3HOVK 3HOYK 4Y52K 1Y1VC 1TWHC 2JA5C 4A3GK 3DXJA 4LK0A 4Y52C 5IP7C 3HOVC 4X6AC 2NVYK 5D4DA 5C44K 2E2JK 4A3GC 4A3IK 3K7AK 2NVYC 3GTOK 5C44C 3RZOK 1I6VA 4A3IC 4KN4A 3K7AC 3GTOC 4A3DK 4LJZA 5TMFA 4QJVB 4LK1A 4AYBD 3RZOC 4A3DC 3S16K 2VUMK 2PA8L 2R93C 1SMYA 3S16C 2VUMC 4A93K 4YFNA 5M3MK 4KMUA 4QIWL 4A93C 5IP9K 5M5YK 1YNJA 3GTMK 4BXXC 5IP9C 3S1NK 3S15K 2WB1L 1TWAK 4YG2A 1TWCK 1I50K 2E2HK 2NVXK 3GTPK 3S15C 1TWAC 4C2MK 1TWCC 4OIRA 1I50C 2E2HC 2NVXC 3GTPC 4XLNA 4BY7K 4A3LK 1BDFA 4MEXA 4BBSK 2YU9K 4BY7C 4A3LC 5IYCK 3RZDK 5IYBK 4BBSC 3HOXK 2YU9C 5TMCA 5IYCC 3RZDC 5IYBC 2NVTK 2PA8D 5FLMK 3HOXC 1SFOK 4OIQA 2Y0SL 2R93K 2JA6C 2WAQD 2NVTC 5FLMC 1SFOC 3M3YC 2R7ZC 4A3MK 1XPPA 4QIWD 1I3QK 4A3MC 4OIPA 2O5IA 5M5WK 4A3KK 4G7OA 4BXXK 3PO3K 1I3QC 1TWFC 2PMZL 4A3KC 3H3VL 3PO3C 4YFXA 4XSZA 4BY1K 4A3JK 1IW7A 4BBRK 4A3FK 4MQ9A 4BY1C 4A3JC 4BBRC 4A3FC 2A69A 5M5XK 3HOZK 4ZH4A 4XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ C;  2E2I K;  3HOU K;  3WOD A;  2E2J C;  5C3E K;  1HQM A;  4G7Z A;  3S1M K;  2E2I C;  2JA6 K;  3HOU C;  3GTQ K;  3S1M C;  5C3E C;  3M3Y K;  3H0G K;  2R7Z K;  3I4M K;  3GTQ C;  3S17 K;  3EQL A;  3H0G C;  5FJ8 K;  2CW0 A;  1R9T K;  2JA8 K;  2PPB A;  3I4N K;  3I4M C;  2R92 K;  3S17 C;  3S2H C;  1TWF K;  1R9T C;  2JA8 C;  3I4N C;  2B63 K;  3GTJ K;  4G7H A;  2R92 C;  4KN7 A;  3FKI K;  2WB1 D;  4MEY A;  4Q4Z A;  3S1R K;  3GTJ C;  2B63 C;  4Y7N K;  1K83 K;  3FKI C;  4GZY A;  3S1R C;  4A3E K;  2JA7 K;  3S2D K;  4Y7N C;  1K83 C;  3S1Q K;  3HOY C;  2JA7 C;  3HKZ L;  4A3E C;  3HOW K;  3S2D C;  3S1Q C;  2A6H A;  3HOW C;  5C4X K;  3PO2 K;  3GTG K;  3GTK K;  4C3I K;  3M4O K;  4LLG A;  5C4X C;  3PO2 C;  3GTK C;  1WCM K;  3GTG C;  4A3C K;  2Y0S D;  1TWG K;  3M4O C;  4Q5S A;  2BE5 A;  4NOI A;  1WCM C;  4AYB L;  4A3C C;  4XLP A;  3GTL K;  4X6A K;  2WAQ L;  1TWG C;  3S14 K;  5M3F K;  3GTL C;  3S2H K;  3S14 C;  5IYD K;  2A6E A;  4QJV A;  2O5J A;  4OIO A;  1ZYR A;  2PMZ D;  5IYD C;  4C3H K;  3CQZ K;  1I6H K;  3H3V D;  4YFK A;  4A3B K;  3GTM C;  2A68 A;  4C3J K;  1YNN A;  3CQZ C;  5C4J K;  1Y1W K;  2NVQ K;  3S1N C;  1I6H C;  1Y1V K;  1TWH K;  2JA5 K;  4JK1 A;  4A3B C;  5IP7 K;  1Y1W C;  4OIN A;  3HKZ D;  5C4J C;  2NVQ C;  3HOV K;  3HOY K;  4Y52 K;  1Y1V C;  1TWH C;  2JA5 C;  4A3G K;  3DXJ A;  4LK0 A;  4Y52 C;  5IP7 C;  3HOV C;  4X6A C;  2NVY K;  5D4D A;  5C44 K;  2E2J K;  4A3G C;  4A3I K;  3K7A K;  2NVY C;  3GTO K;  5C44 C;  3RZO K;  1I6V A;  4A3I C;  4KN4 A;  3K7A C;  3GTO C;  4A3D K;  4LJZ A;  5TMF A;  4QJV B;  4LK1 A;  4AYB D;  3RZO C;  4A3D C;  3S16 K;  2VUM K;  2PA8 L;  2R93 C;  1SMY A;  3S16 C;  2VUM C;  4A93 K;  4YFN A;  5M3M K;  4KMU A;  4QIW L;  4A93 C;  5IP9 K;  5M5Y K;  1YNJ A;  3GTM K;  4BXX C;  5IP9 C;  3S1N K;  3S15 K;  2WB1 L;  1TWA K;  4YG2 A;  1TWC K;  1I50 K;  2E2H K;  2NVX K;  3GTP K;  3S15 C;  1TWA C;  4C2M K;  1TWC C;  4OIR A;  1I50 C;  2E2H C;  2NVX C;  3GTP C;  4XLN A;  4BY7 K;  4A3L K;  1BDF A;  4MEX A;  4BBS K;  2YU9 K;  4BY7 C;  4A3L C;  5IYC K;  3RZD K;  5IYB K;  4BBS C;  3HOX K;  2YU9 C;  5TMC A;  5IYC C;  3RZD C;  5IYB C;  2NVT K;  2PA8 D;  5FLM K;  3HOX C;  1SFO K;  4OIQ A;  2Y0S L;  2R93 K;  2JA6 C;  2WAQ D;  2NVT C;  5FLM C;  1SFO C;  3M3Y C;  2R7Z C;  4A3M K;  1XPP A;  4QIW D;  1I3Q K;  4A3M C;  4OIP A;  2O5I A;  5M5W K;  4A3K K;  4G7O A;  4BXX K;  3PO3 K;  1I3Q C;  1TWF C;  2PMZ L;  4A3K C;  3H3V L;  3PO3 C;  4YFX A;  4XSZ A;  4BY1 K;  4A3J K;  1IW7 A;  4BBR K;  4A3F K;  4MQ9 A;  4BY1 C;  4A3J C;  4BBR C;  4A3F C;  2A69 A;  5M5X K;  3HOZ K;  4ZH4 A;  4XSX A; 
#chains in the Genus database with same CATH topology
 3LPX A;  3HOZ C;  1UV7 A;  3HOU K;  2P8T A;  4GT9 A;  3WOD A;  1WOS A;  5IOT A;  3HOU C;  5L46 A;  3H0G K;  1WIH A;  5FJ8 K;  3H0G C;  2JA8 K;  3I4N K;  2XCQ A;  2VUM A;  3S2H C;  3OEP A;  2JA8 C;  3I4N C;  3GTJ K;  3FKI K;  1BJT A;  2WB1 D;  4MEY A;  4Q4Z A;  4LOW A;  4P9S A;  3S1R K;  3GTJ C;  3FKI C;  3T02 A;  3S1R C;  5IOR A;  3HKZ L;  1TWC A;  5TJ3 A;  4C45 A;  3M4O K;  4LLG A;  4A3C K;  3A8J A;  2Y0S D;  1L0W A;  2YU9 A;  3N0B A;  4DDQ A;  3M4O C;  3ORE A;  3Q3Q A;  4NOI A;  4A3C C;  2WAQ L;  3S14 K;  3S14 C;  2A6E A;  2O5J A;  1WSR A;  3AD8 C;  1ZYR A;  1VGX A;  1XZP A;  4GTB A;  3CQZ K;  4C3H K;  1WSV A;  3H3V D;  4A3B K;  2GSN A;  4C3J K;  4C3H C;  3CQZ C;  4FM9 A;  4A3B C;  3L4J A;  4C3J C;  3HOY K;  4A3G K;  4LK0 A;  2GAG C;  4P5B A;  1B4B A;  1WOO A;  4A3G C;  4A3I K;  3FOF A;  3IPJ A;  1G51 A;  4A3I C;  4GTD A;  4KN4 A;  1XZQ B;  3JST A;  3BUE A;  2R93 C;  4YFN A;  1KQ4 A;  4QIW L;  2ZUF A;  3G4C A;  3GTM K;  1IS1 A;  1TWA K;  4YG2 A;  1I50 K;  2E2H K;  1TWA C;  1O24 A;  1I50 C;  2GSU A;  2E2H C;  5E68 A;  1ISE A;  3LAJ A;  2JA7 A;  4KDD A;  5FLM K;  2JA6 C;  5FLM C;  3M3Y C;  1WCM A;  1YCL A;  1WOR A;  4KAW X;  4KM9 A;  4G7O A;  3GTL A;  2PMZ L;  3BP8 C;  3QX3 A;  1ZVU A;  4KAT A;  2ZFZ A;  3GTM A;  1ZBS A;  4A3J K;  1IW7 A;  1WOP A;  3N3Y A;  1O27 A;  4A3J C;  2ZUE A;  1AB4 A;  4ZH4 A;  1XXB A;  2E2J K;  1PJ6 A;  2E2I K;  5CHP A;  2E2J C;  1EH1 A;  1HQM A;  4C3I C;  5C3E K;  1GE9 A;  2E2I C;  5EGE A;  5C3E C;  2R7Z K;  2V6T A;  1USM A;  2CW0 A;  1EI6 A;  2R92 K;  4G7H A;  2R92 C;  4KN7 A;  4G0V A;  4A3E K;  2PHC B;  1JVI A;  1JOE A;  3HOW K;  4A3E C;  3GTP A;  4P5A A;  2A6H A;  4GTL A;  1V5V A;  3HOW C;  5C4X K;  3PO2 K;  3GTK K;  2CFA A;  5C4X C;  3PO2 C;  3GTK C;  1TWG K;  4WJ3 M;  4AYB L;  1TWG C;  5M3F K;  3S2H K;  2R7Z A;  5IYD K;  4QJV A;  1WQG A;  4OIO A;  4RMF A;  5IYD C;  2A68 A;  5C4J K;  3S1N C;  1Y1V K;  1TWH K;  3T01 A;  3HKZ D;  5C4J C;  1Y1V C;  1TWH C;  3GEI A;  3TFI A;  2NVY K;  2NVY C;  1BS2 A;  3GIR A;  1F7V A;  5TMF A;  5CJ9 A;  4LK1 A;  1IQ0 A;  4GFQ A;  4A93 K;  5M3M K;  4BKW A;  1PJ7 A;  3H0G A;  4A93 C;  5IP9 K;  5M5Y K;  1YNJ A;  5IP9 C;  3AD9 C;  1ZQ1 C;  2WB1 L;  3GTJ A;  2NVX K;  5HL8 A;  3FKI A;  2NVX C;  4XLN A;  4A3L K;  3AH5 A;  1BDF A;  4KMH A;  3TFH A;  4BBS K;  4A3L C;  5IYB K;  4BBS C;  1O25 A;  2GAH C;  2XCO A;  5IYB C;  1SFO K;  2Y0S L;  2R93 K;  1SFO C;  4QIW D;  1I3Q K;  2O5I A;  3HXA A;  1I3Q C;  1TWF C;  4KB2 A;  3H3V L;  1EQR A;  1J6W A;  1C0A A;  4GTF A;  4WIL A;  2D6F C;  3CQZ A;  1O2B A;  2P5M A;  3A8I A;  4KAR A;  3T00 A;  1J98 A;  1ZXO A;  4QJV B;  4PAA A;  2XCR B;  3TTG A;  4G7Z A;  3BP3 A;  2JA6 K;  3GTQ K;  3M3Y K;  3I4M K;  3V4G A;  3GTQ C;  1R9T K;  3I4M C;  2R93 A;  2PPB A;  1R9T C;  1VRQ C;  2B63 K;  1B4A A;  3FOE A;  2B63 C;  1K83 K;  4GZY A;  1USO A;  3S2D K;  1K83 C;  4LQY A;  3S1Q K;  5EGH A;  1TWA A;  3S2D C;  3S1Q C;  1DCO A;  1I50 A;  2E2H A;  1XXC A;  3GTG K;  4C3I K;  3GTG C;  1XZP B;  3GSI A;  3GEE A;  3AQP A;  2JA6 A;  3SZY A;  3ADA C;  4GTC A;  4YFK A;  1J6X A;  1Y1W K;  2NVQ K;  2JA5 K;  4Y52 K;  3HOV K;  1Y1W C;  2NVQ C;  3GDZ A;  3VA7 A;  2JA5 C;  3DXJ A;  4Y52 C;  3HOV C;  3L4K A;  5D4D A;  3RZO K;  3OPF A;  2GSO A;  4LJZ A;  4AYB D;  3RZO C;  3S16 K;  2VUM K;  2V6S A;  2E2I A;  1O2F B;  2PA8 L;  3S16 C;  2VUM C;  4KMU A;  1HI9 A;  1IL2 A;  1VJE A;  1XZQ A;  1X31 C;  4BXX C;  3S1N K;  2R92 A;  1TWC K;  4C2M K;  1TWC C;  2FQO A;  1VH2 A;  4AH6 A;  3AQO A;  2JA5 A;  4C2M C;  4BY7 K;  4MEX A;  2YU9 K;  4BY7 C;  4XCH A;  3RZD K;  5IOQ A;  2EBB A;  2YU9 C;  5TMC A;  3RZD C;  3GTK A;  4KMD A;  2WAQ D;  1XPP A;  4ILD A;  3A8K A;  3AD7 C;  5JVO A;  1TWG A;  1F9N A;  1EFW A;  3CAG A;  4BLA A;  5M5W K;  1WQF A;  4YFX A;  1BGW A;  4XSZ A;  2JH3 A;  3N0C A;  5JFE A;  4BBR K;  4A3F K;  2Y3P A;  2RH6 A;  4MQ9 A;  4BBR C;  4A3F C;  1Y1V A;  1TWH A;  4J3N A;  5M5X K;  5IOS A;  4XLP A;  2NVY A;  3S1M K;  1F7U A;  3S1M C;  2V6U A;  4GTE A;  4KB4 A;  3S17 K;  3EQL A;  4G0W A;  1EK8 A;  3S17 C;  1TWF K;  3TFJ A;  3SZZ A;  4Y7N K;  4BLB A;  2CFA B;  2JA7 K;  1O2A A;  4Y7N C;  1IE0 A;  1XXA A;  3HOY C;  2JA7 C;  3GEH A;  1PJ5 A;  2NVX A;  4LR2 A;  4KMA A;  3S0X A;  1DCP A;  4KAS A;  1YX2 A;  1WCM K;  4Q5S A;  2BE5 A;  1WCM C;  3GTL K;  1SFO A;  3GTL C;  2PMZ D;  1I6H K;  1O28 A;  3GTM C;  1INN A;  1TWF A;  1J6V A;  1YNN A;  1I3Q A;  1I6H C;  4JK1 A;  4X6A K;  1O26 A;  5IP7 K;  4OIN A;  4KM8 A;  4X6A C;  5IP7 C;  1WQH A;  5C44 K;  4O2D A;  3ERE D;  3K7A K;  4GTA A;  1VLO A;  2KWA A;  5C44 C;  3GTO K;  1I6V A;  3K7A C;  3GTO C;  4A3D K;  1DD5 A;  4A3D C;  1SMY A;  3GTQ A;  4PAB A;  2W7V A;  1R9T A;  2RGR A;  3S15 K;  4FZB A;  1JQW A;  4G0U A;  1IBA A;  4M1X A;  3GTP K;  3S15 C;  2B63 A;  4OIR A;  3GTP C;  3G4A A;  1K83 A;  3LAP A;  5IYC K;  3NUH A;  3HOX K;  5IYC C;  3GTO A;  2NVT K;  2PA8 D;  4OIQ A;  3HOX C;  3GTG A;  1F93 A;  3FHZ A;  2NVT C;  2R7Z C;  4A3M K;  4A3M C;  1RU0 A;  4OIP A;  4A3K K;  4BXX K;  3PO3 K;  4A3K C;  3PO3 C;  3MML B;  4BY1 K;  2FQT A;  4BY1 C;  1Y1W A;  1DCH A;  2A69 A;  1O29 A;  4KC6 A;  3HOZ K;  4XSX A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 3HOZ C;  2E2I K;  3HOU K;  3WOD A;  2E2J C;  5C3E K;  1HQM A;  4G7Z A;  3S1M K;  2E2I C;  2JA6 K;  3HOU C;  3GTQ K;  3S1M C;  5C3E C;  3M3Y K;  3H0G K;  2R7Z K;  3I4M K;  3GTQ C;  3S17 K;  3EQL A;  3H0G C;  5FJ8 K;  2CW0 A;  1R9T K;  2JA8 K;  2PPB A;  3I4N K;  3I4M C;  2R92 K;  3S17 C;  3S2H C;  1TWF K;  1R9T C;  2JA8 C;  3I4N C;  2B63 K;  3GTJ K;  4G7H A;  2R92 C;  4KN7 A;  3FKI K;  2WB1 D;  4MEY A;  4Q4Z A;  3S1R K;  3GTJ C;  2B63 C;  4Y7N K;  1K83 K;  3FKI C;  4GZY A;  3S1R C;  4A3E K;  2JA7 K;  3S2D K;  4Y7N C;  1K83 C;  3S1Q K;  3HOY C;  2JA7 C;  3HKZ L;  4A3E C;  3HOW K;  3S2D C;  3S1Q C;  2A6H A;  3HOW C;  5C4X K;  3PO2 K;  3GTG K;  3GTK K;  4C3I K;  3M4O K;  4LLG A;  5C4X C;  3PO2 C;  3GTK C;  1WCM K;  3GTG C;  4A3C K;  2Y0S D;  1TWG K;  3M4O C;  4Q5S A;  2BE5 A;  4NOI A;  1WCM C;  4AYB L;  4A3C C;  4XLP A;  3GTL K;  4X6A K;  2WAQ L;  1TWG C;  3S14 K;  5M3F K;  3GTL C;  3S2H K;  3S14 C;  5IYD K;  2A6E A;  4QJV A;  2O5J A;  4OIO A;  1ZYR A;  2PMZ D;  5IYD C;  4C3H K;  3CQZ K;  1I6H K;  3H3V D;  4YFK A;  4A3B K;  3GTM C;  2A68 A;  4C3J K;  1YNN A;  3CQZ C;  5C4J K;  1Y1W K;  2NVQ K;  3S1N C;  1I6H C;  1Y1V K;  1TWH K;  2JA5 K;  4JK1 A;  4A3B C;  5IP7 K;  1Y1W C;  4OIN A;  3HKZ D;  5C4J C;  2NVQ C;  3HOV K;  3HOY K;  4Y52 K;  1Y1V C;  1TWH C;  2JA5 C;  4A3G K;  3DXJ A;  4LK0 A;  4Y52 C;  5IP7 C;  3HOV C;  4X6A C;  2NVY K;  5D4D A;  5C44 K;  2E2J K;  4A3G C;  4A3I K;  3K7A K;  2NVY C;  3GTO K;  5C44 C;  3RZO K;  1I6V A;  4A3I C;  4KN4 A;  3K7A C;  3GTO C;  4A3D K;  4LJZ A;  5TMF A;  4QJV B;  4LK1 A;  4AYB D;  3RZO C;  4A3D C;  3S16 K;  2VUM K;  2PA8 L;  2R93 C;  1SMY A;  3S16 C;  2VUM C;  4A93 K;  4YFN A;  5M3M K;  4KMU A;  4QIW L;  4A93 C;  5IP9 K;  5M5Y K;  1YNJ A;  3GTM K;  4BXX C;  5IP9 C;  3S1N K;  3S15 K;  2WB1 L;  1TWA K;  4YG2 A;  1TWC K;  1I50 K;  2E2H K;  2NVX K;  3GTP K;  3S15 C;  1TWA C;  4C2M K;  1TWC C;  4OIR A;  1I50 C;  2E2H C;  2NVX C;  3GTP C;  4XLN A;  4BY7 K;  4A3L K;  1BDF A;  4MEX A;  4BBS K;  2YU9 K;  4BY7 C;  4A3L C;  5IYC K;  3RZD K;  5IYB K;  4BBS C;  3HOX K;  2YU9 C;  5TMC A;  5IYC C;  3RZD C;  5IYB C;  2NVT K;  2PA8 D;  5FLM K;  3HOX C;  1SFO K;  4OIQ A;  2Y0S L;  2R93 K;  2JA6 C;  2WAQ D;  2NVT C;  5FLM C;  1SFO C;  3M3Y C;  2R7Z C;  4A3M K;  1XPP A;  4QIW D;  1I3Q K;  4A3M C;  4OIP A;  2O5I A;  5M5W K;  4A3K K;  4G7O A;  4BXX K;  3PO3 K;  1I3Q C;  1TWF C;  2PMZ L;  4A3K C;  3H3V L;  3PO3 C;  4YFX A;  4XSZ A;  4BY1 K;  4A3J K;  1IW7 A;  4BBR K;  4A3F K;  4MQ9 A;  4BY1 C;  4A3J C;  4BBR C;  4A3F C;  2A69 A;  5M5X K;  3HOZ K;  4ZH4 A;  4XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...