1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
3N3YA 4GTCA 4KASA 5IOSA 4GTFA 4GTEA 3G4CA 4GTAA 4KATA 4FZBA 1O25A 4GT9A 1O28A 1O24A 5IOQA 4GTDA 3G4AA 4P5BA 4P5AA 4KARA 1O27A 2CFAA 2CFAB 1O2BA 5CHPA 1O26A 1KQ4A 1O29A 4GTBA 3N0CA 5IOTA 4GTLA 5JFEA 5IORA 3N0BA 3AH5A 1O2AA
chains in the Genus database with same CATH superfamily
3A8IA 4KASA 4JK1A 3S2DC 1JQWA 4QJVA 1JVIA 4C3HC 4O2DA 4KM8A 4GTDA 4OIRA 4KMAA 1TWFK 1DCPA 1O26A 2Y0SL 4BBSK 2NVQC 2KWAA 4C3IK 1TWHK 2RH6A 3HOWC 3S1QK 3HOVK 3GTJK 1YNJA 4BY1C 1VGXA 4A3CK 4A3GC 3SZYA 5C4JC 4G0VA 2R93C 3H0GA 4KC6A 5C3EK 4G7OA 4G7ZA 2XCRB 3WODA 4A3DK 4Y52K 1K83K 1VH2A 5IYCC 4LQYA 2A69A 1DCHA 2B63K 1KQ4A 3TFIA 3RZDK 3AQPA 1HQMA 1SFOC 3GTQK 1PJ7A 2O5JA 4XSXA 4OINA 2ZUEA 3S1MC 4OIPA 2YU9K 3GTOA 5E68A 4BBRC 2NVTC 4BLAA 4M1XA 4LK1A 4A3BK 3GTKK 4WILA 1SMYA 2JA8K 4YFKA 1UV7A 3HOZK 2GSNA 4NOIA 2GAHC 1O24A 4XLNA 1WIHA 4A3FC 3GTGK 3CQZK 5EGHA 3ERED 1I6HK 5EGEA 5TJ3A 1IS1A 4G0WA 1EK8A 2BE5A 1TWFC 1DD5A 5FLMK 1BS2A 1IE0A 1XZQB 3L4JA 3AD8C 2VUMA 2B63A 1WQGA 3S2DK 4BBSC 3N0BA 3GTQA 4YFNA 4C3IC 1TWHC 3HXAA 2YU9A 3I4NK 3HOVC 4AH6A 3T00A 3GTJC 1Y1WA 1TWGA 1J6XA 4KB4A 1TWAK 3LAJA 4P5AA 4OIOA 3FKIC 4Q5SA 3GTGA 3CQZA 3GTLA 1WSRA 2PMZD 3GTPK 3HOWK 3K7AC 5C3EC 4GTBA 1XZPB 4A3DC 4WJ3M 2D6FC 3RZDC 4A3GK 2P8TA 5C4JK 3N3YA 5FJ8K 3S0XA 2FQTA 2A6HA 2R92A 2JA5K 1WCMC 2V6SA 5IYCK 1XXCA 4P5BA 3GTKC 2JA8C 3ADAC 1Y1VK 4KARA 2ZFZA 1XPPA 1VRQC 2PMZL 2XCQA 2JA6C 3HOZC 1IBAA 1J6VA 1WOOA 4P9SA 1I6HC 3T01A 1HI9A 1WSVA 4XCHA 2NVTK 2WAQD 3I4MK 5IOTA 3S16C 2GAGC 5C44K 1I6VA 4A3FK 1J6WA 1I3QK 3S17C 5CJ9A 2R93A 3BP8C 3S14K 3I4NC 2V6TA 2A68A 4ILDA 2NVYK 4KAWX 3GEEA 4WJ4A 2P5MA 3GTMC 1GE9A 2A6EA 1USMA 1G51A 1TWAC 5M5YK 4RMFA 2WAQL 1SFOA 4J3NA 1O2FB 2EBBA 3S1NC 3BUEA 4GTLA 1ZBSA 3GTPC 1YX2A 5JFEA 1B4BA 1EQRA 2V6UA 2NVXK 3FKIK 1ISEA 1PJ6A 5L46A 1YCLA 3PO3K 3S15C 2Y3PA 4BY7C 3K7AK 2CFAA 5JVOA 4MEYA 2JA5C 1AB4A 2CW0A 2JA7C 1R9TC 3GEIA 1USOA 1Y1VC 1F9NA 1TWFA 3BP3A 5C4XC 4ZH4A 5M3FK 3HOYC 2R7ZK 5IORA 1EH1A 1TWHA 3I4MC 1WCMK 4MEXA 3GTJA 4A3MC 5C44C 3TFJA 2JA6K 2PHCB 3G4AA 4LK0A 4YFXA 1I3QC 1O27A 4OIQA 3JSTA 1ZQ1C 3S14C 4MQ9A 1X31C 2NVYC 1WQHA 3EQLA 4A3JC 3S16K 4YG2A 1K83A 1ZVUA 4KB2A 3S17K 1C0AA 1IL2A 1V5VA 1O25A 3H3VD 1I50K 4DDQA 3GTMK 3GTKA 5IYBK 2NVXC 3NUHA 3S1RC 2JA6A 3PO3C 1JOEA 1WOSA 1PJ5A 3S1NK 4KMDA 1XXAA 3A8KA 4A3IC 3LAPA 2W7VA 4GZYA 4FM9A 5IYDC 3OPFA 1TWCK 4LJZA 3S2HK 3Q3QA 4KATA 3G4CA 3H3VL 3S15K 3HOXC 2R7ZC 4BY7K 3CAGA 5IP7C 2E2IK 3OEPA 4A3KC 2JA7K 4A93K 1R9TK 3L4KA 3GTMA 5C4XK 4XLPA 1ZYRA 1TWAA 2PPBA 3HOYK 1ZXOA 4G0UA 1WORA 3N0CA 3LPXA 2VUMC 3GTPA 5M5XK 4A3MK 1IQ0A 1F7UA 4GTEA 4GTAA 5M3MK 1O28A 2E2JC 1F7VA 3M3YC 1EI6A 3GEHA 2WB1D 4C2MC 3T02A 2XCOA 4A3JK 1YNNA 1I50C 4C3JC 2CFAB 2JA5A 3TFHA 5IYBC 1R9TA 1INNA 1Y1VA 1RU0A 5HL8A 4BXXC 4LR2A 2E2HC 1EFWA 2R92C 2WB1L 3S1RK 1TWCC 4KDDA 3S2HC 1I3QA 3AQOA 3HKZD 4A3IK 3GTOK 3IPJA 2NVYA 2E2IC 4A93C 5IYDK 1F93A 3TTGA 3HOXK 3V4GA 3OREA 4BLBA 2GSUA 3M4OC 1L0WA 3RZOC 5IP7K 4A3KK 5IOQA 1BGWA 3HKZL 2NVXA 1BJTA 3AD9C 5IP9K 3FKIA 4A3LK 4KN4A 4Y7NK 5CHPA 4Q4ZA 2VUMK 3QX3A 4GFQA 4X6AC 4KM9A 4KMUA 4A3EK 3A8JA 3PO2K 1DCOA 4PAAA 3FOEA 1Y1WK 1TWGK 1O2AA 4G7HA 2E2JK 4GTCA 3M3YK 5IOSA 4GTFA 3VA7A 3AD7C 4C2MK 1B4AA 3H0GC 2R7ZA 4KN7A 4C3JK 3GTLK 3DXJA 1WCMA 4QIWD 1IW7A 3HOUK 4AYBD 4BKWA 4BXXK 5TMCA 1O29A 2FQOA 3GTOC 3SZZA 2E2HK 3AH5A 2R92K 4C3HK 4XSZA 3S1QC 2JH3A 5TMFA 4FZBA 4GT9A 3GSIA 1VLOA 1WOPA 4QIWL 4A3CC 4AYBL 2PA8D 2NVQK 1VJEA 2GSOA 4LOWA 1I50A 1O2BA 5IP9C 4A3LC 4Y52C 1K83C 1XZQA 4Y7NC 4BY1K 3M4OK 2B63C 2O5IA 3RZOK 2R93K 3FHZA 3GTQC 2YU9C 3FOFA 4A3EC 2E2HA 3GIRA 3PO2C 3GDZA 4QJVB 4PABA 1Y1WC 1TWGC 4A3BC 1WQFA 2RGRA 2PA8L 1TWCA 3MMLB 4LLGA 1BDFA 1SFOK 5M5WK 1J98A 3GTGC 4X6AK 3S1MK 4C45A 2ZUFA 3CQZC 3GTLC 4BBRK 1XZPA 2E2IA 2JA7A 2Y0SD 3HOUC 4KMHA 1XXBA 5D4DA 5FLMC 3H0GK
chains in the Genus database with same CATH topology
2GSUA 3N3YA 3S0XA 4KASA 1O25A 2R92A 4DDQA 4C3HC 5IOQA 1BGWA 4KM8A 4GTDA 1XXCA 4P5BA 3GTKA 2NVXA 1BJTA 4KARA 4KMAA 2ZFZA 3FKIA 3NUHA 2JA6A 2XCQA 5CHPA 1O26A 3QX3A 4KMDA 1XXAA 2KWAA 4GFQA 4KM9A 2RH6A 3LAPA 5IOTA 3FOEA 4FM9A 1O2AA 3OPFA 4GTCA 5IOSA 3Q3QA 4GTFA 3G4CA 4KATA 3VA7A 4G0VA 2R93A 1B4AA 5CJ9A 3H0GA 2R7ZA 3CAGA 4KC6A 1WCMA 4ILDA 4KAWX 3OEPA 2XCRB 3L4KA 2P5MA 3GTMA 1GE9A 4BKWA 4LQYA 1TWAA 1KQ4A 1O29A 3AQPA 1ZXOA 4G0UA 3N0CA 1SFOA 3LPXA 4J3NA 3BUEA 3GTOA 4GTLA 1ZBSA 3GTPA 5JFEA 3AH5A 1B4BA 4BLAA 4M1XA 2JH3A 4GTEA 4GTAA 4FZBA 4GT9A 1ISEA 1O28A 2GSNA 1O24A 1WIHA 2Y3PA 5EGHA 4C2MC 3ERED 5EGEA 2XCOA 2CFAA 2GSOA 4C3JC 1I50A 5TJ3A 2CFAB 5JVOA 1O2BA 1IS1A 2JA5A 1AB4A 4G0WA 1EK8A 1R9TA 1Y1VA 1F9NA 1TWFA 1DD5A 3L4JA 2VUMA 4LR2A 2B63A 1WQGA 5IORA 3FHZA 3N0BA 3GTQA 1EH1A 4C3IC 1TWHA 2YU9A 3FOFA 2E2HA 3GTJA 1Y1WA 1TWGA 1WQFA 2RGRA 2PHCB 4KB4A 1TWCA 3G4AA 4KDDA 4P5AA 3LAJA 3MMLB 1O27A 1I3QA 3AQOA 3GTGA 3CQZA 3GTLA 1WQHA 2NVYA 2E2IA 4GTBA 2JA7A 1K83A 4KMHA 1XXBA 1ZVUA 3V4GA 3OREA 4KB2A 4BLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3Y A;  4GTC A;  4KAS A;  5IOS A;  4GTF A;  4GTE A;  3G4C A;  4GTA A;  4KAT A;  4FZB A;  1O25 A;  4GT9 A;  1O28 A;  1O24 A;  5IOQ A;  4GTD A;  3G4A A;  4P5B A;  4P5A A;  4KAR A;  1O27 A;  2CFA A;  2CFA B;  1O2B A;  5CHP A;  1O26 A;  1KQ4 A;  1O29 A;  4GTB A;  3N0C A;  5IOT A;  4GTL A;  5JFE A;  5IOR A;  3N0B A;  3AH5 A;  1O2A A; 
#chains in the Genus database with same CATH topology
 3A8I A;  4KAS A;  4JK1 A;  3S2D C;  1JQW A;  4QJV A;  1JVI A;  4C3H C;  4O2D A;  4KM8 A;  4GTD A;  4OIR A;  4KMA A;  1TWF K;  1DCP A;  1O26 A;  2Y0S L;  4BBS K;  2NVQ C;  2KWA A;  4C3I K;  1TWH K;  2RH6 A;  3HOW C;  3S1Q K;  3HOV K;  3GTJ K;  1YNJ A;  4BY1 C;  1VGX A;  4A3C K;  4A3G C;  3SZY A;  5C4J C;  4G0V A;  2R93 C;  3H0G A;  4KC6 A;  5C3E K;  4G7O A;  4G7Z A;  2XCR B;  3WOD A;  4A3D K;  4Y52 K;  1K83 K;  1VH2 A;  5IYC C;  4LQY A;  2A69 A;  1DCH A;  2B63 K;  1KQ4 A;  3TFI A;  3RZD K;  3AQP A;  1HQM A;  1SFO C;  3GTQ K;  1PJ7 A;  2O5J A;  4XSX A;  4OIN A;  2ZUE A;  3S1M C;  4OIP A;  2YU9 K;  3GTO A;  5E68 A;  4BBR C;  2NVT C;  4BLA A;  4M1X A;  4LK1 A;  4A3B K;  3GTK K;  4WIL A;  1SMY A;  2JA8 K;  4YFK A;  1UV7 A;  3HOZ K;  2GSN A;  4NOI A;  2GAH C;  1O24 A;  4XLN A;  1WIH A;  4A3F C;  3GTG K;  3CQZ K;  5EGH A;  3ERE D;  1I6H K;  5EGE A;  5TJ3 A;  1IS1 A;  4G0W A;  1EK8 A;  2BE5 A;  1TWF C;  1DD5 A;  5FLM K;  1BS2 A;  1IE0 A;  1XZQ B;  3L4J A;  3AD8 C;  2VUM A;  2B63 A;  1WQG A;  3S2D K;  4BBS C;  3N0B A;  3GTQ A;  4YFN A;  4C3I C;  1TWH C;  3HXA A;  2YU9 A;  3I4N K;  3HOV C;  4AH6 A;  3T00 A;  3GTJ C;  1Y1W A;  1TWG A;  1J6X A;  4KB4 A;  1TWA K;  3LAJ A;  4P5A A;  4OIO A;  3FKI C;  4Q5S A;  3GTG A;  3CQZ A;  3GTL A;  1WSR A;  2PMZ D;  3GTP K;  3HOW K;  3K7A C;  5C3E C;  4GTB A;  1XZP B;  4A3D C;  4WJ3 M;  2D6F C;  3RZD C;  4A3G K;  2P8T A;  5C4J K;  3N3Y A;  5FJ8 K;  3S0X A;  2FQT A;  2A6H A;  2R92 A;  2JA5 K;  1WCM C;  2V6S A;  5IYC K;  1XXC A;  4P5B A;  3GTK C;  2JA8 C;  3ADA C;  1Y1V K;  4KAR A;  2ZFZ A;  1XPP A;  1VRQ C;  2PMZ L;  2XCQ A;  2JA6 C;  3HOZ C;  1IBA A;  1J6V A;  1WOO A;  4P9S A;  1I6H C;  3T01 A;  1HI9 A;  1WSV A;  4XCH A;  2NVT K;  2WAQ D;  3I4M K;  5IOT A;  3S16 C;  2GAG C;  5C44 K;  1I6V A;  4A3F K;  1J6W A;  1I3Q K;  3S17 C;  5CJ9 A;  2R93 A;  3BP8 C;  3S14 K;  3I4N C;  2V6T A;  2A68 A;  4ILD A;  2NVY K;  4KAW X;  3GEE A;  4WJ4 A;  2P5M A;  3GTM C;  1GE9 A;  2A6E A;  1USM A;  1G51 A;  1TWA C;  5M5Y K;  4RMF A;  2WAQ L;  1SFO A;  4J3N A;  1O2F B;  2EBB A;  3S1N C;  3BUE A;  4GTL A;  1ZBS A;  3GTP C;  1YX2 A;  5JFE A;  1B4B A;  1EQR A;  2V6U A;  2NVX K;  3FKI K;  1ISE A;  1PJ6 A;  5L46 A;  1YCL A;  3PO3 K;  3S15 C;  2Y3P A;  4BY7 C;  3K7A K;  2CFA A;  5JVO A;  4MEY A;  2JA5 C;  1AB4 A;  2CW0 A;  2JA7 C;  1R9T C;  3GEI A;  1USO A;  1Y1V C;  1F9N A;  1TWF A;  3BP3 A;  5C4X C;  4ZH4 A;  5M3F K;  3HOY C;  2R7Z K;  5IOR A;  1EH1 A;  1TWH A;  3I4M C;  1WCM K;  4MEX A;  3GTJ A;  4A3M C;  5C44 C;  3TFJ A;  2JA6 K;  2PHC B;  3G4A A;  4LK0 A;  4YFX A;  1I3Q C;  1O27 A;  4OIQ A;  3JST A;  1ZQ1 C;  3S14 C;  4MQ9 A;  1X31 C;  2NVY C;  1WQH A;  3EQL A;  4A3J C;  3S16 K;  4YG2 A;  1K83 A;  1ZVU A;  4KB2 A;  3S17 K;  1C0A A;  1IL2 A;  1V5V A;  1O25 A;  3H3V D;  1I50 K;  4DDQ A;  3GTM K;  3GTK A;  5IYB K;  2NVX C;  3NUH A;  3S1R C;  2JA6 A;  3PO3 C;  1JOE A;  1WOS A;  1PJ5 A;  3S1N K;  4KMD A;  1XXA A;  3A8K A;  4A3I C;  3LAP A;  2W7V A;  4GZY A;  4FM9 A;  5IYD C;  3OPF A;  1TWC K;  4LJZ A;  3S2H K;  3Q3Q A;  4KAT A;  3G4C A;  3H3V L;  3S15 K;  3HOX C;  2R7Z C;  4BY7 K;  3CAG A;  5IP7 C;  2E2I K;  3OEP A;  4A3K C;  2JA7 K;  4A93 K;  1R9T K;  3L4K A;  3GTM A;  5C4X K;  4XLP A;  1ZYR A;  1TWA A;  2PPB A;  3HOY K;  1ZXO A;  4G0U A;  1WOR A;  3N0C A;  3LPX A;  2VUM C;  3GTP A;  5M5X K;  4A3M K;  1IQ0 A;  1F7U A;  4GTE A;  4GTA A;  5M3M K;  1O28 A;  2E2J C;  1F7V A;  3M3Y C;  1EI6 A;  3GEH A;  2WB1 D;  4C2M C;  3T02 A;  2XCO A;  4A3J K;  1YNN A;  1I50 C;  4C3J C;  2CFA B;  2JA5 A;  3TFH A;  5IYB C;  1R9T A;  1INN A;  1Y1V A;  1RU0 A;  5HL8 A;  4BXX C;  4LR2 A;  2E2H C;  1EFW A;  2R92 C;  2WB1 L;  3S1R K;  1TWC C;  4KDD A;  3S2H C;  1I3Q A;  3AQO A;  3HKZ D;  4A3I K;  3GTO K;  3IPJ A;  2NVY A;  2E2I C;  4A93 C;  5IYD K;  1F93 A;  3TTG A;  3HOX K;  3V4G A;  3ORE A;  4BLB A;  2GSU A;  3M4O C;  1L0W A;  3RZO C;  5IP7 K;  4A3K K;  5IOQ A;  1BGW A;  3HKZ L;  2NVX A;  1BJT A;  3AD9 C;  5IP9 K;  3FKI A;  4A3L K;  4KN4 A;  4Y7N K;  5CHP A;  4Q4Z A;  2VUM K;  3QX3 A;  4GFQ A;  4X6A C;  4KM9 A;  4KMU A;  4A3E K;  3A8J A;  3PO2 K;  1DCO A;  4PAA A;  3FOE A;  1Y1W K;  1TWG K;  1O2A A;  4G7H A;  2E2J K;  4GTC A;  3M3Y K;  5IOS A;  4GTF A;  3VA7 A;  3AD7 C;  4C2M K;  1B4A A;  3H0G C;  2R7Z A;  4KN7 A;  4C3J K;  3GTL K;  3DXJ A;  1WCM A;  4QIW D;  1IW7 A;  3HOU K;  4AYB D;  4BKW A;  4BXX K;  5TMC A;  1O29 A;  2FQO A;  3GTO C;  3SZZ A;  2E2H K;  3AH5 A;  2R92 K;  4C3H K;  4XSZ A;  3S1Q C;  2JH3 A;  5TMF A;  4FZB A;  4GT9 A;  3GSI A;  1VLO A;  1WOP A;  4QIW L;  4A3C C;  4AYB L;  2PA8 D;  2NVQ K;  1VJE A;  2GSO A;  4LOW A;  1I50 A;  1O2B A;  5IP9 C;  4A3L C;  4Y52 C;  1K83 C;  1XZQ A;  4Y7N C;  4BY1 K;  3M4O K;  2B63 C;  2O5I A;  3RZO K;  2R93 K;  3FHZ A;  3GTQ C;  2YU9 C;  3FOF A;  4A3E C;  2E2H A;  3GIR A;  3PO2 C;  3GDZ A;  4QJV B;  4PAB A;  1Y1W C;  1TWG C;  4A3B C;  1WQF A;  2RGR A;  2PA8 L;  1TWC A;  3MML B;  4LLG A;  1BDF A;  1SFO K;  5M5W K;  1J98 A;  3GTG C;  4X6A K;  3S1M K;  4C45 A;  2ZUF A;  3CQZ C;  3GTL C;  4BBR K;  1XZP A;  2E2I A;  2JA7 A;  2Y0S D;  3HOU C;  4KMH A;  1XXB A;  5D4D A;  5FLM C;  3H0G K; 
#chains in the Genus database with same CATH homology
 2GSU A;  3N3Y A;  3S0X A;  4KAS A;  1O25 A;  2R92 A;  4DDQ A;  4C3H C;  5IOQ A;  1BGW A;  4KM8 A;  4GTD A;  1XXC A;  4P5B A;  3GTK A;  2NVX A;  1BJT A;  4KAR A;  4KMA A;  2ZFZ A;  3FKI A;  3NUH A;  2JA6 A;  2XCQ A;  5CHP A;  1O26 A;  3QX3 A;  4KMD A;  1XXA A;  2KWA A;  4GFQ A;  4KM9 A;  2RH6 A;  3LAP A;  5IOT A;  3FOE A;  4FM9 A;  1O2A A;  3OPF A;  4GTC A;  5IOS A;  3Q3Q A;  4GTF A;  3G4C A;  4KAT A;  3VA7 A;  4G0V A;  2R93 A;  1B4A A;  5CJ9 A;  3H0G A;  2R7Z A;  3CAG A;  4KC6 A;  1WCM A;  4ILD A;  4KAW X;  3OEP A;  2XCR B;  3L4K A;  2P5M A;  3GTM A;  1GE9 A;  4BKW A;  4LQY A;  1TWA A;  1KQ4 A;  1O29 A;  3AQP A;  1ZXO A;  4G0U A;  3N0C A;  1SFO A;  3LPX A;  4J3N A;  3BUE A;  3GTO A;  4GTL A;  1ZBS A;  3GTP A;  5JFE A;  3AH5 A;  1B4B A;  4BLA A;  4M1X A;  2JH3 A;  4GTE A;  4GTA A;  4FZB A;  4GT9 A;  1ISE A;  1O28 A;  2GSN A;  1O24 A;  1WIH A;  2Y3P A;  5EGH A;  4C2M C;  3ERE D;  5EGE A;  2XCO A;  2CFA A;  2GSO A;  4C3J C;  1I50 A;  5TJ3 A;  2CFA B;  5JVO A;  1O2B A;  1IS1 A;  2JA5 A;  1AB4 A;  4G0W A;  1EK8 A;  1R9T A;  1Y1V A;  1F9N A;  1TWF A;  1DD5 A;  3L4J A;  2VUM A;  4LR2 A;  2B63 A;  1WQG A;  5IOR A;  3FHZ A;  3N0B A;  3GTQ A;  1EH1 A;  4C3I C;  1TWH A;  2YU9 A;  3FOF A;  2E2H A;  3GTJ A;  1Y1W A;  1TWG A;  1WQF A;  2RGR A;  2PHC B;  4KB4 A;  1TWC A;  3G4A A;  4KDD A;  4P5A A;  3LAJ A;  3MML B;  1O27 A;  1I3Q A;  3AQO A;  3GTG A;  3CQZ A;  3GTL A;  1WQH A;  2NVY A;  2E2I A;  4GTB A;  2JA7 A;  1K83 A;  4KMH A;  1XXB A;  1ZVU A;  3V4G A;  3ORE A;  4KB2 A;  4BLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...