1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
2CFAB 4GTBA 5JFEA 1O26A 3N0CA 4GTLA 5IOQA 4FZBA 4GT9A 4P5AA 4P5BA 4GTCA 3G4AA 5IORA 3N3YA 1O27A 1KQ4A 5IOTA 3AH5A 4KARA 1O25A 4KATA 4KASA 1O2AA 1O29A 4GTEA 2CFAA 5IOSA 1O24A 3G4CA 5CHPA 1O2BA 3N0BA 4GTAA 4GTFA 1O28A 4GTDA
chains in the Genus database with same CATH superfamily
2V6UA 3I4NK 4BLAA 3I4MC 1O26A 3GTJA 3RZDK 4AYBL 3GEEA 4YG2A 5E68A 3PO2K 4KASA 2JA6A 3LAJA 4A3DK 2A6HA 1SMYA 2NVYK 3HOYC 3EQLA 1V5VA 4KM9A 3HXAA 1JQWA 3GSIA 1WOPA 5IYBK 2E2HA 1ZVUA 1SFOK 3M3YK 1DCHA 3FKIK 4KMDA 4FM9A 3TFJA 2JA5C 1I6HK 1RU0A 1WQGA 1TWFK 1O27A 4KN4A 5IYCK 4XSZA 1ZBSA 2JA7K 1F9NA 3HOZC 3HOXC 3H0GK 3S17K 4A93C 1TWHC 5CJ9A 2Y3PA 4A3KK 2GSNA 4BBRK 1EK8A 4GTAA 4C3HK 3WODA 3L4KA 1WCMK 1SFOA 1XXCA 2BE5A 4XLNA 1TWAC 1YNJA 3FKIA 3S2HK 5IOQA 2XCQA 2PA8L 1ZYRA 1TWFA 1INNA 4LLGA 5EGEA 2E2JC 1USOA 3H0GA 2E2IC 1WQFA 3GTOK 3S14C 2P5MA 1GE9A 4RMFA 1O29A 5C4JC 4MEXA 1I50A 2O5JA 3M4OK 1WCMA 2B63K 1O28A 4QIWD 3TTGA 4LK0A 3HOVC 3HOUK 3CQZC 4XCHA 2NVXK 4WJ3M 1XZQB 4DDQA 3N0CA 4C3IC 2NVTK 3CAGA 2WAQD 3IPJA 4A3MK 3AQPA 5M5XK 1XZPA 3GTGA 3FOEA 2A69A 1Y1WA 1VJEA 2B63A 4BY7K 3FOFA 5C3EK 2NVQK 2V6TA 1ZQ1C 3S1NC 4GTDA 2JA8K 1IBAA 1R9TK 1K83K 1Y1VA 5M3MK 3I4NC 4PABA 5IP7C 2PHCB 4BBSC 5IORA 5C4XK 1VGXA 4KATA 1TWCC 2R92K 3GTQA 4YFKA 3PO2C 1O2AA 4Q5SA 4GTEA 1WORA 3S1RK 2JA6K 2R93K 4A3DC 4A3FK 1HQMA 3ERED 4Q4ZA 1R9TA 1WSRA 4YFNA 1I3QK 2EBBA 4C2MC 3LPXA 2XCRB 4WILA 4A3IK 3M3YC 4ILDA 3A8JA 2E2HK 1C0AA 4Y7NC 5IYDC 3AQOA 2YU9C 2R92A 4G0VA 4KDDA 1TWGA 3GTPA 1ISEA 3QX3A 2JA7C 2R93A 1YCLA 4A3LK 3S2DC 4A3GK 3NUHA 4BLBA 4A3KC 2R7ZA 3GTKC 1F7VA 4BBRC 1X31C 3HKZD 1I3QA 4A3CK 3GTMA 5HL8A 5FJ8K 5FLMK 3RZOK 2GSOA 4X6AK 1ZXOA 4GT9A 2A68A 4A3BK 3AD9C 1XPPA 1KQ4A 4KARA 2VUMC 5TMCA 3GTOC 3GTLA 3H3VD 2GSUA 4C3JK 2RGRA 4KB4A 4LK1A 3DXJA 2O5IA 2KWAA 1AB4A 1I50K 4KMHA 4LQYA 5C44K 4GTBA 5JFEA 1TWCA 3K7AC 4O2DA 4GTLA 4MEYA 4LOWA 3N3YA 3VA7A 2CW0A 1PJ6A 4C45A 3GTGK 4QIWL 2ZUEA 1Y1WK 1YX2A 5C3EC 4GZYA 2ZFZA 5TJ3A 1XXAA 1DD5A 3HOWK 1F93A 2WAQL 1Y1VK 3AD7C 4P5BA 3HOXK 4A93K 3GTJC 3S16K 5C4XC 3L4JA 4G7OA 3GTQK 4OINA 3GDZA 2Y0SD 2W7VA 4A3JC 2JA6C 1VLOA 5M5YK 1EFWA 3S15C 1WIHA 4A3EC 1TWAK 5M3FK 3S1MC 5EGHA 2JA5A 2E2JK 4P5AA 2E2IK 2WB1D 2E2HC 1TWHA 3S1QK 3S14K 3RZDC 4OIRA 5IOTA 1F7UA 1EQRA 5C4JK 2RH6A 4QJVA 2PMZD 4OIPA 1TWGK 4J3NA 3OPFA 3GTPK 1J98A 3TFHA 3N0BA 3HOVK 1TWAA 3CQZK 2NVYC 1VH2A 2P8TA 2R7ZK 4PAAA 4C3IK 5FLMC 1EI6A 3MMLB 3GTMK 1DCOA 5IYBC 2E2IA 3GIRA 1SFOC 2FQTA 1B4AA 3FKIC 3T00A 3G4AA 3AH5A 4Y52K 1XXBA 4BY1K 3SZYA 1I6HC 1TWFC 5IYCC 3PO3K 1B4BA 2XCOA 4JK1A 1J6VA 3H0GC 3JSTA 3S17C 3GTLK 3CQZA 3HKZL 1O2BA 1BJTA 1IE0A 4KB2A 3Q3QA 5IP9K 1HI9A 1I50C 4C3HC 4KMUA 5IP7K 2CFAB 1WCMC 1PJ5A 4BBSK 5C44C 3OREA 4FZBA 1BS2A 5L46A 1I6VA 1TWCK 4GTCA 3A8IA 4G0WA 3S2HC 1WOSA 5M5WK 4P9SA 3H3VL 1O25A 4AYBD 1J6WA 3OEPA 4BXXK 2JH3A 5CHPA 4XSXA 3LAPA 3GTGC 3S0XA 1Y1WC 1PJ7A 4GTFA 3M4OC 1IS1A 1UV7A 4C2MK 2B63C 3I4MK 1J6XA 4ZH4A 3HOUC 4NOIA 5JVOA 2NVXC 4Y7NK 5IYDK 3HOWC 2YU9K 4G7HA 3GEIA 3T01A 1Y1VC 1WQHA 2NVTC 4BKWA 4MQ9A 4A3MC 3S16C 1YNNA 2NVYA 3S2DK 3HOYK 1O24A 3GTQC 4KN7A 1WSVA 1XZQA 3GTKK 5TMFA 2GAHC 3TFIA 4LR2A 4BY7C 5IOSA 1IQ0A 2NVQC 2JA8C 2YU9A 1O2FB 2FQOA 1K83C 1R9TC 1VRQC 2JA5K 4XLPA 2JA7A 2VUMK 2PA8D 1IL2A 3HOZK 3S1QC 1TWHK 4WJ4A 2Y0SL 5D4DA 2R92C 3GTKA 3AD8C 1IW7A 3G4CA 1TWGC 1WOOA 3GTPC 1JVIA 3S1RC 4OIOA 4G0UA 2R93C 4A3FC 3K7AK 4KAWX 2R7ZC 1G51A 2WB1L 1I3QC 3GTMC 4KMAA 2VUMA 4A3IC 3GTOA 2PMZL 3BP8C 4Y52C 4BY1C 3A8KA 4KM8A 3PO3C 2ZUFA 1L0WA 3V4GA 3ADAC 3GTLC 4LJZA 1BDFA 4A3LC 4A3GC 3FHZA 2NVXA 1XZPB 5IP9C 2GAGC 1BGWA 3SZZA 2V6SA 4A3CC 2D6FC 2A6EA 3RZOC 4X6AC 3GEHA 4KC6A 4YFXA 3GTJK 1EH1A 4A3BC 4AH6A 4A3JK 2CFAA 4M1XA 4BXXC 4GFQA 3T02A 4OIQA 1USMA 4A3EK 1JOEA 3BP3A 3S15K 1DCPA 4C3JC 3S1NK 2PPBA 1K83A 3BUEA 3S1MK 4G7ZA 4QJVB
chains in the Genus database with same CATH topology
2ZFZA 5TJ3A 1XXAA 1DD5A 4BLAA 1Y1VA 5JVOA 1O26A 2PHCB 3GTJA 4P5BA 5IORA 1WQHA 4KATA 4BKWA 3GTQA 3L4JA 4KASA 2JA6A 1O2AA 2NVYA 3LAJA 4GTEA 1O24A 3ERED 4LR2A 1WIHA 1R9TA 4KM9A 5IOSA 2E2HA 4C2MC 1ZVUA 5EGHA 2YU9A 2JA5A 3LPXA 2XCRB 4KMDA 4FM9A 4ILDA 4P5AA 1TWHA 2JA7A 3AQOA 2R92A 1WQGA 1O27A 5IOTA 4G0VA 4KDDA 1TWGA 1ZBSA 1F9NA 3GTPA 1ISEA 2RH6A 3QX3A 2R93A 5CJ9A 3GTKA 2Y3PA 4J3NA 3OPFA 3G4CA 3NUHA 4BLBA 4G0UA 3N0BA 2GSNA 2R7ZA 1TWAA 1EK8A 4GTAA 1I3QA 3GTMA 3L4KA 1SFOA 1XXCA 2GSOA 4KAWX 3MMLB 3FKIA 1ZXOA 4KMAA 5IOQA 2E2IA 4GT9A 2XCQA 2VUMA 1TWFA 1B4AA 3GTOA 3G4AA 5EGEA 1KQ4A 3AH5A 3H0GA 4KARA 1WQFA 1XXBA 1GE9A 2P5MA 1O29A 3GTLA 1B4BA 2GSUA 2XCOA 4KM8A 1I50A 2RGRA 4KB4A 3V4GA 3CQZA 1O2BA 1BJTA 2KWAA 4KB2A 1AB4A 1WCMA 3Q3QA 4KMHA 3FHZA 2NVXA 1O28A 1BGWA 4C3HC 4LQYA 2CFAB 4GTBA 5JFEA 4DDQA 1TWCA 3N0CA 4GTLA 4C3IC 3OREA 4FZBA 4KC6A 3CAGA 4GTCA 1EH1A 4G0WA 3N3YA 3AQPA 1O25A 3VA7A 3OEPA 3GTGA 3FOEA 2JH3A 2CFAA 1Y1WA 4M1XA 4GFQA 5CHPA 2B63A 4C3JC 3LAPA 3FOFA 1K83A 3BUEA 3S0XA 4GTFA 1IS1A 4GTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA B;  4GTB A;  5JFE A;  1O26 A;  3N0C A;  4GTL A;  5IOQ A;  4FZB A;  4GT9 A;  4P5A A;  4P5B A;  4GTC A;  3G4A A;  5IOR A;  3N3Y A;  1O27 A;  1KQ4 A;  5IOT A;  3AH5 A;  4KAR A;  1O25 A;  4KAT A;  4KAS A;  1O2A A;  1O29 A;  4GTE A;  2CFA A;  5IOS A;  1O24 A;  3G4C A;  5CHP A;  1O2B A;  3N0B A;  4GTA A;  4GTF A;  1O28 A;  4GTD A; 
#chains in the Genus database with same CATH topology
 2V6U A;  3I4N K;  4BLA A;  3I4M C;  1O26 A;  3GTJ A;  3RZD K;  4AYB L;  3GEE A;  4YG2 A;  5E68 A;  3PO2 K;  4KAS A;  2JA6 A;  3LAJ A;  4A3D K;  2A6H A;  1SMY A;  2NVY K;  3HOY C;  3EQL A;  1V5V A;  4KM9 A;  3HXA A;  1JQW A;  3GSI A;  1WOP A;  5IYB K;  2E2H A;  1ZVU A;  1SFO K;  3M3Y K;  1DCH A;  3FKI K;  4KMD A;  4FM9 A;  3TFJ A;  2JA5 C;  1I6H K;  1RU0 A;  1WQG A;  1TWF K;  1O27 A;  4KN4 A;  5IYC K;  4XSZ A;  1ZBS A;  2JA7 K;  1F9N A;  3HOZ C;  3HOX C;  3H0G K;  3S17 K;  4A93 C;  1TWH C;  5CJ9 A;  2Y3P A;  4A3K K;  2GSN A;  4BBR K;  1EK8 A;  4GTA A;  4C3H K;  3WOD A;  3L4K A;  1WCM K;  1SFO A;  1XXC A;  2BE5 A;  4XLN A;  1TWA C;  1YNJ A;  3FKI A;  3S2H K;  5IOQ A;  2XCQ A;  2PA8 L;  1ZYR A;  1TWF A;  1INN A;  4LLG A;  5EGE A;  2E2J C;  1USO A;  3H0G A;  2E2I C;  1WQF A;  3GTO K;  3S14 C;  2P5M A;  1GE9 A;  4RMF A;  1O29 A;  5C4J C;  4MEX A;  1I50 A;  2O5J A;  3M4O K;  1WCM A;  2B63 K;  1O28 A;  4QIW D;  3TTG A;  4LK0 A;  3HOV C;  3HOU K;  3CQZ C;  4XCH A;  2NVX K;  4WJ3 M;  1XZQ B;  4DDQ A;  3N0C A;  4C3I C;  2NVT K;  3CAG A;  2WAQ D;  3IPJ A;  4A3M K;  3AQP A;  5M5X K;  1XZP A;  3GTG A;  3FOE A;  2A69 A;  1Y1W A;  1VJE A;  2B63 A;  4BY7 K;  3FOF A;  5C3E K;  2NVQ K;  2V6T A;  1ZQ1 C;  3S1N C;  4GTD A;  2JA8 K;  1IBA A;  1R9T K;  1K83 K;  1Y1V A;  5M3M K;  3I4N C;  4PAB A;  5IP7 C;  2PHC B;  4BBS C;  5IOR A;  5C4X K;  1VGX A;  4KAT A;  1TWC C;  2R92 K;  3GTQ A;  4YFK A;  3PO2 C;  1O2A A;  4Q5S A;  4GTE A;  1WOR A;  3S1R K;  2JA6 K;  2R93 K;  4A3D C;  4A3F K;  1HQM A;  3ERE D;  4Q4Z A;  1R9T A;  1WSR A;  4YFN A;  1I3Q K;  2EBB A;  4C2M C;  3LPX A;  2XCR B;  4WIL A;  4A3I K;  3M3Y C;  4ILD A;  3A8J A;  2E2H K;  1C0A A;  4Y7N C;  5IYD C;  3AQO A;  2YU9 C;  2R92 A;  4G0V A;  4KDD A;  1TWG A;  3GTP A;  1ISE A;  3QX3 A;  2JA7 C;  2R93 A;  1YCL A;  4A3L K;  3S2D C;  4A3G K;  3NUH A;  4BLB A;  4A3K C;  2R7Z A;  3GTK C;  1F7V A;  4BBR C;  1X31 C;  3HKZ D;  1I3Q A;  4A3C K;  3GTM A;  5HL8 A;  5FJ8 K;  5FLM K;  3RZO K;  2GSO A;  4X6A K;  1ZXO A;  4GT9 A;  2A68 A;  4A3B K;  3AD9 C;  1XPP A;  1KQ4 A;  4KAR A;  2VUM C;  5TMC A;  3GTO C;  3GTL A;  3H3V D;  2GSU A;  4C3J K;  2RGR A;  4KB4 A;  4LK1 A;  3DXJ A;  2O5I A;  2KWA A;  1AB4 A;  1I50 K;  4KMH A;  4LQY A;  5C44 K;  4GTB A;  5JFE A;  1TWC A;  3K7A C;  4O2D A;  4GTL A;  4MEY A;  4LOW A;  3N3Y A;  3VA7 A;  2CW0 A;  1PJ6 A;  4C45 A;  3GTG K;  4QIW L;  2ZUE A;  1Y1W K;  1YX2 A;  5C3E C;  4GZY A;  2ZFZ A;  5TJ3 A;  1XXA A;  1DD5 A;  3HOW K;  1F93 A;  2WAQ L;  1Y1V K;  3AD7 C;  4P5B A;  3HOX K;  4A93 K;  3GTJ C;  3S16 K;  5C4X C;  3L4J A;  4G7O A;  3GTQ K;  4OIN A;  3GDZ A;  2Y0S D;  2W7V A;  4A3J C;  2JA6 C;  1VLO A;  5M5Y K;  1EFW A;  3S15 C;  1WIH A;  4A3E C;  1TWA K;  5M3F K;  3S1M C;  5EGH A;  2JA5 A;  2E2J K;  4P5A A;  2E2I K;  2WB1 D;  2E2H C;  1TWH A;  3S1Q K;  3S14 K;  3RZD C;  4OIR A;  5IOT A;  1F7U A;  1EQR A;  5C4J K;  2RH6 A;  4QJV A;  2PMZ D;  4OIP A;  1TWG K;  4J3N A;  3OPF A;  3GTP K;  1J98 A;  3TFH A;  3N0B A;  3HOV K;  1TWA A;  3CQZ K;  2NVY C;  1VH2 A;  2P8T A;  2R7Z K;  4PAA A;  4C3I K;  5FLM C;  1EI6 A;  3MML B;  3GTM K;  1DCO A;  5IYB C;  2E2I A;  3GIR A;  1SFO C;  2FQT A;  1B4A A;  3FKI C;  3T00 A;  3G4A A;  3AH5 A;  4Y52 K;  1XXB A;  4BY1 K;  3SZY A;  1I6H C;  1TWF C;  5IYC C;  3PO3 K;  1B4B A;  2XCO A;  4JK1 A;  1J6V A;  3H0G C;  3JST A;  3S17 C;  3GTL K;  3CQZ A;  3HKZ L;  1O2B A;  1BJT A;  1IE0 A;  4KB2 A;  3Q3Q A;  5IP9 K;  1HI9 A;  1I50 C;  4C3H C;  4KMU A;  5IP7 K;  2CFA B;  1WCM C;  1PJ5 A;  4BBS K;  5C44 C;  3ORE A;  4FZB A;  1BS2 A;  5L46 A;  1I6V A;  1TWC K;  4GTC A;  3A8I A;  4G0W A;  3S2H C;  1WOS A;  5M5W K;  4P9S A;  3H3V L;  1O25 A;  4AYB D;  1J6W A;  3OEP A;  4BXX K;  2JH3 A;  5CHP A;  4XSX A;  3LAP A;  3GTG C;  3S0X A;  1Y1W C;  1PJ7 A;  4GTF A;  3M4O C;  1IS1 A;  1UV7 A;  4C2M K;  2B63 C;  3I4M K;  1J6X A;  4ZH4 A;  3HOU C;  4NOI A;  5JVO A;  2NVX C;  4Y7N K;  5IYD K;  3HOW C;  2YU9 K;  4G7H A;  3GEI A;  3T01 A;  1Y1V C;  1WQH A;  2NVT C;  4BKW A;  4MQ9 A;  4A3M C;  3S16 C;  1YNN A;  2NVY A;  3S2D K;  3HOY K;  1O24 A;  3GTQ C;  4KN7 A;  1WSV A;  1XZQ A;  3GTK K;  5TMF A;  2GAH C;  3TFI A;  4LR2 A;  4BY7 C;  5IOS A;  1IQ0 A;  2NVQ C;  2JA8 C;  2YU9 A;  1O2F B;  2FQO A;  1K83 C;  1R9T C;  1VRQ C;  2JA5 K;  4XLP A;  2JA7 A;  2VUM K;  2PA8 D;  1IL2 A;  3HOZ K;  3S1Q C;  1TWH K;  4WJ4 A;  2Y0S L;  5D4D A;  2R92 C;  3GTK A;  3AD8 C;  1IW7 A;  3G4C A;  1TWG C;  1WOO A;  3GTP C;  1JVI A;  3S1R C;  4OIO A;  4G0U A;  2R93 C;  4A3F C;  3K7A K;  4KAW X;  2R7Z C;  1G51 A;  2WB1 L;  1I3Q C;  3GTM C;  4KMA A;  2VUM A;  4A3I C;  3GTO A;  2PMZ L;  3BP8 C;  4Y52 C;  4BY1 C;  3A8K A;  4KM8 A;  3PO3 C;  2ZUF A;  1L0W A;  3V4G A;  3ADA C;  3GTL C;  4LJZ A;  1BDF A;  4A3L C;  4A3G C;  3FHZ A;  2NVX A;  1XZP B;  5IP9 C;  2GAG C;  1BGW A;  3SZZ A;  2V6S A;  4A3C C;  2D6F C;  2A6E A;  3RZO C;  4X6A C;  3GEH A;  4KC6 A;  4YFX A;  3GTJ K;  1EH1 A;  4A3B C;  4AH6 A;  4A3J K;  2CFA A;  4M1X A;  4BXX C;  4GFQ A;  3T02 A;  4OIQ A;  1USM A;  4A3E K;  1JOE A;  3BP3 A;  3S15 K;  1DCP A;  4C3J C;  3S1N K;  2PPB A;  1K83 A;  3BUE A;  3S1M K;  4G7Z A;  4QJV B; 
#chains in the Genus database with same CATH homology
 2ZFZ A;  5TJ3 A;  1XXA A;  1DD5 A;  4BLA A;  1Y1V A;  5JVO A;  1O26 A;  2PHC B;  3GTJ A;  4P5B A;  5IOR A;  1WQH A;  4KAT A;  4BKW A;  3GTQ A;  3L4J A;  4KAS A;  2JA6 A;  1O2A A;  2NVY A;  3LAJ A;  4GTE A;  1O24 A;  3ERE D;  4LR2 A;  1WIH A;  1R9T A;  4KM9 A;  5IOS A;  2E2H A;  4C2M C;  1ZVU A;  5EGH A;  2YU9 A;  2JA5 A;  3LPX A;  2XCR B;  4KMD A;  4FM9 A;  4ILD A;  4P5A A;  1TWH A;  2JA7 A;  3AQO A;  2R92 A;  1WQG A;  1O27 A;  5IOT A;  4G0V A;  4KDD A;  1TWG A;  1ZBS A;  1F9N A;  3GTP A;  1ISE A;  2RH6 A;  3QX3 A;  2R93 A;  5CJ9 A;  3GTK A;  2Y3P A;  4J3N A;  3OPF A;  3G4C A;  3NUH A;  4BLB A;  4G0U A;  3N0B A;  2GSN A;  2R7Z A;  1TWA A;  1EK8 A;  4GTA A;  1I3Q A;  3GTM A;  3L4K A;  1SFO A;  1XXC A;  2GSO A;  4KAW X;  3MML B;  3FKI A;  1ZXO A;  4KMA A;  5IOQ A;  2E2I A;  4GT9 A;  2XCQ A;  2VUM A;  1TWF A;  1B4A A;  3GTO A;  3G4A A;  5EGE A;  1KQ4 A;  3AH5 A;  3H0G A;  4KAR A;  1WQF A;  1XXB A;  1GE9 A;  2P5M A;  1O29 A;  3GTL A;  1B4B A;  2GSU A;  2XCO A;  4KM8 A;  1I50 A;  2RGR A;  4KB4 A;  3V4G A;  3CQZ A;  1O2B A;  1BJT A;  2KWA A;  4KB2 A;  1AB4 A;  1WCM A;  3Q3Q A;  4KMH A;  3FHZ A;  2NVX A;  1O28 A;  1BGW A;  4C3H C;  4LQY A;  2CFA B;  4GTB A;  5JFE A;  4DDQ A;  1TWC A;  3N0C A;  4GTL A;  4C3I C;  3ORE A;  4FZB A;  4KC6 A;  3CAG A;  4GTC A;  1EH1 A;  4G0W A;  3N3Y A;  3AQP A;  1O25 A;  3VA7 A;  3OEP A;  3GTG A;  3FOE A;  2JH3 A;  2CFA A;  1Y1W A;  4M1X A;  4GFQ A;  5CHP A;  2B63 A;  4C3J C;  3LAP A;  3FOF A;  1K83 A;  3BUE A;  3S0X A;  4GTF A;  1IS1 A;  4GTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...