1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
1O28A 4GTBA 4GTLA 4FZBA 5CHPA 4GTAA 2CFAB 5IORA 4GTEA 1O24A 4GTCA 1O27A 5IOTA 4P5AA 4KASA 1O29A 3N0CA 5JFEA 1O2AA 3AH5A 4KATA 4P5BA 5IOSA 3N3YA 4GTFA 4GTDA 1O2BA 1O25A 4KARA 1KQ4A 3G4CA 4GT9A 1O26A 2CFAA 5IOQA 3G4AA 3N0BA
chains in the Genus database with same CATH superfamily
4GTLA 4LJZA 3T02A 3HXAA 4XCHA 3T00A 1X31C 3A8IA 2NVXC 5IP9K 2NVXA 2V6UA 4KM8A 1O29A 1TWCK 1XPPA 4OIRA 4OINA 4P9SA 2RGRA 5M5XK 3FKIC 3EQLA 1SMYA 4NOIA 3FKIA 3HOWK 2V6TA 4X6AC 4YG2A 4YFXA 3HKZL 3S2DC 3OEPA 1R9TA 1HI9A 3K7AK 4QIWD 3BUEA 4C3JK 2O5JA 1ZYRA 1F7UA 4A3MC 3HOZK 3S14C 4G0WA 1EH1A 3OREA 3CAGA 3RZDC 3GTOK 1J98A 1USMA 3A8KA 1Y1WC 3GTQA 5TJ3A 1GE9A 2Y0SD 1TWGA 1WQFA 4MQ9A 2R7ZK 5JFEA 4A3GC 1VRQC 2R93A 1EI6A 1K83K 1I6VA 3M4OC 3GTPK 2JA6A 2WB1D 3AD7C 5L46A 3S2HC 2Y3PA 2NVQK 4A3CK 4KDDA 3PO3K 4C3HC 2JA7C 2GSOA 4A3FC 2R92C 4O2DA 2R92A 4G7HA 2JA7A 1TWHK 3TFHA 4XLPA 4BLBA 2KWAA 2JA5C 3GTGA 1J6WA 4QJVB 3GTMK 3ERED 3S17K 3S1MK 3GSIA 5IYCC 3LPXA 2PHCB 1PJ5A 3HOYC 4A3EC 5M5WK 4J3NA 1WORA 4BBSC 4C2MC 1BS2A 5C4XK 3LAJA 3RZOK 4XSZA 1PJ6A 1YCLA 3HOVC 3HOUC 4LK1A 2ZFZA 1R9TK 2GSNA 1I6HK 2E2IA 2P5MA 2NVYC 4ILDA 4WJ3M 3FOEA 3GTQK 1O2AA 3I4NK 3H0GA 1TWGK 5C3EC 1EQRA 1BJTA 4BLAA 4GZYA 2R93K 5FLMK 3AQPA 5EGHA 3TFIA 4QJVA 4ZH4A 2E2JK 2JA6K 3GTKA 5CJ9A 2YU9K 4G7ZA 2JH3A 3CQZC 1O27A 4AH6A 1I3QC 4Y7NK 3S1RC 3GTGK 2E2HA 5E68A 1SFOA 5C4JC 2GSUA 4C3IK 1G51A 2WAQD 3AQOA 4GTDA 1VH2A 4A3KK 5IOQA 2PA8L 3GTJC 3I4MK 4Y52C 4BXXC 4BY7K 1DCPA 2B63C 4BY1K 4WILA 2JA8C 4A3JK 1IW7A 5IP7C 3DXJA 2A6EA 2E2IK 1Y1VC 3S16K 4C45A 4P5BA 4KATA 5C44K 4KAWX 5IYBK 3JSTA 4KARA 1J6XA 3G4CA 3S15C 3S1QC 3H0GK 4BKWA 4AYBL 3N0BA 3QX3A 2P8TA 1YNJA 3L4KA 1PJ7A 2A69A 4LR2A 1F7VA 3S1NC 4A3LC 2ZUFA 1VJEA 3HKZD 1WOSA 3GTKK 4A3IC 1Y1WA 1ZVUA 3HOXC 1J6VA 3M3YK 1XZPA 1WCMC 4A93K 5IYDK 1O26A 2E2HK 1SFOK 2NVTC 1JOEA 2VUMC 2PMZL 5TMCA 2VUMA 1O24A 4LK0A 4PABA 2GAGC 4LLGA 3GEEA 3TTGA 2JA5A 1WSRA 1TWAC 4KN4A 1BGWA 3N3YA 3WODA 2NVXK 1JQWA 4A3DC 1DD5A 3PO2C 4KMAA 3FKIK 4BBRC 4X6AK 1JVIA 3ADAC 1XXCA 4KMHA 3S2DK 4GTCA 4KM9A 4A3BC 1F93A 1WQHA 4A3MK 2NVYA 3S14K 1INNA 1I50C 1C0AA 3AD9C 2XCQA 1TWFC 3S0XA 3GTLC 3Q3QA 3RZDK 5IOSA 1Y1WK 2O5IA 4GT9A 3V4GA 3SZZA 4A3GK 1O2FB 5IP9C 4FZBA 3M4OK 2CFAB 1TWCC 1TWCA 3L4JA 1B4BA 3S2HK 1IE0A 2ZUEA 1XXBA 4C3HK 3CQZA 4A3FK 2JA7K 4RMFA 2R92K 3HOWC 1ZXOA 4KB4A 1I3QA 5M3FK 1WOOA 3H3VL 3K7AC 4C3JC 4OIOA 1EK8A 5TMFA 2JA5K 3HOZC 4GTFA 4LOWA 3GEHA 3AD8C 1ISEA 3GTOC 1O28A 4GTBA 3GTOA 2V6SA 3GTJA 5IYCK 3TFJA 3HOYK 2B63A 4A3EK 2R7ZC 1IL2A 5EGEA 4BBSK 4C2MK 4JK1A 1K83C 2GAHC 3MMLB 5FJ8K 1K83A 2PA8D 3GTPC 3HOVK 1BDFA 3GTPA 1YNNA 2NVQC 4A3CC 3PO3C 2NVYK 2XCOA 1Y1VA 4DDQA 1IS1A 4KMDA 1TWHC 1WSVA 1XXAA 1TWHA 1V5VA 3GTMC 4GTAA 4KC6A 2FQTA 3GTMA 1HQMA 1VGXA 3S17C 5C3EK 3S1MC 4WJ4A 1RU0A 3FHZA 4QIWL 3GTLK 4AYBD 2PPBA 3RZOC 5C4XC 3CQZK 2W7VA 3IPJA 1I3QK 3OPFA 1R9TC 1I6HC 1WCMA 4M1XA 3S1RK 2Y0SL 3VA7A 5CHPA 5C4JK 3SZYA 1USOA 4LQYA 3T01A 3GTJK 3GTQC 4BXXK 4Y52K 4Q4ZA 3I4NC 2WB1L 2B63K 1EFWA 1TWGC 5D4DA 4KASA 4MEXA 3N0CA 4G0VA 3FOFA 2JA8K 2R93C 5FLMC 2PMZD 1TWAA 1WIHA 4GFQA 4MEYA 1XZQB 2E2JC 1DCOA 2A6HA 5IP7K 1L0WA 1O25A 4OIPA 2JA6C 2YU9C 2YU9A 1Y1VK 3GDZA 5IORA 4Y7NC 3GTGC 3S15K 3S1QK 1ZQ1C 4C3IC 1UV7A 2A68A 4A3KC 3A8JA 3I4MC 1B4AA 3NUHA 4BY7C 1I50A 4OIQA 4G0UA 4A3LK 3S1NK 4BY1C 1TWFA 3GTLA 1VLOA 4A3IK 4YFNA 4PAAA 1IBAA 4A3JC 4XSXA 3HOXK 1ZBSA 5JVOA 2D6FC 4GTEA 1WCMK 4XLNA 2E2IC 1WQGA 3S16C 2EBBA 5M5YK 4G7OA 3BP3A 5C44C 4P5AA 5IYBC 1IQ0A 2FQOA 2NVTK 1XZQA 2VUMK 3H0GC 3BP8C 4KMUA 3GIRA 3AH5A 3LAPA 2CW0A 1WOPA 1TWAK 3G4AA 2BE5A 3GEIA 4KB2A 3GTKC 3H3VD 1DCHA 4A3DK 2WAQL 3PO2K 4Q5SA 2R7ZA 3M3YC 5IOTA 4YFKA 1YX2A 4KN7A 4A93C 5IYDC 2RH6A 4BBRK 1SFOC 2E2HC 3HOUK 4A3BK 1AB4A 1O2BA 4FM9A 1KQ4A 1I50K 1F9NA 2CFAA 5M3MK 2XCRB 1TWFK 5HL8A 1XZPB
chains in the Genus database with same CATH topology
4GTLA 3VA7A 5EGHA 5CHPA 3GTKA 4LQYA 5CJ9A 1XXCA 4KMHA 4GTCA 4KM9A 2JH3A 1O27A 1WQHA 2NVXA 4KM8A 4KASA 1O29A 2NVYA 3N0CA 4G0VA 2XCQA 3FOFA 2RGRA 3S0XA 3Q3QA 1SFOA 2E2HA 5IOSA 1TWAA 1WIHA 4GFQA 2GSUA 3AQOA 4GTDA 1O25A 3FKIA 4GT9A 3V4GA 5IOQA 3OEPA 1R9TA 2YU9A 3BUEA 4FZBA 2CFAB 5IORA 1TWCA 1EH1A 4G0WA 3OREA 3CAGA 3L4JA 1B4BA 4C3IC 3GTQA 1XXBA 5TJ3A 3CQZA 1GE9A 1ZXOA 1TWGA 4KB4A 1I3QA 1WQFA 1B4AA 3NUHA 5JFEA 4C3JC 1I50A 4G0UA 4P5BA 4KATA 2R93A 1EK8A 1TWFA 3GTLA 4GTFA 4KAWX 4KARA 3G4CA 2JA6A 1ISEA 4BKWA 1ZBSA 2Y3PA 3N0BA 1O28A 4GTBA 3GTOA 3GTJA 4KDDA 3QX3A 4C3HC 5JVOA 2GSOA 2B63A 2R92A 2JA7A 3L4KA 4GTEA 1WQGA 5EGEA 4LR2A 4BLBA 2KWAA 3GTGA 3MMLB 4P5AA 1K83A 3ERED 3GTPA 1Y1WA 1ZVUA 3AH5A 3LAPA 3LPXA 2PHCB 2XCOA 1Y1VA 4DDQA 1IS1A 4KMDA 1O26A 1XXAA 4J3NA 1TWHA 3G4AA 4C2MC 3LAJA 4KB2A 4GTAA 4KC6A 3GTMA 2VUMA 1O24A 2ZFZA 2GSNA 2E2IA 2R7ZA 2P5MA 3FHZA 5IOTA 2JA5A 4ILDA 2RH6A 3FOEA 1O2AA 3H0GA 3N3YA 1BGWA 1AB4A 3OPFA 1O2BA 4FM9A 1KQ4A 1BJTA 1F9NA 2CFAA 4BLAA 1DD5A 2XCRB 1WCMA 4M1XA 3AQPA 4KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O28 A;  4GTB A;  4GTL A;  4FZB A;  5CHP A;  4GTA A;  2CFA B;  5IOR A;  4GTE A;  1O24 A;  4GTC A;  1O27 A;  5IOT A;  4P5A A;  4KAS A;  1O29 A;  3N0C A;  5JFE A;  1O2A A;  3AH5 A;  4KAT A;  4P5B A;  5IOS A;  3N3Y A;  4GTF A;  4GTD A;  1O2B A;  1O25 A;  4KAR A;  1KQ4 A;  3G4C A;  4GT9 A;  1O26 A;  2CFA A;  5IOQ A;  3G4A A;  3N0B A; 
#chains in the Genus database with same CATH topology
 4GTL A;  4LJZ A;  3T02 A;  3HXA A;  4XCH A;  3T00 A;  1X31 C;  3A8I A;  2NVX C;  5IP9 K;  2NVX A;  2V6U A;  4KM8 A;  1O29 A;  1TWC K;  1XPP A;  4OIR A;  4OIN A;  4P9S A;  2RGR A;  5M5X K;  3FKI C;  3EQL A;  1SMY A;  4NOI A;  3FKI A;  3HOW K;  2V6T A;  4X6A C;  4YG2 A;  4YFX A;  3HKZ L;  3S2D C;  3OEP A;  1R9T A;  1HI9 A;  3K7A K;  4QIW D;  3BUE A;  4C3J K;  2O5J A;  1ZYR A;  1F7U A;  4A3M C;  3HOZ K;  3S14 C;  4G0W A;  1EH1 A;  3ORE A;  3CAG A;  3RZD C;  3GTO K;  1J98 A;  1USM A;  3A8K A;  1Y1W C;  3GTQ A;  5TJ3 A;  1GE9 A;  2Y0S D;  1TWG A;  1WQF A;  4MQ9 A;  2R7Z K;  5JFE A;  4A3G C;  1VRQ C;  2R93 A;  1EI6 A;  1K83 K;  1I6V A;  3M4O C;  3GTP K;  2JA6 A;  2WB1 D;  3AD7 C;  5L46 A;  3S2H C;  2Y3P A;  2NVQ K;  4A3C K;  4KDD A;  3PO3 K;  4C3H C;  2JA7 C;  2GSO A;  4A3F C;  2R92 C;  4O2D A;  2R92 A;  4G7H A;  2JA7 A;  1TWH K;  3TFH A;  4XLP A;  4BLB A;  2KWA A;  2JA5 C;  3GTG A;  1J6W A;  4QJV B;  3GTM K;  3ERE D;  3S17 K;  3S1M K;  3GSI A;  5IYC C;  3LPX A;  2PHC B;  1PJ5 A;  3HOY C;  4A3E C;  5M5W K;  4J3N A;  1WOR A;  4BBS C;  4C2M C;  1BS2 A;  5C4X K;  3LAJ A;  3RZO K;  4XSZ A;  1PJ6 A;  1YCL A;  3HOV C;  3HOU C;  4LK1 A;  2ZFZ A;  1R9T K;  2GSN A;  1I6H K;  2E2I A;  2P5M A;  2NVY C;  4ILD A;  4WJ3 M;  3FOE A;  3GTQ K;  1O2A A;  3I4N K;  3H0G A;  1TWG K;  5C3E C;  1EQR A;  1BJT A;  4BLA A;  4GZY A;  2R93 K;  5FLM K;  3AQP A;  5EGH A;  3TFI A;  4QJV A;  4ZH4 A;  2E2J K;  2JA6 K;  3GTK A;  5CJ9 A;  2YU9 K;  4G7Z A;  2JH3 A;  3CQZ C;  1O27 A;  4AH6 A;  1I3Q C;  4Y7N K;  3S1R C;  3GTG K;  2E2H A;  5E68 A;  1SFO A;  5C4J C;  2GSU A;  4C3I K;  1G51 A;  2WAQ D;  3AQO A;  4GTD A;  1VH2 A;  4A3K K;  5IOQ A;  2PA8 L;  3GTJ C;  3I4M K;  4Y52 C;  4BXX C;  4BY7 K;  1DCP A;  2B63 C;  4BY1 K;  4WIL A;  2JA8 C;  4A3J K;  1IW7 A;  5IP7 C;  3DXJ A;  2A6E A;  2E2I K;  1Y1V C;  3S16 K;  4C45 A;  4P5B A;  4KAT A;  5C44 K;  4KAW X;  5IYB K;  3JST A;  4KAR A;  1J6X A;  3G4C A;  3S15 C;  3S1Q C;  3H0G K;  4BKW A;  4AYB L;  3N0B A;  3QX3 A;  2P8T A;  1YNJ A;  3L4K A;  1PJ7 A;  2A69 A;  4LR2 A;  1F7V A;  3S1N C;  4A3L C;  2ZUF A;  1VJE A;  3HKZ D;  1WOS A;  3GTK K;  4A3I C;  1Y1W A;  1ZVU A;  3HOX C;  1J6V A;  3M3Y K;  1XZP A;  1WCM C;  4A93 K;  5IYD K;  1O26 A;  2E2H K;  1SFO K;  2NVT C;  1JOE A;  2VUM C;  2PMZ L;  5TMC A;  2VUM A;  1O24 A;  4LK0 A;  4PAB A;  2GAG C;  4LLG A;  3GEE A;  3TTG A;  2JA5 A;  1WSR A;  1TWA C;  4KN4 A;  1BGW A;  3N3Y A;  3WOD A;  2NVX K;  1JQW A;  4A3D C;  1DD5 A;  3PO2 C;  4KMA A;  3FKI K;  4BBR C;  4X6A K;  1JVI A;  3ADA C;  1XXC A;  4KMH A;  3S2D K;  4GTC A;  4KM9 A;  4A3B C;  1F93 A;  1WQH A;  4A3M K;  2NVY A;  3S14 K;  1INN A;  1I50 C;  1C0A A;  3AD9 C;  2XCQ A;  1TWF C;  3S0X A;  3GTL C;  3Q3Q A;  3RZD K;  5IOS A;  1Y1W K;  2O5I A;  4GT9 A;  3V4G A;  3SZZ A;  4A3G K;  1O2F B;  5IP9 C;  4FZB A;  3M4O K;  2CFA B;  1TWC C;  1TWC A;  3L4J A;  1B4B A;  3S2H K;  1IE0 A;  2ZUE A;  1XXB A;  4C3H K;  3CQZ A;  4A3F K;  2JA7 K;  4RMF A;  2R92 K;  3HOW C;  1ZXO A;  4KB4 A;  1I3Q A;  5M3F K;  1WOO A;  3H3V L;  3K7A C;  4C3J C;  4OIO A;  1EK8 A;  5TMF A;  2JA5 K;  3HOZ C;  4GTF A;  4LOW A;  3GEH A;  3AD8 C;  1ISE A;  3GTO C;  1O28 A;  4GTB A;  3GTO A;  2V6S A;  3GTJ A;  5IYC K;  3TFJ A;  3HOY K;  2B63 A;  4A3E K;  2R7Z C;  1IL2 A;  5EGE A;  4BBS K;  4C2M K;  4JK1 A;  1K83 C;  2GAH C;  3MML B;  5FJ8 K;  1K83 A;  2PA8 D;  3GTP C;  3HOV K;  1BDF A;  3GTP A;  1YNN A;  2NVQ C;  4A3C C;  3PO3 C;  2NVY K;  2XCO A;  1Y1V A;  4DDQ A;  1IS1 A;  4KMD A;  1TWH C;  1WSV A;  1XXA A;  1TWH A;  1V5V A;  3GTM C;  4GTA A;  4KC6 A;  2FQT A;  3GTM A;  1HQM A;  1VGX A;  3S17 C;  5C3E K;  3S1M C;  4WJ4 A;  1RU0 A;  3FHZ A;  4QIW L;  3GTL K;  4AYB D;  2PPB A;  3RZO C;  5C4X C;  3CQZ K;  2W7V A;  3IPJ A;  1I3Q K;  3OPF A;  1R9T C;  1I6H C;  1WCM A;  4M1X A;  3S1R K;  2Y0S L;  3VA7 A;  5CHP A;  5C4J K;  3SZY A;  1USO A;  4LQY A;  3T01 A;  3GTJ K;  3GTQ C;  4BXX K;  4Y52 K;  4Q4Z A;  3I4N C;  2WB1 L;  2B63 K;  1EFW A;  1TWG C;  5D4D A;  4KAS A;  4MEX A;  3N0C A;  4G0V A;  3FOF A;  2JA8 K;  2R93 C;  5FLM C;  2PMZ D;  1TWA A;  1WIH A;  4GFQ A;  4MEY A;  1XZQ B;  2E2J C;  1DCO A;  2A6H A;  5IP7 K;  1L0W A;  1O25 A;  4OIP A;  2JA6 C;  2YU9 C;  2YU9 A;  1Y1V K;  3GDZ A;  5IOR A;  4Y7N C;  3GTG C;  3S15 K;  3S1Q K;  1ZQ1 C;  4C3I C;  1UV7 A;  2A68 A;  4A3K C;  3A8J A;  3I4M C;  1B4A A;  3NUH A;  4BY7 C;  1I50 A;  4OIQ A;  4G0U A;  4A3L K;  3S1N K;  4BY1 C;  1TWF A;  3GTL A;  1VLO A;  4A3I K;  4YFN A;  4PAA A;  1IBA A;  4A3J C;  4XSX A;  3HOX K;  1ZBS A;  5JVO A;  2D6F C;  4GTE A;  1WCM K;  4XLN A;  2E2I C;  1WQG A;  3S16 C;  2EBB A;  5M5Y K;  4G7O A;  3BP3 A;  5C44 C;  4P5A A;  5IYB C;  1IQ0 A;  2FQO A;  2NVT K;  1XZQ A;  2VUM K;  3H0G C;  3BP8 C;  4KMU A;  3GIR A;  3AH5 A;  3LAP A;  2CW0 A;  1WOP A;  1TWA K;  3G4A A;  2BE5 A;  3GEI A;  4KB2 A;  3GTK C;  3H3V D;  1DCH A;  4A3D K;  2WAQ L;  3PO2 K;  4Q5S A;  2R7Z A;  3M3Y C;  5IOT A;  4YFK A;  1YX2 A;  4KN7 A;  4A93 C;  5IYD C;  2RH6 A;  4BBR K;  1SFO C;  2E2H C;  3HOU K;  4A3B K;  1AB4 A;  1O2B A;  4FM9 A;  1KQ4 A;  1I50 K;  1F9N A;  2CFA A;  5M3M K;  2XCR B;  1TWF K;  5HL8 A;  1XZP B; 
#chains in the Genus database with same CATH homology
 4GTL A;  3VA7 A;  5EGH A;  5CHP A;  3GTK A;  4LQY A;  5CJ9 A;  1XXC A;  4KMH A;  4GTC A;  4KM9 A;  2JH3 A;  1O27 A;  1WQH A;  2NVX A;  4KM8 A;  4KAS A;  1O29 A;  2NVY A;  3N0C A;  4G0V A;  2XCQ A;  3FOF A;  2RGR A;  3S0X A;  3Q3Q A;  1SFO A;  2E2H A;  5IOS A;  1TWA A;  1WIH A;  4GFQ A;  2GSU A;  3AQO A;  4GTD A;  1O25 A;  3FKI A;  4GT9 A;  3V4G A;  5IOQ A;  3OEP A;  1R9T A;  2YU9 A;  3BUE A;  4FZB A;  2CFA B;  5IOR A;  1TWC A;  1EH1 A;  4G0W A;  3ORE A;  3CAG A;  3L4J A;  1B4B A;  4C3I C;  3GTQ A;  1XXB A;  5TJ3 A;  3CQZ A;  1GE9 A;  1ZXO A;  1TWG A;  4KB4 A;  1I3Q A;  1WQF A;  1B4A A;  3NUH A;  5JFE A;  4C3J C;  1I50 A;  4G0U A;  4P5B A;  4KAT A;  2R93 A;  1EK8 A;  1TWF A;  3GTL A;  4GTF A;  4KAW X;  4KAR A;  3G4C A;  2JA6 A;  1ISE A;  4BKW A;  1ZBS A;  2Y3P A;  3N0B A;  1O28 A;  4GTB A;  3GTO A;  3GTJ A;  4KDD A;  3QX3 A;  4C3H C;  5JVO A;  2GSO A;  2B63 A;  2R92 A;  2JA7 A;  3L4K A;  4GTE A;  1WQG A;  5EGE A;  4LR2 A;  4BLB A;  2KWA A;  3GTG A;  3MML B;  4P5A A;  1K83 A;  3ERE D;  3GTP A;  1Y1W A;  1ZVU A;  3AH5 A;  3LAP A;  3LPX A;  2PHC B;  2XCO A;  1Y1V A;  4DDQ A;  1IS1 A;  4KMD A;  1O26 A;  1XXA A;  4J3N A;  1TWH A;  3G4A A;  4C2M C;  3LAJ A;  4KB2 A;  4GTA A;  4KC6 A;  3GTM A;  2VUM A;  1O24 A;  2ZFZ A;  2GSN A;  2E2I A;  2R7Z A;  2P5M A;  3FHZ A;  5IOT A;  2JA5 A;  4ILD A;  2RH6 A;  3FOE A;  1O2A A;  3H0G A;  3N3Y A;  1BGW A;  1AB4 A;  3OPF A;  1O2B A;  4FM9 A;  1KQ4 A;  1BJT A;  1F9N A;  2CFA A;  4BLA A;  1DD5 A;  2XCR B;  1WCM A;  4M1X A;  3AQP A;  4KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...