1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
4GTEA 4KATA 3G4AA 5CHPA 1O24A 4P5AA 3N0CA 4GTAA 4KARA 5JFEA 3AH5A 2CFAB 4GTFA 3N0BA 1O2BA 1O27A 2CFAA 3G4CA 5IOSA 4GT9A 4P5BA 5IOTA 4GTDA 3N3YA 4GTBA 4FZBA 1O29A 1KQ4A 4GTLA 4GTCA 1O2AA 1O28A 5IORA 1O25A 5IOQA 4KASA 1O26A
chains in the Genus database with same CATH superfamily
1SMYA 2RGRA 1Y1WA 3M3YC 3G4AA 1XZPB 4ILDA 1JQWA 1R9TA 3OEPA 3S15C 3OPFA 1BDFA 1PJ5A 4BBRC 3L4KA 5TJ3A 2V6TA 1JOEA 2FQTA 1O27A 1Y1VA 1ZVUA 2E2HA 1I50A 3GTJA 3GTKC 1WORA 4AYBL 2JA7A 3HOZC 1I3QK 2R92A 2NVYA 4BLBA 4RMFA 2JA6A 1TWCC 4MEYA 1VLOA 3FKIA 3RZOC 4NOIA 1TWFK 4QJVB 3H0GC 2ZUFA 1EFWA 3BP3A 1ZBSA 3H3VD 3T02A 3N3YA 4A3IC 1IS1A 1WCMC 2NVTK 1YNJA 3BP8C 3S14K 2NVXK 3GTMK 3GTOC 4AYBD 4XLPA 1Y1WK 2A69A 1XXBA 4KATA 5L46A 1R9TK 3I4MK 5E68A 2JA5C 2PHCB 4KDDA 4A3CC 3FKIC 2JH3A 4GFQA 1J98A 5M5YK 4LLGA 3HOXC 4C3HC 3FHZA 1Y1VK 3PO3K 1C0AA 3AQPA 3FOEA 2E2HK 4GTBA 1I50K 1XXCA 3T00A 3TFIA 4A3BK 4A93K 4LK1A 4OINA 3H0GK 2JA7K 4A3DC 5FJ8K 5IOQA 3S1QC 1WOPA 2JA8C 4KC6A 1I6HC 1I3QA 2R92K 2NVYK 1O24A 1VH2A 4C2MK 3N0CA 2JA6K 2CW0A 1XPPA 2NVQK 3FKIK 1TWFA 4A3FC 4A3JK 2YU9C 1X31C 4Y52C 1Y1WC 4C3JC 3DXJA 5C44K 4J3NA 1SFOC 1F7VA 1ZXOA 1YX2A 1WCMA 3V4GA 1O2AA 1TWHC 2FQOA 3S14C 2EBBA 2P8TA 2D6FC 4C3JK 1YNNA 3S2DC 4OIQA 3GTQK 1R9TC 2O5IA 4GTAA 1DCOA 2ZFZA 4C45A 4QIWD 4GTFA 3N0BA 3HOVC 1O2BA 1EH1A 4BY1K 3HOZK 3S1NC 1USOA 4Y7NK 4A3MC 2GSNA 1HI9A 3H3VL 3H0GA 2KWAA 4KB2A 4GTEA 4X6AC 1TWCA 5C4XK 4P5AA 3IPJA 3GTOA 5JFEA 2NVTC 5M5XK 3S1MC 3TFJA 4KM9A 3GTGA 1UV7A 4FM9A 2E2HC 4BBRK 4MQ9A 4A3CK 1WCMK 1JVIA 2XCRB 3RZDC 5IP7C 1F7UA 1IE0A 4OIOA 3HOWC 2Y0SL 4G7HA 3AD8C 3GTGC 3I4MC 3GTQA 3S16K 4BY7C 3PO2C 2W7VA 3GEIA 3JSTA 1XZQA 4A3GK 4A3LC 1AB4A 2GSUA 5IYBC 4G7ZA 3GEEA 2PA8D 2GAGC 4GTCA 5IYCK 1BGWA 5JVOA 1ISEA 2R7ZA 5IP9C 1TWCK 4G7OA 1ZQ1C 3GTOK 2ZUEA 2B63A 1VGXA 2GSOA 3S0XA 1USMA 4QJVA 3T01A 5TMCA 3S1QK 2O5JA 5C4JK 2PPBA 4AH6A 3GTGK 4LQYA 1WOSA 4GTDA 5IYBK 2WB1D 4LOWA 3GTLA 3HOXK 1WQHA 3HOYC 2PA8L 1PJ7A 1I6VA 3HOUK 2GAHC 2PMZL 5IP9K 3EQLA 2YU9A 2CFAB 4A3KC 4BBSC 3CQZK 2E2IC 1TWGC 3TTGA 5C4JC 2CFAA 3ADAC 4A3FK 1Y1VC 3PO3C 3S2HC 4P9SA 4GT9A 1XZQB 3WODA 2B63C 1O29A 4OIRA 3CAGA 3S1RC 4YFXA 3A8IA 1TWFC 2WAQL 1IL2A 3HKZD 3Q3QA 2R7ZK 3AQOA 3BUEA 5IYDC 3I4NK 3SZYA 2B63K 1I3QC 1DCPA 4A3KK 2JA8K 3K7AK 2NVXA 3GIRA 1WIHA 1J6VA 4C3IC 3M4OK 3HOUC 1TWAC 1VJEA 2XCOA 5IOTA 2R93A 4LR2A 4KAWX 1ZYRA 4A3JC 3GTLK 1DCHA 3K7AC 1K83K 2V6SA 1TWGK 1WSVA 4XSZA 4O2DA 3S2DK 1WSRA 4G0VA 1TWAK 1BS2A 4KMDA 4KN7A 2JA5K 4BXXK 2YU9K 3GSIA 4XLNA 4OIPA 3GTPA 4GZYA 4LK0A 1XXAA 3S1RK 4G0WA 1J6WA 3CQZA 2VUMA 3LPXA 5FLMC 4C3IK 4KMUA 3GDZA 4Y7NC 4ZH4A 3RZOK 1IBAA 4KMAA 1B4AA 2JA7C 3A8JA 1F9NA 3GTJC 4A3EC 1HQMA 1O25A 1VRQC 1O26A 2WB1L 4BLAA 5IYDK 4KARA 4WILA 1EK8A 4DDQA 1EI6A 3GEHA 5FLMK 1SFOK 2BE5A 4G0UA 4A3MK 2P5MA 4KB4A 2R93K 5M5WK 5D4DA 4Q4ZA 1KQ4A 3GTLC 4A3IK 1YCLA 1K83A 1TWGA 2VUMC 5CJ9A 4Q5SA 1TWAA 1J6XA 1TWHK 2JA5A 3QX3A 1I6HK 4YG2A 1V5VA 3M3YK 3L4JA 3GTPK 3AH5A 3TFHA 4KN4A 1F93A 2VUMK 1RU0A 4A93C 3OREA 3SZZA 2R92C 4PAAA 3LAJA 2R7ZC 1O2FB 3ERED 5C3EK 2R93C 2A68A 2Y0SD 3GTKA 4C2MC 4A3BC 4Y52K 2PMZD 4YFKA 4X6AK 4WJ3M 1PJ6A 4JK1A 3S1MK 3S2HK 3S16C 3MMLB 2NVYC 1WQFA 4BY7K 3S17K 4WJ4A 3S15K 1K83C 1GE9A 1INNA 5HL8A 4KM8A 3HXAA 1SFOA 3HOVK 3CQZC 2E2IK 2RH6A 2NVXC 3GTMC 3HOWK 4YFNA 4P5BA 4BBSK 5C3EC 3A8KA 5IP7K 1B4BA 3HKZL 4FZBA 1G51A 4MEXA 3VA7A 1O28A 4M1XA 2NVQC 5TMFA 3FOFA 2JA6C 1TWHA 5CHPA 3RZDK 3GTQC 2E2JK 5C44C 4A3EK 4XCHA 3LAPA 1DD5A 1XZPA 2XCQA 3S1NK 3S17C 5IYCC 5EGHA 3GTJK 4GTLA 1WOOA 3GTKK 3M4OC 4KMHA 1L0WA 5IORA 3AD7C 1WQGA 1BJTA 4A3DK 4C3HK 4BY1C 3I4NC 3AD9C 2Y3PA 5C4XC 1I50C 4LJZA 5M3MK 2E2JC 4PABA 3NUHA 4BXXC 5M3FK 1IQ0A 3G4CA 3PO2K 5IOSA 2E2IA 4QIWL 3HOYK 5EGEA 2A6HA 1IW7A 2V6UA 3GTPC 4A3LK 2WAQD 4A3GC 1EQRA 4XSXA 4KASA 4BKWA 3GTMA 2A6EA
chains in the Genus database with same CATH topology
2RGRA 1Y1WA 2JA5A 3G4AA 2YU9A 3QX3A 4ILDA 1R9TA 4GTAA 3L4JA 3OEPA 2ZFZA 2CFAB 3AH5A 3OPFA 4GTFA 3L4KA 3N0BA 5TJ3A 1O2BA 3OREA 1EH1A 1O27A 3LAJA 2CFAA 4GT9A 3ERED 1Y1VA 1ZVUA 2E2HA 1I50A 3GTJA 2GSNA 1O29A 3GTKA 4C2MC 3CAGA 2JA7A 3H0GA 2KWAA 4KB2A 3Q3QA 4GTEA 3AQOA 3BUEA 3MMLB 1TWCA 2NVYA 4P5AA 4BLBA 2R92A 3GTOA 2JA6A 1WQFA 5JFEA 3FKIA 2NVXA 1GE9A 4KM8A 1WIHA 4C3IC 4KM9A 3GTGA 1ZBSA 1SFOA 2RH6A 2XCOA 4P5BA 5IOTA 4FM9A 2R93A 3N3YA 4LR2A 1B4BA 4FZBA 4KAWX 2XCRB 1IS1A 3VA7A 1O28A 4M1XA 4G0VA 3FOFA 1TWHA 4KMDA 4KATA 1XXBA 5CHPA 3GTQA 3GTPA 2PHCB 4KDDA 2JH3A 1XXAA 4G0WA 4GFQA 3CQZA 2VUMA 3LPXA 4C3HC 3FHZA 3LAPA 1DD5A 2XCQA 1AB4A 2GSUA 3AQPA 1B4AA 4KMAA 3FOEA 4GTBA 5EGHA 1XXCA 1F9NA 4GTLA 4KMHA 4GTCA 5IORA 1O25A 5IOQA 1BGWA 1O26A 5JVOA 1ISEA 1WQGA 4KC6A 1BJTA 2R7ZA 4BLAA 1I3QA 1O24A 2Y3PA 3N0CA 2B63A 4KARA 2GSOA 3S0XA 1EK8A 3NUHA 1TWFA 4DDQA 3G4CA 4LQYA 4C3JC 5IOSA 4G0UA 2E2IA 5EGEA 2P5MA 4KB4A 4GTDA 4J3NA 1ZXOA 1WCMA 1KQ4A 3V4GA 3GTLA 1K83A 1TWGA 1O2AA 1WQHA 4KASA 5CJ9A 4BKWA 3GTMA 1TWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTE A;  4KAT A;  3G4A A;  5CHP A;  1O24 A;  4P5A A;  3N0C A;  4GTA A;  4KAR A;  5JFE A;  3AH5 A;  2CFA B;  4GTF A;  3N0B A;  1O2B A;  1O27 A;  2CFA A;  3G4C A;  5IOS A;  4GT9 A;  4P5B A;  5IOT A;  4GTD A;  3N3Y A;  4GTB A;  4FZB A;  1O29 A;  1KQ4 A;  4GTL A;  4GTC A;  1O2A A;  1O28 A;  5IOR A;  1O25 A;  5IOQ A;  4KAS A;  1O26 A; 
#chains in the Genus database with same CATH topology
 1SMY A;  2RGR A;  1Y1W A;  3M3Y C;  3G4A A;  1XZP B;  4ILD A;  1JQW A;  1R9T A;  3OEP A;  3S15 C;  3OPF A;  1BDF A;  1PJ5 A;  4BBR C;  3L4K A;  5TJ3 A;  2V6T A;  1JOE A;  2FQT A;  1O27 A;  1Y1V A;  1ZVU A;  2E2H A;  1I50 A;  3GTJ A;  3GTK C;  1WOR A;  4AYB L;  2JA7 A;  3HOZ C;  1I3Q K;  2R92 A;  2NVY A;  4BLB A;  4RMF A;  2JA6 A;  1TWC C;  4MEY A;  1VLO A;  3FKI A;  3RZO C;  4NOI A;  1TWF K;  4QJV B;  3H0G C;  2ZUF A;  1EFW A;  3BP3 A;  1ZBS A;  3H3V D;  3T02 A;  3N3Y A;  4A3I C;  1IS1 A;  1WCM C;  2NVT K;  1YNJ A;  3BP8 C;  3S14 K;  2NVX K;  3GTM K;  3GTO C;  4AYB D;  4XLP A;  1Y1W K;  2A69 A;  1XXB A;  4KAT A;  5L46 A;  1R9T K;  3I4M K;  5E68 A;  2JA5 C;  2PHC B;  4KDD A;  4A3C C;  3FKI C;  2JH3 A;  4GFQ A;  1J98 A;  5M5Y K;  4LLG A;  3HOX C;  4C3H C;  3FHZ A;  1Y1V K;  3PO3 K;  1C0A A;  3AQP A;  3FOE A;  2E2H K;  4GTB A;  1I50 K;  1XXC A;  3T00 A;  3TFI A;  4A3B K;  4A93 K;  4LK1 A;  4OIN A;  3H0G K;  2JA7 K;  4A3D C;  5FJ8 K;  5IOQ A;  3S1Q C;  1WOP A;  2JA8 C;  4KC6 A;  1I6H C;  1I3Q A;  2R92 K;  2NVY K;  1O24 A;  1VH2 A;  4C2M K;  3N0C A;  2JA6 K;  2CW0 A;  1XPP A;  2NVQ K;  3FKI K;  1TWF A;  4A3F C;  4A3J K;  2YU9 C;  1X31 C;  4Y52 C;  1Y1W C;  4C3J C;  3DXJ A;  5C44 K;  4J3N A;  1SFO C;  1F7V A;  1ZXO A;  1YX2 A;  1WCM A;  3V4G A;  1O2A A;  1TWH C;  2FQO A;  3S14 C;  2EBB A;  2P8T A;  2D6F C;  4C3J K;  1YNN A;  3S2D C;  4OIQ A;  3GTQ K;  1R9T C;  2O5I A;  4GTA A;  1DCO A;  2ZFZ A;  4C45 A;  4QIW D;  4GTF A;  3N0B A;  3HOV C;  1O2B A;  1EH1 A;  4BY1 K;  3HOZ K;  3S1N C;  1USO A;  4Y7N K;  4A3M C;  2GSN A;  1HI9 A;  3H3V L;  3H0G A;  2KWA A;  4KB2 A;  4GTE A;  4X6A C;  1TWC A;  5C4X K;  4P5A A;  3IPJ A;  3GTO A;  5JFE A;  2NVT C;  5M5X K;  3S1M C;  3TFJ A;  4KM9 A;  3GTG A;  1UV7 A;  4FM9 A;  2E2H C;  4BBR K;  4MQ9 A;  4A3C K;  1WCM K;  1JVI A;  2XCR B;  3RZD C;  5IP7 C;  1F7U A;  1IE0 A;  4OIO A;  3HOW C;  2Y0S L;  4G7H A;  3AD8 C;  3GTG C;  3I4M C;  3GTQ A;  3S16 K;  4BY7 C;  3PO2 C;  2W7V A;  3GEI A;  3JST A;  1XZQ A;  4A3G K;  4A3L C;  1AB4 A;  2GSU A;  5IYB C;  4G7Z A;  3GEE A;  2PA8 D;  2GAG C;  4GTC A;  5IYC K;  1BGW A;  5JVO A;  1ISE A;  2R7Z A;  5IP9 C;  1TWC K;  4G7O A;  1ZQ1 C;  3GTO K;  2ZUE A;  2B63 A;  1VGX A;  2GSO A;  3S0X A;  1USM A;  4QJV A;  3T01 A;  5TMC A;  3S1Q K;  2O5J A;  5C4J K;  2PPB A;  4AH6 A;  3GTG K;  4LQY A;  1WOS A;  4GTD A;  5IYB K;  2WB1 D;  4LOW A;  3GTL A;  3HOX K;  1WQH A;  3HOY C;  2PA8 L;  1PJ7 A;  1I6V A;  3HOU K;  2GAH C;  2PMZ L;  5IP9 K;  3EQL A;  2YU9 A;  2CFA B;  4A3K C;  4BBS C;  3CQZ K;  2E2I C;  1TWG C;  3TTG A;  5C4J C;  2CFA A;  3ADA C;  4A3F K;  1Y1V C;  3PO3 C;  3S2H C;  4P9S A;  4GT9 A;  1XZQ B;  3WOD A;  2B63 C;  1O29 A;  4OIR A;  3CAG A;  3S1R C;  4YFX A;  3A8I A;  1TWF C;  2WAQ L;  1IL2 A;  3HKZ D;  3Q3Q A;  2R7Z K;  3AQO A;  3BUE A;  5IYD C;  3I4N K;  3SZY A;  2B63 K;  1I3Q C;  1DCP A;  4A3K K;  2JA8 K;  3K7A K;  2NVX A;  3GIR A;  1WIH A;  1J6V A;  4C3I C;  3M4O K;  3HOU C;  1TWA C;  1VJE A;  2XCO A;  5IOT A;  2R93 A;  4LR2 A;  4KAW X;  1ZYR A;  4A3J C;  3GTL K;  1DCH A;  3K7A C;  1K83 K;  2V6S A;  1TWG K;  1WSV A;  4XSZ A;  4O2D A;  3S2D K;  1WSR A;  4G0V A;  1TWA K;  1BS2 A;  4KMD A;  4KN7 A;  2JA5 K;  4BXX K;  2YU9 K;  3GSI A;  4XLN A;  4OIP A;  3GTP A;  4GZY A;  4LK0 A;  1XXA A;  3S1R K;  4G0W A;  1J6W A;  3CQZ A;  2VUM A;  3LPX A;  5FLM C;  4C3I K;  4KMU A;  3GDZ A;  4Y7N C;  4ZH4 A;  3RZO K;  1IBA A;  4KMA A;  1B4A A;  2JA7 C;  3A8J A;  1F9N A;  3GTJ C;  4A3E C;  1HQM A;  1O25 A;  1VRQ C;  1O26 A;  2WB1 L;  4BLA A;  5IYD K;  4KAR A;  4WIL A;  1EK8 A;  4DDQ A;  1EI6 A;  3GEH A;  5FLM K;  1SFO K;  2BE5 A;  4G0U A;  4A3M K;  2P5M A;  4KB4 A;  2R93 K;  5M5W K;  5D4D A;  4Q4Z A;  1KQ4 A;  3GTL C;  4A3I K;  1YCL A;  1K83 A;  1TWG A;  2VUM C;  5CJ9 A;  4Q5S A;  1TWA A;  1J6X A;  1TWH K;  2JA5 A;  3QX3 A;  1I6H K;  4YG2 A;  1V5V A;  3M3Y K;  3L4J A;  3GTP K;  3AH5 A;  3TFH A;  4KN4 A;  1F93 A;  2VUM K;  1RU0 A;  4A93 C;  3ORE A;  3SZZ A;  2R92 C;  4PAA A;  3LAJ A;  2R7Z C;  1O2F B;  3ERE D;  5C3E K;  2R93 C;  2A68 A;  2Y0S D;  3GTK A;  4C2M C;  4A3B C;  4Y52 K;  2PMZ D;  4YFK A;  4X6A K;  4WJ3 M;  1PJ6 A;  4JK1 A;  3S1M K;  3S2H K;  3S16 C;  3MML B;  2NVY C;  1WQF A;  4BY7 K;  3S17 K;  4WJ4 A;  3S15 K;  1K83 C;  1GE9 A;  1INN A;  5HL8 A;  4KM8 A;  3HXA A;  1SFO A;  3HOV K;  3CQZ C;  2E2I K;  2RH6 A;  2NVX C;  3GTM C;  3HOW K;  4YFN A;  4P5B A;  4BBS K;  5C3E C;  3A8K A;  5IP7 K;  1B4B A;  3HKZ L;  4FZB A;  1G51 A;  4MEX A;  3VA7 A;  1O28 A;  4M1X A;  2NVQ C;  5TMF A;  3FOF A;  2JA6 C;  1TWH A;  5CHP A;  3RZD K;  3GTQ C;  2E2J K;  5C44 C;  4A3E K;  4XCH A;  3LAP A;  1DD5 A;  1XZP A;  2XCQ A;  3S1N K;  3S17 C;  5IYC C;  5EGH A;  3GTJ K;  4GTL A;  1WOO A;  3GTK K;  3M4O C;  4KMH A;  1L0W A;  5IOR A;  3AD7 C;  1WQG A;  1BJT A;  4A3D K;  4C3H K;  4BY1 C;  3I4N C;  3AD9 C;  2Y3P A;  5C4X C;  1I50 C;  4LJZ A;  5M3M K;  2E2J C;  4PAB A;  3NUH A;  4BXX C;  5M3F K;  1IQ0 A;  3G4C A;  3PO2 K;  5IOS A;  2E2I A;  4QIW L;  3HOY K;  5EGE A;  2A6H A;  1IW7 A;  2V6U A;  3GTP C;  4A3L K;  2WAQ D;  4A3G C;  1EQR A;  4XSX A;  4KAS A;  4BKW A;  3GTM A;  2A6E A; 
#chains in the Genus database with same CATH homology
 2RGR A;  1Y1W A;  2JA5 A;  3G4A A;  2YU9 A;  3QX3 A;  4ILD A;  1R9T A;  4GTA A;  3L4J A;  3OEP A;  2ZFZ A;  2CFA B;  3AH5 A;  3OPF A;  4GTF A;  3L4K A;  3N0B A;  5TJ3 A;  1O2B A;  3ORE A;  1EH1 A;  1O27 A;  3LAJ A;  2CFA A;  4GT9 A;  3ERE D;  1Y1V A;  1ZVU A;  2E2H A;  1I50 A;  3GTJ A;  2GSN A;  1O29 A;  3GTK A;  4C2M C;  3CAG A;  2JA7 A;  3H0G A;  2KWA A;  4KB2 A;  3Q3Q A;  4GTE A;  3AQO A;  3BUE A;  3MML B;  1TWC A;  2NVY A;  4P5A A;  4BLB A;  2R92 A;  3GTO A;  2JA6 A;  1WQF A;  5JFE A;  3FKI A;  2NVX A;  1GE9 A;  4KM8 A;  1WIH A;  4C3I C;  4KM9 A;  3GTG A;  1ZBS A;  1SFO A;  2RH6 A;  2XCO A;  4P5B A;  5IOT A;  4FM9 A;  2R93 A;  3N3Y A;  4LR2 A;  1B4B A;  4FZB A;  4KAW X;  2XCR B;  1IS1 A;  3VA7 A;  1O28 A;  4M1X A;  4G0V A;  3FOF A;  1TWH A;  4KMD A;  4KAT A;  1XXB A;  5CHP A;  3GTQ A;  3GTP A;  2PHC B;  4KDD A;  2JH3 A;  1XXA A;  4G0W A;  4GFQ A;  3CQZ A;  2VUM A;  3LPX A;  4C3H C;  3FHZ A;  3LAP A;  1DD5 A;  2XCQ A;  1AB4 A;  2GSU A;  3AQP A;  1B4A A;  4KMA A;  3FOE A;  4GTB A;  5EGH A;  1XXC A;  1F9N A;  4GTL A;  4KMH A;  4GTC A;  5IOR A;  1O25 A;  5IOQ A;  1BGW A;  1O26 A;  5JVO A;  1ISE A;  1WQG A;  4KC6 A;  1BJT A;  2R7Z A;  4BLA A;  1I3Q A;  1O24 A;  2Y3P A;  3N0C A;  2B63 A;  4KAR A;  2GSO A;  3S0X A;  1EK8 A;  3NUH A;  1TWF A;  4DDQ A;  3G4C A;  4LQY A;  4C3J C;  5IOS A;  4G0U A;  2E2I A;  5EGE A;  2P5M A;  4KB4 A;  4GTD A;  4J3N A;  1ZXO A;  1WCM A;  1KQ4 A;  3V4G A;  3GTL A;  1K83 A;  1TWG A;  1O2A A;  1WQH A;  4KAS A;  5CJ9 A;  4BKW A;  3GTM A;  1TWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...