1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
3N0CA 1O27A 4GTEA 1KQ4A 1O2BA 4KARA 1O28A 4P5BA 5IOTA 5JFEA 5CHPA 3G4CA 4GTDA 2CFAB 4GTCA 5IOQA 4GTBA 4P5AA 4GTFA 3AH5A 4KASA 1O29A 1O26A 4GT9A 5IORA 4GTLA 2CFAA 5IOSA 3N3YA 4FZBA 3G4AA 3N0BA 1O2AA 1O25A 4GTAA 1O24A 4KATA
chains in the Genus database with same CATH superfamily
5HL8A 2E2IC 1HI9A 3HOYK 4A3JC 3GTKA 1X31C 1WCMK 1TWGC 4A3EK 4AYBL 4C3JK 4A3FC 4G0WA 1R9TC 4A93C 1TWAA 1VGXA 2XCQA 2P5MA 4KMDA 2BE5A 3GTKC 4A3BC 3CQZK 2JA6K 3PO3C 4BBRC 4FZBA 5FJ8K 2EBBA 2PMZL 3S1RC 5C3EC 3S1NK 2CW0A 1USMA 5C4XK 4XSZA 4C3HC 3OREA 3GTJA 3N0CA 4G0UA 2VUMA 1KQ4A 1XZQB 1SFOC 3TFJA 1TWHK 1JVIA 3GEEA 2NVYA 4X6AC 4J3NA 3HKZL 3LPXA 1YNJA 4BXXK 2O5JA 1Y1WC 4KASA 1R9TK 4A93K 4XLNA 3T02A 4XCHA 1WCMC 3SZYA 1B4BA 4LLGA 3DXJA 4YFKA 1DD5A 2JA8K 3N0BA 1IBAA 3GTGK 3HOUK 1DCOA 1YCLA 2NVQC 4KARA 4KMHA 4XSXA 2NVXC 3GTOK 1VRQC 4LR2A 2YU9C 4GTCA 4KB2A 1TWFK 4G7ZA 1VH2A 3AQOA 4LK1A 1HQMA 1O26A 3LAJA 5IORA 3GTQK 1JQWA 4A3MK 5L46A 3I4NC 5CJ9A 4A3IK 2WB1L 2JA7C 2B63C 1AB4A 1O2BA 4OINA 2E2IA 3A8KA 2Y0SD 3SZZA 2YU9K 1TWGK 2NVQK 2WB1D 3HOYC 3NUHA 3V4GA 3S2DK 3IPJA 4GT9A 5IYBK 1SFOA 2GSOA 1WIHA 1I3QC 3PO2K 4ZH4A 3RZDK 2Y0SL 3HXAA 2D6FC 2GSNA 1PJ7A 1BGWA 3VA7A 4C3HK 2A6HA 2FQOA 1O25A 4BY1C 5C3EK 4A3LC 5M5WK 2GAHC 4A3MC 5IOTA 4BY1K 4C45A 3HOZC 5CHPA 4KC6A 5EGEA 3LAPA 4KMAA 3GTPK 1WQFA 5E68A 3AD9C 3A8IA 3H3VD 1I3QK 3PO2C 1USOA 4KMUA 1TWGA 1UV7A 1TWCA 4QJVB 3OPFA 1IE0A 3RZOC 2NVTC 1ZVUA 3GIRA 4Q5SA 1EFWA 3S14C 4KATA 2NVXA 4A3IC 4BY7C 2R93K 1YNNA 1Y1VK 5TMCA 4P5AA 1O29A 1ZBSA 2KWAA 3S1MK 3K7AK 3H0GC 3GTQA 4G0VA 2FQTA 1IS1A 3GEHA 1ZQ1C 4QIWL 5IP7K 2GSUA 5FLMK 4GTEA 1F9NA 1V5VA 4BBRK 3FKIC 3S15K 4OIPA 2A69A 2NVTK 1C0AA 2R92A 1XXBA 2GAGC 4GTBA 4QIWD 3GTLC 1BDFA 4C3JC 1Y1VA 3S1QC 1F7VA 4A3KC 4FM9A 4BLBA 3GEIA 4OIRA 5M3MK 2E2IK 4G7OA 4X6AK 4ILDA 4KB4A 1B4AA 4C3IK 4Y52C 3CAGA 3HOUC 5IP9K 1ZXOA 4A3CK 1TWCK 1EK8A 3CQZA 3GTQC 3HOWK 2V6UA 4GZYA 1WQGA 3M4OC 5FLMC 3Q3QA 3HOVC 3GTKK 4BBSC 1ZYRA 1VJEA 5IP9C 3FOFA 3I4NK 1F93A 2XCOA 3A8JA 5IYDK 3G4AA 1XZQA 3TTGA 4Y52K 4BY7K 2R93C 1I6HC 1INNA 3TFIA 1GE9A 1VLOA 2PA8D 3GTGA 2WAQD 2V6TA 1DCHA 2Y3PA 4KN7A 4MQ9A 3RZOK 4A3FK 1TWFA 2A6EA 4BLAA 4A3DC 3GTLK 5D4DA 2R92K 3GTPA 4GTFA 3GTOA 4BBSK 4Y7NC 3GSIA 1XZPA 4LOWA 3BP8C 2E2HC 3WODA 3N3YA 2JA8C 1XXCA 3M4OK 1I6HK 5IP7C 5C4XC 3ERED 2XCRB 5IYDC 5C44K 3K7AC 4WJ4A 4P5BA 2P8TA 2E2HK 5EGHA 3HKZD 3GTLA 1TWHA 3S2DC 1K83A 3TFHA 3GTMC 5JVOA 3S1NC 2NVYK 4KDDA 2V6SA 1Y1WK 1WSVA 2E2HA 1WQHA 3FOEA 4LJZA 4YG2A 1PJ6A 2JA6C 3PO3K 3GDZA 2PMZD 1SMYA 2PA8L 1I50C 4LQYA 5TJ3A 3GTMK 2E2JK 2CFAB 1BS2A 1XZPB 2ZUEA 3S1MC 2R7ZC 3L4KA 1J6WA 3FHZA 4A3BK 1EI6A 4KM8A 3AD8C 5M3FK 2JA5A 5IOSA 3AQPA 2E2JC 1I50A 4AYBD 2NVXK 3GTOC 3S16C 1BJTA 4WJ3M 1TWFC 4GTDA 3GTGC 3H3VL 1WOPA 3S17K 2B63A 1K83C 3ADAC 1L0WA 1ISEA 4A3DK 2R7ZA 5TMFA 2R93A 4MEYA 4A3JK 3S14K 4KAWX 2W7VA 2B63K 4MEXA 3AD7C 1XXAA 3S2HC 1O2FB 2JA6A 4KN4A 2O5IA 2VUMK 3QX3A 5C44C 1O27A 4GFQA 4M1XA 5JFEA 3HOVK 3FKIA 4Q4ZA 1J6XA 1TWHC 1JOEA 3GTPC 5C4JK 2WAQL 2R7ZK 2JA5C 4GTLA 1WCMA 3S2HK 4C3IC 3M3YC 3OEPA 2JA7A 3S0XA 4KM9A 3T01A 3RZDC 1PJ5A 1WORA 2PHCB 4WILA 4Y7NK 1O28A 4A3KK 3S1QK 1YX2A 4OIOA 4A3EC 3HOXC 2RGRA 1J6VA 1TWAK 4C2MC 2JA5K 4BXXC 5C4JC 4PAAA 4A3GC 2A68A 1EQRA 3S16K 1WOOA 1XPPA 2YU9A 4A3GK 2ZFZA 3GTMA 4AH6A 1TWCC 1O2AA 1TWAC 4C2MK 3H0GK 4A3LK 3S1RK 4LK0A 3I4MK 4JK1A 4NOIA 4QJVA 2RH6A 5M5XK 1Y1VC 5IYBC 1RU0A 3HOWC 3T00A 1WSRA 2JH3A 3AH5A 1J98A 4BKWA 2NVYC 2R92C 1IL2A 1G51A 3HOXK 1I3QA 1IQ0A 4OIQA 2CFAA 4PABA 1WOSA 3S15C 1I6VA 3FKIK 5IYCC 3GTJC 2JA7K 4P9SA 3L4JA 1SFOK 1F7UA 2ZUFA 3I4MC 3M3YK 4GTAA 2PPBA 1IW7A 4XLPA 1DCPA 1K83K 3G4CA 3MMLB 5IOQA 1Y1WA 4O2DA 4YFXA 1R9TA 3HOZK 3EQLA 3BP3A 3JSTA 4DDQA 4G7HA 4YFNA 4A3CC 2VUMC 1I50K 3S17C 5IYCK 4RMFA 3GTJK 3H0GA 3CQZC 1O24A 5M5YK 1EH1A 3BUEA
chains in the Genus database with same CATH topology
3GTGA 1O27A 4GFQA 2Y3PA 5IOTA 4M1XA 5JFEA 5CHPA 3FKIA 4KC6A 5EGEA 3LAPA 1TWFA 4KMAA 3GTKA 4BLAA 1WQFA 3GTPA 4G0WA 4GTFA 3GTOA 1TWAA 1TWGA 2XCQA 2P5MA 4KMDA 1TWCA 4GTLA 3N3YA 1XXCA 1WCMA 4C3IC 3OPFA 4FZBA 3OEPA 2JA7A 3S0XA 3ERED 4KM9A 2XCRB 1ZVUA 2PHCB 4C3HC 2VUMA 3OREA 4KATA 3N0CA 3GTJA 4G0UA 2NVXA 1KQ4A 1O28A 4P5BA 2RGRA 4C2MC 5EGHA 2NVYA 4J3NA 4P5AA 3LPXA 3GTLA 1TWHA 1K83A 4KASA 1O29A 5JVOA 4KDDA 2YU9A 1ZBSA 2KWAA 1WQHA 1B4BA 2ZFZA 2E2HA 3FOEA 3GTMA 1DD5A 3N0BA 3GTQA 4G0VA 1O2AA 1IS1A 4LQYA 2GSUA 4GTEA 5TJ3A 4KARA 1F9NA 4KMHA 2RH6A 4LR2A 2CFAB 4GTCA 2R92A 1XXBA 4GTBA 3L4KA 4KB2A 2JH3A 3AQOA 3AH5A 3FHZA 1Y1VA 4BKWA 4C3JC 4KM8A 1O26A 1I3QA 3LAJA 4FM9A 5IORA 2JA5A 2CFAA 4BLBA 5IOSA 3AQPA 4ILDA 4KB4A 1I50A 1B4AA 3L4JA 3CAGA 5CJ9A 4GTAA 1BJTA 1ZXOA 1AB4A 1O2BA 2E2IA 3G4CA 4GTDA 1EK8A 3CQZA 3MMLB 1WQGA 2B63A 5IOQA 1Y1WA 1ISEA 2R7ZA 3Q3QA 2R93A 1R9TA 3NUHA 3V4GA 4GT9A 4DDQA 4KAWX 3FOFA 2GSOA 1WIHA 1SFOA 2XCOA 3G4AA 1XXAA 2GSNA 1BGWA 3VA7A 2JA6A 3H0GA 1O25A 1GE9A 3QX3A 1O24A 1EH1A 3BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  1O27 A;  4GTE A;  1KQ4 A;  1O2B A;  4KAR A;  1O28 A;  4P5B A;  5IOT A;  5JFE A;  5CHP A;  3G4C A;  4GTD A;  2CFA B;  4GTC A;  5IOQ A;  4GTB A;  4P5A A;  4GTF A;  3AH5 A;  4KAS A;  1O29 A;  1O26 A;  4GT9 A;  5IOR A;  4GTL A;  2CFA A;  5IOS A;  3N3Y A;  4FZB A;  3G4A A;  3N0B A;  1O2A A;  1O25 A;  4GTA A;  1O24 A;  4KAT A; 
#chains in the Genus database with same CATH topology
 5HL8 A;  2E2I C;  1HI9 A;  3HOY K;  4A3J C;  3GTK A;  1X31 C;  1WCM K;  1TWG C;  4A3E K;  4AYB L;  4C3J K;  4A3F C;  4G0W A;  1R9T C;  4A93 C;  1TWA A;  1VGX A;  2XCQ A;  2P5M A;  4KMD A;  2BE5 A;  3GTK C;  4A3B C;  3CQZ K;  2JA6 K;  3PO3 C;  4BBR C;  4FZB A;  5FJ8 K;  2EBB A;  2PMZ L;  3S1R C;  5C3E C;  3S1N K;  2CW0 A;  1USM A;  5C4X K;  4XSZ A;  4C3H C;  3ORE A;  3GTJ A;  3N0C A;  4G0U A;  2VUM A;  1KQ4 A;  1XZQ B;  1SFO C;  3TFJ A;  1TWH K;  1JVI A;  3GEE A;  2NVY A;  4X6A C;  4J3N A;  3HKZ L;  3LPX A;  1YNJ A;  4BXX K;  2O5J A;  1Y1W C;  4KAS A;  1R9T K;  4A93 K;  4XLN A;  3T02 A;  4XCH A;  1WCM C;  3SZY A;  1B4B A;  4LLG A;  3DXJ A;  4YFK A;  1DD5 A;  2JA8 K;  3N0B A;  1IBA A;  3GTG K;  3HOU K;  1DCO A;  1YCL A;  2NVQ C;  4KAR A;  4KMH A;  4XSX A;  2NVX C;  3GTO K;  1VRQ C;  4LR2 A;  2YU9 C;  4GTC A;  4KB2 A;  1TWF K;  4G7Z A;  1VH2 A;  3AQO A;  4LK1 A;  1HQM A;  1O26 A;  3LAJ A;  5IOR A;  3GTQ K;  1JQW A;  4A3M K;  5L46 A;  3I4N C;  5CJ9 A;  4A3I K;  2WB1 L;  2JA7 C;  2B63 C;  1AB4 A;  1O2B A;  4OIN A;  2E2I A;  3A8K A;  2Y0S D;  3SZZ A;  2YU9 K;  1TWG K;  2NVQ K;  2WB1 D;  3HOY C;  3NUH A;  3V4G A;  3S2D K;  3IPJ A;  4GT9 A;  5IYB K;  1SFO A;  2GSO A;  1WIH A;  1I3Q C;  3PO2 K;  4ZH4 A;  3RZD K;  2Y0S L;  3HXA A;  2D6F C;  2GSN A;  1PJ7 A;  1BGW A;  3VA7 A;  4C3H K;  2A6H A;  2FQO A;  1O25 A;  4BY1 C;  5C3E K;  4A3L C;  5M5W K;  2GAH C;  4A3M C;  5IOT A;  4BY1 K;  4C45 A;  3HOZ C;  5CHP A;  4KC6 A;  5EGE A;  3LAP A;  4KMA A;  3GTP K;  1WQF A;  5E68 A;  3AD9 C;  3A8I A;  3H3V D;  1I3Q K;  3PO2 C;  1USO A;  4KMU A;  1TWG A;  1UV7 A;  1TWC A;  4QJV B;  3OPF A;  1IE0 A;  3RZO C;  2NVT C;  1ZVU A;  3GIR A;  4Q5S A;  1EFW A;  3S14 C;  4KAT A;  2NVX A;  4A3I C;  4BY7 C;  2R93 K;  1YNN A;  1Y1V K;  5TMC A;  4P5A A;  1O29 A;  1ZBS A;  2KWA A;  3S1M K;  3K7A K;  3H0G C;  3GTQ A;  4G0V A;  2FQT A;  1IS1 A;  3GEH A;  1ZQ1 C;  4QIW L;  5IP7 K;  2GSU A;  5FLM K;  4GTE A;  1F9N A;  1V5V A;  4BBR K;  3FKI C;  3S15 K;  4OIP A;  2A69 A;  2NVT K;  1C0A A;  2R92 A;  1XXB A;  2GAG C;  4GTB A;  4QIW D;  3GTL C;  1BDF A;  4C3J C;  1Y1V A;  3S1Q C;  1F7V A;  4A3K C;  4FM9 A;  4BLB A;  3GEI A;  4OIR A;  5M3M K;  2E2I K;  4G7O A;  4X6A K;  4ILD A;  4KB4 A;  1B4A A;  4C3I K;  4Y52 C;  3CAG A;  3HOU C;  5IP9 K;  1ZXO A;  4A3C K;  1TWC K;  1EK8 A;  3CQZ A;  3GTQ C;  3HOW K;  2V6U A;  4GZY A;  1WQG A;  3M4O C;  5FLM C;  3Q3Q A;  3HOV C;  3GTK K;  4BBS C;  1ZYR A;  1VJE A;  5IP9 C;  3FOF A;  3I4N K;  1F93 A;  2XCO A;  3A8J A;  5IYD K;  3G4A A;  1XZQ A;  3TTG A;  4Y52 K;  4BY7 K;  2R93 C;  1I6H C;  1INN A;  3TFI A;  1GE9 A;  1VLO A;  2PA8 D;  3GTG A;  2WAQ D;  2V6T A;  1DCH A;  2Y3P A;  4KN7 A;  4MQ9 A;  3RZO K;  4A3F K;  1TWF A;  2A6E A;  4BLA A;  4A3D C;  3GTL K;  5D4D A;  2R92 K;  3GTP A;  4GTF A;  3GTO A;  4BBS K;  4Y7N C;  3GSI A;  1XZP A;  4LOW A;  3BP8 C;  2E2H C;  3WOD A;  3N3Y A;  2JA8 C;  1XXC A;  3M4O K;  1I6H K;  5IP7 C;  5C4X C;  3ERE D;  2XCR B;  5IYD C;  5C44 K;  3K7A C;  4WJ4 A;  4P5B A;  2P8T A;  2E2H K;  5EGH A;  3HKZ D;  3GTL A;  1TWH A;  3S2D C;  1K83 A;  3TFH A;  3GTM C;  5JVO A;  3S1N C;  2NVY K;  4KDD A;  2V6S A;  1Y1W K;  1WSV A;  2E2H A;  1WQH A;  3FOE A;  4LJZ A;  4YG2 A;  1PJ6 A;  2JA6 C;  3PO3 K;  3GDZ A;  2PMZ D;  1SMY A;  2PA8 L;  1I50 C;  4LQY A;  5TJ3 A;  3GTM K;  2E2J K;  2CFA B;  1BS2 A;  1XZP B;  2ZUE A;  3S1M C;  2R7Z C;  3L4K A;  1J6W A;  3FHZ A;  4A3B K;  1EI6 A;  4KM8 A;  3AD8 C;  5M3F K;  2JA5 A;  5IOS A;  3AQP A;  2E2J C;  1I50 A;  4AYB D;  2NVX K;  3GTO C;  3S16 C;  1BJT A;  4WJ3 M;  1TWF C;  4GTD A;  3GTG C;  3H3V L;  1WOP A;  3S17 K;  2B63 A;  1K83 C;  3ADA C;  1L0W A;  1ISE A;  4A3D K;  2R7Z A;  5TMF A;  2R93 A;  4MEY A;  4A3J K;  3S14 K;  4KAW X;  2W7V A;  2B63 K;  4MEX A;  3AD7 C;  1XXA A;  3S2H C;  1O2F B;  2JA6 A;  4KN4 A;  2O5I A;  2VUM K;  3QX3 A;  5C44 C;  1O27 A;  4GFQ A;  4M1X A;  5JFE A;  3HOV K;  3FKI A;  4Q4Z A;  1J6X A;  1TWH C;  1JOE A;  3GTP C;  5C4J K;  2WAQ L;  2R7Z K;  2JA5 C;  4GTL A;  1WCM A;  3S2H K;  4C3I C;  3M3Y C;  3OEP A;  2JA7 A;  3S0X A;  4KM9 A;  3T01 A;  3RZD C;  1PJ5 A;  1WOR A;  2PHC B;  4WIL A;  4Y7N K;  1O28 A;  4A3K K;  3S1Q K;  1YX2 A;  4OIO A;  4A3E C;  3HOX C;  2RGR A;  1J6V A;  1TWA K;  4C2M C;  2JA5 K;  4BXX C;  5C4J C;  4PAA A;  4A3G C;  2A68 A;  1EQR A;  3S16 K;  1WOO A;  1XPP A;  2YU9 A;  4A3G K;  2ZFZ A;  3GTM A;  4AH6 A;  1TWC C;  1O2A A;  1TWA C;  4C2M K;  3H0G K;  4A3L K;  3S1R K;  4LK0 A;  3I4M K;  4JK1 A;  4NOI A;  4QJV A;  2RH6 A;  5M5X K;  1Y1V C;  5IYB C;  1RU0 A;  3HOW C;  3T00 A;  1WSR A;  2JH3 A;  3AH5 A;  1J98 A;  4BKW A;  2NVY C;  2R92 C;  1IL2 A;  1G51 A;  3HOX K;  1I3Q A;  1IQ0 A;  4OIQ A;  2CFA A;  4PAB A;  1WOS A;  3S15 C;  1I6V A;  3FKI K;  5IYC C;  3GTJ C;  2JA7 K;  4P9S A;  3L4J A;  1SFO K;  1F7U A;  2ZUF A;  3I4M C;  3M3Y K;  4GTA A;  2PPB A;  1IW7 A;  4XLP A;  1DCP A;  1K83 K;  3G4C A;  3MML B;  5IOQ A;  1Y1W A;  4O2D A;  4YFX A;  1R9T A;  3HOZ K;  3EQL A;  3BP3 A;  3JST A;  4DDQ A;  4G7H A;  4YFN A;  4A3C C;  2VUM C;  1I50 K;  3S17 C;  5IYC K;  4RMF A;  3GTJ K;  3H0G A;  3CQZ C;  1O24 A;  5M5Y K;  1EH1 A;  3BUE A; 
#chains in the Genus database with same CATH homology
 3GTG A;  1O27 A;  4GFQ A;  2Y3P A;  5IOT A;  4M1X A;  5JFE A;  5CHP A;  3FKI A;  4KC6 A;  5EGE A;  3LAP A;  1TWF A;  4KMA A;  3GTK A;  4BLA A;  1WQF A;  3GTP A;  4G0W A;  4GTF A;  3GTO A;  1TWA A;  1TWG A;  2XCQ A;  2P5M A;  4KMD A;  1TWC A;  4GTL A;  3N3Y A;  1XXC A;  1WCM A;  4C3I C;  3OPF A;  4FZB A;  3OEP A;  2JA7 A;  3S0X A;  3ERE D;  4KM9 A;  2XCR B;  1ZVU A;  2PHC B;  4C3H C;  2VUM A;  3ORE A;  4KAT A;  3N0C A;  3GTJ A;  4G0U A;  2NVX A;  1KQ4 A;  1O28 A;  4P5B A;  2RGR A;  4C2M C;  5EGH A;  2NVY A;  4J3N A;  4P5A A;  3LPX A;  3GTL A;  1TWH A;  1K83 A;  4KAS A;  1O29 A;  5JVO A;  4KDD A;  2YU9 A;  1ZBS A;  2KWA A;  1WQH A;  1B4B A;  2ZFZ A;  2E2H A;  3FOE A;  3GTM A;  1DD5 A;  3N0B A;  3GTQ A;  4G0V A;  1O2A A;  1IS1 A;  4LQY A;  2GSU A;  4GTE A;  5TJ3 A;  4KAR A;  1F9N A;  4KMH A;  2RH6 A;  4LR2 A;  2CFA B;  4GTC A;  2R92 A;  1XXB A;  4GTB A;  3L4K A;  4KB2 A;  2JH3 A;  3AQO A;  3AH5 A;  3FHZ A;  1Y1V A;  4BKW A;  4C3J C;  4KM8 A;  1O26 A;  1I3Q A;  3LAJ A;  4FM9 A;  5IOR A;  2JA5 A;  2CFA A;  4BLB A;  5IOS A;  3AQP A;  4ILD A;  4KB4 A;  1I50 A;  1B4A A;  3L4J A;  3CAG A;  5CJ9 A;  4GTA A;  1BJT A;  1ZXO A;  1AB4 A;  1O2B A;  2E2I A;  3G4C A;  4GTD A;  1EK8 A;  3CQZ A;  3MML B;  1WQG A;  2B63 A;  5IOQ A;  1Y1W A;  1ISE A;  2R7Z A;  3Q3Q A;  2R93 A;  1R9T A;  3NUH A;  3V4G A;  4GT9 A;  4DDQ A;  4KAW X;  3FOF A;  2GSO A;  1WIH A;  1SFO A;  2XCO A;  3G4A A;  1XXA A;  2GSN A;  1BGW A;  3VA7 A;  2JA6 A;  3H0G A;  1O25 A;  1GE9 A;  3QX3 A;  1O24 A;  1EH1 A;  3BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...