1O24A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima at 2.0 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
208
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 71
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o24A00
3G4AA 4GT9A 1O2BA 1O28A 4P5BA 3N3YA 3AH5A 5CHPA 5IOTA 1O27A 4KARA 1O24A 4GTFA 1O26A 2CFAA 3N0CA 5IOQA 1KQ4A 3G4CA 4KATA 5IOSA 4GTLA 4P5AA 4FZBA 5JFEA 1O29A 3N0BA 2CFAB 5IORA 4GTDA 4KASA 4GTAA 1O2AA 4GTCA 1O25A 4GTEA 4GTBA
chains in the Genus database with same CATH superfamily
3HKZD 1O28A 2P5MA 3AQOA 2JA7C 1Y1WC 4BXXC 5M3MK 3GTLC 1WOPA 1EQRA 2JA5A 1IBAA 1YCLA 1SFOA 2PMZD 1IQ0A 2GSUA 4J3NA 5IP7K 1TWGA 3T00A 1WCMK 3A8IA 1IS1A 1O25A 2NVYK 3GEHA 3TTGA 4C45A 2E2IA 4C3IC 3GTGC 2CW0A 2GAHC 1WCMA 4Y7NK 1JQWA 4G0UA 2R7ZK 4LK0A 1R9TC 3M3YK 1XZPA 4DDQA 3LAJA 2JH3A 4XSZA 3S16K 2YU9K 3GTPC 4KB2A 2JA6K 3GTKC 3GTMK 4A3GC 1O29A 2B63A 1WQGA 2KWAA 3HOWK 2R7ZA 3S1MC 4YFKA 5IP9C 4PABA 4KN4A 1G51A 1Y1VK 4A3DC 1I6HK 4OIPA 2YU9A 3IPJA 3HOZC 2JA6A 4BY1K 3GTMA 2NVXK 2JA7K 1WSVA 1ZYRA 1PJ6A 3S1RK 5M3FK 4LK1A 5D4DA 2FQTA 3HOVK 5IOQA 4A3MC 1SMYA 1J6XA 3GTJK 1PJ5A 2NVXA 2PA8L 1I6VA 3TFHA 2E2JK 1VLOA 3S2DC 1B4AA 2JA5C 5FJ8K 3BUEA 3FOEA 3GTJA 1SFOC 4C3IK 1TWGC 3SZYA 4QJVB 5C3EK 3TFIA 2O5IA 3PO3C 4AH6A 2RGRA 1JVIA 1K83K 1KQ4A 1PJ7A 1ZXOA 3L4JA 1TWFA 3S14C 3GTPK 1O2FB 4C3HC 4KAWX 4ZH4A 2E2IC 4A93K 1XPPA 4A3GK 3GSIA 2FQOA 4GTAA 1WOSA 3S17K 5IP9K 1K83A 3GTPA 2B63C 2ZUEA 3EQLA 4PAAA 3AH5A 4Y7NC 2R7ZC 4OIRA 4Y52K 4G0WA 4LJZA 2XCRB 3I4MK 5HL8A 3M3YC 4WJ4A 4KM8A 5IOSA 4GTLA 3S16C 1B4BA 4FM9A 2YU9C 4A3KK 3S1NK 2JA6C 3GTMC 4NOIA 2CFAB 3HOWC 3L4KA 4MEYA 5C44C 2Y3PA 3M4OC 3VA7A 1TWGK 5TJ3A 3GTQA 4BY1C 2NVXC 4GFQA 3S1RC 3PO3K 1DCOA 3N0CA 3H3VD 3HOVC 3S14K 4C3JC 3GTJC 5CJ9A 4C3HK 2E2IK 1XZQB 5JVOA 2W7VA 4KMAA 1F7VA 2GAGC 2WB1D 5C4XC 2E2JC 1USMA 3TFJA 3GTOK 1TWFC 3G4AA 4A3FK 3K7AK 2B63K 5C3EC 1ZVUA 5IOTA 2Y0SD 3GTOA 3FHZA 4BLBA 1K83C 3GIRA 3S0XA 5IYBC 3V4GA 4A93C 4G7ZA 5M5XK 4KN7A 1IW7A 4QIWL 5C44K 4OINA 3S17C 4GZYA 5IYCC 1XXBA 3WODA 2GSNA 3M4OK 4GT9A 4A3BC 2WAQD 4A3LC 5M5YK 1WQHA 5C4JC 2PMZL 4KARA 1O26A 3AD7C 4WILA 4Y52C 4AYBD 1UV7A 3I4MC 2NVTK 1J6VA 4KC6A 4KATA 2RH6A 5IYDC 4C3JK 4A3IC 4P5AA 4P9SA 4XLPA 1V5VA 4A3KC 4Q5SA 3S1NC 3N0BA 2D6FC 3GTQC 5IORA 3AD9C 4G7OA 5C4XK 2BE5A 1YNJA 4GTEA 3GEIA 4KDDA 3HOYC 4XSXA 1TWFK 4YFNA 4A3JC 1J6WA 1EK8A 5TMFA 1VRQC 4YFXA 1DD5A 1C0AA 4BKWA 2R92K 2V6SA 3NUHA 4O2DA 5IYBK 4JK1A 4MEXA 2PPBA 2A69A 1BDFA 4QJVA 3RZDC 2PHCB 1ISEA 5IYCK 2R92A 3GTOC 3S2HC 4A3BK 4YG2A 3FOFA 1O2BA 5E68A 4A3FC 3K7AC 4BY7K 4A3LK 3CAGA 4LLGA 5C4JK 4Q4ZA 1WOOA 2JA8C 3HXAA 3T01A 5IYDK 1HQMA 4A3IK 4MQ9A 3QX3A 2V6UA 3GTQK 3RZOC 3CQZK 3A8KA 3HOYK 4LR2A 4GTBA 2EBBA 1X31C 1F9NA 3PO2C 4A3JK 3CQZA 1USOA 3S1QK 2P8TA 4G7HA 2CFAA 2R93K 1TWAC 2NVTC 4OIQA 5L46A 5EGHA 4A3CK 3I4NK 3BP8C 5FLMK 1TWHK 4BBSK 1DCHA 1RU0A 3RZDK 2R93A 4KMHA 4XCHA 1GE9A 1I3QK 1I50K 5CHPA 3S2HK 5M5WK 3LAPA 1INNA 1XXCA 4BBRK 2A6EA 2XCQA 3HOXC 1XZQA 1TWHA 1DCPA 1WIHA 2A68A 1O24A 3FKIK 2JA8K 4KMUA 4X6AK 2VUMK 2R92C 1I3QA 3DXJA 1I50A 2NVQK 4KMDA 4G0VA 1ZQ1C 5JFEA 3RZOK 4A3EK 1XZPB 1IL2A 2E2HK 2PA8D 3FKIA 1F93A 3S15K 1AB4A 3HKZL 2VUMA 3PO2K 3LPXA 3N3YA 4M1XA 3OEPA 4BY7C 3H0GK 3ADAC 3GEEA 3H3VL 2E2HA 2NVYA 4C2MK 1YNNA 1TWAK 2WB1L 2A6HA 1VGXA 1VJEA 3AQPA 3H0GA 4KASA 3CQZC 3ERED 1TWAA 1TWCC 1ZBSA 4XLNA 3T02A 1BGWA 1Y1WK 3OREA 4BXXK 1HI9A 3GTLK 4P5BA 2Y0SL 1VH2A 3HOXK 3S1QC 3HOUC 4GTFA 3BP3A 1Y1VA 4ILDA 2R93C 2GSOA 3G4CA 4LOWA 1EFWA 4OIOA 2JA7A 4A3CC 1Y1WA 3GTLA 3I4NC 4LQYA 1WQFA 5FLMC 1TWHC 2V6TA 3A8JA 4BBSC 1IE0A 2WAQL 4KB4A 3GDZA 2XCOA 3JSTA 3GTGK 1I3QC 1I50C 3AD8C 1XXAA 1R9TK 1WORA 1WSRA 4AYBL 4BBRC 1O27A 2O5JA 3FKIC 1J98A 3MMLB 4X6AC 5IP7C 3GTKK 4BLAA 3GTGA 2VUMC 2NVQC 3OPFA 1WCMC 1R9TA 3S1MK 1F7UA 4GTDA 4A3EC 1O2AA 2E2HC 2NVYC 4A3DK 4KM9A 3HOZK 1TWCK 3S15C 3GTKA 1JOEA 2ZUFA 2ZFZA 3H0GC 4WJ3M 3HOUK 1EH1A 4C2MC 4A3MK 4RMFA 1TWCA 3Q3QA 1BJTA 4FZBA 3SZZA 3S2DK 5TMCA 5EGEA 2JA5K 4GTCA 1L0WA 1BS2A 1Y1VC 1SFOK 1I6HC 1EI6A 4QIWD 1YX2A
chains in the Genus database with same CATH topology
1O28A 2P5MA 3AQOA 1EK8A 3LPXA 3N3YA 4M1XA 3OEPA 3AH5A 2JA5A 2E2HA 1DD5A 4G0WA 2NVYA 2XCRB 4BKWA 1SFOA 3NUHA 4KM8A 2GSUA 4J3NA 5IOSA 4GTLA 1TWGA 1B4BA 4FM9A 2CFAB 1IS1A 3AQPA 3H0GA 4KASA 3L4KA 3ERED 1O25A 1TWAA 1ISEA 2PHCB 2Y3PA 2R92A 2E2IA 1ZBSA 3VA7A 4C3IC 3FOFA 5TJ3A 3GTQA 1BGWA 1O2BA 3OREA 1WCMA 4P5BA 3CAGA 4G0UA 4GFQA 4GTFA 1Y1VA 3N0CA 4ILDA 4DDQA 2GSOA 3LAJA 2JH3A 3G4CA 4C3JC 4KB2A 5CJ9A 3QX3A 2JA7A 1O29A 5JVOA 1Y1WA 2B63A 4KMAA 1WQGA 2KWAA 3GTLA 2R7ZA 4LQYA 1WQFA 4LR2A 4KB4A 2XCOA 2YU9A 4GTBA 2JA6A 3GTMA 3G4AA 1F9NA 1XXAA 3CQZA 1ZVUA 5IOTA 1O27A 2CFAA 5IOQA 3MMLB 3FHZA 3GTOA 4BLBA 4BLAA 3GTGA 3S0XA 5EGHA 3OPFA 3V4GA 2NVXA 1R9TA 4GTDA 1O2AA 1B4AA 2R93A 4KM9A 3BUEA 4KMHA 3FOEA 3GTJA 1XXBA 1GE9A 2GSNA 3GTKA 4GT9A 5CHPA 3LAPA 1XXCA 2XCQA 2ZFZA 1WQHA 1TWHA 4KARA 1WIHA 1O24A 1O26A 1EH1A 2RGRA 4C2MC 1ZXOA 1KQ4A 3L4JA 1TWCA 3Q3QA 1BJTA 1TWFA 4KC6A 2RH6A 4KATA 1I3QA 1I50A 4P5AA 4KAWX 4KMDA 4C3HC 4G0VA 4FZBA 5JFEA 3N0BA 5IORA 4GTAA 5EGEA 3FKIA 4GTCA 4GTEA 1AB4A 4KDDA 1K83A 2VUMA 3GTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4A A;  4GT9 A;  1O2B A;  1O28 A;  4P5B A;  3N3Y A;  3AH5 A;  5CHP A;  5IOT A;  1O27 A;  4KAR A;  1O24 A;  4GTF A;  1O26 A;  2CFA A;  3N0C A;  5IOQ A;  1KQ4 A;  3G4C A;  4KAT A;  5IOS A;  4GTL A;  4P5A A;  4FZB A;  5JFE A;  1O29 A;  3N0B A;  2CFA B;  5IOR A;  4GTD A;  4KAS A;  4GTA A;  1O2A A;  4GTC A;  1O25 A;  4GTE A;  4GTB A; 
#chains in the Genus database with same CATH topology
 3HKZ D;  1O28 A;  2P5M A;  3AQO A;  2JA7 C;  1Y1W C;  4BXX C;  5M3M K;  3GTL C;  1WOP A;  1EQR A;  2JA5 A;  1IBA A;  1YCL A;  1SFO A;  2PMZ D;  1IQ0 A;  2GSU A;  4J3N A;  5IP7 K;  1TWG A;  3T00 A;  1WCM K;  3A8I A;  1IS1 A;  1O25 A;  2NVY K;  3GEH A;  3TTG A;  4C45 A;  2E2I A;  4C3I C;  3GTG C;  2CW0 A;  2GAH C;  1WCM A;  4Y7N K;  1JQW A;  4G0U A;  2R7Z K;  4LK0 A;  1R9T C;  3M3Y K;  1XZP A;  4DDQ A;  3LAJ A;  2JH3 A;  4XSZ A;  3S16 K;  2YU9 K;  3GTP C;  4KB2 A;  2JA6 K;  3GTK C;  3GTM K;  4A3G C;  1O29 A;  2B63 A;  1WQG A;  2KWA A;  3HOW K;  2R7Z A;  3S1M C;  4YFK A;  5IP9 C;  4PAB A;  4KN4 A;  1G51 A;  1Y1V K;  4A3D C;  1I6H K;  4OIP A;  2YU9 A;  3IPJ A;  3HOZ C;  2JA6 A;  4BY1 K;  3GTM A;  2NVX K;  2JA7 K;  1WSV A;  1ZYR A;  1PJ6 A;  3S1R K;  5M3F K;  4LK1 A;  5D4D A;  2FQT A;  3HOV K;  5IOQ A;  4A3M C;  1SMY A;  1J6X A;  3GTJ K;  1PJ5 A;  2NVX A;  2PA8 L;  1I6V A;  3TFH A;  2E2J K;  1VLO A;  3S2D C;  1B4A A;  2JA5 C;  5FJ8 K;  3BUE A;  3FOE A;  3GTJ A;  1SFO C;  4C3I K;  1TWG C;  3SZY A;  4QJV B;  5C3E K;  3TFI A;  2O5I A;  3PO3 C;  4AH6 A;  2RGR A;  1JVI A;  1K83 K;  1KQ4 A;  1PJ7 A;  1ZXO A;  3L4J A;  1TWF A;  3S14 C;  3GTP K;  1O2F B;  4C3H C;  4KAW X;  4ZH4 A;  2E2I C;  4A93 K;  1XPP A;  4A3G K;  3GSI A;  2FQO A;  4GTA A;  1WOS A;  3S17 K;  5IP9 K;  1K83 A;  3GTP A;  2B63 C;  2ZUE A;  3EQL A;  4PAA A;  3AH5 A;  4Y7N C;  2R7Z C;  4OIR A;  4Y52 K;  4G0W A;  4LJZ A;  2XCR B;  3I4M K;  5HL8 A;  3M3Y C;  4WJ4 A;  4KM8 A;  5IOS A;  4GTL A;  3S16 C;  1B4B A;  4FM9 A;  2YU9 C;  4A3K K;  3S1N K;  2JA6 C;  3GTM C;  4NOI A;  2CFA B;  3HOW C;  3L4K A;  4MEY A;  5C44 C;  2Y3P A;  3M4O C;  3VA7 A;  1TWG K;  5TJ3 A;  3GTQ A;  4BY1 C;  2NVX C;  4GFQ A;  3S1R C;  3PO3 K;  1DCO A;  3N0C A;  3H3V D;  3HOV C;  3S14 K;  4C3J C;  3GTJ C;  5CJ9 A;  4C3H K;  2E2I K;  1XZQ B;  5JVO A;  2W7V A;  4KMA A;  1F7V A;  2GAG C;  2WB1 D;  5C4X C;  2E2J C;  1USM A;  3TFJ A;  3GTO K;  1TWF C;  3G4A A;  4A3F K;  3K7A K;  2B63 K;  5C3E C;  1ZVU A;  5IOT A;  2Y0S D;  3GTO A;  3FHZ A;  4BLB A;  1K83 C;  3GIR A;  3S0X A;  5IYB C;  3V4G A;  4A93 C;  4G7Z A;  5M5X K;  4KN7 A;  1IW7 A;  4QIW L;  5C44 K;  4OIN A;  3S17 C;  4GZY A;  5IYC C;  1XXB A;  3WOD A;  2GSN A;  3M4O K;  4GT9 A;  4A3B C;  2WAQ D;  4A3L C;  5M5Y K;  1WQH A;  5C4J C;  2PMZ L;  4KAR A;  1O26 A;  3AD7 C;  4WIL A;  4Y52 C;  4AYB D;  1UV7 A;  3I4M C;  2NVT K;  1J6V A;  4KC6 A;  4KAT A;  2RH6 A;  5IYD C;  4C3J K;  4A3I C;  4P5A A;  4P9S A;  4XLP A;  1V5V A;  4A3K C;  4Q5S A;  3S1N C;  3N0B A;  2D6F C;  3GTQ C;  5IOR A;  3AD9 C;  4G7O A;  5C4X K;  2BE5 A;  1YNJ A;  4GTE A;  3GEI A;  4KDD A;  3HOY C;  4XSX A;  1TWF K;  4YFN A;  4A3J C;  1J6W A;  1EK8 A;  5TMF A;  1VRQ C;  4YFX A;  1DD5 A;  1C0A A;  4BKW A;  2R92 K;  2V6S A;  3NUH A;  4O2D A;  5IYB K;  4JK1 A;  4MEX A;  2PPB A;  2A69 A;  1BDF A;  4QJV A;  3RZD C;  2PHC B;  1ISE A;  5IYC K;  2R92 A;  3GTO C;  3S2H C;  4A3B K;  4YG2 A;  3FOF A;  1O2B A;  5E68 A;  4A3F C;  3K7A C;  4BY7 K;  4A3L K;  3CAG A;  4LLG A;  5C4J K;  4Q4Z A;  1WOO A;  2JA8 C;  3HXA A;  3T01 A;  5IYD K;  1HQM A;  4A3I K;  4MQ9 A;  3QX3 A;  2V6U A;  3GTQ K;  3RZO C;  3CQZ K;  3A8K A;  3HOY K;  4LR2 A;  4GTB A;  2EBB A;  1X31 C;  1F9N A;  3PO2 C;  4A3J K;  3CQZ A;  1USO A;  3S1Q K;  2P8T A;  4G7H A;  2CFA A;  2R93 K;  1TWA C;  2NVT C;  4OIQ A;  5L46 A;  5EGH A;  4A3C K;  3I4N K;  3BP8 C;  5FLM K;  1TWH K;  4BBS K;  1DCH A;  1RU0 A;  3RZD K;  2R93 A;  4KMH A;  4XCH A;  1GE9 A;  1I3Q K;  1I50 K;  5CHP A;  3S2H K;  5M5W K;  3LAP A;  1INN A;  1XXC A;  4BBR K;  2A6E A;  2XCQ A;  3HOX C;  1XZQ A;  1TWH A;  1DCP A;  1WIH A;  2A68 A;  1O24 A;  3FKI K;  2JA8 K;  4KMU A;  4X6A K;  2VUM K;  2R92 C;  1I3Q A;  3DXJ A;  1I50 A;  2NVQ K;  4KMD A;  4G0V A;  1ZQ1 C;  5JFE A;  3RZO K;  4A3E K;  1XZP B;  1IL2 A;  2E2H K;  2PA8 D;  3FKI A;  1F93 A;  3S15 K;  1AB4 A;  3HKZ L;  2VUM A;  3PO2 K;  3LPX A;  3N3Y A;  4M1X A;  3OEP A;  4BY7 C;  3H0G K;  3ADA C;  3GEE A;  3H3V L;  2E2H A;  2NVY A;  4C2M K;  1YNN A;  1TWA K;  2WB1 L;  2A6H A;  1VGX A;  1VJE A;  3AQP A;  3H0G A;  4KAS A;  3CQZ C;  3ERE D;  1TWA A;  1TWC C;  1ZBS A;  4XLN A;  3T02 A;  1BGW A;  1Y1W K;  3ORE A;  4BXX K;  1HI9 A;  3GTL K;  4P5B A;  2Y0S L;  1VH2 A;  3HOX K;  3S1Q C;  3HOU C;  4GTF A;  3BP3 A;  1Y1V A;  4ILD A;  2R93 C;  2GSO A;  3G4C A;  4LOW A;  1EFW A;  4OIO A;  2JA7 A;  4A3C C;  1Y1W A;  3GTL A;  3I4N C;  4LQY A;  1WQF A;  5FLM C;  1TWH C;  2V6T A;  3A8J A;  4BBS C;  1IE0 A;  2WAQ L;  4KB4 A;  3GDZ A;  2XCO A;  3JST A;  3GTG K;  1I3Q C;  1I50 C;  3AD8 C;  1XXA A;  1R9T K;  1WOR A;  1WSR A;  4AYB L;  4BBR C;  1O27 A;  2O5J A;  3FKI C;  1J98 A;  3MML B;  4X6A C;  5IP7 C;  3GTK K;  4BLA A;  3GTG A;  2VUM C;  2NVQ C;  3OPF A;  1WCM C;  1R9T A;  3S1M K;  1F7U A;  4GTD A;  4A3E C;  1O2A A;  2E2H C;  2NVY C;  4A3D K;  4KM9 A;  3HOZ K;  1TWC K;  3S15 C;  3GTK A;  1JOE A;  2ZUF A;  2ZFZ A;  3H0G C;  4WJ3 M;  3HOU K;  1EH1 A;  4C2M C;  4A3M K;  4RMF A;  1TWC A;  3Q3Q A;  1BJT A;  4FZB A;  3SZZ A;  3S2D K;  5TMC A;  5EGE A;  2JA5 K;  4GTC A;  1L0W A;  1BS2 A;  1Y1V C;  1SFO K;  1I6H C;  1EI6 A;  4QIW D;  1YX2 A; 
#chains in the Genus database with same CATH homology
 1O28 A;  2P5M A;  3AQO A;  1EK8 A;  3LPX A;  3N3Y A;  4M1X A;  3OEP A;  3AH5 A;  2JA5 A;  2E2H A;  1DD5 A;  4G0W A;  2NVY A;  2XCR B;  4BKW A;  1SFO A;  3NUH A;  4KM8 A;  2GSU A;  4J3N A;  5IOS A;  4GTL A;  1TWG A;  1B4B A;  4FM9 A;  2CFA B;  1IS1 A;  3AQP A;  3H0G A;  4KAS A;  3L4K A;  3ERE D;  1O25 A;  1TWA A;  1ISE A;  2PHC B;  2Y3P A;  2R92 A;  2E2I A;  1ZBS A;  3VA7 A;  4C3I C;  3FOF A;  5TJ3 A;  3GTQ A;  1BGW A;  1O2B A;  3ORE A;  1WCM A;  4P5B A;  3CAG A;  4G0U A;  4GFQ A;  4GTF A;  1Y1V A;  3N0C A;  4ILD A;  4DDQ A;  2GSO A;  3LAJ A;  2JH3 A;  3G4C A;  4C3J C;  4KB2 A;  5CJ9 A;  3QX3 A;  2JA7 A;  1O29 A;  5JVO A;  1Y1W A;  2B63 A;  4KMA A;  1WQG A;  2KWA A;  3GTL A;  2R7Z A;  4LQY A;  1WQF A;  4LR2 A;  4KB4 A;  2XCO A;  2YU9 A;  4GTB A;  2JA6 A;  3GTM A;  3G4A A;  1F9N A;  1XXA A;  3CQZ A;  1ZVU A;  5IOT A;  1O27 A;  2CFA A;  5IOQ A;  3MML B;  3FHZ A;  3GTO A;  4BLB A;  4BLA A;  3GTG A;  3S0X A;  5EGH A;  3OPF A;  3V4G A;  2NVX A;  1R9T A;  4GTD A;  1O2A A;  1B4A A;  2R93 A;  4KM9 A;  3BUE A;  4KMH A;  3FOE A;  3GTJ A;  1XXB A;  1GE9 A;  2GSN A;  3GTK A;  4GT9 A;  5CHP A;  3LAP A;  1XXC A;  2XCQ A;  2ZFZ A;  1WQH A;  1TWH A;  4KAR A;  1WIH A;  1O24 A;  1O26 A;  1EH1 A;  2RGR A;  4C2M C;  1ZXO A;  1KQ4 A;  3L4J A;  1TWC A;  3Q3Q A;  1BJT A;  1TWF A;  4KC6 A;  2RH6 A;  4KAT A;  1I3Q A;  1I50 A;  4P5A A;  4KAW X;  4KMD A;  4C3H C;  4G0V A;  4FZB A;  5JFE A;  3N0B A;  5IOR A;  4GTA A;  5EGE A;  3FKI A;  4GTC A;  4GTE A;  1AB4 A;  4KDD A;  1K83 A;  2VUM A;  3GTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...