1XXCA

C-terminal domain of escherichia coli arginine repressor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
PLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARGININE REPRESSOR
publication title Structure of the oligomerization and L-arginine binding domain of the arginine repressor of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Dna binding regulatory protein
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1995-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1xxcA00
4KC6A 4G0UA 1WIHA 1WQGA 1BGWA 3OPFA 4G0WA 3FHZA 3QX3A 1DD5A 4G0VA 1ZVUA 1WQHA 4GFQA 3LAJA 4KAWX 2P5MA 1XXBA 1EK8A 2XCQA 3FOEA 1AB4A 3L4KA 1WQFA 3LPXA 1F9NA 2ZFZA 2RGRA 3V4GA 2XCOA 1ISEA 1GE9A 1EH1A 1XXCA 5JVOA 4DDQA 3NUHA 4KDDA 1XXAA 3VA7A 2PHCB 3OREA 3L4JA 3ERED 2KWAA 1BJTA 4J3NA 1IS1A 4KB2A 3FOFA 3MMLB 3BUEA 3CAGA 2XCRB 2Y3PA 1B4BA 4KB4A 1B4AA 3LAPA 5CJ9A 4FM9A 3OEPA
chains in the Genus database with same CATH superfamily
4GTFA 2YU9K 4KASA 3FKIC 1TWFC 4G7HA 1O28A 1PJ7A 1Y1VA 1XZQB 5EGEA 1WQFA 1WOSA 1F9NA 3S14C 1O29A 3HKZD 2NVXA 3GTLA 5TMCA 3TFIA 2BE5A 2NVTC 4KDDA 1VRQC 5C3EK 4A3LC 3GEIA 3DXJA 1VJEA 1B4BA 3PO2K 1HI9A 3H3VD 2CFAA 4GTBA 3T00A 4LQYA 5C44C 1TWAC 3GEEA 5IP7K 1EQRA 2R7ZC 4XLNA 3GTQA 2A6EA 1O2BA 4OIPA 2FQTA 1XXAA 4A3EK 1TWHK 5IYCK 1J6VA 1I3QC 4KM8A 4GTAA 3I4NK 4KB4A 1Y1WC 5IP9K 4A3IC 2PMZD 1R9TA 2JA5C 1WSVA 4A3MK 3CQZK 5TMFA 2A69A 2FQOA 4Y52K 3AD7C 1AB4A 4O2DA 2R92C 2VUMA 1WOPA 3OREA 1YX2A 3HOVC 3PO3K 3RZOC 1IS1A 3FOFA 4C3IK 3CAGA 2CFAB 3GTKC 4BBSC 1WORA 4X6AK 2E2IC 3S17K 3AD8C 4A3FC 4G0WA 1JVIA 2ZUFA 1DD5A 5EGHA 3IPJA 3GTGK 3M4OK 4YFKA 1WQHA 1G51A 2R93K 1XZPA 2GSOA 3G4AA 1TWFA 5HL8A 5M5XK 2B63C 4A3JC 3HKZL 5CHPA 5M5WK 1TWGC 3WODA 3TTGA 1USOA 4LK0A 4KN4A 1XPPA 4A3CK 2NVYC 1TWCK 3H3VL 2O5IA 4BXXC 3T02A 3GEHA 1BGWA 1UV7A 4MQ9A 4LLGA 3FHZA 3GTLK 2YU9C 3S16K 1INNA 1EK8A 2A6HA 1TWAA 4Q4ZA 4LR2A 3H0GA 1ZQ1C 1IE0A 1XXCA 4G7ZA 4KARA 1J6XA 3GIRA 3M3YK 4J3NA 2O5JA 5C3EC 2XCRB 1YCLA 2JA7C 4KMUA 5CJ9A 1I3QA 2Y0SD 4WJ3M 3HOZK 3PO2C 2JA6K 2PMZL 3S1NK 1ZYRA 5L46A 1XZPB 1IL2A 4GFQA 3LAJA 2EBBA 2JA5A 1I6VA 4A3BK 2E2HK 4YFXA 1I50K 1PJ5A 3AH5A 5IOQA 3HOXK 5IP7C 2ZFZA 4PABA 5IYBC 3RZDK 4RMFA 4QIWD 1TWHC 5IYCC 2GSUA 2NVQK 3GTOA 2W7VA 4KC6A 3I4NC 2V6TA 3GTJA 4A3GK 5IP9C 3OPFA 3GTKA 1WCMA 4BLAA 2E2IA 4KATA 4A3MC 3CQZC 2WB1L 4AYBD 4NOIA 3S15K 1JQWA 3GTMK 4Y52C 3K7AK 5FLMK 3NUHA 2PHCB 1F7UA 5IOSA 3ERED 3MMLB 1O2FB 1SMYA 2GAHC 3BP8C 4GTDA 3S2DK 3PO3C 3SZZA 1I6HK 3T01A 4C3IC 2ZUEA 1V5VA 3QX3A 4X6AC 1BDFA 2PA8D 4GTLA 3N3YA 2P8TA 3GTGC 3M4OC 1IW7A 1IQ0A 1VH2A 2CW0A 4C3JK 3L4KA 2D6FC 2R93C 1SFOA 4GTEA 3HXAA 4DDQA 1K83A 5M3FK 4YFNA 4KM9A 1L0WA 2GAGC 3GTPA 4BY7C 1TWAK 4A3CC 3SZYA 1O24A 2Y0SL 4A3DK 2JA7A 5IYDK 1TWCC 4LOWA 3H0GK 4JK1A 4G7OA 5D4DA 2V6UA 4KAWX 4C3HK 3GTLC 3I4MC 3FKIA 3S0XA 1YNNA 2PPBA 3S16C 4YG2A 5M3MK 4Y7NK 4WJ4A 2KWAA 1BJTA 4OIRA 4QIWL 1F93A 3AQPA 2Y3PA 2JA5K 4XCHA 4LJZA 3TFJA 3M3YC 3GSIA 4XSZA 1Y1VK 4A93K 5M5YK 4QJVA 1JOEA 2NVXK 2JA6C 4KMAA 2WAQD 3S1NC 2XCQA 3AD9C 4AYBL 1XZQA 3A8KA 2E2HC 4GT9A 5C4JK 4MEXA 2RGRA 4A3BC 1I50C 2R7ZA 3GTOK 3HOXC 5JVOA 3RZOK 3S1MK 3GTJK 1WCMK 3S2HK 1B4AA 3RZDC 4MEYA 1WIHA 4BBRK 1J98A 3GTQK 3S1RK 2NVQC 4OIOA 1Y1WA 4A3GC 3GDZA 2PA8L 1EI6A 4C45A 2P5MA 4FZBA 3N0CA 1VLOA 3HOUK 3A8IA 1ZBSA 3HOWK 2JA8K 3GTGA 1F7VA 3S15C 3GTMC 2E2JK 2R93A 3VA7A 5FLMC 3S1QK 1R9TK 2R92A 4C2MK 4KB2A 3BUEA 4A3EC 4G0UA 3S2DC 4QJVB 5C4XK 1I6HC 1SFOK 3A8JA 2VUMK 1K83K 1TWCA 1O2AA 1XXBA 4GZYA 4A3KK 3HOYK 4ILDA 3GTPK 2GSNA 4ZH4A 5IOTA 2XCOA 4PAAA 4C3JC 1USMA 4BY1K 2JA7K 2B63A 3AQOA 4P5AA 1TWGA 2V6SA 1J6WA 4WILA 3OEPA 5IORA 3FKIK 1WQGA 1TWFK 4OIQA 5JFEA 2NVYA 1O27A 4A3DC 5IYDC 3H0GC 2JH3A 5E68A 3S17C 2WAQL 3S14K 3N0BA 3FOEA 2JA6A 4C3HC 2YU9A 2NVTK 1RU0A 3BP3A 1ISEA 3G4CA 4A3LK 1EH1A 1YNJA 1GE9A 5IYBK 3ADAC 4BKWA 1O25A 2E2HA 3L4JA 1I50A 4BLBA 4Y7NC 3LAPA 5C44K 5TJ3A 2R7ZK 1Y1VC 1HQMA 5FJ8K 4A93C 1ZVUA 4AH6A 2NVXC 3EQLA 4KMDA 1EFWA 5C4JC 1I3QK 4M1XA 4P5BA 3GTOC 1Y1WK 3GTMA 3Q3QA 3S1MC 3GTJC 4A3IK 3TFHA 1KQ4A 1WCMC 1DCHA 3S2HC 1TWHA 2A68A 4BBRC 3GTQC 3S1RC 3HOZC 2WB1D 1WSRA 2R92K 2RH6A 3HOUC 4KMHA 3CQZA 3HOVK 3HOWC 2JA8C 4LK1A 1O26A 4P9SA 4BY7K 4XSXA 2E2JC 3GTKK 4BBSK 1WOOA 3S1QC 1R9TC 2E2IK 1PJ6A 4C2MC 1C0AA 4A3FK 4FM9A 3I4MK 1BS2A 1VGXA 4XLPA 4G0VA 5C4XC 1IBAA 1SFOC 2VUMC 4GTCA 2B63K 4A3JK 1K83C 1DCOA 3LPXA 1X31C 3V4GA 1TWGK 4A3KC 3HOYC 1ZXOA 3GTPC 3K7AC 2NVYK 4BY1C 4KN7A 4BXXK 1DCPA 4Q5SA 4OINA 3JSTA
chains in the Genus database with same CATH topology
1O24A 1WQGA 1BGWA 4GTFA 2JA7A 4KASA 5JFEA 2NVYA 1O27A 3FHZA 2JH3A 4KAWX 1O28A 1EK8A 1TWAA 1Y1VA 3N0BA 3FOEA 4LR2A 2JA6A 3FKIA 5EGEA 3S0XA 1WQFA 4C3HC 1F9NA 2YU9A 3H0GA 1O29A 3G4CA 1ISEA 3GTLA 2NVXA 1EH1A 1GE9A 1XXCA 4BKWA 1O25A 2E2HA 4KARA 4KDDA 3L4JA 1I50A 2KWAA 4BLBA 1BJTA 4J3NA 2XCRB 3AQPA 2Y3PA 1B4BA 3LAPA 5CJ9A 1I3QA 2CFAA 5TJ3A 4GTBA 4LQYA 4KMAA 1ZVUA 4GFQA 3LAJA 2JA5A 2XCQA 5IORA 3GTQA 3AH5A 5IOQA 4GT9A 2ZFZA 4KMDA 2RGRA 2R7ZA 1O2BA 5JVOA 1XXAA 4M1XA 4P5BA 3GTMA 3Q3QA 4KM8A 4GTAA 4KB4A 1KQ4A 2GSUA 1B4AA 3GTOA 4KC6A 1WIHA 1TWHA 1R9TA 3GTJA 3OPFA 3GTKA 1Y1WA 1WCMA 4BLAA 2E2IA 4KATA 2P5MA 4FZBA 3N0CA 1AB4A 1ZBSA 2RH6A 2VUMA 3GTGA 4KMHA 3CQZA 2R93A 3NUHA 1O26A 3VA7A 2PHCB 3OREA 5IOSA 3ERED 2R92A 1IS1A 4KB2A 3FOFA 3MMLB 3BUEA 3CAGA 4GTDA 2CFAB 4C2MC 4G0UA 4FM9A 4C3IC 4G0WA 3QX3A 1DD5A 5EGHA 4G0VA 4GTLA 3N3YA 1WQHA 1TWCA 1O2AA 1XXBA 4GTCA 2GSOA 4ILDA 3G4AA 1TWFA 3L4KA 3LPXA 2GSNA 5IOTA 3V4GA 1SFOA 2XCOA 1ZXOA 4GTEA 4C3JC 5CHPA 4DDQA 1K83A 2B63A 4KM9A 3AQOA 4P5AA 3GTPA 1TWGA 3OEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KC6 A;  4G0U A;  1WIH A;  1WQG A;  1BGW A;  3OPF A;  4G0W A;  3FHZ A;  3QX3 A;  1DD5 A;  4G0V A;  1ZVU A;  1WQH A;  4GFQ A;  3LAJ A;  4KAW X;  2P5M A;  1XXB A;  1EK8 A;  2XCQ A;  3FOE A;  1AB4 A;  3L4K A;  1WQF A;  3LPX A;  1F9N A;  2ZFZ A;  2RGR A;  3V4G A;  2XCO A;  1ISE A;  1GE9 A;  1EH1 A;  1XXC A;  5JVO A;  4DDQ A;  3NUH A;  4KDD A;  1XXA A;  3VA7 A;  2PHC B;  3ORE A;  3L4J A;  3ERE D;  2KWA A;  1BJT A;  4J3N A;  1IS1 A;  4KB2 A;  3FOF A;  3MML B;  3BUE A;  3CAG A;  2XCR B;  2Y3P A;  1B4B A;  4KB4 A;  1B4A A;  3LAP A;  5CJ9 A;  4FM9 A;  3OEP A; 
#chains in the Genus database with same CATH topology
 4GTF A;  2YU9 K;  4KAS A;  3FKI C;  1TWF C;  4G7H A;  1O28 A;  1PJ7 A;  1Y1V A;  1XZQ B;  5EGE A;  1WQF A;  1WOS A;  1F9N A;  3S14 C;  1O29 A;  3HKZ D;  2NVX A;  3GTL A;  5TMC A;  3TFI A;  2BE5 A;  2NVT C;  4KDD A;  1VRQ C;  5C3E K;  4A3L C;  3GEI A;  3DXJ A;  1VJE A;  1B4B A;  3PO2 K;  1HI9 A;  3H3V D;  2CFA A;  4GTB A;  3T00 A;  4LQY A;  5C44 C;  1TWA C;  3GEE A;  5IP7 K;  1EQR A;  2R7Z C;  4XLN A;  3GTQ A;  2A6E A;  1O2B A;  4OIP A;  2FQT A;  1XXA A;  4A3E K;  1TWH K;  5IYC K;  1J6V A;  1I3Q C;  4KM8 A;  4GTA A;  3I4N K;  4KB4 A;  1Y1W C;  5IP9 K;  4A3I C;  2PMZ D;  1R9T A;  2JA5 C;  1WSV A;  4A3M K;  3CQZ K;  5TMF A;  2A69 A;  2FQO A;  4Y52 K;  3AD7 C;  1AB4 A;  4O2D A;  2R92 C;  2VUM A;  1WOP A;  3ORE A;  1YX2 A;  3HOV C;  3PO3 K;  3RZO C;  1IS1 A;  3FOF A;  4C3I K;  3CAG A;  2CFA B;  3GTK C;  4BBS C;  1WOR A;  4X6A K;  2E2I C;  3S17 K;  3AD8 C;  4A3F C;  4G0W A;  1JVI A;  2ZUF A;  1DD5 A;  5EGH A;  3IPJ A;  3GTG K;  3M4O K;  4YFK A;  1WQH A;  1G51 A;  2R93 K;  1XZP A;  2GSO A;  3G4A A;  1TWF A;  5HL8 A;  5M5X K;  2B63 C;  4A3J C;  3HKZ L;  5CHP A;  5M5W K;  1TWG C;  3WOD A;  3TTG A;  1USO A;  4LK0 A;  4KN4 A;  1XPP A;  4A3C K;  2NVY C;  1TWC K;  3H3V L;  2O5I A;  4BXX C;  3T02 A;  3GEH A;  1BGW A;  1UV7 A;  4MQ9 A;  4LLG A;  3FHZ A;  3GTL K;  2YU9 C;  3S16 K;  1INN A;  1EK8 A;  2A6H A;  1TWA A;  4Q4Z A;  4LR2 A;  3H0G A;  1ZQ1 C;  1IE0 A;  1XXC A;  4G7Z A;  4KAR A;  1J6X A;  3GIR A;  3M3Y K;  4J3N A;  2O5J A;  5C3E C;  2XCR B;  1YCL A;  2JA7 C;  4KMU A;  5CJ9 A;  1I3Q A;  2Y0S D;  4WJ3 M;  3HOZ K;  3PO2 C;  2JA6 K;  2PMZ L;  3S1N K;  1ZYR A;  5L46 A;  1XZP B;  1IL2 A;  4GFQ A;  3LAJ A;  2EBB A;  2JA5 A;  1I6V A;  4A3B K;  2E2H K;  4YFX A;  1I50 K;  1PJ5 A;  3AH5 A;  5IOQ A;  3HOX K;  5IP7 C;  2ZFZ A;  4PAB A;  5IYB C;  3RZD K;  4RMF A;  4QIW D;  1TWH C;  5IYC C;  2GSU A;  2NVQ K;  3GTO A;  2W7V A;  4KC6 A;  3I4N C;  2V6T A;  3GTJ A;  4A3G K;  5IP9 C;  3OPF A;  3GTK A;  1WCM A;  4BLA A;  2E2I A;  4KAT A;  4A3M C;  3CQZ C;  2WB1 L;  4AYB D;  4NOI A;  3S15 K;  1JQW A;  3GTM K;  4Y52 C;  3K7A K;  5FLM K;  3NUH A;  2PHC B;  1F7U A;  5IOS A;  3ERE D;  3MML B;  1O2F B;  1SMY A;  2GAH C;  3BP8 C;  4GTD A;  3S2D K;  3PO3 C;  3SZZ A;  1I6H K;  3T01 A;  4C3I C;  2ZUE A;  1V5V A;  3QX3 A;  4X6A C;  1BDF A;  2PA8 D;  4GTL A;  3N3Y A;  2P8T A;  3GTG C;  3M4O C;  1IW7 A;  1IQ0 A;  1VH2 A;  2CW0 A;  4C3J K;  3L4K A;  2D6F C;  2R93 C;  1SFO A;  4GTE A;  3HXA A;  4DDQ A;  1K83 A;  5M3F K;  4YFN A;  4KM9 A;  1L0W A;  2GAG C;  3GTP A;  4BY7 C;  1TWA K;  4A3C C;  3SZY A;  1O24 A;  2Y0S L;  4A3D K;  2JA7 A;  5IYD K;  1TWC C;  4LOW A;  3H0G K;  4JK1 A;  4G7O A;  5D4D A;  2V6U A;  4KAW X;  4C3H K;  3GTL C;  3I4M C;  3FKI A;  3S0X A;  1YNN A;  2PPB A;  3S16 C;  4YG2 A;  5M3M K;  4Y7N K;  4WJ4 A;  2KWA A;  1BJT A;  4OIR A;  4QIW L;  1F93 A;  3AQP A;  2Y3P A;  2JA5 K;  4XCH A;  4LJZ A;  3TFJ A;  3M3Y C;  3GSI A;  4XSZ A;  1Y1V K;  4A93 K;  5M5Y K;  4QJV A;  1JOE A;  2NVX K;  2JA6 C;  4KMA A;  2WAQ D;  3S1N C;  2XCQ A;  3AD9 C;  4AYB L;  1XZQ A;  3A8K A;  2E2H C;  4GT9 A;  5C4J K;  4MEX A;  2RGR A;  4A3B C;  1I50 C;  2R7Z A;  3GTO K;  3HOX C;  5JVO A;  3RZO K;  3S1M K;  3GTJ K;  1WCM K;  3S2H K;  1B4A A;  3RZD C;  4MEY A;  1WIH A;  4BBR K;  1J98 A;  3GTQ K;  3S1R K;  2NVQ C;  4OIO A;  1Y1W A;  4A3G C;  3GDZ A;  2PA8 L;  1EI6 A;  4C45 A;  2P5M A;  4FZB A;  3N0C A;  1VLO A;  3HOU K;  3A8I A;  1ZBS A;  3HOW K;  2JA8 K;  3GTG A;  1F7V A;  3S15 C;  3GTM C;  2E2J K;  2R93 A;  3VA7 A;  5FLM C;  3S1Q K;  1R9T K;  2R92 A;  4C2M K;  4KB2 A;  3BUE A;  4A3E C;  4G0U A;  3S2D C;  4QJV B;  5C4X K;  1I6H C;  1SFO K;  3A8J A;  2VUM K;  1K83 K;  1TWC A;  1O2A A;  1XXB A;  4GZY A;  4A3K K;  3HOY K;  4ILD A;  3GTP K;  2GSN A;  4ZH4 A;  5IOT A;  2XCO A;  4PAA A;  4C3J C;  1USM A;  4BY1 K;  2JA7 K;  2B63 A;  3AQO A;  4P5A A;  1TWG A;  2V6S A;  1J6W A;  4WIL A;  3OEP A;  5IOR A;  3FKI K;  1WQG A;  1TWF K;  4OIQ A;  5JFE A;  2NVY A;  1O27 A;  4A3D C;  5IYD C;  3H0G C;  2JH3 A;  5E68 A;  3S17 C;  2WAQ L;  3S14 K;  3N0B A;  3FOE A;  2JA6 A;  4C3H C;  2YU9 A;  2NVT K;  1RU0 A;  3BP3 A;  1ISE A;  3G4C A;  4A3L K;  1EH1 A;  1YNJ A;  1GE9 A;  5IYB K;  3ADA C;  4BKW A;  1O25 A;  2E2H A;  3L4J A;  1I50 A;  4BLB A;  4Y7N C;  3LAP A;  5C44 K;  5TJ3 A;  2R7Z K;  1Y1V C;  1HQM A;  5FJ8 K;  4A93 C;  1ZVU A;  4AH6 A;  2NVX C;  3EQL A;  4KMD A;  1EFW A;  5C4J C;  1I3Q K;  4M1X A;  4P5B A;  3GTO C;  1Y1W K;  3GTM A;  3Q3Q A;  3S1M C;  3GTJ C;  4A3I K;  3TFH A;  1KQ4 A;  1WCM C;  1DCH A;  3S2H C;  1TWH A;  2A68 A;  4BBR C;  3GTQ C;  3S1R C;  3HOZ C;  2WB1 D;  1WSR A;  2R92 K;  2RH6 A;  3HOU C;  4KMH A;  3CQZ A;  3HOV K;  3HOW C;  2JA8 C;  4LK1 A;  1O26 A;  4P9S A;  4BY7 K;  4XSX A;  2E2J C;  3GTK K;  4BBS K;  1WOO A;  3S1Q C;  1R9T C;  2E2I K;  1PJ6 A;  4C2M C;  1C0A A;  4A3F K;  4FM9 A;  3I4M K;  1BS2 A;  1VGX A;  4XLP A;  4G0V A;  5C4X C;  1IBA A;  1SFO C;  2VUM C;  4GTC A;  2B63 K;  4A3J K;  1K83 C;  1DCO A;  3LPX A;  1X31 C;  3V4G A;  1TWG K;  4A3K C;  3HOY C;  1ZXO A;  3GTP C;  3K7A C;  2NVY K;  4BY1 C;  4KN7 A;  4BXX K;  1DCP A;  4Q5S A;  4OIN A;  3JST A; 
#chains in the Genus database with same CATH homology
 1O24 A;  1WQG A;  1BGW A;  4GTF A;  2JA7 A;  4KAS A;  5JFE A;  2NVY A;  1O27 A;  3FHZ A;  2JH3 A;  4KAW X;  1O28 A;  1EK8 A;  1TWA A;  1Y1V A;  3N0B A;  3FOE A;  4LR2 A;  2JA6 A;  3FKI A;  5EGE A;  3S0X A;  1WQF A;  4C3H C;  1F9N A;  2YU9 A;  3H0G A;  1O29 A;  3G4C A;  1ISE A;  3GTL A;  2NVX A;  1EH1 A;  1GE9 A;  1XXC A;  4BKW A;  1O25 A;  2E2H A;  4KAR A;  4KDD A;  3L4J A;  1I50 A;  2KWA A;  4BLB A;  1BJT A;  4J3N A;  2XCR B;  3AQP A;  2Y3P A;  1B4B A;  3LAP A;  5CJ9 A;  1I3Q A;  2CFA A;  5TJ3 A;  4GTB A;  4LQY A;  4KMA A;  1ZVU A;  4GFQ A;  3LAJ A;  2JA5 A;  2XCQ A;  5IOR A;  3GTQ A;  3AH5 A;  5IOQ A;  4GT9 A;  2ZFZ A;  4KMD A;  2RGR A;  2R7Z A;  1O2B A;  5JVO A;  1XXA A;  4M1X A;  4P5B A;  3GTM A;  3Q3Q A;  4KM8 A;  4GTA A;  4KB4 A;  1KQ4 A;  2GSU A;  1B4A A;  3GTO A;  4KC6 A;  1WIH A;  1TWH A;  1R9T A;  3GTJ A;  3OPF A;  3GTK A;  1Y1W A;  1WCM A;  4BLA A;  2E2I A;  4KAT A;  2P5M A;  4FZB A;  3N0C A;  1AB4 A;  1ZBS A;  2RH6 A;  2VUM A;  3GTG A;  4KMH A;  3CQZ A;  2R93 A;  3NUH A;  1O26 A;  3VA7 A;  2PHC B;  3ORE A;  5IOS A;  3ERE D;  2R92 A;  1IS1 A;  4KB2 A;  3FOF A;  3MML B;  3BUE A;  3CAG A;  4GTD A;  2CFA B;  4C2M C;  4G0U A;  4FM9 A;  4C3I C;  4G0W A;  3QX3 A;  1DD5 A;  5EGH A;  4G0V A;  4GTL A;  3N3Y A;  1WQH A;  1TWC A;  1O2A A;  1XXB A;  4GTC A;  2GSO A;  4ILD A;  3G4A A;  1TWF A;  3L4K A;  3LPX A;  2GSN A;  5IOT A;  3V4G A;  1SFO A;  2XCO A;  1ZXO A;  4GTE A;  4C3J C;  5CHP A;  4DDQ A;  1K83 A;  2B63 A;  4KM9 A;  3AQO A;  4P5A A;  3GTP A;  1TWG A;  3OEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...