1XXCA

C-terminal domain of escherichia coli arginine repressor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
PLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding regulatory protein
molecule keywords ARGININE REPRESSOR
publication title Structure of the oligomerization and L-arginine binding domain of the arginine repressor of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1995-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1xxcA00
4KC6A 1ZVUA 3CAGA 3OEPA 1XXAA 2XCRB 4KB2A 3L4KA 1XXBA 5JVOA 5CJ9A 4G0VA 3FOFA 1F9NA 3MMLB 3OPFA 4KB4A 1B4AA 3OREA 1BJTA 1GE9A 1EK8A 1IS1A 1BGWA 2PHCB 2Y3PA 3FOEA 3BUEA 1XXCA 3V4GA 1DD5A 2ZFZA 4GFQA 1WQHA 4KDDA 1AB4A 2P5MA 2XCOA 3LAPA 4DDQA 2KWAA 4J3NA 3LAJA 1ISEA 3ERED 1WQFA 4G0UA 4FM9A 1B4BA 4G0WA 4KAWX 1WQGA 3NUHA 3L4JA 1EH1A 3FHZA 1WIHA 2RGRA 3LPXA 3VA7A 2XCQA 3QX3A
chains in the Genus database with same CATH superfamily
3OEPA 1TWHK 3FKIK 1F9NA 4BY1C 4LOWA 3CQZC 2W7VA 3BUEA 4M1XA 2E2IA 4A3MC 5FLMK 3S16C 1DD5A 3HOVK 1R9TA 4BLAA 4A3GK 3DXJA 4OIQA 4FM9A 3RZDK 3GTGK 2NVTC 2CFAA 1O2BA 2A6HA 5CHPA 1J6VA 2JH3A 2XCRB 1XXBA 5IORA 3AQPA 3I4MC 1USOA 4KM9A 3GTJK 5M3FK 3HOZC 2JA8C 1I3QC 3HKZD 1DCHA 1F7VA 2E2HC 3AD9C 3GEEA 1TWHC 3FKIC 1WQHA 1Y1VA 2WB1L 4C2MK 2P5MA 3GTMC 5IP9K 1UV7A 1B4BA 2Y0SD 4G7ZA 2V6SA 3I4NK 5FLMC 2NVYK 4A3EK 3HOVC 4KATA 3GTQA 1IBAA 3S1NC 2CFAB 1BDFA 4BY7K 1TWFK 3L4KA 3RZDC 3GTGC 4QJVA 1ZXOA 1WORA 4OIRA 1TWHA 1C0AA 4P5AA 3A8IA 4KMDA 3GTJC 2JA7K 2NVXC 4JK1A 4XSZA 5EGHA 4KMUA 1J6WA 4C2MC 5C4XK 3GTGA 3H3VL 2GAHC 5E68A 3CAGA 5IP9C 3I4NC 1I50K 2NVYC 2O5JA 1O26A 3MMLB 3OPFA 4LQYA 4A3EC 2E2IK 3RZOK 1YNNA 3S14K 3HXAA 1TWFC 5IYCK 3HOUK 2B63C 5C3EK 2WB1D 1ZQ1C 3S0XA 4Q5SA 1AB4A 4Y52C 1XPPA 4C45A 5IOQA 4G0UA 4A93C 1SFOA 2GSOA 4Q4ZA 2NVQK 4BXXK 1IE0A 2NVYA 1XXAA 1KQ4A 2GAGC 1VLOA 2P8TA 1B4AA 1TWFA 2D6FC 3GTLA 3BP3A 4NOIA 5C4XC 1BGWA 4KN7A 1G51A 3V4GA 5IOTA 1I50C 5M5WK 2E2IC 4C3JC 3RZOC 3A8JA 2KWAA 4J3NA 3LAJA 3S14C 3GTQK 4A3BK 3HOUC 3FHZA 5D4DA 1ZBSA 5C3EC 2JA7A 1VJEA 1O27A 1V5VA 5CJ9A 2NVQC 4BXXC 3HOWK 4A3JK 3ADAC 1I50A 3FOEA 5C44K 2R93K 4O2DA 1INNA 1PJ5A 3T02A 4A3FC 3S1QK 1Y1VC 1WQGA 3GEIA 4GT9A 1TWGA 4OIPA 3GTQC 1VH2A 3S15C 2GSUA 2R92A 3OREA 4BBRK 5L46A 2O5IA 2Y3PA 1K83K 5TMFA 2RH6A 3S1RK 4GTEA 1SFOK 3HOWC 3M4OK 1IQ0A 1TWCK 3T00A 1Y1WK 2RGRA 2R93C 4A3GC 4RMFA 4KC6A 3S1QC 2V6TA 3GTLK 5M5XK 3S2HK 3HOXK 1I6HK 5IYBK 2A6EA 2VUMK 4KDDA 1WCMK 4A3IK 2E2JK 1DCOA 4QIWD 2R93A 3GTPK 1K83C 1WIHA 1VRQC 3H0GA 3S1RC 1SFOC 3QX3A 1TWAK 5C4JK 3M4OC 4AYBL 3TFIA 1TWCC 4BBSK 1Y1WC 4A3KK 3PO2K 3EQLA 2EBBA 4QJVB 3GDZA 4BY7C 1SMYA 1EI6A 1YX2A 3GTLC 3GEHA 3S2HC 4KN4A 3K7AK 4GTAA 1IW7A 1WOPA 3N0BA 1I6HC 1K83A 2VUMC 4KAWX 4KM8A 1HQMA 1TWGK 1YNJA 3AD7C 3N3YA 4Y7NK 3JSTA 2BE5A 4GTDA 1WCMC 2V6UA 1XZPA 2JA7C 2E2JC 1ZVUA 1TWCA 4XLPA 2R92K 1Y1WA 4C3IK 4G0VA 2JA6A 1O2FB 4C3HK 1F93A 2PHCB 1TWAC 5C4JC 1EQRA 4GZYA 3IPJA 3GTOK 5EGEA 3M3YK 3HOYK 2R7ZA 3SZYA 4A3KC 1L0WA 3PO2C 4AH6A 2VUMA 3SZZA 1JVIA 2YU9A 1WOSA 1WQFA 5IYCC 1WCMA 5HL8A 3CQZK 3BP8C 5M3MK 3AQOA 3AH5A 4ZH4A 3TFJA 3AD8C 3GTPA 4AYBD 4P9SA 1TWGC 1XZPB 1O28A 2FQTA 4Y7NC 2JA5A 1TWAA 1GE9A 1XZQA 5TJ3A 5JFEA 2R92C 4C3IC 4A3LK 2GSNA 5IP7K 1YCLA 4C3HC 1BS2A 1ISEA 3H0GK 3WODA 3HOZK 3GTOC 2PA8L 3M3YC 4QIWL 3HOYC 4XLNA 1HI9A 4A3DK 2XCQA 4P5BA 5FJ8K 4A3BC 2WAQL 4MQ9A 4ILDA 3GTMK 4A3CK 3GTKA 1O25A 1XZQB 3S1NK 1JQWA 3GSIA 4DDQA 3PO3K 3GTOA 3S2DK 4A3JC 1USMA 3NUHA 5C44C 4A3LC 4YFXA 5IP7C 3S1MK 3G4CA 4YG2A 2A68A 4X6AK 2JA6K 1J98A 3H0GC 3CQZA 4GTCA 5JVOA 4GTBA 1VGXA 4MEYA 4KB4A 2NVXK 4WJ4A 1EK8A 1EFWA 4A3DC 2R7ZK 4LJZA 3S17K 4FZBA 2YU9K 2CW0A 2ZFZA 3Q3QA 4KARA 4GTLA 1J6XA 4PAAA 4A3CC 4BBRC 3TFHA 2PA8D 4BKWA 3L4JA 4LLGA 5IYDK 1PJ6A 1WSRA 3T01A 1O2AA 2PMZL 3PO3C 4KMAA 2B63K 1X31C 2FQOA 2JA5K 2WAQD 4KB2A 1I3QA 3S2DC 4LK1A 4BLBA 2E2HA 4Y52K 3S1MC 1DCPA 4A93K 3FKIA 5IOSA 4X6AC 2JA6C 4YFNA 1XXCA 1IL2A 3GTMA 3N0CA 3ERED 3G4AA 2R7ZC 4WJ3M 3HOXC 3S17C 5IYBC 1EH1A 1JOEA 2YU9C 4GTFA 3A8KA 5TMCA 4A3IC 4G7HA 1ZYRA 5IYDC 4C3JK 2A69A 3GTPC 3GTKK 4MEXA 1WSVA 1IS1A 4LK0A 1R9TK 4PABA 3TTGA 3GTJA 2JA5C 2NVXA 5M5YK 4GFQA 4XSXA 1RU0A 4BBSC 2XCOA 1F7UA 4G0WA 1PJ7A 4BY1K 4OIOA 2PMZD 3K7AC 4OINA 4A3MK 3S16K 4KASA 3FOFA 1I6VA 4G7OA 2PPBA 1BJTA 3GIRA 4WILA 2B63A 1O29A 1O24A 4A3FK 1Y1VK 3HKZL 2NVTK 2ZUEA 3LAPA 4KMHA 4LR2A 1WOOA 2ZUFA 3GTKC 1R9TC 3S15K 4XCHA 2Y0SL 3I4MK 4YFKA 3H3VD 3LPXA 2JA8K 1I3QK 3VA7A 2E2HK
chains in the Genus database with same CATH topology
2NVYA 3OEPA 1XXAA 1KQ4A 3CQZA 4GTCA 5JVOA 4GTBA 1F9NA 4KB4A 1B4AA 1TWFA 1EK8A 3GTLA 1BGWA 3BUEA 4M1XA 4FZBA 2E2IA 3V4GA 1DD5A 5IOTA 2ZFZA 3Q3QA 4BLAA 1R9TA 4KARA 4C3JC 4GTLA 4GTAA 2KWAA 4J3NA 3LAJA 3N0BA 4FM9A 1K83A 4KAWX 4KM8A 4BKWA 2CFAA 1O2BA 3L4JA 3FHZA 2JA7A 1ZBSA 3N3YA 4GTDA 5CHPA 1O2AA 1ZVUA 1TWCA 1O27A 4KMAA 2JH3A 1Y1WA 2XCRB 4KB2A 1I3QA 1XXBA 5IORA 3AQPA 5CJ9A 4BLBA 4G0VA 2E2HA 2JA6A 4KM9A 3FKIA 5IOSA 2PHCB 1I50A 3FOEA 1XXCA 5EGEA 3GTMA 2R7ZA 1WQHA 1Y1VA 2P5MA 2VUMA 3N0CA 2YU9A 3ERED 1WQFA 3G4AA 1B4BA 1WQGA 1WCMA 1EH1A 4GT9A 4GTFA 4KATA 3GTQA 2CFAB 1TWGA 3AQOA 3AH5A 3GTPA 3L4KA 1ZXOA 1O28A 2GSUA 2R92A 3OREA 2JA5A 1TWAA 1GE9A 1IS1A 1TWHA 2Y3PA 5TJ3A 3GTJA 5JFEA 2NVXA 4P5AA 4C3IC 2GSNA 4GFQA 2RH6A 4KMDA 2XCOA 4GTEA 4C3HC 1ISEA 4G0WA 5EGHA 2RGRA 4C2MC 3GTGA 2XCQA 4P5BA 4KC6A 3CAGA 4KASA 3FOFA 1O26A 3MMLB 3OPFA 4LQYA 4ILDA 1BJTA 2B63A 1O29A 1O24A 3GTKA 1O25A 3S0XA 4KDDA 1AB4A 3LAPA 4KMHA 4LR2A 4DDQA 5IOQA 4G0UA 3GTOA 1SFOA 3NUHA 2R93A 2GSOA 1WIHA 3LPXA 3H0GA 3VA7A 3G4CA 3QX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KC6 A;  1ZVU A;  3CAG A;  3OEP A;  1XXA A;  2XCR B;  4KB2 A;  3L4K A;  1XXB A;  5JVO A;  5CJ9 A;  4G0V A;  3FOF A;  1F9N A;  3MML B;  3OPF A;  4KB4 A;  1B4A A;  3ORE A;  1BJT A;  1GE9 A;  1EK8 A;  1IS1 A;  1BGW A;  2PHC B;  2Y3P A;  3FOE A;  3BUE A;  1XXC A;  3V4G A;  1DD5 A;  2ZFZ A;  4GFQ A;  1WQH A;  4KDD A;  1AB4 A;  2P5M A;  2XCO A;  3LAP A;  4DDQ A;  2KWA A;  4J3N A;  3LAJ A;  1ISE A;  3ERE D;  1WQF A;  4G0U A;  4FM9 A;  1B4B A;  4G0W A;  4KAW X;  1WQG A;  3NUH A;  3L4J A;  1EH1 A;  3FHZ A;  1WIH A;  2RGR A;  3LPX A;  3VA7 A;  2XCQ A;  3QX3 A; 
#chains in the Genus database with same CATH topology
 3OEP A;  1TWH K;  3FKI K;  1F9N A;  4BY1 C;  4LOW A;  3CQZ C;  2W7V A;  3BUE A;  4M1X A;  2E2I A;  4A3M C;  5FLM K;  3S16 C;  1DD5 A;  3HOV K;  1R9T A;  4BLA A;  4A3G K;  3DXJ A;  4OIQ A;  4FM9 A;  3RZD K;  3GTG K;  2NVT C;  2CFA A;  1O2B A;  2A6H A;  5CHP A;  1J6V A;  2JH3 A;  2XCR B;  1XXB A;  5IOR A;  3AQP A;  3I4M C;  1USO A;  4KM9 A;  3GTJ K;  5M3F K;  3HOZ C;  2JA8 C;  1I3Q C;  3HKZ D;  1DCH A;  1F7V A;  2E2H C;  3AD9 C;  3GEE A;  1TWH C;  3FKI C;  1WQH A;  1Y1V A;  2WB1 L;  4C2M K;  2P5M A;  3GTM C;  5IP9 K;  1UV7 A;  1B4B A;  2Y0S D;  4G7Z A;  2V6S A;  3I4N K;  5FLM C;  2NVY K;  4A3E K;  3HOV C;  4KAT A;  3GTQ A;  1IBA A;  3S1N C;  2CFA B;  1BDF A;  4BY7 K;  1TWF K;  3L4K A;  3RZD C;  3GTG C;  4QJV A;  1ZXO A;  1WOR A;  4OIR A;  1TWH A;  1C0A A;  4P5A A;  3A8I A;  4KMD A;  3GTJ C;  2JA7 K;  2NVX C;  4JK1 A;  4XSZ A;  5EGH A;  4KMU A;  1J6W A;  4C2M C;  5C4X K;  3GTG A;  3H3V L;  2GAH C;  5E68 A;  3CAG A;  5IP9 C;  3I4N C;  1I50 K;  2NVY C;  2O5J A;  1O26 A;  3MML B;  3OPF A;  4LQY A;  4A3E C;  2E2I K;  3RZO K;  1YNN A;  3S14 K;  3HXA A;  1TWF C;  5IYC K;  3HOU K;  2B63 C;  5C3E K;  2WB1 D;  1ZQ1 C;  3S0X A;  4Q5S A;  1AB4 A;  4Y52 C;  1XPP A;  4C45 A;  5IOQ A;  4G0U A;  4A93 C;  1SFO A;  2GSO A;  4Q4Z A;  2NVQ K;  4BXX K;  1IE0 A;  2NVY A;  1XXA A;  1KQ4 A;  2GAG C;  1VLO A;  2P8T A;  1B4A A;  1TWF A;  2D6F C;  3GTL A;  3BP3 A;  4NOI A;  5C4X C;  1BGW A;  4KN7 A;  1G51 A;  3V4G A;  5IOT A;  1I50 C;  5M5W K;  2E2I C;  4C3J C;  3RZO C;  3A8J A;  2KWA A;  4J3N A;  3LAJ A;  3S14 C;  3GTQ K;  4A3B K;  3HOU C;  3FHZ A;  5D4D A;  1ZBS A;  5C3E C;  2JA7 A;  1VJE A;  1O27 A;  1V5V A;  5CJ9 A;  2NVQ C;  4BXX C;  3HOW K;  4A3J K;  3ADA C;  1I50 A;  3FOE A;  5C44 K;  2R93 K;  4O2D A;  1INN A;  1PJ5 A;  3T02 A;  4A3F C;  3S1Q K;  1Y1V C;  1WQG A;  3GEI A;  4GT9 A;  1TWG A;  4OIP A;  3GTQ C;  1VH2 A;  3S15 C;  2GSU A;  2R92 A;  3ORE A;  4BBR K;  5L46 A;  2O5I A;  2Y3P A;  1K83 K;  5TMF A;  2RH6 A;  3S1R K;  4GTE A;  1SFO K;  3HOW C;  3M4O K;  1IQ0 A;  1TWC K;  3T00 A;  1Y1W K;  2RGR A;  2R93 C;  4A3G C;  4RMF A;  4KC6 A;  3S1Q C;  2V6T A;  3GTL K;  5M5X K;  3S2H K;  3HOX K;  1I6H K;  5IYB K;  2A6E A;  2VUM K;  4KDD A;  1WCM K;  4A3I K;  2E2J K;  1DCO A;  4QIW D;  2R93 A;  3GTP K;  1K83 C;  1WIH A;  1VRQ C;  3H0G A;  3S1R C;  1SFO C;  3QX3 A;  1TWA K;  5C4J K;  3M4O C;  4AYB L;  3TFI A;  1TWC C;  4BBS K;  1Y1W C;  4A3K K;  3PO2 K;  3EQL A;  2EBB A;  4QJV B;  3GDZ A;  4BY7 C;  1SMY A;  1EI6 A;  1YX2 A;  3GTL C;  3GEH A;  3S2H C;  4KN4 A;  3K7A K;  4GTA A;  1IW7 A;  1WOP A;  3N0B A;  1I6H C;  1K83 A;  2VUM C;  4KAW X;  4KM8 A;  1HQM A;  1TWG K;  1YNJ A;  3AD7 C;  3N3Y A;  4Y7N K;  3JST A;  2BE5 A;  4GTD A;  1WCM C;  2V6U A;  1XZP A;  2JA7 C;  2E2J C;  1ZVU A;  1TWC A;  4XLP A;  2R92 K;  1Y1W A;  4C3I K;  4G0V A;  2JA6 A;  1O2F B;  4C3H K;  1F93 A;  2PHC B;  1TWA C;  5C4J C;  1EQR A;  4GZY A;  3IPJ A;  3GTO K;  5EGE A;  3M3Y K;  3HOY K;  2R7Z A;  3SZY A;  4A3K C;  1L0W A;  3PO2 C;  4AH6 A;  2VUM A;  3SZZ A;  1JVI A;  2YU9 A;  1WOS A;  1WQF A;  5IYC C;  1WCM A;  5HL8 A;  3CQZ K;  3BP8 C;  5M3M K;  3AQO A;  3AH5 A;  4ZH4 A;  3TFJ A;  3AD8 C;  3GTP A;  4AYB D;  4P9S A;  1TWG C;  1XZP B;  1O28 A;  2FQT A;  4Y7N C;  2JA5 A;  1TWA A;  1GE9 A;  1XZQ A;  5TJ3 A;  5JFE A;  2R92 C;  4C3I C;  4A3L K;  2GSN A;  5IP7 K;  1YCL A;  4C3H C;  1BS2 A;  1ISE A;  3H0G K;  3WOD A;  3HOZ K;  3GTO C;  2PA8 L;  3M3Y C;  4QIW L;  3HOY C;  4XLN A;  1HI9 A;  4A3D K;  2XCQ A;  4P5B A;  5FJ8 K;  4A3B C;  2WAQ L;  4MQ9 A;  4ILD A;  3GTM K;  4A3C K;  3GTK A;  1O25 A;  1XZQ B;  3S1N K;  1JQW A;  3GSI A;  4DDQ A;  3PO3 K;  3GTO A;  3S2D K;  4A3J C;  1USM A;  3NUH A;  5C44 C;  4A3L C;  4YFX A;  5IP7 C;  3S1M K;  3G4C A;  4YG2 A;  2A68 A;  4X6A K;  2JA6 K;  1J98 A;  3H0G C;  3CQZ A;  4GTC A;  5JVO A;  4GTB A;  1VGX A;  4MEY A;  4KB4 A;  2NVX K;  4WJ4 A;  1EK8 A;  1EFW A;  4A3D C;  2R7Z K;  4LJZ A;  3S17 K;  4FZB A;  2YU9 K;  2CW0 A;  2ZFZ A;  3Q3Q A;  4KAR A;  4GTL A;  1J6X A;  4PAA A;  4A3C C;  4BBR C;  3TFH A;  2PA8 D;  4BKW A;  3L4J A;  4LLG A;  5IYD K;  1PJ6 A;  1WSR A;  3T01 A;  1O2A A;  2PMZ L;  3PO3 C;  4KMA A;  2B63 K;  1X31 C;  2FQO A;  2JA5 K;  2WAQ D;  4KB2 A;  1I3Q A;  3S2D C;  4LK1 A;  4BLB A;  2E2H A;  4Y52 K;  3S1M C;  1DCP A;  4A93 K;  3FKI A;  5IOS A;  4X6A C;  2JA6 C;  4YFN A;  1XXC A;  1IL2 A;  3GTM A;  3N0C A;  3ERE D;  3G4A A;  2R7Z C;  4WJ3 M;  3HOX C;  3S17 C;  5IYB C;  1EH1 A;  1JOE A;  2YU9 C;  4GTF A;  3A8K A;  5TMC A;  4A3I C;  4G7H A;  1ZYR A;  5IYD C;  4C3J K;  2A69 A;  3GTP C;  3GTK K;  4MEX A;  1WSV A;  1IS1 A;  4LK0 A;  1R9T K;  4PAB A;  3TTG A;  3GTJ A;  2JA5 C;  2NVX A;  5M5Y K;  4GFQ A;  4XSX A;  1RU0 A;  4BBS C;  2XCO A;  1F7U A;  4G0W A;  1PJ7 A;  4BY1 K;  4OIO A;  2PMZ D;  3K7A C;  4OIN A;  4A3M K;  3S16 K;  4KAS A;  3FOF A;  1I6V A;  4G7O A;  2PPB A;  1BJT A;  3GIR A;  4WIL A;  2B63 A;  1O29 A;  1O24 A;  4A3F K;  1Y1V K;  3HKZ L;  2NVT K;  2ZUE A;  3LAP A;  4KMH A;  4LR2 A;  1WOO A;  2ZUF A;  3GTK C;  1R9T C;  3S15 K;  4XCH A;  2Y0S L;  3I4M K;  4YFK A;  3H3V D;  3LPX A;  2JA8 K;  1I3Q K;  3VA7 A;  2E2H K; 
#chains in the Genus database with same CATH homology
 2NVY A;  3OEP A;  1XXA A;  1KQ4 A;  3CQZ A;  4GTC A;  5JVO A;  4GTB A;  1F9N A;  4KB4 A;  1B4A A;  1TWF A;  1EK8 A;  3GTL A;  1BGW A;  3BUE A;  4M1X A;  4FZB A;  2E2I A;  3V4G A;  1DD5 A;  5IOT A;  2ZFZ A;  3Q3Q A;  4BLA A;  1R9T A;  4KAR A;  4C3J C;  4GTL A;  4GTA A;  2KWA A;  4J3N A;  3LAJ A;  3N0B A;  4FM9 A;  1K83 A;  4KAW X;  4KM8 A;  4BKW A;  2CFA A;  1O2B A;  3L4J A;  3FHZ A;  2JA7 A;  1ZBS A;  3N3Y A;  4GTD A;  5CHP A;  1O2A A;  1ZVU A;  1TWC A;  1O27 A;  4KMA A;  2JH3 A;  1Y1W A;  2XCR B;  4KB2 A;  1I3Q A;  1XXB A;  5IOR A;  3AQP A;  5CJ9 A;  4BLB A;  4G0V A;  2E2H A;  2JA6 A;  4KM9 A;  3FKI A;  5IOS A;  2PHC B;  1I50 A;  3FOE A;  1XXC A;  5EGE A;  3GTM A;  2R7Z A;  1WQH A;  1Y1V A;  2P5M A;  2VUM A;  3N0C A;  2YU9 A;  3ERE D;  1WQF A;  3G4A A;  1B4B A;  1WQG A;  1WCM A;  1EH1 A;  4GT9 A;  4GTF A;  4KAT A;  3GTQ A;  2CFA B;  1TWG A;  3AQO A;  3AH5 A;  3GTP A;  3L4K A;  1ZXO A;  1O28 A;  2GSU A;  2R92 A;  3ORE A;  2JA5 A;  1TWA A;  1GE9 A;  1IS1 A;  1TWH A;  2Y3P A;  5TJ3 A;  3GTJ A;  5JFE A;  2NVX A;  4P5A A;  4C3I C;  2GSN A;  4GFQ A;  2RH6 A;  4KMD A;  2XCO A;  4GTE A;  4C3H C;  1ISE A;  4G0W A;  5EGH A;  2RGR A;  4C2M C;  3GTG A;  2XCQ A;  4P5B A;  4KC6 A;  3CAG A;  4KAS A;  3FOF A;  1O26 A;  3MML B;  3OPF A;  4LQY A;  4ILD A;  1BJT A;  2B63 A;  1O29 A;  1O24 A;  3GTK A;  1O25 A;  3S0X A;  4KDD A;  1AB4 A;  3LAP A;  4KMH A;  4LR2 A;  4DDQ A;  5IOQ A;  4G0U A;  3GTO A;  1SFO A;  3NUH A;  2R93 A;  2GSO A;  1WIH A;  3LPX A;  3H0G A;  3VA7 A;  3G4C A;  3QX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...