4BBSK

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbsK00
5C4XK 4AYBD 4A3DC 5C4XC 3HOVK 2PMZD 3HOVC 2E2HK 3PO2K 4NOIA 4AYBL 5M5WK 2E2HC 3WODA 4KMUA 3PO2C 3CQZK 2PMZL 1IW7A 4OIQA 3S1QK 5IYBK 4Q4ZA 4OINA 3HOWK 4Y52K 1Y1VK 5IYBC 4JK1A 4Y52C 3HOWC 4LK0A 1Y1VC 4QIWD 3FKIK 3I4NK 5FLMK 2R93C 4G7HA 2R93K 3I4NC 5FLMC 3S16K 1XPPA 1SMYA 3S16C 4QIWL 1SFOK 3S17C 4QJVA 1SFOC 1HQMA 3HOYK 3GTPK 4A3EK 4BXXK 3GTPC 3S1MK 3M4OK 3DXJA 4A3EC 3S1MC 4BXXC 1I6VA 4QJVB 3S2DK 3HOXK 3S2HK 5IYDK 4MEYA 3HOXC 3S2HC 3S2DC 2A6EA 5IYDC 5FJ8K 2R7ZK 2R7ZC 4X6AK 4GZYA 5M3FK 3GTKK 4YG2A 4OIOA 2VUMK 4A3GK 2VUMC 4A3GC 4C2MK 3GTJK 4A3LK 3CQZC 3GTJC 4XSZA 4A3LC 2NVQK 2WB1D 4A93K 3S1QC 4LLGA 4YFNA 1WCMK 2JA5K 3FKIC 2WB1L 1WCMC 2JA5C 4G7OA 2CW0A 4C3IK 2PPBA 4XSXA 5C3EK 4OIPA 4MEXA 5C3EC 4YFXA 4BY7K 4YFKA 3HOYC 4BY7C 4C3JK 3M4OC 4BBSK 3HKZD 5C44K 4G7ZA 5TMFA 3H0GK 4MQ9A 5C44C 2A6HA 4A3MK 1R9TK 3H0GC 2PA8D 4A3MC 2Y0SD 3RZDK 3GTMK 4A93C 3RZDC 1ZYRA 3HKZL 2NVYK 2B63K 3GTKC 3GTMC 2NVYC 4A3FK 2B63C 1BDFA 2PA8L 2Y0SL 5IP7K 4A3FC 3GTGK 3HOZK 5IP7C 3HOZC 3S14K 3S14C 2A69A 3GTGC 5M3MK 3PO3K 4ZH4A 4Q5SA 1I50K 1TWFK 5M5YK 2NVQC 1Y1WK 4KN7A 1I50C 1TWFC 3PO3C 2JA6K 1Y1WC 3K7AK 4A3JK 4OIRA 3I4MK 2JA7K 2JA6C 3K7AC 4A3JC 3I4MC 2JA7C 4A3BK 5C4JK 1YNNA 4A3BC 5C4JC 2R92K 2R92C 3S1RK 5TMCA 3S1RC 4XLPA 2YU9K 4Y7NK 4A3CK 4A3IK 4LJZA 2YU9C 4Y7NC 4BBSC 4A3CC 4A3IC 2NVXK 4BY1K 3H3VD 1YNJA 4BY1C 2NVXC 1TWAK 1TWAC 5M5XK 4C3HK 3H3VL 3GTOK 3GTOC 1I3QK 4KN4A 4XLNA 1I3QC 1R9TC 3GTQK 3GTQC 2JA8K 1TWGK 2WAQD 2JA8C 1TWHK 1TWGC 1I6HK 2O5IA 3GTLK 1TWHC 1I6HC 5D4DA 3GTLC 3S1NK 3S15K 2WAQL 2O5JA 4A3KK 3S17K 2NVTK 3S15C 3S1NC 3HOUK 1K83K 4A3KC 4LK1A 1TWCK 2NVTC 3HOUC 1K83C 4X6AC 1TWCC 2E2JK 2E2IK 2BE5A 5IP9K 4BBRK 2E2JC 2E2IC 5IP9C 4BBRC 5IYCK 3RZOK 3EQLA 5IYCC 3RZOC 3M3YK 3M3YC 2A68A 4A3DK
chains in the Genus database with same CATH superfamily
5JVOA 5M5WK 2XCQA 2PMZL 4OIQA 3S1QK 3HOWK 1KQ4A 3HOWC 2V6UA 4JK1A 4LK0A 4QIWD 3S16K 3S16C 1SFOK 4QJVA 3AH5A 1SFOC 1RU0A 4PAAA 3S1MK 3GDZA 3S1MC 2XCRB 4G0WA 1Y1WA 3S2HK 1WQFA 2JA6A 3S2HC 1O26A 5M3FK 3TFIA 1O29A 4KC6A 1XZQB 1EI6A 3BUEA 4GFQA 1USOA 3CQZC 2YU9A 2NVQK 4O2DA 1DCPA 1WCMK 3FKIC 2KWAA 1WCMC 1I3QA 4WJ3M 3TTGA 1J98A 3GTQA 3A8JA 1F7VA 2NVYA 1WQHA 4YFXA 4YFKA 3HOYC 3V4GA 3GTLA 4KM8A 4J3NA 1TWCA 4ILDA 3AD7C 3HKZD 5C44K 4G7ZA 4A3MK 5C44C 1R9TK 2E2IA 4A3MC 1JVIA 2Y0SD 3JSTA 4GT9A 3GSIA 3GTMK 3GTMC 3N0CA 2B63K 1B4BA 5E68A 2FQOA 2P8TA 2B63C 1DCHA 3GTGK 3GTGC 1WOPA 5CJ9A 2RH6A 1G51A 1Y1WK 2JA6K 1Y1WC 3K7AK 4OIRA 2JA6C 3K7AC 2E2HA 5C4JK 4BLAA 5C4JC 1IQ0A 4KDDA 1UV7A 3S1RK 3S1RC 1USMA 2YU9K 4G0UA 4A3IK 4GTBA 2YU9C 4WILA 4A3IC 5M5XK 2EBBA 1XZPA 3H3VL 1I3QK 1I3QC 3GTQK 3GTQC 2JA8K 2JA8C 3GTLK 4KB4A 3GTLC 3BP8C 2WAQL 1ZQ1C 4GTAA 4LK1A 1TWCK 1TWCC 4KATA 2E2IK 4BBRK 1PJ6A 3GTJA 2E2IC 1F93A 4BBRC 1F9NA 5IYCK 5IYCC 3BP3A 3A8IA 2A68A 4A3DK 4AYBD 4A3DC 2E2HK 4NOIA 2E2HC 2CFAA 4KMUA 3WODA 1IW7A 3VA7A 4Q4ZA 3HXAA 4Y52K 4Y52C 1X31C 4G7HA 1HI9A 1XPPA 1L0WA 4QIWL 3S17C 4LR2A 5EGHA 3ADAC 4QJVB 4GTLA 1TWFA 3S2DK 5JFEA 5IYDK 3S2DC 1V5VA 5IYDC 5FJ8K 3GEIA 4KAWX 1XXCA 3T02A 3GTKK 4OIOA 3ERED 3GTJK 3GTJC 4XSZA 2WB1D 3S1QC 4RMFA 1EH1A 1WQGA 1ISEA 2GSOA 1R9TA 1O2FB 3GTMA 2PPBA 4MEXA 4OIPA 5IOQA 2B63A 4C3JK 3GTGA 4C3JC 1EFWA 1IS1A 1O2AA 1GE9A 2PA8D 1PJ7A 3HKZL 1C0AA 1BJTA 3S14K 5IP7K 2Y0SL 3S14C 5IP7C 2PHCB 2GAGC 5M3MK 3PO3K 1IL2A 1TWFK 2NVQC 3PO3C 1TWFC 5CHPA 2V6TA 4A3BK 1ZXOA 4A3BC 1JOEA 2R92K 4WJ4A 1IE0A 2R92C 1Y1VA 5TJ3A 5TMCA 4XLPA 4Y7NK 4A3CK 4Y7NC 4A3CC 4BY1K 1EK8A 4BY1C 1VRQC 3LPXA 4KN4A 1R9TC 1XZPB 4KASA 1WORA 4KMDA 5D4DA 2R7ZA 3HOUK 1XXAA 3OEPA 3HOUC 2E2JK 2E2JC 3RZOK 1YCLA 2XCOA 3CAGA 5L46A 3RZOC 3NUHA 2V6SA 1WSVA 5C4XK 5C4XC 4GTCA 3PO2K 4AYBL 3PO2C 4XCHA 3LAJA 4C45A 4OINA 1Y1VK 2CFAB 1Y1VC 3I4NK 5FLMK 3I4NC 5FLMC 1IBAA 1F7UA 1SMYA 3GTKA 4KMAA 4BXXK 3M4OK 4BXXC 1I6VA 4MEYA 1WOOA 2R7ZK 1WOSA 2R7ZC 4GZYA 1O25A 4FZBA 3SZZA 1ZVUA 2D6FC 2VUMK 2VUMC 3T00A 4A3LK 1VH2A 4A3LC 4LLGA 2FQTA 2JH3A 1TWAA 2WB1L 4KMHA 4M1XA 2GSUA 3GTOA 4LQYA 2CW0A 4KB2A 4XSXA 5EGEA 3N0BA 4BY7K 4BY7C 1INNA 3GIRA 5IOSA 3L4JA 3T01A 1EQRA 1K83A 4BBSK 2W7VA 2P5MA 5TMFA 4MQ9A 4A93K 2A6HA 4BBSC 4A93C 1JQWA 3TFHA 3GTKC 2R92A 4BKWA 4A3FK 1DCOA 2GSNA 2PA8L 3HOZK 4A3FC 3HOZC 2A69A 2ZFZA 4ZH4A 4KN7A 3N3YA 1J6WA 4A3JK 2RGRA 4A3JC 1O2BA 5IORA 3SZYA 2Y3PA 2R93A 1TWAK 3AD8C 1TWAC 3GTOK 1DD5A 3GTOC 3GTPA 4XLNA 2ZUEA 1J6XA 1I6HK 1AB4A 2O5IA 1I6HC 3S1NK 3S15K 3S1NC 3S15C 4X6AK 1K83K 4X6AC 3FHZA 1K83C 4GTEA 2BE5A 5IP9K 5IP9C 3LAPA 3M3YK 3TFJA 3M3YC 2JA5A 3G4CA 3HOVK 4GTDA 4KARA 2PMZD 3HOVC 3CQZK 5IYBK 1VGXA 5IYBC 2R93K 1ZBSA 3FKIK 2R93C 1J6VA 3H0GA 3FOFA 2VUMA 1HQMA 1PJ5A 3HOYK 3GTPK 4A3EK 3MMLB 3GTPC 3DXJA 4A3EC 1I50A 1O28A 3HOXK 3HOXC 1XZQA 3A8KA 2A6EA 2JA7A 5IOTA 4YG2A 5HL8A 4A3GK 4A3GC 4C2MK 4C2MC 3OREA 2NVXA 4PABA 4YFNA 3AQPA 2JA5K 4P9SA 3GEHA 2JA5C 3GEEA 4G7OA 4C3IK 4AH6A 5C3EK 1XXBA 4C3IC 1TWGA 5C3EC 1TWHA 3S0XA 3M4OC 1VJEA 3QX3A 4P5BA 3H0GK 4G0VA 3H0GC 3RZDK 2ZUFA 3RZDC 1YX2A 1ZYRA 2NVYK 4KM9A 2NVYC 1VLOA 1BDFA 4Q5SA 1I50K 5M5YK 1BS2A 1I50C 3IPJA 3I4MK 3AQOA 2JA7K 3FOEA 3I4MC 2JA7C 4LOWA 2GAHC 1YNNA 3L4KA 3G4AA 1WSRA 4LJZA 4FM9A 3OPFA 2NVXK 3H3VD 1YNJA 2NVXC 1SFOA 4C3HK 4C3HC 1O27A 1WIHA 1TWGK 4BLBA 2WAQD 1TWHK 1TWGC 1TWHC 4GTFA 2O5JA 4A3KK 3AD9C 2NVTK 1B4AA 3S17K 4A3KC 2NVTC 1BGWA 3CQZA 3EQLA 4DDQA 3Q3QA 4P5AA 1O24A 3FKIA 1WCMA
chains in the Genus database with same CATH topology
5C4XK 4AYBD 4A3DC 5C4XC 3HOVK 2PMZD 3HOVC 2E2HK 3PO2K 4NOIA 4AYBL 5M5WK 2E2HC 3WODA 4KMUA 3PO2C 3CQZK 2PMZL 1IW7A 4OIQA 3S1QK 5IYBK 4Q4ZA 4OINA 3HOWK 4Y52K 1Y1VK 5IYBC 4JK1A 4Y52C 3HOWC 4LK0A 1Y1VC 4QIWD 3FKIK 3I4NK 5FLMK 2R93C 4G7HA 2R93K 3I4NC 5FLMC 3S16K 1XPPA 1SMYA 3S16C 4QIWL 1SFOK 3S17C 4QJVA 1SFOC 1HQMA 3HOYK 3GTPK 4A3EK 4BXXK 3GTPC 3S1MK 3M4OK 3DXJA 4A3EC 3S1MC 4BXXC 1I6VA 4QJVB 3S2DK 3HOXK 3S2HK 5IYDK 4MEYA 3HOXC 3S2HC 3S2DC 2A6EA 5IYDC 5FJ8K 2R7ZK 2R7ZC 4X6AK 4GZYA 5M3FK 3GTKK 4YG2A 4OIOA 2VUMK 4A3GK 2VUMC 4A3GC 4C2MK 3GTJK 4A3LK 3CQZC 3GTJC 4XSZA 4A3LC 2NVQK 2WB1D 4A93K 3S1QC 4LLGA 4YFNA 1WCMK 2JA5K 3FKIC 2WB1L 1WCMC 2JA5C 4G7OA 2CW0A 4C3IK 2PPBA 4XSXA 5C3EK 4OIPA 4MEXA 5C3EC 4YFXA 4BY7K 4YFKA 3HOYC 4BY7C 4C3JK 3M4OC 4BBSK 3HKZD 5C44K 4G7ZA 5TMFA 3H0GK 4MQ9A 5C44C 2A6HA 4A3MK 1R9TK 3H0GC 2PA8D 4A3MC 2Y0SD 3RZDK 3GTMK 4A93C 3RZDC 1ZYRA 3HKZL 2NVYK 2B63K 3GTKC 3GTMC 2NVYC 4A3FK 2B63C 1BDFA 2PA8L 2Y0SL 5IP7K 4A3FC 3GTGK 3HOZK 5IP7C 3HOZC 3S14K 3S14C 2A69A 3GTGC 5M3MK 3PO3K 4ZH4A 4Q5SA 1I50K 1TWFK 5M5YK 2NVQC 1Y1WK 4KN7A 1I50C 1TWFC 3PO3C 2JA6K 1Y1WC 3K7AK 4A3JK 4OIRA 3I4MK 2JA7K 2JA6C 3K7AC 4A3JC 3I4MC 2JA7C 4A3BK 5C4JK 1YNNA 4A3BC 5C4JC 2R92K 2R92C 3S1RK 5TMCA 3S1RC 4XLPA 2YU9K 4Y7NK 4A3CK 4A3IK 4LJZA 2YU9C 4Y7NC 4BBSC 4A3CC 4A3IC 2NVXK 4BY1K 3H3VD 1YNJA 4BY1C 2NVXC 1TWAK 1TWAC 5M5XK 4C3HK 3H3VL 3GTOK 3GTOC 1I3QK 4KN4A 4XLNA 1I3QC 1R9TC 3GTQK 3GTQC 2JA8K 1TWGK 2WAQD 2JA8C 1TWHK 1TWGC 1I6HK 2O5IA 3GTLK 1TWHC 1I6HC 5D4DA 3GTLC 3S1NK 3S15K 2WAQL 2O5JA 4A3KK 3S17K 2NVTK 3S15C 3S1NC 3HOUK 1K83K 4A3KC 4LK1A 1TWCK 2NVTC 3HOUC 1K83C 4X6AC 1TWCC 2E2JK 2E2IK 2BE5A 5IP9K 4BBRK 2E2JC 2E2IC 5IP9C 4BBRC 5IYCK 3RZOK 3EQLA 5IYCC 3RZOC 3M3YK 3M3YC 2A68A 4A3DK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X K;  4AYB D;  4A3D C;  5C4X C;  3HOV K;  2PMZ D;  3HOV C;  2E2H K;  3PO2 K;  4NOI A;  4AYB L;  5M5W K;  2E2H C;  3WOD A;  4KMU A;  3PO2 C;  3CQZ K;  2PMZ L;  1IW7 A;  4OIQ A;  3S1Q K;  5IYB K;  4Q4Z A;  4OIN A;  3HOW K;  4Y52 K;  1Y1V K;  5IYB C;  4JK1 A;  4Y52 C;  3HOW C;  4LK0 A;  1Y1V C;  4QIW D;  3FKI K;  3I4N K;  5FLM K;  2R93 C;  4G7H A;  2R93 K;  3I4N C;  5FLM C;  3S16 K;  1XPP A;  1SMY A;  3S16 C;  4QIW L;  1SFO K;  3S17 C;  4QJV A;  1SFO C;  1HQM A;  3HOY K;  3GTP K;  4A3E K;  4BXX K;  3GTP C;  3S1M K;  3M4O K;  3DXJ A;  4A3E C;  3S1M C;  4BXX C;  1I6V A;  4QJV B;  3S2D K;  3HOX K;  3S2H K;  5IYD K;  4MEY A;  3HOX C;  3S2H C;  3S2D C;  2A6E A;  5IYD C;  5FJ8 K;  2R7Z K;  2R7Z C;  4X6A K;  4GZY A;  5M3F K;  3GTK K;  4YG2 A;  4OIO A;  2VUM K;  4A3G K;  2VUM C;  4A3G C;  4C2M K;  3GTJ K;  4A3L K;  3CQZ C;  3GTJ C;  4XSZ A;  4A3L C;  2NVQ K;  2WB1 D;  4A93 K;  3S1Q C;  4LLG A;  4YFN A;  1WCM K;  2JA5 K;  3FKI C;  2WB1 L;  1WCM C;  2JA5 C;  4G7O A;  2CW0 A;  4C3I K;  2PPB A;  4XSX A;  5C3E K;  4OIP A;  4MEX A;  5C3E C;  4YFX A;  4BY7 K;  4YFK A;  3HOY C;  4BY7 C;  4C3J K;  3M4O C;  4BBS K;  3HKZ D;  5C44 K;  4G7Z A;  5TMF A;  3H0G K;  4MQ9 A;  5C44 C;  2A6H A;  4A3M K;  1R9T K;  3H0G C;  2PA8 D;  4A3M C;  2Y0S D;  3RZD K;  3GTM K;  4A93 C;  3RZD C;  1ZYR A;  3HKZ L;  2NVY K;  2B63 K;  3GTK C;  3GTM C;  2NVY C;  4A3F K;  2B63 C;  1BDF A;  2PA8 L;  2Y0S L;  5IP7 K;  4A3F C;  3GTG K;  3HOZ K;  5IP7 C;  3HOZ C;  3S14 K;  3S14 C;  2A69 A;  3GTG C;  5M3M K;  3PO3 K;  4ZH4 A;  4Q5S A;  1I50 K;  1TWF K;  5M5Y K;  2NVQ C;  1Y1W K;  4KN7 A;  1I50 C;  1TWF C;  3PO3 C;  2JA6 K;  1Y1W C;  3K7A K;  4A3J K;  4OIR A;  3I4M K;  2JA7 K;  2JA6 C;  3K7A C;  4A3J C;  3I4M C;  2JA7 C;  4A3B K;  5C4J K;  1YNN A;  4A3B C;  5C4J C;  2R92 K;  2R92 C;  3S1R K;  5TMC A;  3S1R C;  4XLP A;  2YU9 K;  4Y7N K;  4A3C K;  4A3I K;  4LJZ A;  2YU9 C;  4Y7N C;  4BBS C;  4A3C C;  4A3I C;  2NVX K;  4BY1 K;  3H3V D;  1YNJ A;  4BY1 C;  2NVX C;  1TWA K;  1TWA C;  5M5X K;  4C3H K;  3H3V L;  3GTO K;  3GTO C;  1I3Q K;  4KN4 A;  4XLN A;  1I3Q C;  1R9T C;  3GTQ K;  3GTQ C;  2JA8 K;  1TWG K;  2WAQ D;  2JA8 C;  1TWH K;  1TWG C;  1I6H K;  2O5I A;  3GTL K;  1TWH C;  1I6H C;  5D4D A;  3GTL C;  3S1N K;  3S15 K;  2WAQ L;  2O5J A;  4A3K K;  3S17 K;  2NVT K;  3S15 C;  3S1N C;  3HOU K;  1K83 K;  4A3K C;  4LK1 A;  1TWC K;  2NVT C;  3HOU C;  1K83 C;  4X6A C;  1TWC C;  2E2J K;  2E2I K;  2BE5 A;  5IP9 K;  4BBR K;  2E2J C;  2E2I C;  5IP9 C;  4BBR C;  5IYC K;  3RZO K;  3EQL A;  5IYC C;  3RZO C;  3M3Y K;  3M3Y C;  2A68 A;  4A3D K; 
#chains in the Genus database with same CATH topology
 5JVO A;  5M5W K;  2XCQ A;  2PMZ L;  4OIQ A;  3S1Q K;  3HOW K;  1KQ4 A;  3HOW C;  2V6U A;  4JK1 A;  4LK0 A;  4QIW D;  3S16 K;  3S16 C;  1SFO K;  4QJV A;  3AH5 A;  1SFO C;  1RU0 A;  4PAA A;  3S1M K;  3GDZ A;  3S1M C;  2XCR B;  4G0W A;  1Y1W A;  3S2H K;  1WQF A;  2JA6 A;  3S2H C;  1O26 A;  5M3F K;  3TFI A;  1O29 A;  4KC6 A;  1XZQ B;  1EI6 A;  3BUE A;  4GFQ A;  1USO A;  3CQZ C;  2YU9 A;  2NVQ K;  4O2D A;  1DCP A;  1WCM K;  3FKI C;  2KWA A;  1WCM C;  1I3Q A;  4WJ3 M;  3TTG A;  1J98 A;  3GTQ A;  3A8J A;  1F7V A;  2NVY A;  1WQH A;  4YFX A;  4YFK A;  3HOY C;  3V4G A;  3GTL A;  4KM8 A;  4J3N A;  1TWC A;  4ILD A;  3AD7 C;  3HKZ D;  5C44 K;  4G7Z A;  4A3M K;  5C44 C;  1R9T K;  2E2I A;  4A3M C;  1JVI A;  2Y0S D;  3JST A;  4GT9 A;  3GSI A;  3GTM K;  3GTM C;  3N0C A;  2B63 K;  1B4B A;  5E68 A;  2FQO A;  2P8T A;  2B63 C;  1DCH A;  3GTG K;  3GTG C;  1WOP A;  5CJ9 A;  2RH6 A;  1G51 A;  1Y1W K;  2JA6 K;  1Y1W C;  3K7A K;  4OIR A;  2JA6 C;  3K7A C;  2E2H A;  5C4J K;  4BLA A;  5C4J C;  1IQ0 A;  4KDD A;  1UV7 A;  3S1R K;  3S1R C;  1USM A;  2YU9 K;  4G0U A;  4A3I K;  4GTB A;  2YU9 C;  4WIL A;  4A3I C;  5M5X K;  2EBB A;  1XZP A;  3H3V L;  1I3Q K;  1I3Q C;  3GTQ K;  3GTQ C;  2JA8 K;  2JA8 C;  3GTL K;  4KB4 A;  3GTL C;  3BP8 C;  2WAQ L;  1ZQ1 C;  4GTA A;  4LK1 A;  1TWC K;  1TWC C;  4KAT A;  2E2I K;  4BBR K;  1PJ6 A;  3GTJ A;  2E2I C;  1F93 A;  4BBR C;  1F9N A;  5IYC K;  5IYC C;  3BP3 A;  3A8I A;  2A68 A;  4A3D K;  4AYB D;  4A3D C;  2E2H K;  4NOI A;  2E2H C;  2CFA A;  4KMU A;  3WOD A;  1IW7 A;  3VA7 A;  4Q4Z A;  3HXA A;  4Y52 K;  4Y52 C;  1X31 C;  4G7H A;  1HI9 A;  1XPP A;  1L0W A;  4QIW L;  3S17 C;  4LR2 A;  5EGH A;  3ADA C;  4QJV B;  4GTL A;  1TWF A;  3S2D K;  5JFE A;  5IYD K;  3S2D C;  1V5V A;  5IYD C;  5FJ8 K;  3GEI A;  4KAW X;  1XXC A;  3T02 A;  3GTK K;  4OIO A;  3ERE D;  3GTJ K;  3GTJ C;  4XSZ A;  2WB1 D;  3S1Q C;  4RMF A;  1EH1 A;  1WQG A;  1ISE A;  2GSO A;  1R9T A;  1O2F B;  3GTM A;  2PPB A;  4MEX A;  4OIP A;  5IOQ A;  2B63 A;  4C3J K;  3GTG A;  4C3J C;  1EFW A;  1IS1 A;  1O2A A;  1GE9 A;  2PA8 D;  1PJ7 A;  3HKZ L;  1C0A A;  1BJT A;  3S14 K;  5IP7 K;  2Y0S L;  3S14 C;  5IP7 C;  2PHC B;  2GAG C;  5M3M K;  3PO3 K;  1IL2 A;  1TWF K;  2NVQ C;  3PO3 C;  1TWF C;  5CHP A;  2V6T A;  4A3B K;  1ZXO A;  4A3B C;  1JOE A;  2R92 K;  4WJ4 A;  1IE0 A;  2R92 C;  1Y1V A;  5TJ3 A;  5TMC A;  4XLP A;  4Y7N K;  4A3C K;  4Y7N C;  4A3C C;  4BY1 K;  1EK8 A;  4BY1 C;  1VRQ C;  3LPX A;  4KN4 A;  1R9T C;  1XZP B;  4KAS A;  1WOR A;  4KMD A;  5D4D A;  2R7Z A;  3HOU K;  1XXA A;  3OEP A;  3HOU C;  2E2J K;  2E2J C;  3RZO K;  1YCL A;  2XCO A;  3CAG A;  5L46 A;  3RZO C;  3NUH A;  2V6S A;  1WSV A;  5C4X K;  5C4X C;  4GTC A;  3PO2 K;  4AYB L;  3PO2 C;  4XCH A;  3LAJ A;  4C45 A;  4OIN A;  1Y1V K;  2CFA B;  1Y1V C;  3I4N K;  5FLM K;  3I4N C;  5FLM C;  1IBA A;  1F7U A;  1SMY A;  3GTK A;  4KMA A;  4BXX K;  3M4O K;  4BXX C;  1I6V A;  4MEY A;  1WOO A;  2R7Z K;  1WOS A;  2R7Z C;  4GZY A;  1O25 A;  4FZB A;  3SZZ A;  1ZVU A;  2D6F C;  2VUM K;  2VUM C;  3T00 A;  4A3L K;  1VH2 A;  4A3L C;  4LLG A;  2FQT A;  2JH3 A;  1TWA A;  2WB1 L;  4KMH A;  4M1X A;  2GSU A;  3GTO A;  4LQY A;  2CW0 A;  4KB2 A;  4XSX A;  5EGE A;  3N0B A;  4BY7 K;  4BY7 C;  1INN A;  3GIR A;  5IOS A;  3L4J A;  3T01 A;  1EQR A;  1K83 A;  4BBS K;  2W7V A;  2P5M A;  5TMF A;  4MQ9 A;  4A93 K;  2A6H A;  4BBS C;  4A93 C;  1JQW A;  3TFH A;  3GTK C;  2R92 A;  4BKW A;  4A3F K;  1DCO A;  2GSN A;  2PA8 L;  3HOZ K;  4A3F C;  3HOZ C;  2A69 A;  2ZFZ A;  4ZH4 A;  4KN7 A;  3N3Y A;  1J6W A;  4A3J K;  2RGR A;  4A3J C;  1O2B A;  5IOR A;  3SZY A;  2Y3P A;  2R93 A;  1TWA K;  3AD8 C;  1TWA C;  3GTO K;  1DD5 A;  3GTO C;  3GTP A;  4XLN A;  2ZUE A;  1J6X A;  1I6H K;  1AB4 A;  2O5I A;  1I6H C;  3S1N K;  3S15 K;  3S1N C;  3S15 C;  4X6A K;  1K83 K;  4X6A C;  3FHZ A;  1K83 C;  4GTE A;  2BE5 A;  5IP9 K;  5IP9 C;  3LAP A;  3M3Y K;  3TFJ A;  3M3Y C;  2JA5 A;  3G4C A;  3HOV K;  4GTD A;  4KAR A;  2PMZ D;  3HOV C;  3CQZ K;  5IYB K;  1VGX A;  5IYB C;  2R93 K;  1ZBS A;  3FKI K;  2R93 C;  1J6V A;  3H0G A;  3FOF A;  2VUM A;  1HQM A;  1PJ5 A;  3HOY K;  3GTP K;  4A3E K;  3MML B;  3GTP C;  3DXJ A;  4A3E C;  1I50 A;  1O28 A;  3HOX K;  3HOX C;  1XZQ A;  3A8K A;  2A6E A;  2JA7 A;  5IOT A;  4YG2 A;  5HL8 A;  4A3G K;  4A3G C;  4C2M K;  4C2M C;  3ORE A;  2NVX A;  4PAB A;  4YFN A;  3AQP A;  2JA5 K;  4P9S A;  3GEH A;  2JA5 C;  3GEE A;  4G7O A;  4C3I K;  4AH6 A;  5C3E K;  1XXB A;  4C3I C;  1TWG A;  5C3E C;  1TWH A;  3S0X A;  3M4O C;  1VJE A;  3QX3 A;  4P5B A;  3H0G K;  4G0V A;  3H0G C;  3RZD K;  2ZUF A;  3RZD C;  1YX2 A;  1ZYR A;  2NVY K;  4KM9 A;  2NVY C;  1VLO A;  1BDF A;  4Q5S A;  1I50 K;  5M5Y K;  1BS2 A;  1I50 C;  3IPJ A;  3I4M K;  3AQO A;  2JA7 K;  3FOE A;  3I4M C;  2JA7 C;  4LOW A;  2GAH C;  1YNN A;  3L4K A;  3G4A A;  1WSR A;  4LJZ A;  4FM9 A;  3OPF A;  2NVX K;  3H3V D;  1YNJ A;  2NVX C;  1SFO A;  4C3H K;  4C3H C;  1O27 A;  1WIH A;  1TWG K;  4BLB A;  2WAQ D;  1TWH K;  1TWG C;  1TWH C;  4GTF A;  2O5J A;  4A3K K;  3AD9 C;  2NVT K;  1B4A A;  3S17 K;  4A3K C;  2NVT C;  1BGW A;  3CQZ A;  3EQL A;  4DDQ A;  3Q3Q A;  4P5A A;  1O24 A;  3FKI A;  1WCM A; 
#chains in the Genus database with same CATH homology
 5C4X K;  4AYB D;  4A3D C;  5C4X C;  3HOV K;  2PMZ D;  3HOV C;  2E2H K;  3PO2 K;  4NOI A;  4AYB L;  5M5W K;  2E2H C;  3WOD A;  4KMU A;  3PO2 C;  3CQZ K;  2PMZ L;  1IW7 A;  4OIQ A;  3S1Q K;  5IYB K;  4Q4Z A;  4OIN A;  3HOW K;  4Y52 K;  1Y1V K;  5IYB C;  4JK1 A;  4Y52 C;  3HOW C;  4LK0 A;  1Y1V C;  4QIW D;  3FKI K;  3I4N K;  5FLM K;  2R93 C;  4G7H A;  2R93 K;  3I4N C;  5FLM C;  3S16 K;  1XPP A;  1SMY A;  3S16 C;  4QIW L;  1SFO K;  3S17 C;  4QJV A;  1SFO C;  1HQM A;  3HOY K;  3GTP K;  4A3E K;  4BXX K;  3GTP C;  3S1M K;  3M4O K;  3DXJ A;  4A3E C;  3S1M C;  4BXX C;  1I6V A;  4QJV B;  3S2D K;  3HOX K;  3S2H K;  5IYD K;  4MEY A;  3HOX C;  3S2H C;  3S2D C;  2A6E A;  5IYD C;  5FJ8 K;  2R7Z K;  2R7Z C;  4X6A K;  4GZY A;  5M3F K;  3GTK K;  4YG2 A;  4OIO A;  2VUM K;  4A3G K;  2VUM C;  4A3G C;  4C2M K;  3GTJ K;  4A3L K;  3CQZ C;  3GTJ C;  4XSZ A;  4A3L C;  2NVQ K;  2WB1 D;  4A93 K;  3S1Q C;  4LLG A;  4YFN A;  1WCM K;  2JA5 K;  3FKI C;  2WB1 L;  1WCM C;  2JA5 C;  4G7O A;  2CW0 A;  4C3I K;  2PPB A;  4XSX A;  5C3E K;  4OIP A;  4MEX A;  5C3E C;  4YFX A;  4BY7 K;  4YFK A;  3HOY C;  4BY7 C;  4C3J K;  3M4O C;  4BBS K;  3HKZ D;  5C44 K;  4G7Z A;  5TMF A;  3H0G K;  4MQ9 A;  5C44 C;  2A6H A;  4A3M K;  1R9T K;  3H0G C;  2PA8 D;  4A3M C;  2Y0S D;  3RZD K;  3GTM K;  4A93 C;  3RZD C;  1ZYR A;  3HKZ L;  2NVY K;  2B63 K;  3GTK C;  3GTM C;  2NVY C;  4A3F K;  2B63 C;  1BDF A;  2PA8 L;  2Y0S L;  5IP7 K;  4A3F C;  3GTG K;  3HOZ K;  5IP7 C;  3HOZ C;  3S14 K;  3S14 C;  2A69 A;  3GTG C;  5M3M K;  3PO3 K;  4ZH4 A;  4Q5S A;  1I50 K;  1TWF K;  5M5Y K;  2NVQ C;  1Y1W K;  4KN7 A;  1I50 C;  1TWF C;  3PO3 C;  2JA6 K;  1Y1W C;  3K7A K;  4A3J K;  4OIR A;  3I4M K;  2JA7 K;  2JA6 C;  3K7A C;  4A3J C;  3I4M C;  2JA7 C;  4A3B K;  5C4J K;  1YNN A;  4A3B C;  5C4J C;  2R92 K;  2R92 C;  3S1R K;  5TMC A;  3S1R C;  4XLP A;  2YU9 K;  4Y7N K;  4A3C K;  4A3I K;  4LJZ A;  2YU9 C;  4Y7N C;  4BBS C;  4A3C C;  4A3I C;  2NVX K;  4BY1 K;  3H3V D;  1YNJ A;  4BY1 C;  2NVX C;  1TWA K;  1TWA C;  5M5X K;  4C3H K;  3H3V L;  3GTO K;  3GTO C;  1I3Q K;  4KN4 A;  4XLN A;  1I3Q C;  1R9T C;  3GTQ K;  3GTQ C;  2JA8 K;  1TWG K;  2WAQ D;  2JA8 C;  1TWH K;  1TWG C;  1I6H K;  2O5I A;  3GTL K;  1TWH C;  1I6H C;  5D4D A;  3GTL C;  3S1N K;  3S15 K;  2WAQ L;  2O5J A;  4A3K K;  3S17 K;  2NVT K;  3S15 C;  3S1N C;  3HOU K;  1K83 K;  4A3K C;  4LK1 A;  1TWC K;  2NVT C;  3HOU C;  1K83 C;  4X6A C;  1TWC C;  2E2J K;  2E2I K;  2BE5 A;  5IP9 K;  4BBR K;  2E2J C;  2E2I C;  5IP9 C;  4BBR C;  5IYC K;  3RZO K;  3EQL A;  5IYC C;  3RZO C;  3M3Y K;  3M3Y C;  2A68 A;  4A3D K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...