4BBSK

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbsK00
1ZYRA 3H3VL 3S2HK 2Y0SD 4LK0A 5D4DA 4G7OA 4XLNA 4A3DK 2R93C 2R7ZC 2WB1L 3HOZC 3HOWC 3PO3C 1TWFK 2E2JC 2A68A 4QIWL 2JA5K 4XSZA 3GTOC 3I4MC 3GTGC 3GTQK 4BBSC 4A3GK 2E2HK 4LK1A 4BY7K 2NVTC 3RZOK 5TMCA 5IYDK 5M5WK 2WB1D 2B63C 4A3EK 1TWGC 3H3VD 4C3IK 2YU9C 3I4MK 3GTPK 5IYCK 4Q4ZA 4BY7C 4Y7NC 3S1MK 3WODA 1TWHK 4C3JK 3GTJC 3RZDK 3RZOC 1I50C 2VUMC 5C4JK 3I4NC 1I6HK 1I6VA 5FLMK 4A3KC 3S1NK 1TWGK 3HOXK 1WCMC 4A3CK 4KMUA 4LLGA 4GZYA 4Q5SA 5IP9K 4A3JC 2PA8D 2JA6K 3M4OK 3GTJK 3RZDC 3HOVK 1R9TK 3S15C 4OIRA 4A3EC 3GTKK 2YU9K 1TWCK 1Y1VC 2PPBA 5IYBK 4AYBL 2JA7C 3HOWK 5C4XC 3GTLC 1TWHC 5M3MK 3I4NK 2R92C 3M4OC 1BDFA 1TWFC 2PMZD 2A6HA 4Y52C 5IP7C 1TWAK 2WAQL 1SFOK 3M3YK 1XPPA 4NOIA 4KN7A 5C3EK 5FJ8K 3S17C 5IYBC 4A3JK 2E2HC 3H0GK 3FKIC 3GTMK 3S14C 3S16C 3GTLK 1YNJA 4A3LC 2R92K 4OIOA 4YFKA 4AYBD 1TWAC 3GTKC 1YNNA 2B63K 3HOYC 3S2HC 2O5JA 4QJVB 3S17K 2NVYK 1HQMA 4A3BK 3CQZK 4A3LK 1SFOC 5C4JC 2Y0SL 4G7ZA 4ZH4A 2WAQD 1K83C 5C44K 2A6EA 3S1QK 3EQLA 5IP9C 4C2MK 2JA6C 2NVTK 3PO3K 4C3HK 4BXXC 4YFXA 5IYDC 2E2IK 3GTOK 3S2DC 5C4XK 4A3IK 2NVYC 5IYCC 1Y1WK 2JA8K 3PO2K 3CQZC 4A3DC 3HKZD 5M5YK 3K7AK 4X6AC 4BXXK 5IP7K 4BBRK 5TMFA 3DXJA 4QIWD 4A3MK 2CW0A 3S1QC 1WCMK 3GTPC 3HOZK 2R7ZK 2NVXC 4A3CC 3S14K 3S1MC 4OINA 4JK1A 3HKZL 2A69A 4QJVA 1I50K 2PA8L 4KN4A 2JA8C 2VUMK 3PO2C 4X6AK 3S1NC 3S2DK 3HOUK 2R93K 1TWCC 1Y1VK 2JA7K 4BY1K 2NVXK 4A93K 1I3QK 4A3FC 3K7AC 4G7HA 4A3BC 1R9TC 3S15K 4OIQA 4Y52K 4XLPA 5M5XK 4A3MC 1K83K 4LJZA 5C44C 3S1RK 3HOUC 5C3EC 4BY1C 4A93C 3FKIK 3GTMC 1IW7A 4Y7NK 2NVQK 4A3FK 4MQ9A 4MEXA 1I6HC 4OIPA 2E2IC 5M3FK 3M3YC 5FLMC 4A3KK 4MEYA 4YFNA 3HOYK 3HOXC 2PMZL 2JA5C 3S1RC 4YG2A 4A3IC 2BE5A 1SMYA 3H0GC 3GTGK 3GTQC 2O5IA 1I3QC 1Y1WC 3S16K 4BBSK 4A3GC 2NVQC 4XSXA 3HOVC 2E2JK 4BBRC
chains in the Genus database with same CATH superfamily
1ZYRA 4RMFA 2Y0SD 1TWAA 5D4DA 4C3IC 4KMAA 3HOZC 2WB1L 3HOWC 3GEIA 2JA5K 3I4MC 4KMDA 1USOA 4A3GK 4J3NA 1VRQC 3RZOK 5IYDK 3AQOA 1WSVA 3BUEA 4GTFA 3OREA 3GTPK 4Q4ZA 4GTAA 3I4NC 3GTJC 3RZDK 1IS1A 5C4JK 3ADAC 3S1NK 4BLAA 1G51A 4KMUA 4GZYA 2PA8D 2JA6K 2V6SA 2JA5A 3GTKK 2YU9K 4AYBL 3N0CA 3HOWK 1XXCA 3T01A 1J6WA 2R92C 2PMZD 2XCQA 4BLBA 3S0XA 1TWAK 2RH6A 3VA7A 5C3EK 5FJ8K 3H0GK 4A3LC 2NVYA 1XXAA 1WQHA 2Y3PA 2NVYK 4AH6A 1HQMA 2NVXA 5C4JC 4KDDA 2Y0SL 3NUHA 1K83A 5C44K 1USMA 2EBBA 3L4KA 2JA6C 4P5BA 1B4AA 4A3IK 2FQTA 1DCPA 1ZBSA 3CQZC 3HKZD 5M5YK 2CW0A 1WCMK 4WJ3M 2R7ZK 2GSOA 4FM9A 5IOQA 3PO2C 1I50K 1PJ5A 1WOPA 4P5AA 1IQ0A 2JA7K 4BY1K 2NVXK 4A3FC 3K7AC 2E2HA 1R9TC 2R7ZA 4Y52K 1WCMA 4XLPA 3T00A 5C44C 2PHCB 3OPFA 3FOEA 2V6UA 1PJ7A 1I6HC 4OIPA 5M3FK 3M3YC 3OEPA 4YFNA 3HOXC 4YG2A 4A3IC 3GTGK 4GTEA 2NVQC 3GTKA 1RU0A 2R93C 2R7ZC 1JQWA 3PO3C 1JOEA 4KASA 2A68A 4BBSC 3A8KA 2E2HK 2NVTC 3TFHA 5M5WK 2WB1D 2JA7A 5IYCK 4BY7C 1AB4A 3S1MK 3WODA 4C3JK 1I6HK 2ZFZA 4KM8A 1ZVUA 1TWGK 1F7UA 3HOXK 4G0UA 1DCHA 4A3JC 3ERED 1KQ4A 3AD7C 3S15C 4OIRA 4A3EC 2B63A 1TWCK 1Y1VC 1VGXA 4M1XA 5M3MK 1TWHC 1EK8A 2CFAA 3M4OC 5IP7C 3GTPA 2WAQL 4NOIA 1VH2A 1O26A 4KN7A 1O29A 3GDZA 3TFIA 2E2HC 3GTMK 1YNJA 4C2MC 4AYBD 1YNNA 3S2HC 3HOYC 2O5JA 1EI6A 2GAGC 4KAWX 2R92A 1I3QA 1J6XA 5HL8A 3H0GA 4A3BK 1EQRA 1SFOC 4ZH4A 3S1QK 1SFOA 1PJ6A 1BGWA 1ISEA 3CAGA 4YFXA 2ZUEA 1VJEA 2JA6A 3GTJA 2ZUFA 3PO2K 4BXXK 5IP7K 4BBRK 3AH5A 3HXAA 4QIWD 4A3CC 3GTPC 2NVXC 4P9SA 1TWHA 4JK1A 2JA8C 4A3DK 4KN4A 4X6AK 3S1NC 3N0BA 2GSNA 3S2DK 3IPJA 1DCOA 4WJ4A 4A3BC 2D6FC 3FHZA 1BJTA 4A3MC 4LJZA 2P8TA 1WOSA 3FKIK 1IW7A 4Y7NK 2NVQK 3GTQA 4LOWA 4MEYA 1WIHA 2JA5C 2R93K 2BE5A 3H0GC 1YX2A 4A3GC 1I3QC 1XZPB 3GTMA 4BBRC 3H3VL 4ILDA 4LK0A 4XLNA 4DDQA 5JFEA 1TWFK 1IE0A 2R93A 2V6TA 3FOFA 4QIWL 3GTOC 3LAJA 3GTGA 3GTQK 4LK1A 4BY7K 3N3YA 1WSRA 3G4AA 5TMCA 1Y1VA 4KARA 1V5VA 2B63C 1TWGC 3H3VD 4C3IK 2YU9C 1EFWA 4Y7NC 2P5MA 1INNA 2VUMC 4LQYA 3TTGA 4O2DA 1WCMC 1O27A 3SZZA 1F7VA 3T02A 3M4OK 1J6VA 3JSTA 2E2IA 2JA7C 5C4XC 2PPBA 3I4NK 1TWFC 1DD5A 4Y52C 4G0VA 3BP8C 5TJ3A 1O2BA 5IYBC 1YCLA 3S16C 3S14C 3GTLK 3BP3A 3A8IA 1TWCA 3G4CA 4PABA 3GTKC 2B63K 3V4GA 4QJVB 4GTDA 2GAHC 3S17K 3CQZK 5CHPA 2WAQD 1K83C 2A6EA 3LAPA 3PO3K 4BXXC 5IYDC 5C4XK 1R9TA 3TFJA 2NVYC 1I50A 1Y1WK 2JA8K 4A3DC 2RGRA 5E68A 3K7AK 4X6AC 1JVIA 5TMFA 3DXJA 5JVOA 4GTBA 3S14K 3S1MC 4OINA 3HKZL 2A69A 4QJVA 2CFAB 3GIRA 3CQZA 1B4BA 4G7HA 3S15K 5M5XK 1EH1A 1K83K 1XZQA 3HOUC 5IOTA 5C3EC 4A93C 3GTLA 5FLMC 4A3KK 5EGEA 2FQOA 2PMZL 3S1RC 4KMHA 4BBSK 4KB2A 2O5IA 5IOSA 1Y1WC 4XSXA 1WOOA 4KC6A 3HOVC 3S2HK 5CJ9A 4G7OA 1O2FB 1IBAA 2E2JC 3L4JA 4XSZA 1VLOA 3GTGC 1O2AA 1GE9A 3GEHA 3AD9C 1XZPA 1ZQ1C 4A3EK 3I4MK 3GSIA 1TWHK 1F93A 4GTLA 3RZOC 1I50C 1I6VA 5FLMK 4A3KC 4A3CK 4Q5SA 4LLGA 1ZXOA 5IP9K 1Y1WA 3GTJK 3RZDC 3HOVK 1R9TK 4PAAA 4BKWA 3MMLB 4C45A 5EGHA 1L0WA 5IYBK 2XCOA 1HI9A 3GTLC 4C3JC 2KWAA 1BDFA 2A6HA 1X31C 4KB4A 1SFOK 3M3YK 1WQGA 1XPPA 4GTCA 4LR2A 3S17C 4A3JK 3FKIC 2R92K 1O24A 4OIOA 3Q3QA 4YFKA 1TWAC 4KM9A 1IL2A 4A3LK 2W7VA 4G7ZA 5IORA 1BS2A 3EQLA 5IP9C 4G0WA 4C2MK 2NVTK 4C3HK 2E2IK 4KATA 3GTOK 3S2DC 1XXBA 1WORA 5L46A 2VUMA 5IYCC 3SZYA 3FKIA 2YU9A 1TWGA 4XCHA 4A3MK 3S1QC 1C0AA 3HOZK 2XCRB 2VUMK 2PA8L 4GT9A 3GEEA 3GTOA 1O28A 3HOUK 1UV7A 1TWCC 1Y1VK 4A93K 1J98A 4FZBA 1I3QK 3QX3A 4OIQA 1O25A 3S1RK 1XZQB 1TWFA 2JH3A 4BY1C 3AD8C 3GTMC 4A3FK 2GSUA 4MQ9A 4C3HC 4MEXA 2E2IC 1F9NA 4WILA 3HOYK 3A8JA 1SMYA 3S16K 3GTQC 3AQPA 3LPXA 1WQFA 2E2JK 4GFQA
chains in the Genus database with same CATH topology
1ZYRA 3H3VL 3S2HK 2Y0SD 4LK0A 5D4DA 4G7OA 4XLNA 4A3DK 2R93C 2R7ZC 2WB1L 3HOZC 3HOWC 3PO3C 1TWFK 2E2JC 2A68A 4QIWL 2JA5K 4XSZA 3GTOC 3I4MC 3GTGC 3GTQK 4BBSC 4A3GK 2E2HK 4LK1A 4BY7K 2NVTC 3RZOK 5TMCA 5IYDK 5M5WK 2WB1D 2B63C 4A3EK 1TWGC 3H3VD 4C3IK 2YU9C 3I4MK 3GTPK 5IYCK 4Q4ZA 4BY7C 4Y7NC 3S1MK 3WODA 1TWHK 4C3JK 3GTJC 3RZDK 3RZOC 1I50C 2VUMC 5C4JK 3I4NC 1I6HK 1I6VA 5FLMK 4A3KC 3S1NK 1TWGK 3HOXK 1WCMC 4A3CK 4KMUA 4LLGA 4GZYA 4Q5SA 5IP9K 4A3JC 2PA8D 2JA6K 3M4OK 3GTJK 3RZDC 3HOVK 1R9TK 3S15C 4OIRA 4A3EC 3GTKK 2YU9K 1TWCK 1Y1VC 2PPBA 5IYBK 4AYBL 2JA7C 3HOWK 5C4XC 3GTLC 1TWHC 5M3MK 3I4NK 2R92C 3M4OC 1BDFA 1TWFC 2PMZD 2A6HA 4Y52C 5IP7C 1TWAK 2WAQL 1SFOK 3M3YK 1XPPA 4NOIA 4KN7A 5C3EK 5FJ8K 3S17C 5IYBC 4A3JK 2E2HC 3H0GK 3FKIC 3GTMK 3S14C 3S16C 3GTLK 1YNJA 4A3LC 2R92K 4OIOA 4YFKA 4AYBD 1TWAC 3GTKC 1YNNA 2B63K 3HOYC 3S2HC 2O5JA 4QJVB 3S17K 2NVYK 1HQMA 4A3BK 3CQZK 4A3LK 1SFOC 5C4JC 2Y0SL 4G7ZA 4ZH4A 2WAQD 1K83C 5C44K 2A6EA 3S1QK 3EQLA 5IP9C 4C2MK 2JA6C 2NVTK 3PO3K 4C3HK 4BXXC 4YFXA 5IYDC 2E2IK 3GTOK 3S2DC 5C4XK 4A3IK 2NVYC 5IYCC 1Y1WK 2JA8K 3PO2K 3CQZC 4A3DC 3HKZD 5M5YK 3K7AK 4X6AC 4BXXK 5IP7K 4BBRK 5TMFA 3DXJA 4QIWD 4A3MK 2CW0A 3S1QC 1WCMK 3GTPC 3HOZK 2R7ZK 2NVXC 4A3CC 3S14K 3S1MC 4OINA 4JK1A 3HKZL 2A69A 4QJVA 1I50K 2PA8L 4KN4A 2JA8C 2VUMK 3PO2C 4X6AK 3S1NC 3S2DK 3HOUK 2R93K 1TWCC 1Y1VK 2JA7K 4BY1K 2NVXK 4A93K 1I3QK 4A3FC 3K7AC 4G7HA 4A3BC 1R9TC 3S15K 4OIQA 4Y52K 4XLPA 5M5XK 4A3MC 1K83K 4LJZA 5C44C 3S1RK 3HOUC 5C3EC 4BY1C 4A93C 3FKIK 3GTMC 1IW7A 4Y7NK 2NVQK 4A3FK 4MQ9A 4MEXA 1I6HC 4OIPA 2E2IC 5M3FK 3M3YC 5FLMC 4A3KK 4MEYA 4YFNA 3HOYK 3HOXC 2PMZL 2JA5C 3S1RC 4YG2A 4A3IC 2BE5A 1SMYA 3H0GC 3GTGK 3GTQC 2O5IA 1I3QC 1Y1WC 3S16K 4BBSK 4A3GC 2NVQC 4XSXA 3HOVC 2E2JK 4BBRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR A;  3H3V L;  3S2H K;  2Y0S D;  4LK0 A;  5D4D A;  4G7O A;  4XLN A;  4A3D K;  2R93 C;  2R7Z C;  2WB1 L;  3HOZ C;  3HOW C;  3PO3 C;  1TWF K;  2E2J C;  2A68 A;  4QIW L;  2JA5 K;  4XSZ A;  3GTO C;  3I4M C;  3GTG C;  3GTQ K;  4BBS C;  4A3G K;  2E2H K;  4LK1 A;  4BY7 K;  2NVT C;  3RZO K;  5TMC A;  5IYD K;  5M5W K;  2WB1 D;  2B63 C;  4A3E K;  1TWG C;  3H3V D;  4C3I K;  2YU9 C;  3I4M K;  3GTP K;  5IYC K;  4Q4Z A;  4BY7 C;  4Y7N C;  3S1M K;  3WOD A;  1TWH K;  4C3J K;  3GTJ C;  3RZD K;  3RZO C;  1I50 C;  2VUM C;  5C4J K;  3I4N C;  1I6H K;  1I6V A;  5FLM K;  4A3K C;  3S1N K;  1TWG K;  3HOX K;  1WCM C;  4A3C K;  4KMU A;  4LLG A;  4GZY A;  4Q5S A;  5IP9 K;  4A3J C;  2PA8 D;  2JA6 K;  3M4O K;  3GTJ K;  3RZD C;  3HOV K;  1R9T K;  3S15 C;  4OIR A;  4A3E C;  3GTK K;  2YU9 K;  1TWC K;  1Y1V C;  2PPB A;  5IYB K;  4AYB L;  2JA7 C;  3HOW K;  5C4X C;  3GTL C;  1TWH C;  5M3M K;  3I4N K;  2R92 C;  3M4O C;  1BDF A;  1TWF C;  2PMZ D;  2A6H A;  4Y52 C;  5IP7 C;  1TWA K;  2WAQ L;  1SFO K;  3M3Y K;  1XPP A;  4NOI A;  4KN7 A;  5C3E K;  5FJ8 K;  3S17 C;  5IYB C;  4A3J K;  2E2H C;  3H0G K;  3FKI C;  3GTM K;  3S14 C;  3S16 C;  3GTL K;  1YNJ A;  4A3L C;  2R92 K;  4OIO A;  4YFK A;  4AYB D;  1TWA C;  3GTK C;  1YNN A;  2B63 K;  3HOY C;  3S2H C;  2O5J A;  4QJV B;  3S17 K;  2NVY K;  1HQM A;  4A3B K;  3CQZ K;  4A3L K;  1SFO C;  5C4J C;  2Y0S L;  4G7Z A;  4ZH4 A;  2WAQ D;  1K83 C;  5C44 K;  2A6E A;  3S1Q K;  3EQL A;  5IP9 C;  4C2M K;  2JA6 C;  2NVT K;  3PO3 K;  4C3H K;  4BXX C;  4YFX A;  5IYD C;  2E2I K;  3GTO K;  3S2D C;  5C4X K;  4A3I K;  2NVY C;  5IYC C;  1Y1W K;  2JA8 K;  3PO2 K;  3CQZ C;  4A3D C;  3HKZ D;  5M5Y K;  3K7A K;  4X6A C;  4BXX K;  5IP7 K;  4BBR K;  5TMF A;  3DXJ A;  4QIW D;  4A3M K;  2CW0 A;  3S1Q C;  1WCM K;  3GTP C;  3HOZ K;  2R7Z K;  2NVX C;  4A3C C;  3S14 K;  3S1M C;  4OIN A;  4JK1 A;  3HKZ L;  2A69 A;  4QJV A;  1I50 K;  2PA8 L;  4KN4 A;  2JA8 C;  2VUM K;  3PO2 C;  4X6A K;  3S1N C;  3S2D K;  3HOU K;  2R93 K;  1TWC C;  1Y1V K;  2JA7 K;  4BY1 K;  2NVX K;  4A93 K;  1I3Q K;  4A3F C;  3K7A C;  4G7H A;  4A3B C;  1R9T C;  3S15 K;  4OIQ A;  4Y52 K;  4XLP A;  5M5X K;  4A3M C;  1K83 K;  4LJZ A;  5C44 C;  3S1R K;  3HOU C;  5C3E C;  4BY1 C;  4A93 C;  3FKI K;  3GTM C;  1IW7 A;  4Y7N K;  2NVQ K;  4A3F K;  4MQ9 A;  4MEX A;  1I6H C;  4OIP A;  2E2I C;  5M3F K;  3M3Y C;  5FLM C;  4A3K K;  4MEY A;  4YFN A;  3HOY K;  3HOX C;  2PMZ L;  2JA5 C;  3S1R C;  4YG2 A;  4A3I C;  2BE5 A;  1SMY A;  3H0G C;  3GTG K;  3GTQ C;  2O5I A;  1I3Q C;  1Y1W C;  3S16 K;  4BBS K;  4A3G C;  2NVQ C;  4XSX A;  3HOV C;  2E2J K;  4BBR C; 
#chains in the Genus database with same CATH topology
 1ZYR A;  4RMF A;  2Y0S D;  1TWA A;  5D4D A;  4C3I C;  4KMA A;  3HOZ C;  2WB1 L;  3HOW C;  3GEI A;  2JA5 K;  3I4M C;  4KMD A;  1USO A;  4A3G K;  4J3N A;  1VRQ C;  3RZO K;  5IYD K;  3AQO A;  1WSV A;  3BUE A;  4GTF A;  3ORE A;  3GTP K;  4Q4Z A;  4GTA A;  3I4N C;  3GTJ C;  3RZD K;  1IS1 A;  5C4J K;  3ADA C;  3S1N K;  4BLA A;  1G51 A;  4KMU A;  4GZY A;  2PA8 D;  2JA6 K;  2V6S A;  2JA5 A;  3GTK K;  2YU9 K;  4AYB L;  3N0C A;  3HOW K;  1XXC A;  3T01 A;  1J6W A;  2R92 C;  2PMZ D;  2XCQ A;  4BLB A;  3S0X A;  1TWA K;  2RH6 A;  3VA7 A;  5C3E K;  5FJ8 K;  3H0G K;  4A3L C;  2NVY A;  1XXA A;  1WQH A;  2Y3P A;  2NVY K;  4AH6 A;  1HQM A;  2NVX A;  5C4J C;  4KDD A;  2Y0S L;  3NUH A;  1K83 A;  5C44 K;  1USM A;  2EBB A;  3L4K A;  2JA6 C;  4P5B A;  1B4A A;  4A3I K;  2FQT A;  1DCP A;  1ZBS A;  3CQZ C;  3HKZ D;  5M5Y K;  2CW0 A;  1WCM K;  4WJ3 M;  2R7Z K;  2GSO A;  4FM9 A;  5IOQ A;  3PO2 C;  1I50 K;  1PJ5 A;  1WOP A;  4P5A A;  1IQ0 A;  2JA7 K;  4BY1 K;  2NVX K;  4A3F C;  3K7A C;  2E2H A;  1R9T C;  2R7Z A;  4Y52 K;  1WCM A;  4XLP A;  3T00 A;  5C44 C;  2PHC B;  3OPF A;  3FOE A;  2V6U A;  1PJ7 A;  1I6H C;  4OIP A;  5M3F K;  3M3Y C;  3OEP A;  4YFN A;  3HOX C;  4YG2 A;  4A3I C;  3GTG K;  4GTE A;  2NVQ C;  3GTK A;  1RU0 A;  2R93 C;  2R7Z C;  1JQW A;  3PO3 C;  1JOE A;  4KAS A;  2A68 A;  4BBS C;  3A8K A;  2E2H K;  2NVT C;  3TFH A;  5M5W K;  2WB1 D;  2JA7 A;  5IYC K;  4BY7 C;  1AB4 A;  3S1M K;  3WOD A;  4C3J K;  1I6H K;  2ZFZ A;  4KM8 A;  1ZVU A;  1TWG K;  1F7U A;  3HOX K;  4G0U A;  1DCH A;  4A3J C;  3ERE D;  1KQ4 A;  3AD7 C;  3S15 C;  4OIR A;  4A3E C;  2B63 A;  1TWC K;  1Y1V C;  1VGX A;  4M1X A;  5M3M K;  1TWH C;  1EK8 A;  2CFA A;  3M4O C;  5IP7 C;  3GTP A;  2WAQ L;  4NOI A;  1VH2 A;  1O26 A;  4KN7 A;  1O29 A;  3GDZ A;  3TFI A;  2E2H C;  3GTM K;  1YNJ A;  4C2M C;  4AYB D;  1YNN A;  3S2H C;  3HOY C;  2O5J A;  1EI6 A;  2GAG C;  4KAW X;  2R92 A;  1I3Q A;  1J6X A;  5HL8 A;  3H0G A;  4A3B K;  1EQR A;  1SFO C;  4ZH4 A;  3S1Q K;  1SFO A;  1PJ6 A;  1BGW A;  1ISE A;  3CAG A;  4YFX A;  2ZUE A;  1VJE A;  2JA6 A;  3GTJ A;  2ZUF A;  3PO2 K;  4BXX K;  5IP7 K;  4BBR K;  3AH5 A;  3HXA A;  4QIW D;  4A3C C;  3GTP C;  2NVX C;  4P9S A;  1TWH A;  4JK1 A;  2JA8 C;  4A3D K;  4KN4 A;  4X6A K;  3S1N C;  3N0B A;  2GSN A;  3S2D K;  3IPJ A;  1DCO A;  4WJ4 A;  4A3B C;  2D6F C;  3FHZ A;  1BJT A;  4A3M C;  4LJZ A;  2P8T A;  1WOS A;  3FKI K;  1IW7 A;  4Y7N K;  2NVQ K;  3GTQ A;  4LOW A;  4MEY A;  1WIH A;  2JA5 C;  2R93 K;  2BE5 A;  3H0G C;  1YX2 A;  4A3G C;  1I3Q C;  1XZP B;  3GTM A;  4BBR C;  3H3V L;  4ILD A;  4LK0 A;  4XLN A;  4DDQ A;  5JFE A;  1TWF K;  1IE0 A;  2R93 A;  2V6T A;  3FOF A;  4QIW L;  3GTO C;  3LAJ A;  3GTG A;  3GTQ K;  4LK1 A;  4BY7 K;  3N3Y A;  1WSR A;  3G4A A;  5TMC A;  1Y1V A;  4KAR A;  1V5V A;  2B63 C;  1TWG C;  3H3V D;  4C3I K;  2YU9 C;  1EFW A;  4Y7N C;  2P5M A;  1INN A;  2VUM C;  4LQY A;  3TTG A;  4O2D A;  1WCM C;  1O27 A;  3SZZ A;  1F7V A;  3T02 A;  3M4O K;  1J6V A;  3JST A;  2E2I A;  2JA7 C;  5C4X C;  2PPB A;  3I4N K;  1TWF C;  1DD5 A;  4Y52 C;  4G0V A;  3BP8 C;  5TJ3 A;  1O2B A;  5IYB C;  1YCL A;  3S16 C;  3S14 C;  3GTL K;  3BP3 A;  3A8I A;  1TWC A;  3G4C A;  4PAB A;  3GTK C;  2B63 K;  3V4G A;  4QJV B;  4GTD A;  2GAH C;  3S17 K;  3CQZ K;  5CHP A;  2WAQ D;  1K83 C;  2A6E A;  3LAP A;  3PO3 K;  4BXX C;  5IYD C;  5C4X K;  1R9T A;  3TFJ A;  2NVY C;  1I50 A;  1Y1W K;  2JA8 K;  4A3D C;  2RGR A;  5E68 A;  3K7A K;  4X6A C;  1JVI A;  5TMF A;  3DXJ A;  5JVO A;  4GTB A;  3S14 K;  3S1M C;  4OIN A;  3HKZ L;  2A69 A;  4QJV A;  2CFA B;  3GIR A;  3CQZ A;  1B4B A;  4G7H A;  3S15 K;  5M5X K;  1EH1 A;  1K83 K;  1XZQ A;  3HOU C;  5IOT A;  5C3E C;  4A93 C;  3GTL A;  5FLM C;  4A3K K;  5EGE A;  2FQO A;  2PMZ L;  3S1R C;  4KMH A;  4BBS K;  4KB2 A;  2O5I A;  5IOS A;  1Y1W C;  4XSX A;  1WOO A;  4KC6 A;  3HOV C;  3S2H K;  5CJ9 A;  4G7O A;  1O2F B;  1IBA A;  2E2J C;  3L4J A;  4XSZ A;  1VLO A;  3GTG C;  1O2A A;  1GE9 A;  3GEH A;  3AD9 C;  1XZP A;  1ZQ1 C;  4A3E K;  3I4M K;  3GSI A;  1TWH K;  1F93 A;  4GTL A;  3RZO C;  1I50 C;  1I6V A;  5FLM K;  4A3K C;  4A3C K;  4Q5S A;  4LLG A;  1ZXO A;  5IP9 K;  1Y1W A;  3GTJ K;  3RZD C;  3HOV K;  1R9T K;  4PAA A;  4BKW A;  3MML B;  4C45 A;  5EGH A;  1L0W A;  5IYB K;  2XCO A;  1HI9 A;  3GTL C;  4C3J C;  2KWA A;  1BDF A;  2A6H A;  1X31 C;  4KB4 A;  1SFO K;  3M3Y K;  1WQG A;  1XPP A;  4GTC A;  4LR2 A;  3S17 C;  4A3J K;  3FKI C;  2R92 K;  1O24 A;  4OIO A;  3Q3Q A;  4YFK A;  1TWA C;  4KM9 A;  1IL2 A;  4A3L K;  2W7V A;  4G7Z A;  5IOR A;  1BS2 A;  3EQL A;  5IP9 C;  4G0W A;  4C2M K;  2NVT K;  4C3H K;  2E2I K;  4KAT A;  3GTO K;  3S2D C;  1XXB A;  1WOR A;  5L46 A;  2VUM A;  5IYC C;  3SZY A;  3FKI A;  2YU9 A;  1TWG A;  4XCH A;  4A3M K;  3S1Q C;  1C0A A;  3HOZ K;  2XCR B;  2VUM K;  2PA8 L;  4GT9 A;  3GEE A;  3GTO A;  1O28 A;  3HOU K;  1UV7 A;  1TWC C;  1Y1V K;  4A93 K;  1J98 A;  4FZB A;  1I3Q K;  3QX3 A;  4OIQ A;  1O25 A;  3S1R K;  1XZQ B;  1TWF A;  2JH3 A;  4BY1 C;  3AD8 C;  3GTM C;  4A3F K;  2GSU A;  4MQ9 A;  4C3H C;  4MEX A;  2E2I C;  1F9N A;  4WIL A;  3HOY K;  3A8J A;  1SMY A;  3S16 K;  3GTQ C;  3AQP A;  3LPX A;  1WQF A;  2E2J K;  4GFQ A; 
#chains in the Genus database with same CATH homology
 1ZYR A;  3H3V L;  3S2H K;  2Y0S D;  4LK0 A;  5D4D A;  4G7O A;  4XLN A;  4A3D K;  2R93 C;  2R7Z C;  2WB1 L;  3HOZ C;  3HOW C;  3PO3 C;  1TWF K;  2E2J C;  2A68 A;  4QIW L;  2JA5 K;  4XSZ A;  3GTO C;  3I4M C;  3GTG C;  3GTQ K;  4BBS C;  4A3G K;  2E2H K;  4LK1 A;  4BY7 K;  2NVT C;  3RZO K;  5TMC A;  5IYD K;  5M5W K;  2WB1 D;  2B63 C;  4A3E K;  1TWG C;  3H3V D;  4C3I K;  2YU9 C;  3I4M K;  3GTP K;  5IYC K;  4Q4Z A;  4BY7 C;  4Y7N C;  3S1M K;  3WOD A;  1TWH K;  4C3J K;  3GTJ C;  3RZD K;  3RZO C;  1I50 C;  2VUM C;  5C4J K;  3I4N C;  1I6H K;  1I6V A;  5FLM K;  4A3K C;  3S1N K;  1TWG K;  3HOX K;  1WCM C;  4A3C K;  4KMU A;  4LLG A;  4GZY A;  4Q5S A;  5IP9 K;  4A3J C;  2PA8 D;  2JA6 K;  3M4O K;  3GTJ K;  3RZD C;  3HOV K;  1R9T K;  3S15 C;  4OIR A;  4A3E C;  3GTK K;  2YU9 K;  1TWC K;  1Y1V C;  2PPB A;  5IYB K;  4AYB L;  2JA7 C;  3HOW K;  5C4X C;  3GTL C;  1TWH C;  5M3M K;  3I4N K;  2R92 C;  3M4O C;  1BDF A;  1TWF C;  2PMZ D;  2A6H A;  4Y52 C;  5IP7 C;  1TWA K;  2WAQ L;  1SFO K;  3M3Y K;  1XPP A;  4NOI A;  4KN7 A;  5C3E K;  5FJ8 K;  3S17 C;  5IYB C;  4A3J K;  2E2H C;  3H0G K;  3FKI C;  3GTM K;  3S14 C;  3S16 C;  3GTL K;  1YNJ A;  4A3L C;  2R92 K;  4OIO A;  4YFK A;  4AYB D;  1TWA C;  3GTK C;  1YNN A;  2B63 K;  3HOY C;  3S2H C;  2O5J A;  4QJV B;  3S17 K;  2NVY K;  1HQM A;  4A3B K;  3CQZ K;  4A3L K;  1SFO C;  5C4J C;  2Y0S L;  4G7Z A;  4ZH4 A;  2WAQ D;  1K83 C;  5C44 K;  2A6E A;  3S1Q K;  3EQL A;  5IP9 C;  4C2M K;  2JA6 C;  2NVT K;  3PO3 K;  4C3H K;  4BXX C;  4YFX A;  5IYD C;  2E2I K;  3GTO K;  3S2D C;  5C4X K;  4A3I K;  2NVY C;  5IYC C;  1Y1W K;  2JA8 K;  3PO2 K;  3CQZ C;  4A3D C;  3HKZ D;  5M5Y K;  3K7A K;  4X6A C;  4BXX K;  5IP7 K;  4BBR K;  5TMF A;  3DXJ A;  4QIW D;  4A3M K;  2CW0 A;  3S1Q C;  1WCM K;  3GTP C;  3HOZ K;  2R7Z K;  2NVX C;  4A3C C;  3S14 K;  3S1M C;  4OIN A;  4JK1 A;  3HKZ L;  2A69 A;  4QJV A;  1I50 K;  2PA8 L;  4KN4 A;  2JA8 C;  2VUM K;  3PO2 C;  4X6A K;  3S1N C;  3S2D K;  3HOU K;  2R93 K;  1TWC C;  1Y1V K;  2JA7 K;  4BY1 K;  2NVX K;  4A93 K;  1I3Q K;  4A3F C;  3K7A C;  4G7H A;  4A3B C;  1R9T C;  3S15 K;  4OIQ A;  4Y52 K;  4XLP A;  5M5X K;  4A3M C;  1K83 K;  4LJZ A;  5C44 C;  3S1R K;  3HOU C;  5C3E C;  4BY1 C;  4A93 C;  3FKI K;  3GTM C;  1IW7 A;  4Y7N K;  2NVQ K;  4A3F K;  4MQ9 A;  4MEX A;  1I6H C;  4OIP A;  2E2I C;  5M3F K;  3M3Y C;  5FLM C;  4A3K K;  4MEY A;  4YFN A;  3HOY K;  3HOX C;  2PMZ L;  2JA5 C;  3S1R C;  4YG2 A;  4A3I C;  2BE5 A;  1SMY A;  3H0G C;  3GTG K;  3GTQ C;  2O5I A;  1I3Q C;  1Y1W C;  3S16 K;  4BBS K;  4A3G C;  2NVQ C;  4XSX A;  3HOV C;  2E2J K;  4BBR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...