4BBSK

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbsK00
2JA7K 3HOWC 3S16K 3I4NC 1IW7A 3S1MK 2A6EA 3HOYC 4OIQA 2VUMK 3PO2C 2JA5C 4OIRA 1I3QK 4Y7NK 4A3IK 4A3JK 4A3FC 3I4MC 2CW0A 3GTLC 1R9TC 1TWCC 4KN7A 4OIPA 4A3BC 2JA6C 4Y52K 4BXXC 3S15K 3GTPC 1ZYRA 4A3KK 1BDFA 2PA8D 4A3CK 3GTOC 2JA8K 3HOYK 2JA7C 3HOVK 3S16C 5M5WK 1HQMA 4OIOA 4G7ZA 2VUMC 1SMYA 4QJVA 2A69A 3GTGK 5M5XK 1I3QC 4Y7NC 4A3IC 4A3JC 3M3YK 1I6VA 5C4JK 2PA8L 1TWAK 4YG2A 2NVYK 2PMZD 2JA6K 3GTJK 4Y52C 3S15C 3H0GK 4LK0A 3GTMK 4A3KC 2Y0SL 4YFNA 5FJ8K 3S1NK 4A3CC 2JA8C 3S1QK 3HOVC 1TWFK 1Y1WK 2PMZL 2E2JK 4X6AK 3EQLA 2E2IK 3GTGC 5M3FK 4AYBD 3M3YC 5C4JC 4BY7K 2R93K 1TWAC 2YU9K 4A3GK 2NVYC 4MEYA 3GTJC 2E2HK 3S1RK 3H0GC 3GTMC 3S1NC 5IYCK 4AYBL 4BBSK 3S14K 3S1QC 5C44K 1TWFC 1Y1WC 1TWGK 5TMCA 2E2JC 4X6AC 3PO3K 4C2MK 2E2IC 3DXJA 4MEXA 3GTOK 4A3LK 1I6HK 2A68A 2NVQK 4BY7C 2R93C 2WAQD 2YU9C 4A3GC 2R7ZK 4XLNA 5C3EK 2E2HC 4NOIA 2NVXK 3S1RC 4OINA 3FKIC 1XPPA 5IYCC 4BBSC 4KN4A 3S14C 5C44C 1K83K 1TWGC 2WAQL 2WB1D 5C4XK 4BBRK 3PO3C 3H3VD 3HOXK 1YNJA 2NVTK 4A3LC 3GTKK 1I6HC 3RZDK 2BE5A 2NVQC 1YNNA 4ZH4A 5IYBK 4QJVB 2R7ZC 5C3EC 4G7HA 4G7OA 3HKZD 2WB1L 4Q5SA 4A3DK 2B63K 3K7AK 3FKIK 4MQ9A 4QIWD 3WODA 2NVXC 4XLPA 3CQZK 4A93K 1Y1VK 4LLGA 3HOUK 4BY1K 1K83C 4BXXK 5C4XC 4BBRC 3HKZL 2A6HA 5IP7K 2O5JA 3HOXC 2NVTC 3S2DK 3GTKC 4QIWL 5FLMK 4C3JK 5TMFA 4XSZA 3RZDC 2PPBA 2R92K 1TWHK 2O5IA 5IYBC 5D4DA 4XSXA 4A3DC 3S2HK 2B63C 3K7AC 1WCMK 5IP9C 3GTQK 3M4OK 3S17C 5IYDK 3CQZC 4A93C 1Y1VC 4A3MC 3RZOC 5M3MK 4A3EK 4YFKA 3HOUC 4YFXA 4BY1C 4JK1A 1I50K 4A3MK 3HOZK 1SFOK 4LJZA 3RZOK 5IP7C 3S17K 4KMUA 3HOWK 3I4NK 3S2DC 3PO2K 5FLMC 2R92C 2JA5K 1TWHC 4A3FK 2Y0SD 4C3IK 3I4MK 5IP9K 3H3VL 3GTLK 3S2HC 3M4OC 1WCMC 3GTQC 4C3HK 1TWCK 1R9TK 4A3BK 5IYDC 4GZYA 3GTPK 4A3EC 5M5YK 3S1MC 3HOZC 1I50C 4LK1A 1SFOC 4Q4ZA
chains in the Genus database with same CATH superfamily
1Y1WA 3I4NC 3FOFA 1O2BA 3HOYC 1BGWA 4AH6A 4KATA 4Y7NK 4A3FC 1I50C 4C3IC 5IOQA 1R9TC 2D6FC 2CFAA 4Y52K 3GTPC 4KC6A 1ZYRA 4A3KK 1BDFA 5CHPA 4KM9A 3GTOC 1HQMA 4G7ZA 3VA7A 2Y3PA 4Y7NC 3M3YK 1I6VA 1XXCA 2PA8L 2R7ZA 1TWAK 4GTFA 1DD5A 3GTJK 1UV7A 4Y52C 4A3KC 2Y0SL 3S1NK 2EBBA 2PMZL 4X6AK 1WIHA 4AYBD 3M3YC 4BY7K 3GEIA 2R93K 1XXAA 1TWAC 1PJ7A 3GTJC 2E2HK 3GTLA 3S1RK 1TWCA 2ZUFA 3S1NC 5IYCK 1XZPB 3TFIA 1WQHA 3TTGA 3JSTA 4X6AC 4MEXA 2R92A 1IS1A 4BY7C 2R93C 4XLNA 3BP3A 3OPFA 2E2HC 3S1RC 4OINA 4FZBA 5IYCC 4KN4A 5EGEA 2WAQL 4BBRK 1XXBA 3H3VD 3TFHA 3GTKK 2JA5A 3RZDK 1B4BA 1YNNA 4ZH4A 4G7OA 5EGHA 3AD7C 4QIWD 2JA6A 4BY1K 3N3YA 1WOPA 4BBRC 4WJ3M 3GTKC 4C3JK 4J3NA 1DCPA 3RZDC 2O5IA 3AQOA 3L4JA 3A8IA 3AD8C 1V5VA 4RMFA 1DCOA 4KMAA 4YFKA 4A3EK 4BY1C 3HOZK 4A3MK 1SFOK 4LJZA 3HOWK 3PO2K 4C3JC 3GTGA 2Y0SD 3GDZA 1IQ0A 1WSVA 4A3EC 3HOZC 4A3MC 1SFOC 3HOWC 1IW7A 1WSRA 3PO2C 2VUMK 2E2IA 4PAAA 4DDQA 5L46A 4G0WA 3BUEA 2CW0A 3T00A 4KN7A 3S15K 1J6XA 3FKIA 3N0CA 2FQTA 1DCHA 3HOYK 3HOVK 1TWGA 1XZQA 3ADAC 1ZVUA 2VUMC 5M5XK 2NVYK 1USMA 3S15C 4P5BA 1WQGA 5FJ8K 1O28A 3HOVC 1Y1WK 2E2JK 1I50A 3NUHA 3AH5A 1HI9A 4WILA 2NVYC 4C45A 3Q3QA 3CQZA 1O26A 4BBSK 3S14K 3AD9C 4KARA 1Y1WC 2E2JC 4KAWX 3PO3K 4C2MK 3GTOA 3DXJA 3T02A 4A3LK 1I6HK 2A68A 1TWHA 1ZXOA 2R7ZK 1WCMA 1F7UA 1XPPA 4BBSC 3S14C 1K83K 3PO3C 4C2MC 1I6HC 1YNJA 2NVTK 4A3LC 1WOOA 3GSIA 4QJVB 2R7ZC 4G7HA 2WB1L 4Q5SA 1YX2A 4A3DK 3WODA 1O25A 4XCHA 4XLPA 4PABA 4LLGA 1K83C 1F7VA 2JA7A 3HKZL 3CAGA 2NVTC 3G4AA 5FLMK 2R92K 4XSZA 1I3QA 4XSXA 4A3DC 2V6TA 3G4CA 3S1MK 4JK1A 4KMUA 2V6UA 5FLMC 2R92C 3LPXA 2KWAA 2JA5K 5IORA 4C3HK 4GTEA 3LAPA 3GTMA 3S1MC 4BLBA 4Q4ZA 2A6EA 1RU0A 4KMDA 2JA5C 2ZUEA 4OIRA 4A3IK 4A3JK 1VGXA 2YU9A 4C3HC 2JA6C 3HXAA 2PA8D 3A8JA 2JA8K 5M5WK 4OIOA 5JFEA 4QJVA 3GTGK 4A3IC 4A3JC 3BP8C 4GT9A 2XCRB 1J98A 3GEEA 4YG2A 2PMZD 1XZPA 3TFJA 1BS2A 1F9NA 2RGRA 4O2DA 3QX3A 3H0GK 4LK0A 4YFNA 3OREA 2W7VA 2JA8C 1TWFK 2CFAB 1ZQ1C 2E2IK 3GTGC 5M3FK 2P5MA 3SZYA 2GSOA 5JVOA 3AQPA 2B63A 3H0GC 1F93A 1Y1VA 4AYBL 4FM9A 5C44K 1TWFC 1TWGK 3LAJA 2E2IC 4GTCA 2NVQK 2VUMA 1IL2A 2WAQD 1X31C 5TJ3A 4M1XA 1WQFA 2XCQA 4LQYA 1O29A 3GTQA 4NOIA 2NVXK 3FKIC 5C44C 4GTAA 1TWGC 4GTLA 4KB4A 5C4XK 1C0AA 3HOXK 2NVQC 5IOTA 1JVIA 3GIRA 3K7AK 1R9TA 2NVXC 3CQZK 3GTPA 1J6WA 5C4XC 5IP7K 3HOXC 4QIWL 4BKWA 5TMFA 1TWHK 4GFQA 5D4DA 3K7AC 1WCMK 5IP9C 1L0WA 3T01A 3M4OK 4WJ4A 5IYDK 3CQZC 3IPJA 3RZOC 1EI6A 4YFXA 3ERED 5IP7C 2PHCB 1TWHC 1VJEA 3I4MK 1TWAA 3GTLK 3M4OC 1WCMC 3MMLB 3GTJA 1EQRA 1TWCK 4A3BK 5IYDC 1JOEA 4P5AA 4KDDA 4OIQA 4LK1A 2JA7K 3S16K 5HL8A 1K83A 1VRQC 4G0VA 1I3QK 1IBAA 2R93A 3I4MC 3GTLC 1O2FB 1EK8A 1TWCC 4OIPA 4A3BC 2E2HA 2V6SA 2JH3A 4A3CK 1ISEA 2JA7C 3S16C 4GTDA 1SMYA 2A69A 1I3QC 1O27A 5C4JK 4P9SA 1PJ5A 2JA6K 1ZBSA 2XCOA 3GTMK 4A3CC 3S1QK 1G51A 3V4GA 2FQOA 1O24A 2GAGC 3EQLA 3GTKA 5E68A 2GSNA 5C4JC 1XZQB 2YU9K 4A3GK 4MEYA 3SZZA 1KQ4A 5IOSA 3GTMC 3S1QC 5TMCA 3FHZA 2RH6A 2GSUA 4GTBA 4LOWA 2YU9C 4A3GC 3S0XA 5C3EK 1EFWA 3L4KA 1AB4A 1JQWA 1INNA 2ZFZA 1SFOA 2WB1D 3A8KA 3FOEA 2BE5A 4G0UA 5IYBK 5C3EC 4KASA 3HKZD 2B63K 3FKIK 4MQ9A 4A93K 1Y1VK 3HOUK 5CJ9A 1EH1A 3H0GA 4BXXK 2A6HA 4KM8A 2O5JA 1TWFA 2P8TA 3S2DK 1IE0A 4KB2A 2PPBA 1WOSA 1GE9A 5IYBC 1WORA 3GEHA 3S2HK 1O2AA 2B63C 3GTQK 3S17C 4ILDA 4KMHA 4A93C 1Y1VC 3N0BA 5M3MK 3HOUC 1J6VA 1I50K 3S17K 3RZOK 4BXXC 3I4NK 2GAHC 3S2DC 1YCLA 1B4AA 4A3FK 4C3IK 5IP9K 1VH2A 2NVYA 3H3VL 3S2HC 3GTQC 3OEPA 1R9TK 1PJ6A 4GZYA 1VLOA 3GTPK 5M5YK 2NVXA 1BJTA 4LR2A 4BLAA 3GTOK 1USOA
chains in the Genus database with same CATH topology
2JA7K 3HOWC 3S16K 3I4NC 1IW7A 3S1MK 2A6EA 3HOYC 4OIQA 2VUMK 3PO2C 2JA5C 4OIRA 1I3QK 4Y7NK 4A3IK 4A3JK 4A3FC 3I4MC 2CW0A 3GTLC 1R9TC 1TWCC 4KN7A 4OIPA 4A3BC 2JA6C 4Y52K 4BXXC 3S15K 3GTPC 1ZYRA 4A3KK 1BDFA 2PA8D 4A3CK 3GTOC 2JA8K 3HOYK 2JA7C 3HOVK 3S16C 5M5WK 1HQMA 4OIOA 4G7ZA 2VUMC 1SMYA 4QJVA 2A69A 3GTGK 5M5XK 1I3QC 4Y7NC 4A3IC 4A3JC 3M3YK 1I6VA 5C4JK 2PA8L 1TWAK 4YG2A 2NVYK 2PMZD 2JA6K 3GTJK 4Y52C 3S15C 3H0GK 4LK0A 3GTMK 4A3KC 2Y0SL 4YFNA 5FJ8K 3S1NK 4A3CC 2JA8C 3S1QK 3HOVC 1TWFK 1Y1WK 2PMZL 2E2JK 4X6AK 3EQLA 2E2IK 3GTGC 5M3FK 4AYBD 3M3YC 5C4JC 4BY7K 2R93K 1TWAC 2YU9K 4A3GK 2NVYC 4MEYA 3GTJC 2E2HK 3S1RK 3H0GC 3GTMC 3S1NC 5IYCK 4AYBL 4BBSK 3S14K 3S1QC 5C44K 1TWFC 1Y1WC 1TWGK 5TMCA 2E2JC 4X6AC 3PO3K 4C2MK 2E2IC 3DXJA 4MEXA 3GTOK 4A3LK 1I6HK 2A68A 2NVQK 4BY7C 2R93C 2WAQD 2YU9C 4A3GC 2R7ZK 4XLNA 5C3EK 2E2HC 4NOIA 2NVXK 3S1RC 4OINA 3FKIC 1XPPA 5IYCC 4BBSC 4KN4A 3S14C 5C44C 1K83K 1TWGC 2WAQL 2WB1D 5C4XK 4BBRK 3PO3C 3H3VD 3HOXK 1YNJA 2NVTK 4A3LC 3GTKK 1I6HC 3RZDK 2BE5A 2NVQC 1YNNA 4ZH4A 5IYBK 4QJVB 2R7ZC 5C3EC 4G7HA 4G7OA 3HKZD 2WB1L 4Q5SA 4A3DK 2B63K 3K7AK 3FKIK 4MQ9A 4QIWD 3WODA 2NVXC 4XLPA 3CQZK 4A93K 1Y1VK 4LLGA 3HOUK 4BY1K 1K83C 4BXXK 5C4XC 4BBRC 3HKZL 2A6HA 5IP7K 2O5JA 3HOXC 2NVTC 3S2DK 3GTKC 4QIWL 5FLMK 4C3JK 5TMFA 4XSZA 3RZDC 2PPBA 2R92K 1TWHK 2O5IA 5IYBC 5D4DA 4XSXA 4A3DC 3S2HK 2B63C 3K7AC 1WCMK 5IP9C 3GTQK 3M4OK 3S17C 5IYDK 3CQZC 4A93C 1Y1VC 4A3MC 3RZOC 5M3MK 4A3EK 4YFKA 3HOUC 4YFXA 4BY1C 4JK1A 1I50K 4A3MK 3HOZK 1SFOK 4LJZA 3RZOK 5IP7C 3S17K 4KMUA 3HOWK 3I4NK 3S2DC 3PO2K 5FLMC 2R92C 2JA5K 1TWHC 4A3FK 2Y0SD 4C3IK 3I4MK 5IP9K 3H3VL 3GTLK 3S2HC 3M4OC 1WCMC 3GTQC 4C3HK 1TWCK 1R9TK 4A3BK 5IYDC 4GZYA 3GTPK 4A3EC 5M5YK 3S1MC 3HOZC 1I50C 4LK1A 1SFOC 4Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 K;  3HOW C;  3S16 K;  3I4N C;  1IW7 A;  3S1M K;  2A6E A;  3HOY C;  4OIQ A;  2VUM K;  3PO2 C;  2JA5 C;  4OIR A;  1I3Q K;  4Y7N K;  4A3I K;  4A3J K;  4A3F C;  3I4M C;  2CW0 A;  3GTL C;  1R9T C;  1TWC C;  4KN7 A;  4OIP A;  4A3B C;  2JA6 C;  4Y52 K;  4BXX C;  3S15 K;  3GTP C;  1ZYR A;  4A3K K;  1BDF A;  2PA8 D;  4A3C K;  3GTO C;  2JA8 K;  3HOY K;  2JA7 C;  3HOV K;  3S16 C;  5M5W K;  1HQM A;  4OIO A;  4G7Z A;  2VUM C;  1SMY A;  4QJV A;  2A69 A;  3GTG K;  5M5X K;  1I3Q C;  4Y7N C;  4A3I C;  4A3J C;  3M3Y K;  1I6V A;  5C4J K;  2PA8 L;  1TWA K;  4YG2 A;  2NVY K;  2PMZ D;  2JA6 K;  3GTJ K;  4Y52 C;  3S15 C;  3H0G K;  4LK0 A;  3GTM K;  4A3K C;  2Y0S L;  4YFN A;  5FJ8 K;  3S1N K;  4A3C C;  2JA8 C;  3S1Q K;  3HOV C;  1TWF K;  1Y1W K;  2PMZ L;  2E2J K;  4X6A K;  3EQL A;  2E2I K;  3GTG C;  5M3F K;  4AYB D;  3M3Y C;  5C4J C;  4BY7 K;  2R93 K;  1TWA C;  2YU9 K;  4A3G K;  2NVY C;  4MEY A;  3GTJ C;  2E2H K;  3S1R K;  3H0G C;  3GTM C;  3S1N C;  5IYC K;  4AYB L;  4BBS K;  3S14 K;  3S1Q C;  5C44 K;  1TWF C;  1Y1W C;  1TWG K;  5TMC A;  2E2J C;  4X6A C;  3PO3 K;  4C2M K;  2E2I C;  3DXJ A;  4MEX A;  3GTO K;  4A3L K;  1I6H K;  2A68 A;  2NVQ K;  4BY7 C;  2R93 C;  2WAQ D;  2YU9 C;  4A3G C;  2R7Z K;  4XLN A;  5C3E K;  2E2H C;  4NOI A;  2NVX K;  3S1R C;  4OIN A;  3FKI C;  1XPP A;  5IYC C;  4BBS C;  4KN4 A;  3S14 C;  5C44 C;  1K83 K;  1TWG C;  2WAQ L;  2WB1 D;  5C4X K;  4BBR K;  3PO3 C;  3H3V D;  3HOX K;  1YNJ A;  2NVT K;  4A3L C;  3GTK K;  1I6H C;  3RZD K;  2BE5 A;  2NVQ C;  1YNN A;  4ZH4 A;  5IYB K;  4QJV B;  2R7Z C;  5C3E C;  4G7H A;  4G7O A;  3HKZ D;  2WB1 L;  4Q5S A;  4A3D K;  2B63 K;  3K7A K;  3FKI K;  4MQ9 A;  4QIW D;  3WOD A;  2NVX C;  4XLP A;  3CQZ K;  4A93 K;  1Y1V K;  4LLG A;  3HOU K;  4BY1 K;  1K83 C;  4BXX K;  5C4X C;  4BBR C;  3HKZ L;  2A6H A;  5IP7 K;  2O5J A;  3HOX C;  2NVT C;  3S2D K;  3GTK C;  4QIW L;  5FLM K;  4C3J K;  5TMF A;  4XSZ A;  3RZD C;  2PPB A;  2R92 K;  1TWH K;  2O5I A;  5IYB C;  5D4D A;  4XSX A;  4A3D C;  3S2H K;  2B63 C;  3K7A C;  1WCM K;  5IP9 C;  3GTQ K;  3M4O K;  3S17 C;  5IYD K;  3CQZ C;  4A93 C;  1Y1V C;  4A3M C;  3RZO C;  5M3M K;  4A3E K;  4YFK A;  3HOU C;  4YFX A;  4BY1 C;  4JK1 A;  1I50 K;  4A3M K;  3HOZ K;  1SFO K;  4LJZ A;  3RZO K;  5IP7 C;  3S17 K;  4KMU A;  3HOW K;  3I4N K;  3S2D C;  3PO2 K;  5FLM C;  2R92 C;  2JA5 K;  1TWH C;  4A3F K;  2Y0S D;  4C3I K;  3I4M K;  5IP9 K;  3H3V L;  3GTL K;  3S2H C;  3M4O C;  1WCM C;  3GTQ C;  4C3H K;  1TWC K;  1R9T K;  4A3B K;  5IYD C;  4GZY A;  3GTP K;  4A3E C;  5M5Y K;  3S1M C;  3HOZ C;  1I50 C;  4LK1 A;  1SFO C;  4Q4Z A; 
#chains in the Genus database with same CATH topology
 1Y1W A;  3I4N C;  3FOF A;  1O2B A;  3HOY C;  1BGW A;  4AH6 A;  4KAT A;  4Y7N K;  4A3F C;  1I50 C;  4C3I C;  5IOQ A;  1R9T C;  2D6F C;  2CFA A;  4Y52 K;  3GTP C;  4KC6 A;  1ZYR A;  4A3K K;  1BDF A;  5CHP A;  4KM9 A;  3GTO C;  1HQM A;  4G7Z A;  3VA7 A;  2Y3P A;  4Y7N C;  3M3Y K;  1I6V A;  1XXC A;  2PA8 L;  2R7Z A;  1TWA K;  4GTF A;  1DD5 A;  3GTJ K;  1UV7 A;  4Y52 C;  4A3K C;  2Y0S L;  3S1N K;  2EBB A;  2PMZ L;  4X6A K;  1WIH A;  4AYB D;  3M3Y C;  4BY7 K;  3GEI A;  2R93 K;  1XXA A;  1TWA C;  1PJ7 A;  3GTJ C;  2E2H K;  3GTL A;  3S1R K;  1TWC A;  2ZUF A;  3S1N C;  5IYC K;  1XZP B;  3TFI A;  1WQH A;  3TTG A;  3JST A;  4X6A C;  4MEX A;  2R92 A;  1IS1 A;  4BY7 C;  2R93 C;  4XLN A;  3BP3 A;  3OPF A;  2E2H C;  3S1R C;  4OIN A;  4FZB A;  5IYC C;  4KN4 A;  5EGE A;  2WAQ L;  4BBR K;  1XXB A;  3H3V D;  3TFH A;  3GTK K;  2JA5 A;  3RZD K;  1B4B A;  1YNN A;  4ZH4 A;  4G7O A;  5EGH A;  3AD7 C;  4QIW D;  2JA6 A;  4BY1 K;  3N3Y A;  1WOP A;  4BBR C;  4WJ3 M;  3GTK C;  4C3J K;  4J3N A;  1DCP A;  3RZD C;  2O5I A;  3AQO A;  3L4J A;  3A8I A;  3AD8 C;  1V5V A;  4RMF A;  1DCO A;  4KMA A;  4YFK A;  4A3E K;  4BY1 C;  3HOZ K;  4A3M K;  1SFO K;  4LJZ A;  3HOW K;  3PO2 K;  4C3J C;  3GTG A;  2Y0S D;  3GDZ A;  1IQ0 A;  1WSV A;  4A3E C;  3HOZ C;  4A3M C;  1SFO C;  3HOW C;  1IW7 A;  1WSR A;  3PO2 C;  2VUM K;  2E2I A;  4PAA A;  4DDQ A;  5L46 A;  4G0W A;  3BUE A;  2CW0 A;  3T00 A;  4KN7 A;  3S15 K;  1J6X A;  3FKI A;  3N0C A;  2FQT A;  1DCH A;  3HOY K;  3HOV K;  1TWG A;  1XZQ A;  3ADA C;  1ZVU A;  2VUM C;  5M5X K;  2NVY K;  1USM A;  3S15 C;  4P5B A;  1WQG A;  5FJ8 K;  1O28 A;  3HOV C;  1Y1W K;  2E2J K;  1I50 A;  3NUH A;  3AH5 A;  1HI9 A;  4WIL A;  2NVY C;  4C45 A;  3Q3Q A;  3CQZ A;  1O26 A;  4BBS K;  3S14 K;  3AD9 C;  4KAR A;  1Y1W C;  2E2J C;  4KAW X;  3PO3 K;  4C2M K;  3GTO A;  3DXJ A;  3T02 A;  4A3L K;  1I6H K;  2A68 A;  1TWH A;  1ZXO A;  2R7Z K;  1WCM A;  1F7U A;  1XPP A;  4BBS C;  3S14 C;  1K83 K;  3PO3 C;  4C2M C;  1I6H C;  1YNJ A;  2NVT K;  4A3L C;  1WOO A;  3GSI A;  4QJV B;  2R7Z C;  4G7H A;  2WB1 L;  4Q5S A;  1YX2 A;  4A3D K;  3WOD A;  1O25 A;  4XCH A;  4XLP A;  4PAB A;  4LLG A;  1K83 C;  1F7V A;  2JA7 A;  3HKZ L;  3CAG A;  2NVT C;  3G4A A;  5FLM K;  2R92 K;  4XSZ A;  1I3Q A;  4XSX A;  4A3D C;  2V6T A;  3G4C A;  3S1M K;  4JK1 A;  4KMU A;  2V6U A;  5FLM C;  2R92 C;  3LPX A;  2KWA A;  2JA5 K;  5IOR A;  4C3H K;  4GTE A;  3LAP A;  3GTM A;  3S1M C;  4BLB A;  4Q4Z A;  2A6E A;  1RU0 A;  4KMD A;  2JA5 C;  2ZUE A;  4OIR A;  4A3I K;  4A3J K;  1VGX A;  2YU9 A;  4C3H C;  2JA6 C;  3HXA A;  2PA8 D;  3A8J A;  2JA8 K;  5M5W K;  4OIO A;  5JFE A;  4QJV A;  3GTG K;  4A3I C;  4A3J C;  3BP8 C;  4GT9 A;  2XCR B;  1J98 A;  3GEE A;  4YG2 A;  2PMZ D;  1XZP A;  3TFJ A;  1BS2 A;  1F9N A;  2RGR A;  4O2D A;  3QX3 A;  3H0G K;  4LK0 A;  4YFN A;  3ORE A;  2W7V A;  2JA8 C;  1TWF K;  2CFA B;  1ZQ1 C;  2E2I K;  3GTG C;  5M3F K;  2P5M A;  3SZY A;  2GSO A;  5JVO A;  3AQP A;  2B63 A;  3H0G C;  1F93 A;  1Y1V A;  4AYB L;  4FM9 A;  5C44 K;  1TWF C;  1TWG K;  3LAJ A;  2E2I C;  4GTC A;  2NVQ K;  2VUM A;  1IL2 A;  2WAQ D;  1X31 C;  5TJ3 A;  4M1X A;  1WQF A;  2XCQ A;  4LQY A;  1O29 A;  3GTQ A;  4NOI A;  2NVX K;  3FKI C;  5C44 C;  4GTA A;  1TWG C;  4GTL A;  4KB4 A;  5C4X K;  1C0A A;  3HOX K;  2NVQ C;  5IOT A;  1JVI A;  3GIR A;  3K7A K;  1R9T A;  2NVX C;  3CQZ K;  3GTP A;  1J6W A;  5C4X C;  5IP7 K;  3HOX C;  4QIW L;  4BKW A;  5TMF A;  1TWH K;  4GFQ A;  5D4D A;  3K7A C;  1WCM K;  5IP9 C;  1L0W A;  3T01 A;  3M4O K;  4WJ4 A;  5IYD K;  3CQZ C;  3IPJ A;  3RZO C;  1EI6 A;  4YFX A;  3ERE D;  5IP7 C;  2PHC B;  1TWH C;  1VJE A;  3I4M K;  1TWA A;  3GTL K;  3M4O C;  1WCM C;  3MML B;  3GTJ A;  1EQR A;  1TWC K;  4A3B K;  5IYD C;  1JOE A;  4P5A A;  4KDD A;  4OIQ A;  4LK1 A;  2JA7 K;  3S16 K;  5HL8 A;  1K83 A;  1VRQ C;  4G0V A;  1I3Q K;  1IBA A;  2R93 A;  3I4M C;  3GTL C;  1O2F B;  1EK8 A;  1TWC C;  4OIP A;  4A3B C;  2E2H A;  2V6S A;  2JH3 A;  4A3C K;  1ISE A;  2JA7 C;  3S16 C;  4GTD A;  1SMY A;  2A69 A;  1I3Q C;  1O27 A;  5C4J K;  4P9S A;  1PJ5 A;  2JA6 K;  1ZBS A;  2XCO A;  3GTM K;  4A3C C;  3S1Q K;  1G51 A;  3V4G A;  2FQO A;  1O24 A;  2GAG C;  3EQL A;  3GTK A;  5E68 A;  2GSN A;  5C4J C;  1XZQ B;  2YU9 K;  4A3G K;  4MEY A;  3SZZ A;  1KQ4 A;  5IOS A;  3GTM C;  3S1Q C;  5TMC A;  3FHZ A;  2RH6 A;  2GSU A;  4GTB A;  4LOW A;  2YU9 C;  4A3G C;  3S0X A;  5C3E K;  1EFW A;  3L4K A;  1AB4 A;  1JQW A;  1INN A;  2ZFZ A;  1SFO A;  2WB1 D;  3A8K A;  3FOE A;  2BE5 A;  4G0U A;  5IYB K;  5C3E C;  4KAS A;  3HKZ D;  2B63 K;  3FKI K;  4MQ9 A;  4A93 K;  1Y1V K;  3HOU K;  5CJ9 A;  1EH1 A;  3H0G A;  4BXX K;  2A6H A;  4KM8 A;  2O5J A;  1TWF A;  2P8T A;  3S2D K;  1IE0 A;  4KB2 A;  2PPB A;  1WOS A;  1GE9 A;  5IYB C;  1WOR A;  3GEH A;  3S2H K;  1O2A A;  2B63 C;  3GTQ K;  3S17 C;  4ILD A;  4KMH A;  4A93 C;  1Y1V C;  3N0B A;  5M3M K;  3HOU C;  1J6V A;  1I50 K;  3S17 K;  3RZO K;  4BXX C;  3I4N K;  2GAH C;  3S2D C;  1YCL A;  1B4A A;  4A3F K;  4C3I K;  5IP9 K;  1VH2 A;  2NVY A;  3H3V L;  3S2H C;  3GTQ C;  3OEP A;  1R9T K;  1PJ6 A;  4GZY A;  1VLO A;  3GTP K;  5M5Y K;  2NVX A;  1BJT A;  4LR2 A;  4BLA A;  3GTO K;  1USO A; 
#chains in the Genus database with same CATH homology
 2JA7 K;  3HOW C;  3S16 K;  3I4N C;  1IW7 A;  3S1M K;  2A6E A;  3HOY C;  4OIQ A;  2VUM K;  3PO2 C;  2JA5 C;  4OIR A;  1I3Q K;  4Y7N K;  4A3I K;  4A3J K;  4A3F C;  3I4M C;  2CW0 A;  3GTL C;  1R9T C;  1TWC C;  4KN7 A;  4OIP A;  4A3B C;  2JA6 C;  4Y52 K;  4BXX C;  3S15 K;  3GTP C;  1ZYR A;  4A3K K;  1BDF A;  2PA8 D;  4A3C K;  3GTO C;  2JA8 K;  3HOY K;  2JA7 C;  3HOV K;  3S16 C;  5M5W K;  1HQM A;  4OIO A;  4G7Z A;  2VUM C;  1SMY A;  4QJV A;  2A69 A;  3GTG K;  5M5X K;  1I3Q C;  4Y7N C;  4A3I C;  4A3J C;  3M3Y K;  1I6V A;  5C4J K;  2PA8 L;  1TWA K;  4YG2 A;  2NVY K;  2PMZ D;  2JA6 K;  3GTJ K;  4Y52 C;  3S15 C;  3H0G K;  4LK0 A;  3GTM K;  4A3K C;  2Y0S L;  4YFN A;  5FJ8 K;  3S1N K;  4A3C C;  2JA8 C;  3S1Q K;  3HOV C;  1TWF K;  1Y1W K;  2PMZ L;  2E2J K;  4X6A K;  3EQL A;  2E2I K;  3GTG C;  5M3F K;  4AYB D;  3M3Y C;  5C4J C;  4BY7 K;  2R93 K;  1TWA C;  2YU9 K;  4A3G K;  2NVY C;  4MEY A;  3GTJ C;  2E2H K;  3S1R K;  3H0G C;  3GTM C;  3S1N C;  5IYC K;  4AYB L;  4BBS K;  3S14 K;  3S1Q C;  5C44 K;  1TWF C;  1Y1W C;  1TWG K;  5TMC A;  2E2J C;  4X6A C;  3PO3 K;  4C2M K;  2E2I C;  3DXJ A;  4MEX A;  3GTO K;  4A3L K;  1I6H K;  2A68 A;  2NVQ K;  4BY7 C;  2R93 C;  2WAQ D;  2YU9 C;  4A3G C;  2R7Z K;  4XLN A;  5C3E K;  2E2H C;  4NOI A;  2NVX K;  3S1R C;  4OIN A;  3FKI C;  1XPP A;  5IYC C;  4BBS C;  4KN4 A;  3S14 C;  5C44 C;  1K83 K;  1TWG C;  2WAQ L;  2WB1 D;  5C4X K;  4BBR K;  3PO3 C;  3H3V D;  3HOX K;  1YNJ A;  2NVT K;  4A3L C;  3GTK K;  1I6H C;  3RZD K;  2BE5 A;  2NVQ C;  1YNN A;  4ZH4 A;  5IYB K;  4QJV B;  2R7Z C;  5C3E C;  4G7H A;  4G7O A;  3HKZ D;  2WB1 L;  4Q5S A;  4A3D K;  2B63 K;  3K7A K;  3FKI K;  4MQ9 A;  4QIW D;  3WOD A;  2NVX C;  4XLP A;  3CQZ K;  4A93 K;  1Y1V K;  4LLG A;  3HOU K;  4BY1 K;  1K83 C;  4BXX K;  5C4X C;  4BBR C;  3HKZ L;  2A6H A;  5IP7 K;  2O5J A;  3HOX C;  2NVT C;  3S2D K;  3GTK C;  4QIW L;  5FLM K;  4C3J K;  5TMF A;  4XSZ A;  3RZD C;  2PPB A;  2R92 K;  1TWH K;  2O5I A;  5IYB C;  5D4D A;  4XSX A;  4A3D C;  3S2H K;  2B63 C;  3K7A C;  1WCM K;  5IP9 C;  3GTQ K;  3M4O K;  3S17 C;  5IYD K;  3CQZ C;  4A93 C;  1Y1V C;  4A3M C;  3RZO C;  5M3M K;  4A3E K;  4YFK A;  3HOU C;  4YFX A;  4BY1 C;  4JK1 A;  1I50 K;  4A3M K;  3HOZ K;  1SFO K;  4LJZ A;  3RZO K;  5IP7 C;  3S17 K;  4KMU A;  3HOW K;  3I4N K;  3S2D C;  3PO2 K;  5FLM C;  2R92 C;  2JA5 K;  1TWH C;  4A3F K;  2Y0S D;  4C3I K;  3I4M K;  5IP9 K;  3H3V L;  3GTL K;  3S2H C;  3M4O C;  1WCM C;  3GTQ C;  4C3H K;  1TWC K;  1R9T K;  4A3B K;  5IYD C;  4GZY A;  3GTP K;  4A3E C;  5M5Y K;  3S1M C;  3HOZ C;  1I50 C;  4LK1 A;  1SFO C;  4Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...