4BBSK

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbsK00
3M4OK 3H3VL 4LJZA 2BE5A 4A3JK 4A3MC 4Q4ZA 5IYCK 1SFOK 5C3EC 3HOZC 4A3GC 1TWCC 4Y7NK 3DXJA 4ZH4A 4BY1K 3S14C 2Y0SD 2JA7K 3S16C 5C4XC 4Y52C 5M5YK 3RZDK 3GTLC 4A93K 4OIPA 1I50C 3HOXC 1I50K 4BBRC 2YU9K 4G7ZA 2JA6C 1SMYA 4A3EK 2VUMC 1TWCK 4Y7NC 3S14K 5FLMK 4QIWD 3HOUC 3S17C 4A3LC 3S15C 2WAQD 4AYBD 3HKZL 5FLMC 2PPBA 3HOUK 4C3HK 5C4XK 5M3FK 4C3JK 1HQMA 4XSXA 2O5IA 2B63K 3GTQK 5IYBK 5IYDC 3CQZK 4A3KC 4A3KK 2JA8K 5C4JC 2NVXK 4OIOA 4A3FC 3HOYK 5M5XK 1R9TC 4OINA 2NVYK 4XSZA 1K83K 2E2IC 4BXXK 2R93K 3H3VD 4BXXC 1IW7A 1BDFA 4LLGA 2B63C 2PMZL 2WB1L 2CW0A 1TWGC 3HKZD 4A3IK 3S1RC 5C4JK 2NVXC 2JA8C 3PO3C 3S2HK 1Y1VC 3HOYC 3GTGC 1I3QK 4A3CK 3PO2C 5D4DA 2NVQK 3I4NK 4YFXA 1I3QC 4BY7K 4C3IK 2NVTC 4QJVA 5M3MK 4BY7C 2A6HA 5IP9K 3S1MC 3K7AK 3GTPK 2A69A 3S2DK 1XPPA 1TWAK 2E2JK 3I4MK 4XLNA 2JA7C 5TMCA 3RZOK 3PO3K 2A6EA 2PA8D 3S1NK 3S2HC 5M5WK 3GTGK 4A93C 4GZYA 4A3CC 4Q5SA 3FKIK 2R92K 2WB1D 2PMZD 5FJ8K 3HOXK 4LK0A 4C2MK 4BBRK 2JA5C 3HOVC 3HOVK 5C3EK 3HOZK 3S1MK 2A68A 5TMFA 4BY1C 1YNJA 1I6HC 3GTMK 5IYCC 1SFOC 1TWAC 3RZOC 3GTLK 2O5JA 1TWFC 3GTKC 5IYBC 3WODA 3GTJC 4KN7A 5IYDK 2R7ZC 1TWHK 3GTJK 4X6AK 3M4OC 4A3DC 3S17K 4A3LK 2JA6K 1I6HK 3GTMC 3H0GK 4A3EC 2VUMK 3H0GC 4LK1A 2E2IK 4MQ9A 5IP7C 3RZDC 3M3YK 4Y52K 4QJVB 5IP7K 4A3BC 3M3YC 4A3BK 1TWHC 2YU9C 4MEXA 3CQZC 4X6AC 1I6VA 4KN4A 1YNNA 2NVYC 2NVQC 4A3FK 5C44C 4JK1A 1R9TK 4OIRA 3GTOK 4G7OA 5C44K 3GTOC 4OIQA 2PA8L 4A3DK 5IP9C 3GTQC 3HOWK 3EQLA 4YFKA 3HOWC 4MEYA 2WAQL 4AYBL 1Y1VK 2Y0SL 1WCMK 3PO2K 1TWGK 4A3IC 3S1RK 2NVTK 3FKIC 2R92C 1Y1WC 3S1QC 2JA5K 4BBSK 1K83C 3K7AC 3GTPC 4BBSC 4A3JC 4A3MK 4A3GK 4NOIA 2E2JC 3I4MC 4YG2A 3S2DC 4KMUA 1WCMC 3S16K 1TWFK 1ZYRA 4YFNA 4XLPA 3GTKK 3I4NC 3S1NC 2E2HK 1Y1WK 3S15K 4QIWL 3S1QK 2R7ZK 2R93C 2E2HC 4G7HA
chains in the Genus database with same CATH superfamily
3M4OK 4A3DK 4A3MC 4A3GC 5C3EC 4KMDA 3HOZC 3DXJA 5CJ9A 4ZH4A 1F9NA 1WCMA 3RZDK 4OIPA 1PJ6A 4GTDA 4G7ZA 4LOWA 1YX2A 4GT9A 1SMYA 3S17C 5FLMK 3HOUC 3A8IA 3A8JA 4KATA 4GTBA 5M3FK 4PAAA 1VJEA 4C3JK 1HQMA 3FHZA 3AD8C 2CFAB 4XCHA 4P9SA 4KC6A 2V6UA 3GSIA 3GEEA 5M5XK 3HOYK 4OINA 2NVYK 4BXXK 1WQFA 4KARA 4BXXC 4GTEA 2CW0A 3HKZD 2JA8C 3PO3C 1ZXOA 1O2AA 4KB2A 3GTGC 2NVQK 4A3CK 2V6SA 4BY7K 2NVTC 5M3MK 4BY7C 1ZBSA 2A69A 2E2JK 3S2HC 1JQWA 3S1NK 1TWGA 5M5WK 4A93C 3HOXK 4WJ4A 4LK0A 4RMFA 1F7VA 1BGWA 3S1MK 2CFAA 2VUMA 2A68A 4BY1C 1I6HC 1O2BA 1O27A 1ISEA 3GTKC 1IE0A 5L46A 5IYBC 4KN7A 1J6VA 4X6AK 3GDZA 1XZQB 4O2DA 4LK1A 3GTQA 2E2IK 2B63A 4LQYA 3TFHA 4MEXA 2YU9A 4KN4A 1I3QA 1IQ0A 2NVQC 1JOEA 1WIHA 5C44K 1PJ5A 2PA8L 3N0BA 3EQLA 3HOWC 3AQOA 3SZZA 3S1QC 2JA5K 3T01A 1K83C 3K7AC 1USOA 4BBSC 1ZQ1C 3QX3A 4NOIA 1O28A 4FZBA 1O25A 4YG2A 4KMUA 4YFNA 1DCPA 2E2HK 3GTGA 4QIWL 2GAGC 4WILA 3H3VL 5IYCK 1BS2A 1SFOK 4Y7NK 4BY1K 2Y0SD 2JA7K 3L4JA 4Y52C 5M5YK 2ZUEA 1XZPB 2NVXA 3JSTA 5IOQA 4P5BA 3S14K 3N0CA 1SFOA 1J98A 1B4AA 4AYBD 4KDDA 3CQZK 5IOSA 2GSNA 3TFJA 3LPXA 2NVXK 4OIOA 1RU0A 2JA8K 4A3FC 3FKIA 4GTLA 4XSZA 1K83K 4GFQA 3VA7A 5EGHA 3LAJA 3H3VD 1BDFA 3ADAC 1EFWA 2B63C 1TWGC 4A3IK 5C4JK 3S2HK 1USMA 1Y1VC 3HOYC 3MMLB 1I3QC 1GE9A 4QJVA 2A6HA 4P5AA 3S1MC 3K7AK 1VGXA 1VRQC 1XPPA 1L0WA 1TWAK 3GTKA 5TMCA 1XXAA 2A6EA 2PA8D 3GTGK 4GZYA 4BKWA 4A3CC 2R92K 2WB1D 2PMZD 4BBRK 3A8KA 3HOVK 4GTFA 3HXAA 1WQGA 1XXBA 4ILDA 1DCOA 3GTMK 3CAGA 2P5MA 3GTLK 2O5JA 1VLOA 1TWFC 2FQTA 3GTJC 1KQ4A 4G0UA 1X31C 3ERED 1O2FB 4WJ3M 4A3LK 2JA6K 1I6HK 4A3EC 3BP8C 1PJ7A 4C3JC 4MQ9A 3M3YK 4QJVB 4A3BC 4A3BK 3AH5A 3CQZC 4X6AC 5EGEA 1O24A 4KAWX 2EBBA 1O29A 1XZPA 4OIQA 5IP9C 2V6TA 4YFKA 1DCHA 4AYBL 3T02A 2GSUA 4C3IC 1J6WA 1EK8A 3GTPA 1K83A 1V5VA 1INNA 3I4MC 3TTGA 1F93A 1TWFK 1ZYRA 3CQZA 1WSRA 3S15K 1Y1WK 2R93C 5IORA 3S15C 2R93K 3GTMA 4Q4ZA 3H0GA 3S14C 3T00A 5JVOA 4C3HC 3GTLC 4A93K 1TWHA 1I50C 5TJ3A 3HOXC 1EQRA 1I50K 2YU9K 2JA6A 2VUMC 1TWCK 4Y7NC 4A3LC 2WAQD 5FLMC 3HKZL 2PPBA 3HOUK 5C4XK 1JVIA 4XSXA 3GTQK 2O5IA 2B63K 5IYBK 1AB4A 1Y1VA 1F7UA 5C4JC 4GTCA 2R92A 2E2IC 1IW7A 2P8TA 1WORA 1C0AA 2NVXC 4J3NA 5CHPA 1IBAA 5D4DA 3I4NK 1WOSA 4C3IK 2RH6A 3S0XA 1WSVA 3I4MK 2JA7A 1TWFA 2XCRB 1XZQA 4Q5SA 3BP3A 3FKIK 2JA5C 4BLBA 3N3YA 2KWAA 5TMFA 1YNJA 1TWAC 3AD9C 3RZOC 3FOEA 1I50A 3WODA 2R7ZC 3GTMC 3H0GK 2VUMK 1TWAA 3H0GC 4Y52K 3L4KA 4KMHA 2W7VA 1EI6A 1TWHC 3OPFA 3OEPA 1WQHA 3Q3QA 3AQPA 5C44C 4OIRA 4G7OA 1YCLA 2GAHC 3HOWK 2FQOA 4MEYA 2WAQL 1Y1VK 1J6XA 2Y0SL 1WCMK 3GTJA 3PO2K 4FM9A 3NUHA 3FKIC 1Y1WC 3TFIA 4BBSK 1ZVUA 3GTPC 4A3MK 4A3GK 3GEIA 5IOTA 1VH2A 3GTKK 4XLPA 3S1NC 4PABA 2R7ZK 1R9TA 2E2HC 4G7HA 1IS1A 1BJTA 4LJZA 2BE5A 3G4CA 5JFEA 4A3JK 1TWCC 5E68A 4C45A 3S16C 5C4XC 3GTLA 3AD7C 4BBRC 3LAPA 2E2HA 3G4AA 2JA6C 4A3EK 3GTOA 4QIWD 2E2IA 4AH6A 1WOPA 5HL8A 4C3HK 1UV7A 1HI9A 5IYDC 4A3KC 4A3KK 2R93A 3GIRA 4G0VA 3GEHA 1R9TC 1G51A 2PHCB 4LLGA 2PMZL 2WB1L 1DD5A 2GSOA 3S1RC 4KM8A 1I3QK 3PO2C 4YFXA 5IP9K 3GTPK 3S2DK 4G0WA 3RZOK 4XLNA 4KM9A 2JA7C 3PO3K 5FJ8K 3HOVC 4C2MK 3OREA 2JA5A 2NVYA 1Y1WA 5C3EK 3HOZK 1B4BA 5IYCC 1SFOC 3BUEA 3V4GA 5IYDK 1TWHK 1EH1A 4BLAA 2R7ZA 3GTJK 2RGRA 3M4OC 2JH3A 4A3DC 3S17K 1O26A 1TWCA 5IP7C 3RZDC 5IP7K 3M3YC 4LR2A 4DDQA 1WOOA 2YU9C 2XCQA 1I6VA 4KMAA 1YNNA 3FOFA 2NVYC 2Y3PA 4A3FK 3GTOK 4JK1A 1R9TK 3GTOC 2XCOA 3GTQC 3SZYA 1TWGK 4A3IC 4KASA 3S1RK 2D6FC 2ZUFA 2NVTK 2R92C 4KB4A 3IPJA 4C2MC 4GTAA 4A3JC 2E2JC 4M1XA 3S2DC 1WCMC 3S16K 3I4NC 2ZFZA 3S1QK 1IL2A 1XXCA
chains in the Genus database with same CATH topology
3M4OK 3H3VL 4LJZA 2BE5A 4A3JK 4A3MC 4Q4ZA 5IYCK 1SFOK 5C3EC 3HOZC 4A3GC 1TWCC 4Y7NK 3DXJA 4ZH4A 4BY1K 3S14C 2Y0SD 2JA7K 3S16C 5C4XC 4Y52C 5M5YK 3RZDK 3GTLC 4A93K 4OIPA 1I50C 3HOXC 1I50K 4BBRC 2YU9K 4G7ZA 2JA6C 1SMYA 4A3EK 2VUMC 1TWCK 4Y7NC 3S14K 5FLMK 4QIWD 3HOUC 3S17C 4A3LC 3S15C 2WAQD 4AYBD 3HKZL 5FLMC 2PPBA 3HOUK 4C3HK 5C4XK 5M3FK 4C3JK 1HQMA 4XSXA 2O5IA 2B63K 3GTQK 5IYBK 5IYDC 3CQZK 4A3KC 4A3KK 2JA8K 5C4JC 2NVXK 4OIOA 4A3FC 3HOYK 5M5XK 1R9TC 4OINA 2NVYK 4XSZA 1K83K 2E2IC 4BXXK 2R93K 3H3VD 4BXXC 1IW7A 1BDFA 4LLGA 2B63C 2PMZL 2WB1L 2CW0A 1TWGC 3HKZD 4A3IK 3S1RC 5C4JK 2NVXC 2JA8C 3PO3C 3S2HK 1Y1VC 3HOYC 3GTGC 1I3QK 4A3CK 3PO2C 5D4DA 2NVQK 3I4NK 4YFXA 1I3QC 4BY7K 4C3IK 2NVTC 4QJVA 5M3MK 4BY7C 2A6HA 5IP9K 3S1MC 3K7AK 3GTPK 2A69A 3S2DK 1XPPA 1TWAK 2E2JK 3I4MK 4XLNA 2JA7C 5TMCA 3RZOK 3PO3K 2A6EA 2PA8D 3S1NK 3S2HC 5M5WK 3GTGK 4A93C 4GZYA 4A3CC 4Q5SA 3FKIK 2R92K 2WB1D 2PMZD 5FJ8K 3HOXK 4LK0A 4C2MK 4BBRK 2JA5C 3HOVC 3HOVK 5C3EK 3HOZK 3S1MK 2A68A 5TMFA 4BY1C 1YNJA 1I6HC 3GTMK 5IYCC 1SFOC 1TWAC 3RZOC 3GTLK 2O5JA 1TWFC 3GTKC 5IYBC 3WODA 3GTJC 4KN7A 5IYDK 2R7ZC 1TWHK 3GTJK 4X6AK 3M4OC 4A3DC 3S17K 4A3LK 2JA6K 1I6HK 3GTMC 3H0GK 4A3EC 2VUMK 3H0GC 4LK1A 2E2IK 4MQ9A 5IP7C 3RZDC 3M3YK 4Y52K 4QJVB 5IP7K 4A3BC 3M3YC 4A3BK 1TWHC 2YU9C 4MEXA 3CQZC 4X6AC 1I6VA 4KN4A 1YNNA 2NVYC 2NVQC 4A3FK 5C44C 4JK1A 1R9TK 4OIRA 3GTOK 4G7OA 5C44K 3GTOC 4OIQA 2PA8L 4A3DK 5IP9C 3GTQC 3HOWK 3EQLA 4YFKA 3HOWC 4MEYA 2WAQL 4AYBL 1Y1VK 2Y0SL 1WCMK 3PO2K 1TWGK 4A3IC 3S1RK 2NVTK 3FKIC 2R92C 1Y1WC 3S1QC 2JA5K 4BBSK 1K83C 3K7AC 3GTPC 4BBSC 4A3JC 4A3MK 4A3GK 4NOIA 2E2JC 3I4MC 4YG2A 3S2DC 4KMUA 1WCMC 3S16K 1TWFK 1ZYRA 4YFNA 4XLPA 3GTKK 3I4NC 3S1NC 2E2HK 1Y1WK 3S15K 4QIWL 3S1QK 2R7ZK 2R93C 2E2HC 4G7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  3H3V L;  4LJZ A;  2BE5 A;  4A3J K;  4A3M C;  4Q4Z A;  5IYC K;  1SFO K;  5C3E C;  3HOZ C;  4A3G C;  1TWC C;  4Y7N K;  3DXJ A;  4ZH4 A;  4BY1 K;  3S14 C;  2Y0S D;  2JA7 K;  3S16 C;  5C4X C;  4Y52 C;  5M5Y K;  3RZD K;  3GTL C;  4A93 K;  4OIP A;  1I50 C;  3HOX C;  1I50 K;  4BBR C;  2YU9 K;  4G7Z A;  2JA6 C;  1SMY A;  4A3E K;  2VUM C;  1TWC K;  4Y7N C;  3S14 K;  5FLM K;  4QIW D;  3HOU C;  3S17 C;  4A3L C;  3S15 C;  2WAQ D;  4AYB D;  3HKZ L;  5FLM C;  2PPB A;  3HOU K;  4C3H K;  5C4X K;  5M3F K;  4C3J K;  1HQM A;  4XSX A;  2O5I A;  2B63 K;  3GTQ K;  5IYB K;  5IYD C;  3CQZ K;  4A3K C;  4A3K K;  2JA8 K;  5C4J C;  2NVX K;  4OIO A;  4A3F C;  3HOY K;  5M5X K;  1R9T C;  4OIN A;  2NVY K;  4XSZ A;  1K83 K;  2E2I C;  4BXX K;  2R93 K;  3H3V D;  4BXX C;  1IW7 A;  1BDF A;  4LLG A;  2B63 C;  2PMZ L;  2WB1 L;  2CW0 A;  1TWG C;  3HKZ D;  4A3I K;  3S1R C;  5C4J K;  2NVX C;  2JA8 C;  3PO3 C;  3S2H K;  1Y1V C;  3HOY C;  3GTG C;  1I3Q K;  4A3C K;  3PO2 C;  5D4D A;  2NVQ K;  3I4N K;  4YFX A;  1I3Q C;  4BY7 K;  4C3I K;  2NVT C;  4QJV A;  5M3M K;  4BY7 C;  2A6H A;  5IP9 K;  3S1M C;  3K7A K;  3GTP K;  2A69 A;  3S2D K;  1XPP A;  1TWA K;  2E2J K;  3I4M K;  4XLN A;  2JA7 C;  5TMC A;  3RZO K;  3PO3 K;  2A6E A;  2PA8 D;  3S1N K;  3S2H C;  5M5W K;  3GTG K;  4A93 C;  4GZY A;  4A3C C;  4Q5S A;  3FKI K;  2R92 K;  2WB1 D;  2PMZ D;  5FJ8 K;  3HOX K;  4LK0 A;  4C2M K;  4BBR K;  2JA5 C;  3HOV C;  3HOV K;  5C3E K;  3HOZ K;  3S1M K;  2A68 A;  5TMF A;  4BY1 C;  1YNJ A;  1I6H C;  3GTM K;  5IYC C;  1SFO C;  1TWA C;  3RZO C;  3GTL K;  2O5J A;  1TWF C;  3GTK C;  5IYB C;  3WOD A;  3GTJ C;  4KN7 A;  5IYD K;  2R7Z C;  1TWH K;  3GTJ K;  4X6A K;  3M4O C;  4A3D C;  3S17 K;  4A3L K;  2JA6 K;  1I6H K;  3GTM C;  3H0G K;  4A3E C;  2VUM K;  3H0G C;  4LK1 A;  2E2I K;  4MQ9 A;  5IP7 C;  3RZD C;  3M3Y K;  4Y52 K;  4QJV B;  5IP7 K;  4A3B C;  3M3Y C;  4A3B K;  1TWH C;  2YU9 C;  4MEX A;  3CQZ C;  4X6A C;  1I6V A;  4KN4 A;  1YNN A;  2NVY C;  2NVQ C;  4A3F K;  5C44 C;  4JK1 A;  1R9T K;  4OIR A;  3GTO K;  4G7O A;  5C44 K;  3GTO C;  4OIQ A;  2PA8 L;  4A3D K;  5IP9 C;  3GTQ C;  3HOW K;  3EQL A;  4YFK A;  3HOW C;  4MEY A;  2WAQ L;  4AYB L;  1Y1V K;  2Y0S L;  1WCM K;  3PO2 K;  1TWG K;  4A3I C;  3S1R K;  2NVT K;  3FKI C;  2R92 C;  1Y1W C;  3S1Q C;  2JA5 K;  4BBS K;  1K83 C;  3K7A C;  3GTP C;  4BBS C;  4A3J C;  4A3M K;  4A3G K;  4NOI A;  2E2J C;  3I4M C;  4YG2 A;  3S2D C;  4KMU A;  1WCM C;  3S16 K;  1TWF K;  1ZYR A;  4YFN A;  4XLP A;  3GTK K;  3I4N C;  3S1N C;  2E2H K;  1Y1W K;  3S15 K;  4QIW L;  3S1Q K;  2R7Z K;  2R93 C;  2E2H C;  4G7H A; 
#chains in the Genus database with same CATH topology
 3M4O K;  4A3D K;  4A3M C;  4A3G C;  5C3E C;  4KMD A;  3HOZ C;  3DXJ A;  5CJ9 A;  4ZH4 A;  1F9N A;  1WCM A;  3RZD K;  4OIP A;  1PJ6 A;  4GTD A;  4G7Z A;  4LOW A;  1YX2 A;  4GT9 A;  1SMY A;  3S17 C;  5FLM K;  3HOU C;  3A8I A;  3A8J A;  4KAT A;  4GTB A;  5M3F K;  4PAA A;  1VJE A;  4C3J K;  1HQM A;  3FHZ A;  3AD8 C;  2CFA B;  4XCH A;  4P9S A;  4KC6 A;  2V6U A;  3GSI A;  3GEE A;  5M5X K;  3HOY K;  4OIN A;  2NVY K;  4BXX K;  1WQF A;  4KAR A;  4BXX C;  4GTE A;  2CW0 A;  3HKZ D;  2JA8 C;  3PO3 C;  1ZXO A;  1O2A A;  4KB2 A;  3GTG C;  2NVQ K;  4A3C K;  2V6S A;  4BY7 K;  2NVT C;  5M3M K;  4BY7 C;  1ZBS A;  2A69 A;  2E2J K;  3S2H C;  1JQW A;  3S1N K;  1TWG A;  5M5W K;  4A93 C;  3HOX K;  4WJ4 A;  4LK0 A;  4RMF A;  1F7V A;  1BGW A;  3S1M K;  2CFA A;  2VUM A;  2A68 A;  4BY1 C;  1I6H C;  1O2B A;  1O27 A;  1ISE A;  3GTK C;  1IE0 A;  5L46 A;  5IYB C;  4KN7 A;  1J6V A;  4X6A K;  3GDZ A;  1XZQ B;  4O2D A;  4LK1 A;  3GTQ A;  2E2I K;  2B63 A;  4LQY A;  3TFH A;  4MEX A;  2YU9 A;  4KN4 A;  1I3Q A;  1IQ0 A;  2NVQ C;  1JOE A;  1WIH A;  5C44 K;  1PJ5 A;  2PA8 L;  3N0B A;  3EQL A;  3HOW C;  3AQO A;  3SZZ A;  3S1Q C;  2JA5 K;  3T01 A;  1K83 C;  3K7A C;  1USO A;  4BBS C;  1ZQ1 C;  3QX3 A;  4NOI A;  1O28 A;  4FZB A;  1O25 A;  4YG2 A;  4KMU A;  4YFN A;  1DCP A;  2E2H K;  3GTG A;  4QIW L;  2GAG C;  4WIL A;  3H3V L;  5IYC K;  1BS2 A;  1SFO K;  4Y7N K;  4BY1 K;  2Y0S D;  2JA7 K;  3L4J A;  4Y52 C;  5M5Y K;  2ZUE A;  1XZP B;  2NVX A;  3JST A;  5IOQ A;  4P5B A;  3S14 K;  3N0C A;  1SFO A;  1J98 A;  1B4A A;  4AYB D;  4KDD A;  3CQZ K;  5IOS A;  2GSN A;  3TFJ A;  3LPX A;  2NVX K;  4OIO A;  1RU0 A;  2JA8 K;  4A3F C;  3FKI A;  4GTL A;  4XSZ A;  1K83 K;  4GFQ A;  3VA7 A;  5EGH A;  3LAJ A;  3H3V D;  1BDF A;  3ADA C;  1EFW A;  2B63 C;  1TWG C;  4A3I K;  5C4J K;  3S2H K;  1USM A;  1Y1V C;  3HOY C;  3MML B;  1I3Q C;  1GE9 A;  4QJV A;  2A6H A;  4P5A A;  3S1M C;  3K7A K;  1VGX A;  1VRQ C;  1XPP A;  1L0W A;  1TWA K;  3GTK A;  5TMC A;  1XXA A;  2A6E A;  2PA8 D;  3GTG K;  4GZY A;  4BKW A;  4A3C C;  2R92 K;  2WB1 D;  2PMZ D;  4BBR K;  3A8K A;  3HOV K;  4GTF A;  3HXA A;  1WQG A;  1XXB A;  4ILD A;  1DCO A;  3GTM K;  3CAG A;  2P5M A;  3GTL K;  2O5J A;  1VLO A;  1TWF C;  2FQT A;  3GTJ C;  1KQ4 A;  4G0U A;  1X31 C;  3ERE D;  1O2F B;  4WJ3 M;  4A3L K;  2JA6 K;  1I6H K;  4A3E C;  3BP8 C;  1PJ7 A;  4C3J C;  4MQ9 A;  3M3Y K;  4QJV B;  4A3B C;  4A3B K;  3AH5 A;  3CQZ C;  4X6A C;  5EGE A;  1O24 A;  4KAW X;  2EBB A;  1O29 A;  1XZP A;  4OIQ A;  5IP9 C;  2V6T A;  4YFK A;  1DCH A;  4AYB L;  3T02 A;  2GSU A;  4C3I C;  1J6W A;  1EK8 A;  3GTP A;  1K83 A;  1V5V A;  1INN A;  3I4M C;  3TTG A;  1F93 A;  1TWF K;  1ZYR A;  3CQZ A;  1WSR A;  3S15 K;  1Y1W K;  2R93 C;  5IOR A;  3S15 C;  2R93 K;  3GTM A;  4Q4Z A;  3H0G A;  3S14 C;  3T00 A;  5JVO A;  4C3H C;  3GTL C;  4A93 K;  1TWH A;  1I50 C;  5TJ3 A;  3HOX C;  1EQR A;  1I50 K;  2YU9 K;  2JA6 A;  2VUM C;  1TWC K;  4Y7N C;  4A3L C;  2WAQ D;  5FLM C;  3HKZ L;  2PPB A;  3HOU K;  5C4X K;  1JVI A;  4XSX A;  3GTQ K;  2O5I A;  2B63 K;  5IYB K;  1AB4 A;  1Y1V A;  1F7U A;  5C4J C;  4GTC A;  2R92 A;  2E2I C;  1IW7 A;  2P8T A;  1WOR A;  1C0A A;  2NVX C;  4J3N A;  5CHP A;  1IBA A;  5D4D A;  3I4N K;  1WOS A;  4C3I K;  2RH6 A;  3S0X A;  1WSV A;  3I4M K;  2JA7 A;  1TWF A;  2XCR B;  1XZQ A;  4Q5S A;  3BP3 A;  3FKI K;  2JA5 C;  4BLB A;  3N3Y A;  2KWA A;  5TMF A;  1YNJ A;  1TWA C;  3AD9 C;  3RZO C;  3FOE A;  1I50 A;  3WOD A;  2R7Z C;  3GTM C;  3H0G K;  2VUM K;  1TWA A;  3H0G C;  4Y52 K;  3L4K A;  4KMH A;  2W7V A;  1EI6 A;  1TWH C;  3OPF A;  3OEP A;  1WQH A;  3Q3Q A;  3AQP A;  5C44 C;  4OIR A;  4G7O A;  1YCL A;  2GAH C;  3HOW K;  2FQO A;  4MEY A;  2WAQ L;  1Y1V K;  1J6X A;  2Y0S L;  1WCM K;  3GTJ A;  3PO2 K;  4FM9 A;  3NUH A;  3FKI C;  1Y1W C;  3TFI A;  4BBS K;  1ZVU A;  3GTP C;  4A3M K;  4A3G K;  3GEI A;  5IOT A;  1VH2 A;  3GTK K;  4XLP A;  3S1N C;  4PAB A;  2R7Z K;  1R9T A;  2E2H C;  4G7H A;  1IS1 A;  1BJT A;  4LJZ A;  2BE5 A;  3G4C A;  5JFE A;  4A3J K;  1TWC C;  5E68 A;  4C45 A;  3S16 C;  5C4X C;  3GTL A;  3AD7 C;  4BBR C;  3LAP A;  2E2H A;  3G4A A;  2JA6 C;  4A3E K;  3GTO A;  4QIW D;  2E2I A;  4AH6 A;  1WOP A;  5HL8 A;  4C3H K;  1UV7 A;  1HI9 A;  5IYD C;  4A3K C;  4A3K K;  2R93 A;  3GIR A;  4G0V A;  3GEH A;  1R9T C;  1G51 A;  2PHC B;  4LLG A;  2PMZ L;  2WB1 L;  1DD5 A;  2GSO A;  3S1R C;  4KM8 A;  1I3Q K;  3PO2 C;  4YFX A;  5IP9 K;  3GTP K;  3S2D K;  4G0W A;  3RZO K;  4XLN A;  4KM9 A;  2JA7 C;  3PO3 K;  5FJ8 K;  3HOV C;  4C2M K;  3ORE A;  2JA5 A;  2NVY A;  1Y1W A;  5C3E K;  3HOZ K;  1B4B A;  5IYC C;  1SFO C;  3BUE A;  3V4G A;  5IYD K;  1TWH K;  1EH1 A;  4BLA A;  2R7Z A;  3GTJ K;  2RGR A;  3M4O C;  2JH3 A;  4A3D C;  3S17 K;  1O26 A;  1TWC A;  5IP7 C;  3RZD C;  5IP7 K;  3M3Y C;  4LR2 A;  4DDQ A;  1WOO A;  2YU9 C;  2XCQ A;  1I6V A;  4KMA A;  1YNN A;  3FOF A;  2NVY C;  2Y3P A;  4A3F K;  3GTO K;  4JK1 A;  1R9T K;  3GTO C;  2XCO A;  3GTQ C;  3SZY A;  1TWG K;  4A3I C;  4KAS A;  3S1R K;  2D6F C;  2ZUF A;  2NVT K;  2R92 C;  4KB4 A;  3IPJ A;  4C2M C;  4GTA A;  4A3J C;  2E2J C;  4M1X A;  3S2D C;  1WCM C;  3S16 K;  3I4N C;  2ZFZ A;  3S1Q K;  1IL2 A;  1XXC A; 
#chains in the Genus database with same CATH homology
 3M4O K;  3H3V L;  4LJZ A;  2BE5 A;  4A3J K;  4A3M C;  4Q4Z A;  5IYC K;  1SFO K;  5C3E C;  3HOZ C;  4A3G C;  1TWC C;  4Y7N K;  3DXJ A;  4ZH4 A;  4BY1 K;  3S14 C;  2Y0S D;  2JA7 K;  3S16 C;  5C4X C;  4Y52 C;  5M5Y K;  3RZD K;  3GTL C;  4A93 K;  4OIP A;  1I50 C;  3HOX C;  1I50 K;  4BBR C;  2YU9 K;  4G7Z A;  2JA6 C;  1SMY A;  4A3E K;  2VUM C;  1TWC K;  4Y7N C;  3S14 K;  5FLM K;  4QIW D;  3HOU C;  3S17 C;  4A3L C;  3S15 C;  2WAQ D;  4AYB D;  3HKZ L;  5FLM C;  2PPB A;  3HOU K;  4C3H K;  5C4X K;  5M3F K;  4C3J K;  1HQM A;  4XSX A;  2O5I A;  2B63 K;  3GTQ K;  5IYB K;  5IYD C;  3CQZ K;  4A3K C;  4A3K K;  2JA8 K;  5C4J C;  2NVX K;  4OIO A;  4A3F C;  3HOY K;  5M5X K;  1R9T C;  4OIN A;  2NVY K;  4XSZ A;  1K83 K;  2E2I C;  4BXX K;  2R93 K;  3H3V D;  4BXX C;  1IW7 A;  1BDF A;  4LLG A;  2B63 C;  2PMZ L;  2WB1 L;  2CW0 A;  1TWG C;  3HKZ D;  4A3I K;  3S1R C;  5C4J K;  2NVX C;  2JA8 C;  3PO3 C;  3S2H K;  1Y1V C;  3HOY C;  3GTG C;  1I3Q K;  4A3C K;  3PO2 C;  5D4D A;  2NVQ K;  3I4N K;  4YFX A;  1I3Q C;  4BY7 K;  4C3I K;  2NVT C;  4QJV A;  5M3M K;  4BY7 C;  2A6H A;  5IP9 K;  3S1M C;  3K7A K;  3GTP K;  2A69 A;  3S2D K;  1XPP A;  1TWA K;  2E2J K;  3I4M K;  4XLN A;  2JA7 C;  5TMC A;  3RZO K;  3PO3 K;  2A6E A;  2PA8 D;  3S1N K;  3S2H C;  5M5W K;  3GTG K;  4A93 C;  4GZY A;  4A3C C;  4Q5S A;  3FKI K;  2R92 K;  2WB1 D;  2PMZ D;  5FJ8 K;  3HOX K;  4LK0 A;  4C2M K;  4BBR K;  2JA5 C;  3HOV C;  3HOV K;  5C3E K;  3HOZ K;  3S1M K;  2A68 A;  5TMF A;  4BY1 C;  1YNJ A;  1I6H C;  3GTM K;  5IYC C;  1SFO C;  1TWA C;  3RZO C;  3GTL K;  2O5J A;  1TWF C;  3GTK C;  5IYB C;  3WOD A;  3GTJ C;  4KN7 A;  5IYD K;  2R7Z C;  1TWH K;  3GTJ K;  4X6A K;  3M4O C;  4A3D C;  3S17 K;  4A3L K;  2JA6 K;  1I6H K;  3GTM C;  3H0G K;  4A3E C;  2VUM K;  3H0G C;  4LK1 A;  2E2I K;  4MQ9 A;  5IP7 C;  3RZD C;  3M3Y K;  4Y52 K;  4QJV B;  5IP7 K;  4A3B C;  3M3Y C;  4A3B K;  1TWH C;  2YU9 C;  4MEX A;  3CQZ C;  4X6A C;  1I6V A;  4KN4 A;  1YNN A;  2NVY C;  2NVQ C;  4A3F K;  5C44 C;  4JK1 A;  1R9T K;  4OIR A;  3GTO K;  4G7O A;  5C44 K;  3GTO C;  4OIQ A;  2PA8 L;  4A3D K;  5IP9 C;  3GTQ C;  3HOW K;  3EQL A;  4YFK A;  3HOW C;  4MEY A;  2WAQ L;  4AYB L;  1Y1V K;  2Y0S L;  1WCM K;  3PO2 K;  1TWG K;  4A3I C;  3S1R K;  2NVT K;  3FKI C;  2R92 C;  1Y1W C;  3S1Q C;  2JA5 K;  4BBS K;  1K83 C;  3K7A C;  3GTP C;  4BBS C;  4A3J C;  4A3M K;  4A3G K;  4NOI A;  2E2J C;  3I4M C;  4YG2 A;  3S2D C;  4KMU A;  1WCM C;  3S16 K;  1TWF K;  1ZYR A;  4YFN A;  4XLP A;  3GTK K;  3I4N C;  3S1N C;  2E2H K;  1Y1W K;  3S15 K;  4QIW L;  3S1Q K;  2R7Z K;  2R93 C;  2E2H C;  4G7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...