4BBSK

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbsK00
1K83C 4A3KC 4A3MC 5M3MK 2NVXK 1K83K 4A3KK 2Y0SD 5TMFA 4A3MK 1Y1WC 3GTGC 3I4NC 4LK1A 3GTGK 5FJ8K 3HOVK 3PO3K 4OIRA 2VUMC 3S2DC 5TMCA 2A68A 2VUMK 3S2DK 3S17C 5IP7C 2Y0SL 1TWGC 4YFNA 2PMZD 5IYDC 2R7ZC 3RZDK 3S14C 1TWGK 1TWFK 4MEYA 2PA8D 3EQLA 2R7ZK 2JA5K 3S14K 5IYDK 4OIOA 5C4XC 1YNNA 4QJVA 5C4JC 4JK1A 4LJZA 2NVYC 5C4XK 1R9TC 2PMZL 5C4JK 3GTKK 2NVYK 4A3EC 1R9TK 3S1NC 1I6HC 4C3JK 2PA8L 4A3EK 3S1NK 1I6HK 2O5IA 5IYCC 2YU9C 1SFOC 3PO2C 5M5WK 4C2MK 3S15K 5IYCK 4C3IK 1SFOK 2YU9K 4NOIA 2B63C 3PO2K 4BBSC 2B63K 4BBSK 4C3HK 4MQ9A 5C44C 4MEXA 4G7OA 5C44K 1BDFA 3S1RC 1Y1WK 5C3EC 1SMYA 4G7ZA 2NVQC 3I4NK 3I4MC 4AYBD 3S1RK 2JA7C 3DXJA 3S16C 2NVQK 3GTQC 3I4MK 2R93C 5IYBC 3S16K 1I3QC 2JA7K 3HOZC 4A93C 3GTQK 4Q5SA 4XLPA 4GZYA 5IYBK 1I6VA 1I3QK 4XSZA 3S17K 4A93K 5IP7K 4AYBL 2A6HA 4X6AC 3M4OC 4G7HA 3GTOC 4X6AK 3M4OK 3GTOK 5M3FK 4Q4ZA 4A3FC 3FKIC 4KN7A 3FKIK 3RZOC 2R93K 3RZOK 4A3GC 1Y1VC 4QIWD 3GTMC 1YNJA 1Y1VK 3S2HC 5D4DA 4A3GK 2WB1D 3GTMK 4A3IC 3S2HK 4A3CC 3HOUC 4QJVB 2JA8C 4A3CK 4YG2A 3GTJC 4A3IK 3HOUK 2JA8K 3HKZD 3GTJK 4QIWL 3WODA 5C3EK 4A3DC 1TWCC 4A3JC 2WB1L 4BXXC 3HOXC 2WAQD 4LK0A 3HOZK 1TWCK 4A3JK 3S1QC 4A3DK 3H0GC 3HOXK 4BXXK 4Y7NC 4A3BC 3HKZL 2PPBA 3H0GK 4Y7NK 3GTLC 4OIPA 3K7AC 3GTLK 3M3YC 2NVTC 3K7AK 4KMUA 4XLNA 3M3YK 4OINA 2NVTK 2O5JA 4ZH4A 4A3FK 5IP9C 2CW0A 5M5XK 5IP9K 3PO3C 3HOVC 4BY1C 4YFKA 5M5YK 4A3LC 3HOYC 1WCMC 5FLMC 4BY1K 4XSXA 4A3LK 3S1MC 1IW7A 1WCMK 3HOYK 1TWHC 4YFXA 5FLMK 3S1MK 2A6EA 3RZDC 1TWHK 1TWFC 4LLGA 4BY7C 2JA5C 4BY7K 2JA6C 1ZYRA 1XPPA 2JA6K 3H3VD 3HOWC 1HQMA 4Y52C 3GTKC 2BE5A 4KN4A 3HOWK 3S1QK 4Y52K 2R92C 4BBRC 2E2JC 2A69A 1TWAC 3CQZC 4A3BK 2R92K 4BBRK 2E2JK 1TWAK 3CQZK 2E2IC 3GTPC 2E2HC 3H3VL 3S15C 2WAQL 4OIQA 1I50C 2E2IK 3GTPK 2E2HK 2NVXC 1I50K
chains in the Genus database with same CATH superfamily
4GFQA 1K83K 1Y1WC 3I4NC 1EI6A 4LK1A 3HOVK 4OIRA 2VUMC 3S2DK 3SZYA 3TFJA 5IP7C 3AQOA 1PJ6A 2EBBA 2GAGC 1TWGK 5IYDK 3L4JA 5JVOA 4AH6A 4LJZA 1O2AA 2GSOA 2NVYK 1R9TK 4DDQA 4A3EK 3S1NK 3PO2C 5M5WK 4C2MK 3G4CA 5IYCK 4KATA 3CQZA 2YU9K 4C3HC 1WSVA 2E2IA 3GTPA 1VJEA 1O25A 4P5AA 2NVXA 1BDFA 4WJ4A 3LAPA 1SMYA 3S16C 3LAJA 2JA7K 4A93C 3N0BA 5IYBK 1I6VA 3S17K 1XZPB 4AYBL 4G7HA 4G0UA 1TWFA 1O27A 5M3FK 1J98A 3L4KA 1USMA 3FHZA 3MMLB 3BP8C 1SFOA 3S2HK 1IS1A 3HOUC 2JA8C 1G51A 4GTBA 4KB4A 5C3EK 3WODA 4A3DC 1TWCC 2WB1L 3N3YA 3HOZK 5JFEA 3GTQA 4GT9A 4Y7NC 3GTLC 4C45A 2FQOA 2NVTC 3FOFA 3M3YK 2O5JA 3T01A 1XZQA 5IOTA 2NVYA 1R9TA 3HOVC 4BY1C 4YFKA 5FLMC 2YU9A 1DCHA 1TWHC 2A6EA 3FOEA 3GTJA 3HOWK 4Y52K 2A69A 1TWAC 4BLBA 1ISEA 3QX3A 1DD5A 3CQZK 3H3VL 3ADAC 2E2IK 3GTPK 5IOQA 2D6FC 2NVXK 5M3MK 4XCHA 1INNA 4A3KK 1WORA 4A3MK 3GTGC 4GTFA 3S17C 4YFNA 1WCMA 2R7ZC 1PJ5A 3BP3A 1TWFK 3S14K 3N0CA 5C4XK 3AD8C 3A8JA 4C3JC 5C4JK 1I6HC 4KMDA 4P9SA 2ZUFA 2ZFZA 1X31C 1ZQ1C 2ZUEA 4C3IK 1SFOK 3GEEA 2B63C 4BBSC 3OREA 5CJ9A 1USOA 4MQ9A 1I50A 2W7VA 5C44K 3S1RC 1YCLA 5C3EC 4M1XA 4AYBD 2NVQK 2PHCB 3I4MK 2R93C 3HOZC 4Q5SA 3GTQK 4KC6A 4XLPA 5TJ3A 1F9NA 1I3QK 2VUMA 4G0VA 1XZQB 3A8IA 1VRQC 2A6HA 4GTAA 3GTOC 3M4OC 4X6AC 4PABA 2JA5A 3Q3QA 2Y3PA 3FKIC 4KN7A 3AQPA 3RZOK 1Y1VC 4RMFA 1AB4A 3GTMC 4A3GK 1WQHA 1B4BA 2WB1D 4A3CC 1O26A 4QJVB 4YG2A 4A3IK 1O24A 3GTJK 1XXBA 4LR2A 1O28A 4A3JK 3H0GC 3HOXK 4BXXK 3GSIA 3HKZL 2PPBA 3GEHA 4OIPA 3K7AC 1V5VA 1ZXOA 1IQ0A 4KMUA 3AD7C 3V4GA 1EK8A 1DCOA 1F93A 2CW0A 1UV7A 5IP9K 1EQRA 4WJ3M 5EGHA 4A3LC 1JQWA 4P5BA 1IW7A 1WCMK 3HOYK 2CFAA 3OEPA 4ILDA 3S1MK 1ZBSA 1TWFC 4LLGA 2P8TA 4BY7K 2JA6C 3H3VD 3S1QK 1I3QA 1TWCA 2E2JC 4A3BK 2R92K 4BBRK 2E2HC 1J6WA 3TFIA 3GTLA 1I50K 5D4DA 1K83C 4KM9A 1IBAA 3HXAA 5TMFA 1WQGA 5FJ8K 3S2DC 5TMCA 2VUMK 4GTCA 2Y0SL 1TWGC 5IYDC 3JSTA 3RZDK 3CAGA 1TWHA 2JA5K 4WILA 4G0WA 1ZVUA 4QJVA 4JK1A 2NVYC 1R9TC 2PMZL 4LOWA 4A3EC 3S1NC 1WOOA 2PA8L 4C2MC 5IYCC 2YU9C 1TWAA 3PO2K 3BUEA 3GDZA 4C3HK 1BS2A 4G7OA 4KMHA 2V6SA 2JA7C 3DXJA 5IYBC 3S16K 2XCOA 1XXCA 4XSZA 4A93K 1KQ4A 1WSRA 1EFWA 1WIHA 1XXAA 4LQYA 3GTKA 1BJTA 2CFAB 2R92A 4PAAA 5EGEA 1YNJA 3S2HC 1JOEA 3AH5A 3G4AA 2B63A 3HOUK 2JA8K 3HKZD 4QIWL 1Y1WA 2WAQD 3S1QC 4A3DK 1TWCK 2R93A 4A3BC 3T02A 2P5MA 4Y7NK 3GTLK 3M3YC 2XCRB 1DCPA 4XLNA 2NVTK 3GTOA 2RH6A 4A3FK 4KDDA 2GSUA 5M5XK 3FKIA 1F7VA 5L46A 4BY1K 1VH2A 4O2DA 4YFXA 5FLMK 4GTLA 1Y1VA 3A8KA 1O29A 3RZDC 1TWHK 3GTMA 3SZZA 2JA5C 1ZYRA 1GE9A 2GSNA 4KM8A 1WQFA 3HOWC 1HQMA 4Y52C 5IORA 3NUHA 3CQZC 1IE0A 1TWAK 2E2IC 3H0GA 3GTPC 2WAQL 4OIQA 1J6XA 4J3NA 2NVXC 1C0AA 4A3KC 4A3MC 1VGXA 2KWAA 2Y0SD 3TTGA 3GTGK 3PO3K 3T00A 1YX2A 2A68A 2PMZD 3S14C 5E68A 4MEYA 2PA8D 3EQLA 2R7ZK 4OIOA 5C4XC 1YNNA 5C4JC 2JA6A 3GTKK 4C3JK 1I6HK 2O5IA 4C3IC 1SFOC 3S15K 4NOIA 1IL2A 4KAWX 2B63K 4BBSK 2E2HA 5C44C 4MEXA 1RU0A 2FQTA 1Y1WK 4G7ZA 2NVQC 5CHPA 1K83A 1L0WA 3S1RK 3I4NK 3I4MC 3GTQC 1F7UA 1I3QC 4KARA 4GTDA 2R93K 4GZYA 3LPXA 5IP7K 1WOSA 3ERED 1TWGA 4X6AK 3M4OK 2V6UA 3GTOK 3GEIA 2RGRA 4Q4ZA 4A3FC 1JVIA 3FKIK 3RZOC 1BGWA 4A3GC 4QIWD 1Y1VK 3GTMK 4A3IC 4FZBA 3GTJC 4A3CK 3VA7A 4BLAA 3GTGA 4A3JC 4BXXC 3HOXC 4LK0A 2XCQA 2JA7A 1WOPA 2JH3A 1PJ7A 2GAHC 3H0GK 1O2FB 4KMAA 2R7ZA 5HL8A 3K7AK 4OINA 4KB2A 1XZPA 3OPFA 4GTEA 4ZH4A 5IP9C 1O2BA 1EH1A 1HI9A 3PO3C 3IPJA 3GIRA 5M5YK 3HOYC 1WCMC 4XSXA 4A3LK 3S1MC 4BY7C 1B4AA 1XPPA 2JA6K 2V6TA 4BKWA 4KASA 3S0XA 2BE5A 3GTKC 1J6VA 4KN4A 4FM9A 2R92C 4BBRC 5IOSA 3AD9C 2E2JK 3S15C 1I50C 2E2HK 1VLOA 3TFHA
chains in the Genus database with same CATH topology
1K83C 4A3KC 4A3MC 5M3MK 2NVXK 1K83K 4A3KK 2Y0SD 5TMFA 4A3MK 1Y1WC 3GTGC 3I4NC 4LK1A 3GTGK 5FJ8K 3HOVK 3PO3K 4OIRA 2VUMC 3S2DC 5TMCA 2A68A 2VUMK 3S2DK 3S17C 5IP7C 2Y0SL 1TWGC 4YFNA 2PMZD 5IYDC 2R7ZC 3RZDK 3S14C 1TWGK 1TWFK 4MEYA 2PA8D 3EQLA 2R7ZK 2JA5K 3S14K 5IYDK 4OIOA 5C4XC 1YNNA 4QJVA 5C4JC 4JK1A 4LJZA 2NVYC 5C4XK 1R9TC 2PMZL 5C4JK 3GTKK 2NVYK 4A3EC 1R9TK 3S1NC 1I6HC 4C3JK 2PA8L 4A3EK 3S1NK 1I6HK 2O5IA 5IYCC 2YU9C 1SFOC 3PO2C 5M5WK 4C2MK 3S15K 5IYCK 4C3IK 1SFOK 2YU9K 4NOIA 2B63C 3PO2K 4BBSC 2B63K 4BBSK 4C3HK 4MQ9A 5C44C 4MEXA 4G7OA 5C44K 1BDFA 3S1RC 1Y1WK 5C3EC 1SMYA 4G7ZA 2NVQC 3I4NK 3I4MC 4AYBD 3S1RK 2JA7C 3DXJA 3S16C 2NVQK 3GTQC 3I4MK 2R93C 5IYBC 3S16K 1I3QC 2JA7K 3HOZC 4A93C 3GTQK 4Q5SA 4XLPA 4GZYA 5IYBK 1I6VA 1I3QK 4XSZA 3S17K 4A93K 5IP7K 4AYBL 2A6HA 4X6AC 3M4OC 4G7HA 3GTOC 4X6AK 3M4OK 3GTOK 5M3FK 4Q4ZA 4A3FC 3FKIC 4KN7A 3FKIK 3RZOC 2R93K 3RZOK 4A3GC 1Y1VC 4QIWD 3GTMC 1YNJA 1Y1VK 3S2HC 5D4DA 4A3GK 2WB1D 3GTMK 4A3IC 3S2HK 4A3CC 3HOUC 4QJVB 2JA8C 4A3CK 4YG2A 3GTJC 4A3IK 3HOUK 2JA8K 3HKZD 3GTJK 4QIWL 3WODA 5C3EK 4A3DC 1TWCC 4A3JC 2WB1L 4BXXC 3HOXC 2WAQD 4LK0A 3HOZK 1TWCK 4A3JK 3S1QC 4A3DK 3H0GC 3HOXK 4BXXK 4Y7NC 4A3BC 3HKZL 2PPBA 3H0GK 4Y7NK 3GTLC 4OIPA 3K7AC 3GTLK 3M3YC 2NVTC 3K7AK 4KMUA 4XLNA 3M3YK 4OINA 2NVTK 2O5JA 4ZH4A 4A3FK 5IP9C 2CW0A 5M5XK 5IP9K 3PO3C 3HOVC 4BY1C 4YFKA 5M5YK 4A3LC 3HOYC 1WCMC 5FLMC 4BY1K 4XSXA 4A3LK 3S1MC 1IW7A 1WCMK 3HOYK 1TWHC 4YFXA 5FLMK 3S1MK 2A6EA 3RZDC 1TWHK 1TWFC 4LLGA 4BY7C 2JA5C 4BY7K 2JA6C 1ZYRA 1XPPA 2JA6K 3H3VD 3HOWC 1HQMA 4Y52C 3GTKC 2BE5A 4KN4A 3HOWK 3S1QK 4Y52K 2R92C 4BBRC 2E2JC 2A69A 1TWAC 3CQZC 4A3BK 2R92K 4BBRK 2E2JK 1TWAK 3CQZK 2E2IC 3GTPC 2E2HC 3H3VL 3S15C 2WAQL 4OIQA 1I50C 2E2IK 3GTPK 2E2HK 2NVXC 1I50K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 C;  4A3K C;  4A3M C;  5M3M K;  2NVX K;  1K83 K;  4A3K K;  2Y0S D;  5TMF A;  4A3M K;  1Y1W C;  3GTG C;  3I4N C;  4LK1 A;  3GTG K;  5FJ8 K;  3HOV K;  3PO3 K;  4OIR A;  2VUM C;  3S2D C;  5TMC A;  2A68 A;  2VUM K;  3S2D K;  3S17 C;  5IP7 C;  2Y0S L;  1TWG C;  4YFN A;  2PMZ D;  5IYD C;  2R7Z C;  3RZD K;  3S14 C;  1TWG K;  1TWF K;  4MEY A;  2PA8 D;  3EQL A;  2R7Z K;  2JA5 K;  3S14 K;  5IYD K;  4OIO A;  5C4X C;  1YNN A;  4QJV A;  5C4J C;  4JK1 A;  4LJZ A;  2NVY C;  5C4X K;  1R9T C;  2PMZ L;  5C4J K;  3GTK K;  2NVY K;  4A3E C;  1R9T K;  3S1N C;  1I6H C;  4C3J K;  2PA8 L;  4A3E K;  3S1N K;  1I6H K;  2O5I A;  5IYC C;  2YU9 C;  1SFO C;  3PO2 C;  5M5W K;  4C2M K;  3S15 K;  5IYC K;  4C3I K;  1SFO K;  2YU9 K;  4NOI A;  2B63 C;  3PO2 K;  4BBS C;  2B63 K;  4BBS K;  4C3H K;  4MQ9 A;  5C44 C;  4MEX A;  4G7O A;  5C44 K;  1BDF A;  3S1R C;  1Y1W K;  5C3E C;  1SMY A;  4G7Z A;  2NVQ C;  3I4N K;  3I4M C;  4AYB D;  3S1R K;  2JA7 C;  3DXJ A;  3S16 C;  2NVQ K;  3GTQ C;  3I4M K;  2R93 C;  5IYB C;  3S16 K;  1I3Q C;  2JA7 K;  3HOZ C;  4A93 C;  3GTQ K;  4Q5S A;  4XLP A;  4GZY A;  5IYB K;  1I6V A;  1I3Q K;  4XSZ A;  3S17 K;  4A93 K;  5IP7 K;  4AYB L;  2A6H A;  4X6A C;  3M4O C;  4G7H A;  3GTO C;  4X6A K;  3M4O K;  3GTO K;  5M3F K;  4Q4Z A;  4A3F C;  3FKI C;  4KN7 A;  3FKI K;  3RZO C;  2R93 K;  3RZO K;  4A3G C;  1Y1V C;  4QIW D;  3GTM C;  1YNJ A;  1Y1V K;  3S2H C;  5D4D A;  4A3G K;  2WB1 D;  3GTM K;  4A3I C;  3S2H K;  4A3C C;  3HOU C;  4QJV B;  2JA8 C;  4A3C K;  4YG2 A;  3GTJ C;  4A3I K;  3HOU K;  2JA8 K;  3HKZ D;  3GTJ K;  4QIW L;  3WOD A;  5C3E K;  4A3D C;  1TWC C;  4A3J C;  2WB1 L;  4BXX C;  3HOX C;  2WAQ D;  4LK0 A;  3HOZ K;  1TWC K;  4A3J K;  3S1Q C;  4A3D K;  3H0G C;  3HOX K;  4BXX K;  4Y7N C;  4A3B C;  3HKZ L;  2PPB A;  3H0G K;  4Y7N K;  3GTL C;  4OIP A;  3K7A C;  3GTL K;  3M3Y C;  2NVT C;  3K7A K;  4KMU A;  4XLN A;  3M3Y K;  4OIN A;  2NVT K;  2O5J A;  4ZH4 A;  4A3F K;  5IP9 C;  2CW0 A;  5M5X K;  5IP9 K;  3PO3 C;  3HOV C;  4BY1 C;  4YFK A;  5M5Y K;  4A3L C;  3HOY C;  1WCM C;  5FLM C;  4BY1 K;  4XSX A;  4A3L K;  3S1M C;  1IW7 A;  1WCM K;  3HOY K;  1TWH C;  4YFX A;  5FLM K;  3S1M K;  2A6E A;  3RZD C;  1TWH K;  1TWF C;  4LLG A;  4BY7 C;  2JA5 C;  4BY7 K;  2JA6 C;  1ZYR A;  1XPP A;  2JA6 K;  3H3V D;  3HOW C;  1HQM A;  4Y52 C;  3GTK C;  2BE5 A;  4KN4 A;  3HOW K;  3S1Q K;  4Y52 K;  2R92 C;  4BBR C;  2E2J C;  2A69 A;  1TWA C;  3CQZ C;  4A3B K;  2R92 K;  4BBR K;  2E2J K;  1TWA K;  3CQZ K;  2E2I C;  3GTP C;  2E2H C;  3H3V L;  3S15 C;  2WAQ L;  4OIQ A;  1I50 C;  2E2I K;  3GTP K;  2E2H K;  2NVX C;  1I50 K; 
#chains in the Genus database with same CATH topology
 4GFQ A;  1K83 K;  1Y1W C;  3I4N C;  1EI6 A;  4LK1 A;  3HOV K;  4OIR A;  2VUM C;  3S2D K;  3SZY A;  3TFJ A;  5IP7 C;  3AQO A;  1PJ6 A;  2EBB A;  2GAG C;  1TWG K;  5IYD K;  3L4J A;  5JVO A;  4AH6 A;  4LJZ A;  1O2A A;  2GSO A;  2NVY K;  1R9T K;  4DDQ A;  4A3E K;  3S1N K;  3PO2 C;  5M5W K;  4C2M K;  3G4C A;  5IYC K;  4KAT A;  3CQZ A;  2YU9 K;  4C3H C;  1WSV A;  2E2I A;  3GTP A;  1VJE A;  1O25 A;  4P5A A;  2NVX A;  1BDF A;  4WJ4 A;  3LAP A;  1SMY A;  3S16 C;  3LAJ A;  2JA7 K;  4A93 C;  3N0B A;  5IYB K;  1I6V A;  3S17 K;  1XZP B;  4AYB L;  4G7H A;  4G0U A;  1TWF A;  1O27 A;  5M3F K;  1J98 A;  3L4K A;  1USM A;  3FHZ A;  3MML B;  3BP8 C;  1SFO A;  3S2H K;  1IS1 A;  3HOU C;  2JA8 C;  1G51 A;  4GTB A;  4KB4 A;  5C3E K;  3WOD A;  4A3D C;  1TWC C;  2WB1 L;  3N3Y A;  3HOZ K;  5JFE A;  3GTQ A;  4GT9 A;  4Y7N C;  3GTL C;  4C45 A;  2FQO A;  2NVT C;  3FOF A;  3M3Y K;  2O5J A;  3T01 A;  1XZQ A;  5IOT A;  2NVY A;  1R9T A;  3HOV C;  4BY1 C;  4YFK A;  5FLM C;  2YU9 A;  1DCH A;  1TWH C;  2A6E A;  3FOE A;  3GTJ A;  3HOW K;  4Y52 K;  2A69 A;  1TWA C;  4BLB A;  1ISE A;  3QX3 A;  1DD5 A;  3CQZ K;  3H3V L;  3ADA C;  2E2I K;  3GTP K;  5IOQ A;  2D6F C;  2NVX K;  5M3M K;  4XCH A;  1INN A;  4A3K K;  1WOR A;  4A3M K;  3GTG C;  4GTF A;  3S17 C;  4YFN A;  1WCM A;  2R7Z C;  1PJ5 A;  3BP3 A;  1TWF K;  3S14 K;  3N0C A;  5C4X K;  3AD8 C;  3A8J A;  4C3J C;  5C4J K;  1I6H C;  4KMD A;  4P9S A;  2ZUF A;  2ZFZ A;  1X31 C;  1ZQ1 C;  2ZUE A;  4C3I K;  1SFO K;  3GEE A;  2B63 C;  4BBS C;  3ORE A;  5CJ9 A;  1USO A;  4MQ9 A;  1I50 A;  2W7V A;  5C44 K;  3S1R C;  1YCL A;  5C3E C;  4M1X A;  4AYB D;  2NVQ K;  2PHC B;  3I4M K;  2R93 C;  3HOZ C;  4Q5S A;  3GTQ K;  4KC6 A;  4XLP A;  5TJ3 A;  1F9N A;  1I3Q K;  2VUM A;  4G0V A;  1XZQ B;  3A8I A;  1VRQ C;  2A6H A;  4GTA A;  3GTO C;  3M4O C;  4X6A C;  4PAB A;  2JA5 A;  3Q3Q A;  2Y3P A;  3FKI C;  4KN7 A;  3AQP A;  3RZO K;  1Y1V C;  4RMF A;  1AB4 A;  3GTM C;  4A3G K;  1WQH A;  1B4B A;  2WB1 D;  4A3C C;  1O26 A;  4QJV B;  4YG2 A;  4A3I K;  1O24 A;  3GTJ K;  1XXB A;  4LR2 A;  1O28 A;  4A3J K;  3H0G C;  3HOX K;  4BXX K;  3GSI A;  3HKZ L;  2PPB A;  3GEH A;  4OIP A;  3K7A C;  1V5V A;  1ZXO A;  1IQ0 A;  4KMU A;  3AD7 C;  3V4G A;  1EK8 A;  1DCO A;  1F93 A;  2CW0 A;  1UV7 A;  5IP9 K;  1EQR A;  4WJ3 M;  5EGH A;  4A3L C;  1JQW A;  4P5B A;  1IW7 A;  1WCM K;  3HOY K;  2CFA A;  3OEP A;  4ILD A;  3S1M K;  1ZBS A;  1TWF C;  4LLG A;  2P8T A;  4BY7 K;  2JA6 C;  3H3V D;  3S1Q K;  1I3Q A;  1TWC A;  2E2J C;  4A3B K;  2R92 K;  4BBR K;  2E2H C;  1J6W A;  3TFI A;  3GTL A;  1I50 K;  5D4D A;  1K83 C;  4KM9 A;  1IBA A;  3HXA A;  5TMF A;  1WQG A;  5FJ8 K;  3S2D C;  5TMC A;  2VUM K;  4GTC A;  2Y0S L;  1TWG C;  5IYD C;  3JST A;  3RZD K;  3CAG A;  1TWH A;  2JA5 K;  4WIL A;  4G0W A;  1ZVU A;  4QJV A;  4JK1 A;  2NVY C;  1R9T C;  2PMZ L;  4LOW A;  4A3E C;  3S1N C;  1WOO A;  2PA8 L;  4C2M C;  5IYC C;  2YU9 C;  1TWA A;  3PO2 K;  3BUE A;  3GDZ A;  4C3H K;  1BS2 A;  4G7O A;  4KMH A;  2V6S A;  2JA7 C;  3DXJ A;  5IYB C;  3S16 K;  2XCO A;  1XXC A;  4XSZ A;  4A93 K;  1KQ4 A;  1WSR A;  1EFW A;  1WIH A;  1XXA A;  4LQY A;  3GTK A;  1BJT A;  2CFA B;  2R92 A;  4PAA A;  5EGE A;  1YNJ A;  3S2H C;  1JOE A;  3AH5 A;  3G4A A;  2B63 A;  3HOU K;  2JA8 K;  3HKZ D;  4QIW L;  1Y1W A;  2WAQ D;  3S1Q C;  4A3D K;  1TWC K;  2R93 A;  4A3B C;  3T02 A;  2P5M A;  4Y7N K;  3GTL K;  3M3Y C;  2XCR B;  1DCP A;  4XLN A;  2NVT K;  3GTO A;  2RH6 A;  4A3F K;  4KDD A;  2GSU A;  5M5X K;  3FKI A;  1F7V A;  5L46 A;  4BY1 K;  1VH2 A;  4O2D A;  4YFX A;  5FLM K;  4GTL A;  1Y1V A;  3A8K A;  1O29 A;  3RZD C;  1TWH K;  3GTM A;  3SZZ A;  2JA5 C;  1ZYR A;  1GE9 A;  2GSN A;  4KM8 A;  1WQF A;  3HOW C;  1HQM A;  4Y52 C;  5IOR A;  3NUH A;  3CQZ C;  1IE0 A;  1TWA K;  2E2I C;  3H0G A;  3GTP C;  2WAQ L;  4OIQ A;  1J6X A;  4J3N A;  2NVX C;  1C0A A;  4A3K C;  4A3M C;  1VGX A;  2KWA A;  2Y0S D;  3TTG A;  3GTG K;  3PO3 K;  3T00 A;  1YX2 A;  2A68 A;  2PMZ D;  3S14 C;  5E68 A;  4MEY A;  2PA8 D;  3EQL A;  2R7Z K;  4OIO A;  5C4X C;  1YNN A;  5C4J C;  2JA6 A;  3GTK K;  4C3J K;  1I6H K;  2O5I A;  4C3I C;  1SFO C;  3S15 K;  4NOI A;  1IL2 A;  4KAW X;  2B63 K;  4BBS K;  2E2H A;  5C44 C;  4MEX A;  1RU0 A;  2FQT A;  1Y1W K;  4G7Z A;  2NVQ C;  5CHP A;  1K83 A;  1L0W A;  3S1R K;  3I4N K;  3I4M C;  3GTQ C;  1F7U A;  1I3Q C;  4KAR A;  4GTD A;  2R93 K;  4GZY A;  3LPX A;  5IP7 K;  1WOS A;  3ERE D;  1TWG A;  4X6A K;  3M4O K;  2V6U A;  3GTO K;  3GEI A;  2RGR A;  4Q4Z A;  4A3F C;  1JVI A;  3FKI K;  3RZO C;  1BGW A;  4A3G C;  4QIW D;  1Y1V K;  3GTM K;  4A3I C;  4FZB A;  3GTJ C;  4A3C K;  3VA7 A;  4BLA A;  3GTG A;  4A3J C;  4BXX C;  3HOX C;  4LK0 A;  2XCQ A;  2JA7 A;  1WOP A;  2JH3 A;  1PJ7 A;  2GAH C;  3H0G K;  1O2F B;  4KMA A;  2R7Z A;  5HL8 A;  3K7A K;  4OIN A;  4KB2 A;  1XZP A;  3OPF A;  4GTE A;  4ZH4 A;  5IP9 C;  1O2B A;  1EH1 A;  1HI9 A;  3PO3 C;  3IPJ A;  3GIR A;  5M5Y K;  3HOY C;  1WCM C;  4XSX A;  4A3L K;  3S1M C;  4BY7 C;  1B4A A;  1XPP A;  2JA6 K;  2V6T A;  4BKW A;  4KAS A;  3S0X A;  2BE5 A;  3GTK C;  1J6V A;  4KN4 A;  4FM9 A;  2R92 C;  4BBR C;  5IOS A;  3AD9 C;  2E2J K;  3S15 C;  1I50 C;  2E2H K;  1VLO A;  3TFH A; 
#chains in the Genus database with same CATH homology
 1K83 C;  4A3K C;  4A3M C;  5M3M K;  2NVX K;  1K83 K;  4A3K K;  2Y0S D;  5TMF A;  4A3M K;  1Y1W C;  3GTG C;  3I4N C;  4LK1 A;  3GTG K;  5FJ8 K;  3HOV K;  3PO3 K;  4OIR A;  2VUM C;  3S2D C;  5TMC A;  2A68 A;  2VUM K;  3S2D K;  3S17 C;  5IP7 C;  2Y0S L;  1TWG C;  4YFN A;  2PMZ D;  5IYD C;  2R7Z C;  3RZD K;  3S14 C;  1TWG K;  1TWF K;  4MEY A;  2PA8 D;  3EQL A;  2R7Z K;  2JA5 K;  3S14 K;  5IYD K;  4OIO A;  5C4X C;  1YNN A;  4QJV A;  5C4J C;  4JK1 A;  4LJZ A;  2NVY C;  5C4X K;  1R9T C;  2PMZ L;  5C4J K;  3GTK K;  2NVY K;  4A3E C;  1R9T K;  3S1N C;  1I6H C;  4C3J K;  2PA8 L;  4A3E K;  3S1N K;  1I6H K;  2O5I A;  5IYC C;  2YU9 C;  1SFO C;  3PO2 C;  5M5W K;  4C2M K;  3S15 K;  5IYC K;  4C3I K;  1SFO K;  2YU9 K;  4NOI A;  2B63 C;  3PO2 K;  4BBS C;  2B63 K;  4BBS K;  4C3H K;  4MQ9 A;  5C44 C;  4MEX A;  4G7O A;  5C44 K;  1BDF A;  3S1R C;  1Y1W K;  5C3E C;  1SMY A;  4G7Z A;  2NVQ C;  3I4N K;  3I4M C;  4AYB D;  3S1R K;  2JA7 C;  3DXJ A;  3S16 C;  2NVQ K;  3GTQ C;  3I4M K;  2R93 C;  5IYB C;  3S16 K;  1I3Q C;  2JA7 K;  3HOZ C;  4A93 C;  3GTQ K;  4Q5S A;  4XLP A;  4GZY A;  5IYB K;  1I6V A;  1I3Q K;  4XSZ A;  3S17 K;  4A93 K;  5IP7 K;  4AYB L;  2A6H A;  4X6A C;  3M4O C;  4G7H A;  3GTO C;  4X6A K;  3M4O K;  3GTO K;  5M3F K;  4Q4Z A;  4A3F C;  3FKI C;  4KN7 A;  3FKI K;  3RZO C;  2R93 K;  3RZO K;  4A3G C;  1Y1V C;  4QIW D;  3GTM C;  1YNJ A;  1Y1V K;  3S2H C;  5D4D A;  4A3G K;  2WB1 D;  3GTM K;  4A3I C;  3S2H K;  4A3C C;  3HOU C;  4QJV B;  2JA8 C;  4A3C K;  4YG2 A;  3GTJ C;  4A3I K;  3HOU K;  2JA8 K;  3HKZ D;  3GTJ K;  4QIW L;  3WOD A;  5C3E K;  4A3D C;  1TWC C;  4A3J C;  2WB1 L;  4BXX C;  3HOX C;  2WAQ D;  4LK0 A;  3HOZ K;  1TWC K;  4A3J K;  3S1Q C;  4A3D K;  3H0G C;  3HOX K;  4BXX K;  4Y7N C;  4A3B C;  3HKZ L;  2PPB A;  3H0G K;  4Y7N K;  3GTL C;  4OIP A;  3K7A C;  3GTL K;  3M3Y C;  2NVT C;  3K7A K;  4KMU A;  4XLN A;  3M3Y K;  4OIN A;  2NVT K;  2O5J A;  4ZH4 A;  4A3F K;  5IP9 C;  2CW0 A;  5M5X K;  5IP9 K;  3PO3 C;  3HOV C;  4BY1 C;  4YFK A;  5M5Y K;  4A3L C;  3HOY C;  1WCM C;  5FLM C;  4BY1 K;  4XSX A;  4A3L K;  3S1M C;  1IW7 A;  1WCM K;  3HOY K;  1TWH C;  4YFX A;  5FLM K;  3S1M K;  2A6E A;  3RZD C;  1TWH K;  1TWF C;  4LLG A;  4BY7 C;  2JA5 C;  4BY7 K;  2JA6 C;  1ZYR A;  1XPP A;  2JA6 K;  3H3V D;  3HOW C;  1HQM A;  4Y52 C;  3GTK C;  2BE5 A;  4KN4 A;  3HOW K;  3S1Q K;  4Y52 K;  2R92 C;  4BBR C;  2E2J C;  2A69 A;  1TWA C;  3CQZ C;  4A3B K;  2R92 K;  4BBR K;  2E2J K;  1TWA K;  3CQZ K;  2E2I C;  3GTP C;  2E2H C;  3H3V L;  3S15 C;  2WAQ L;  4OIQ A;  1I50 C;  2E2I K;  3GTP K;  2E2H K;  2NVX C;  1I50 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...