1INNA

Crystal structure of d. radiodurans luxs, p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
b'NVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1innA00
1YCLA 2FQOA 5E68A 1JVIA 1JOEA 1IE0A 1J6VA 1VJEA 1VGXA 4XCHA 1VH2A 1J6WA 1INNA 1JQWA 1J98A 1J6XA 2FQTA
chains in the Genus database with same CATH superfamily
3S1MK 1TWHC 4MEXA 4AH6A 3HOVC 4JK1A 2NVTK 2R92A 4KATA 2PA8L 3V4GA 1ZYRA 5IP9C 2R7ZK 4BY7C 4A3KK 3S2DK 1O24A 3GDZA 4NOIA 3M3YK 4A3FK 1USMA 4BXXC 3NUHA 1Y1WA 1VH2A 3ERED 1X31C 4QIWL 3GEEA 2E2IK 1O2BA 1WQGA 2R7ZC 3GTQA 1JVIA 2PA8D 5M3MK 1DCHA 4A3BK 2FQTA 3OREA 5IYBC 3GTMA 1I50C 3S15K 3GTOK 1PJ5A 4C2MC 4WJ3M 1TWAK 2B63C 4QIWD 4A3BC 5FLMC 4BBSK 2EBBA 1O26A 3GTJA 4A3IC 2Y0SL 4WJ4A 3S15C 3A8KA 2JA6A 1TWAC 3HXAA 3T01A 4BBSC 2R93K 2E2HA 3GTPK 1SFOK 4YFXA 3CAGA 3SZYA 1TWCK 4A3EC 4GTCA 4A3DC 5IYCK 3I4MC 2Y0SD 2R93C 1K83A 2A6HA 1O27A 1SFOC 3T00A 1YX2A 4GTBA 5FJ8K 1TWCC 1EH1A 4GTDA 2E2JC 5IYCC 2NVYC 3Q3QA 1KQ4A 2CW0A 1J98A 3LAPA 1TWFK 4RMFA 5IOSA 2JA8C 1ZQ1C 3GTKC 4MQ9A 3HOXC 1J6XA 2FQOA 4X6AC 2JA5C 4YFKA 5C4XK 3ADAC 2XCOA 4Q5SA 4QJVA 4DDQA 4C3HK 3I4NC 2WB1L 3S1NK 5IORA 2PHCB 5C3EC 4MEYA 1TWHA 1XXAA 2NVXC 4KMAA 2YU9C 4KB4A 3L4JA 1R9TA 1WCMK 3S1RK 2GSUA 5C44C 1AB4A 3CQZC 3S2HK 4Q4ZA 2WB1D 4A3LK 4LLGA 5IP7K 2O5JA 2RH6A 2P5MA 4GT9A 4G0WA 1HQMA 3GSIA 4A3LC 1I3QK 4QJVB 3HOZK 1EQRA 2D6FC 2JA7C 1VLOA 1Y1VC 3OPFA 4AYBL 1I50A 1VGXA 4BLAA 3RZOC 3HOYK 2GAHC 3H0GC 4Y7NK 1PJ6A 4KDDA 2B63A 3PO2K 1WQFA 3QX3A 2GAGC 3HOZC 3S1QK 4A93C 3S1MC 2VUMA 1ZBSA 1DD5A 4GTFA 3L4KA 2NVTC 3S14K 4Y7NC 2BE5A 4GTAA 4AYBD 1XZQA 1F7VA 3S1QC 3N0CA 4A3KC 3S2DC 1L0WA 1WSRA 1O2AA 1F93A 3M3YC 4A3FC 3M4OK 4PABA 3S14C 4KN7A 2E2IC 3PO3K 2RGRA 2W7VA 3TTGA 4BLBA 1O25A 1BGWA 4C45A 4A3JK 1IQ0A 1WQHA 4BY1K 3GTGK 3M4OC 3FKIA 2A68A 1ZVUA 5M3FK 2NVYA 3GTOC 4A3GK 2V6UA 1YCLA 2R92K 4WILA 2A6EA 4A3JC 4BKWA 4BY1C 3GTLA 4G0VA 4BBRK 3TFJA 3LAJA 3GEHA 1DCPA 1TWGA 1WOOA 1DCOA 2V6SA 1XZQB 1J6WA 4OINA 1XZPA 1Y1WK 1F7UA 1XPPA 3GTKA 4GFQA 3GTPC 3S17K 3LPXA 4OIQA 3GTQK 4BBRC 2JA5A 4GTEA 1USOA 2ZUFA 4XLNA 3SZZA 3S0XA 3GTMK 1ZXOA 1V5VA 3A8JA 5TMFA 2NVXA 3IPJA 3GTJK 4Y52K 3GTMC 5L46A 2PMZD 1INNA 4P5AA 2JA6K 2ZFZA 4M1XA 2CFAB 1VJEA 2O5IA 2ZUEA 5EGHA 3GTJC 2E2HK 3CQZA 1TWFC 3A8IA 1XZPB 4KMUA 1WOPA 1TWGK 4KASA 1WSVA 1ISEA 1C0AA 5M5XK 4KM9A 1K83K 1EK8A 5TJ3A 4LQYA 2Y3PA 4XLPA 2JA7A 1Y1VA 5C4XC 2GSNA 1JOEA 3H0GA 5M5YK 1K83C 3EQLA 4C3HC 4G7HA 3S1NC 1SMYA 2NVQK 1YNNA 3K7AK 4J3NA 5JFEA 3BP3A 3TFHA 1WCMC 1BS2A 1F9NA 3S1RC 5C4JK 2R7ZA 2NVQC 4XSXA 1B4AA 1RU0A 1WORA 3RZDK 5CHPA 3S2HC 1VRQC 5IP7C 3MMLB 3S16K 2E2IA 4P5BA 3G4CA 5D4DA 4LOWA 1O2FB 3AD7C 4YG2A 3RZDC 1XXCA 1I3QC 1IBAA 3S16C 1TWHK 3GTOA 1J6VA 3HOVK 1JQWA 1TWAA 3HOYC 1R9TK 1BDFA 3PO2C 4PAAA 4O2DA 5IP9K 4BY7K 3BP8C 5TMCA 4YFNA 1YNJA 4BXXK 1UV7A 1R9TC 1IS1A 2R93A 3GTPA 4A3MK 1WOSA 4G7OA 1SFOA 3H3VL 1HI9A 1TWCA 3FOEA 5IYBK 4ILDA 1EFWA 3N0BA 3PO3C 4C3JK 1I50K 4A3MC 4C2MK 5JVOA 2B63K 5FLMK 1O29A 5HL8A 4A3IK 3GTGC 3HKZL 4A3CK 2CFAA 4C3JC 3H3VD 2PPBA 2VUMK 1O28A 4A3GC 4OIOA 3GEIA 4GZYA 2R92C 1I6HK 4LK1A 3TFIA 1TWFA 3DXJA 4FM9A 2KWAA 4A3CC 2PMZL 2WAQL 2VUMC 4KMHA 4A3EK 4A3DK 3I4MK 1Y1WC 3HKZD 3T02A 1I6HC 4LK0A 3S17C 3AH5A 4KARA 3GTQC 4LR2A 1IW7A 3FHZA 3OEPA 2E2JK 2YU9A 5IOQA 3JSTA 3FKIK 2WAQD 2NVYK 2A69A 1GE9A 3G4AA 5IOTA 4KM8A 1B4BA 4Y52C 3GTLK 1G51A 3FKIC 3AD8C 1WCMA 4C3IK 2JA8K 2JA6C 3FOFA 3AQPA 1EI6A 2P8TA 2JH3A 2E2HC 3GTKK 3GTLC 3HOXK 4X6AK 1WIHA 2JA5K 1TWGC 4C3IC 2XCQA 5IYDK 4OIRA 2GSOA 1I6VA 5M5WK 4KAWX 3I4NK 1I3QA 4ZH4A 5C3EK 3VA7A 2NVXK 5IYDC 2YU9K 1IE0A 5CJ9A 4LJZA 3WODA 3N3YA 3AQOA 4XCHA 3HOUK 3HOWK 4P9SA 5C44K 3GIRA 2V6TA 3K7AC 2XCRB 3CQZK 4XSZA 1XXBA 4KMDA 1BJTA 3BUEA 5C4JC 4FZBA 5EGEA 4GTLA 3HOUC 3HOWC 4G7ZA 1PJ7A 1IL2A 2JA7K 1Y1VK 4KN4A 3RZOK 5E68A 3H0GK 4KB2A 3AD9C 4KC6A 4OIPA 3GTGA 4G0UA 4A93K
chains in the Genus database with same CATH topology
1YCLA 2FQOA 5E68A 1JVIA 1JOEA 1IE0A 1J6VA 1VJEA 1VGXA 4XCHA 1VH2A 1J6WA 1INNA 1JQWA 1J98A 1J6XA 2FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  2FQO A;  5E68 A;  1JVI A;  1JOE A;  1IE0 A;  1J6V A;  1VJE A;  1VGX A;  4XCH A;  1VH2 A;  1J6W A;  1INN A;  1JQW A;  1J98 A;  1J6X A;  2FQT A; 
#chains in the Genus database with same CATH topology
 3S1M K;  1TWH C;  4MEX A;  4AH6 A;  3HOV C;  4JK1 A;  2NVT K;  2R92 A;  4KAT A;  2PA8 L;  3V4G A;  1ZYR A;  5IP9 C;  2R7Z K;  4BY7 C;  4A3K K;  3S2D K;  1O24 A;  3GDZ A;  4NOI A;  3M3Y K;  4A3F K;  1USM A;  4BXX C;  3NUH A;  1Y1W A;  1VH2 A;  3ERE D;  1X31 C;  4QIW L;  3GEE A;  2E2I K;  1O2B A;  1WQG A;  2R7Z C;  3GTQ A;  1JVI A;  2PA8 D;  5M3M K;  1DCH A;  4A3B K;  2FQT A;  3ORE A;  5IYB C;  3GTM A;  1I50 C;  3S15 K;  3GTO K;  1PJ5 A;  4C2M C;  4WJ3 M;  1TWA K;  2B63 C;  4QIW D;  4A3B C;  5FLM C;  4BBS K;  2EBB A;  1O26 A;  3GTJ A;  4A3I C;  2Y0S L;  4WJ4 A;  3S15 C;  3A8K A;  2JA6 A;  1TWA C;  3HXA A;  3T01 A;  4BBS C;  2R93 K;  2E2H A;  3GTP K;  1SFO K;  4YFX A;  3CAG A;  3SZY A;  1TWC K;  4A3E C;  4GTC A;  4A3D C;  5IYC K;  3I4M C;  2Y0S D;  2R93 C;  1K83 A;  2A6H A;  1O27 A;  1SFO C;  3T00 A;  1YX2 A;  4GTB A;  5FJ8 K;  1TWC C;  1EH1 A;  4GTD A;  2E2J C;  5IYC C;  2NVY C;  3Q3Q A;  1KQ4 A;  2CW0 A;  1J98 A;  3LAP A;  1TWF K;  4RMF A;  5IOS A;  2JA8 C;  1ZQ1 C;  3GTK C;  4MQ9 A;  3HOX C;  1J6X A;  2FQO A;  4X6A C;  2JA5 C;  4YFK A;  5C4X K;  3ADA C;  2XCO A;  4Q5S A;  4QJV A;  4DDQ A;  4C3H K;  3I4N C;  2WB1 L;  3S1N K;  5IOR A;  2PHC B;  5C3E C;  4MEY A;  1TWH A;  1XXA A;  2NVX C;  4KMA A;  2YU9 C;  4KB4 A;  3L4J A;  1R9T A;  1WCM K;  3S1R K;  2GSU A;  5C44 C;  1AB4 A;  3CQZ C;  3S2H K;  4Q4Z A;  2WB1 D;  4A3L K;  4LLG A;  5IP7 K;  2O5J A;  2RH6 A;  2P5M A;  4GT9 A;  4G0W A;  1HQM A;  3GSI A;  4A3L C;  1I3Q K;  4QJV B;  3HOZ K;  1EQR A;  2D6F C;  2JA7 C;  1VLO A;  1Y1V C;  3OPF A;  4AYB L;  1I50 A;  1VGX A;  4BLA A;  3RZO C;  3HOY K;  2GAH C;  3H0G C;  4Y7N K;  1PJ6 A;  4KDD A;  2B63 A;  3PO2 K;  1WQF A;  3QX3 A;  2GAG C;  3HOZ C;  3S1Q K;  4A93 C;  3S1M C;  2VUM A;  1ZBS A;  1DD5 A;  4GTF A;  3L4K A;  2NVT C;  3S14 K;  4Y7N C;  2BE5 A;  4GTA A;  4AYB D;  1XZQ A;  1F7V A;  3S1Q C;  3N0C A;  4A3K C;  3S2D C;  1L0W A;  1WSR A;  1O2A A;  1F93 A;  3M3Y C;  4A3F C;  3M4O K;  4PAB A;  3S14 C;  4KN7 A;  2E2I C;  3PO3 K;  2RGR A;  2W7V A;  3TTG A;  4BLB A;  1O25 A;  1BGW A;  4C45 A;  4A3J K;  1IQ0 A;  1WQH A;  4BY1 K;  3GTG K;  3M4O C;  3FKI A;  2A68 A;  1ZVU A;  5M3F K;  2NVY A;  3GTO C;  4A3G K;  2V6U A;  1YCL A;  2R92 K;  4WIL A;  2A6E A;  4A3J C;  4BKW A;  4BY1 C;  3GTL A;  4G0V A;  4BBR K;  3TFJ A;  3LAJ A;  3GEH A;  1DCP A;  1TWG A;  1WOO A;  1DCO A;  2V6S A;  1XZQ B;  1J6W A;  4OIN A;  1XZP A;  1Y1W K;  1F7U A;  1XPP A;  3GTK A;  4GFQ A;  3GTP C;  3S17 K;  3LPX A;  4OIQ A;  3GTQ K;  4BBR C;  2JA5 A;  4GTE A;  1USO A;  2ZUF A;  4XLN A;  3SZZ A;  3S0X A;  3GTM K;  1ZXO A;  1V5V A;  3A8J A;  5TMF A;  2NVX A;  3IPJ A;  3GTJ K;  4Y52 K;  3GTM C;  5L46 A;  2PMZ D;  1INN A;  4P5A A;  2JA6 K;  2ZFZ A;  4M1X A;  2CFA B;  1VJE A;  2O5I A;  2ZUE A;  5EGH A;  3GTJ C;  2E2H K;  3CQZ A;  1TWF C;  3A8I A;  1XZP B;  4KMU A;  1WOP A;  1TWG K;  4KAS A;  1WSV A;  1ISE A;  1C0A A;  5M5X K;  4KM9 A;  1K83 K;  1EK8 A;  5TJ3 A;  4LQY A;  2Y3P A;  4XLP A;  2JA7 A;  1Y1V A;  5C4X C;  2GSN A;  1JOE A;  3H0G A;  5M5Y K;  1K83 C;  3EQL A;  4C3H C;  4G7H A;  3S1N C;  1SMY A;  2NVQ K;  1YNN A;  3K7A K;  4J3N A;  5JFE A;  3BP3 A;  3TFH A;  1WCM C;  1BS2 A;  1F9N A;  3S1R C;  5C4J K;  2R7Z A;  2NVQ C;  4XSX A;  1B4A A;  1RU0 A;  1WOR A;  3RZD K;  5CHP A;  3S2H C;  1VRQ C;  5IP7 C;  3MML B;  3S16 K;  2E2I A;  4P5B A;  3G4C A;  5D4D A;  4LOW A;  1O2F B;  3AD7 C;  4YG2 A;  3RZD C;  1XXC A;  1I3Q C;  1IBA A;  3S16 C;  1TWH K;  3GTO A;  1J6V A;  3HOV K;  1JQW A;  1TWA A;  3HOY C;  1R9T K;  1BDF A;  3PO2 C;  4PAA A;  4O2D A;  5IP9 K;  4BY7 K;  3BP8 C;  5TMC A;  4YFN A;  1YNJ A;  4BXX K;  1UV7 A;  1R9T C;  1IS1 A;  2R93 A;  3GTP A;  4A3M K;  1WOS A;  4G7O A;  1SFO A;  3H3V L;  1HI9 A;  1TWC A;  3FOE A;  5IYB K;  4ILD A;  1EFW A;  3N0B A;  3PO3 C;  4C3J K;  1I50 K;  4A3M C;  4C2M K;  5JVO A;  2B63 K;  5FLM K;  1O29 A;  5HL8 A;  4A3I K;  3GTG C;  3HKZ L;  4A3C K;  2CFA A;  4C3J C;  3H3V D;  2PPB A;  2VUM K;  1O28 A;  4A3G C;  4OIO A;  3GEI A;  4GZY A;  2R92 C;  1I6H K;  4LK1 A;  3TFI A;  1TWF A;  3DXJ A;  4FM9 A;  2KWA A;  4A3C C;  2PMZ L;  2WAQ L;  2VUM C;  4KMH A;  4A3E K;  4A3D K;  3I4M K;  1Y1W C;  3HKZ D;  3T02 A;  1I6H C;  4LK0 A;  3S17 C;  3AH5 A;  4KAR A;  3GTQ C;  4LR2 A;  1IW7 A;  3FHZ A;  3OEP A;  2E2J K;  2YU9 A;  5IOQ A;  3JST A;  3FKI K;  2WAQ D;  2NVY K;  2A69 A;  1GE9 A;  3G4A A;  5IOT A;  4KM8 A;  1B4B A;  4Y52 C;  3GTL K;  1G51 A;  3FKI C;  3AD8 C;  1WCM A;  4C3I K;  2JA8 K;  2JA6 C;  3FOF A;  3AQP A;  1EI6 A;  2P8T A;  2JH3 A;  2E2H C;  3GTK K;  3GTL C;  3HOX K;  4X6A K;  1WIH A;  2JA5 K;  1TWG C;  4C3I C;  2XCQ A;  5IYD K;  4OIR A;  2GSO A;  1I6V A;  5M5W K;  4KAW X;  3I4N K;  1I3Q A;  4ZH4 A;  5C3E K;  3VA7 A;  2NVX K;  5IYD C;  2YU9 K;  1IE0 A;  5CJ9 A;  4LJZ A;  3WOD A;  3N3Y A;  3AQO A;  4XCH A;  3HOU K;  3HOW K;  4P9S A;  5C44 K;  3GIR A;  2V6T A;  3K7A C;  2XCR B;  3CQZ K;  4XSZ A;  1XXB A;  4KMD A;  1BJT A;  3BUE A;  5C4J C;  4FZB A;  5EGE A;  4GTL A;  3HOU C;  3HOW C;  4G7Z A;  1PJ7 A;  1IL2 A;  2JA7 K;  1Y1V K;  4KN4 A;  3RZO K;  5E68 A;  3H0G K;  4KB2 A;  3AD9 C;  4KC6 A;  4OIP A;  3GTG A;  4G0U A;  4A93 K; 
#chains in the Genus database with same CATH homology
 1YCL A;  2FQO A;  5E68 A;  1JVI A;  1JOE A;  1IE0 A;  1J6V A;  1VJE A;  1VGX A;  4XCH A;  1VH2 A;  1J6W A;  1INN A;  1JQW A;  1J98 A;  1J6X A;  2FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...