1INNA

Crystal structure of d. radiodurans luxs, p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
NVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1innA00
1JQWA 1JVIA 1JOEA 1YCLA 5E68A 1VH2A 4XCHA 1VGXA 1INNA 1J6VA 1J6WA 2FQOA 1J6XA 1IE0A 1VJEA 2FQTA 1J98A
chains in the Genus database with same CATH superfamily
1Y1VC 1ZBSA 4A93K 5TJ3A 4C3IK 2GSOA 3JSTA 2NVYK 2YU9C 3GTMK 4ZH4A 1R9TC 2E2JC 2JA6K 2NVYA 3GTMA 2JA6A 3OPFA 1J98A 4LR2A 4KASA 4AYBD 2E2HK 1XXCA 3S17C 3RZDC 3AD9C 2XCOA 3EQLA 3HOVC 2E2HA 3FHZA 4YFNA 3AQOA 3N0BA 5C4XK 4KB4A 3CQZK 5EGEA 2R92A 3CQZA 3GEEA 3S1NK 4ILDA 4XLNA 2BE5A 1PJ7A 3AH5A 1EK8A 3OREA 4OIPA 2E2IC 3I4MC 1IW7A 4KMDA 2GSNA 1O25A 3S1RK 1I3QK 4BY1K 1XXAA 2GSUA 5IORA 1I3QA 1VLOA 1F93A 3N0CA 1O28A 4Q4ZA 1DCOA 1JVIA 1TWCC 4KARA 5IYBK 4J3NA 4LK1A 2Y0SD 3PO3K 4GTFA 1WOSA 4A3KK 1K83A 4C2MC 1RU0A 4GTEA 1DD5A 1X31C 2VUMK 1Y1WK 3G4CA 2VUMA 1KQ4A 3IPJA 4LK0A 1YNJA 1TWHC 1Y1WA 5EGHA 1WORA 3HXAA 1O26A 1SFOK 4A3LC 4BBRK 1VRQC 1WCMC 1SFOA 4A3IK 3S2HK 2WB1L 3AQPA 3RZOC 4BXXC 1TWFC 2NVTC 5M5XK 3FKIC 5CJ9A 3SZYA 3WODA 4FM9A 4MEXA 2KWAA 4BKWA 1I50K 1IS1A 4JK1A 3BP3A 4Q5SA 3T01A 3T02A 1I50A 4WJ3M 5IP7K 4QJVB 2FQOA 3S1QK 1XZPB 2P8TA 3T00A 1WQHA 1WOOA 3K7AC 1TWAA 3S1MK 4LOWA 3M4OK 5FLMK 3L4JA 4BLBA 4A3EC 2NVYC 3GTMC 4MEYA 2JA6C 1WSVA 4MQ9A 3HOWK 1V5VA 4QJVA 1XZPA 3TFHA 5C4JK 5C3EC 4X6AK 2NVXK 4Y52C 1B4BA 4Y7NC 2ZUFA 2GAHC 2V6SA 3S16C 1J6VA 2EBBA 4XLPA 3GTJA 4OIOA 2R92C 4A3JK 4KATA 2D6FC 4A3FC 5IOTA 5M5YK 3LAPA 1DCHA 1GE9A 4KMAA 4A3BC 2NVQK 1C0AA 1I6VA 4P5BA 1BDFA 3GEIA 2JA7C 4A3DK 2Y0SL 2B63K 5IP9K 2O5IA 2PHCB 3H0GK 1PJ5A 1WIHA 3H0GA 1I6HC 1K83C 4BY7K 3HOYC 2CFAB 3S2DK 2XCRB 4GTAA 4M1XA 1YX2A 3S15K 2R93C 2VUMC 4G0WA 5JVOA 1ZXOA 3BUEA 1Y1WC 3PO2K 2A6EA 3A8KA 4A3MC 4QIWL 4C3HK 3NUHA 1TWGC 2CFAA 4OIRA 3I4NC 4G0VA 4G7ZA 4BBRC 3HOXC 1UV7A 3TFJA 4A3IC 4C45A 1WQGA 1O2AA 4A3CK 3OEPA 3G4AA 1BGWA 4OINA 5IOQA 1Y1VK 1INNA 3BP8C 3GTLK 3GTGC 1I50C 4P5AA 1Y1VA 3GTLA 2YU9K 5TMCA 1R9TK 1BS2A 2YU9A 1WOPA 3VA7A 1R9TA 2JA8C 4WJ4A 4YFKA 1TWAC 3S1QC 2V6TA 4C3JC 4KMUA 4WILA 3V4GA 5FLMC 3RZDK 3HOVK 3GTKC 2O5JA 2R7ZK 4QIWD 2R7ZA 1L0WA 3GDZA 4PAAA 1G51A 1ZVUA 2P5MA 3HOUC 3SZZA 3FOFA 5IYDC 3GTQK 4X6AC 4KM8A 4KM9A 3GTQA 1XZQB 3GTJC 2WAQD 4GTBA 5C44C 1USOA 2W7VA 4LJZA 1O27A 2JA5C 1O24A 3CAGA 4A3GC 1EH1A 4YG2A 1XZQA 1B4AA 1TWCK 2NVQC 4A93C 4GTDA 4C3IC 5M3FK 1O2BA 1TWCA 4DDQA 5M3MK 4A3DC 4C2MK 5IOSA 1J6XA 4XSZA 3QX3A 4GT9A 3H0GC 1O2FB 1ZQ1C 1VJEA 1TWHK 2ZUEA 2E2HC 2NVXA 1XXBA 1VGXA 4KN4A 4BBSK 3S2DC 3GTOK 4A3LK 5C4XC 3CQZC 4GTLA 2V6UA 4XSXA 3GTOA 3GTPK 1WSRA 2A68A 1IE0A 4BXXK 3RZOK 3S1NC 1TWFK 3GTPA 4FZBA 4C3HC 5E68A 2NVTK 2RH6A 2ZFZA 1HQMA 3FKIK 2PMZD 4G7OA 4G0UA 3DXJA 3FKIA 3S1RC 1I3QC 4BY1C 1AB4A 2B63A 4KB2A 3ERED 3H3VD 5IYBC 1EQRA 5IYCK 1XPPA 3PO3C 1YCLA 4LLGA 4XCHA 4A3KC 3K7AK 3TFIA 3HOZK 3GTLC 4A3EK 4KAWX 4GFQA 1JQWA 3LAJA 3MMLB 4KN7A 5C3EK 5CHPA 4Y52K 4Y7NK 1SFOC 1IL2A 3S16K 3HKZD 2R7ZC 2R92K 3S2HC 2WAQL 4A3FK 3GIRA 1F7UA 4AH6A 3A8IA 3TTGA 1WQFA 4P9SA 1DCPA 3GTQC 3M3YK 3S14K 4A3BK 1EFWA 2JA7K 2E2JK 1YNNA 5IP7C 2JA7A 2FQTA 4GZYA 1VH2A 2CW0A 3Q3QA 1HI9A 1I6HK 4KC6A 3S1MC 3S17K 1K83K 3N3YA 3M4OC 5D4DA 3HOYK 1PJ6A 2PPBA 5JFEA 3LPXA 1BJTA 4G7HA 4RMFA 2R93K 3HOWC 3L4KA 1EI6A 2R93A 5FJ8K 5C4JC 2NVXC 2PA8L 4A3MK 1TWGK 3A8JA 3I4NK 2JH3A 4BBSC 2E2IK 3I4MK 1TWGA 3GTOC 1IBAA 2PMZL 3HOXK 1USMA 2E2IA 4A3JC 5M5WK 3GTPC 1F9NA 1SMYA 1O29A 1F7VA 4KDDA 3H3VL 3ADAC 2XCQA 3GSIA 2B63C 5IP9C 3GTGK 3GTGA 4O2DA 4BLAA 1JOEA 2JA8K 4BY7C 1TWAK 5IYCC 1TWHA 4C3JK 4KMHA 3HOZC 3S15C 1WCMK 4NOIA 5HL8A 4AYBL 3GTKK 2PA8D 1WCMA 3HKZL 3PO2C 3GTKA 1ISEA 2RGRA 4PABA 3HOUK 1TWFA 5IYDK 3AD7C 5L46A 2GAGC 1J6WA 2Y3PA 4YFXA 3GTJK 4GTCA 4OIQA 3AD8C 2A6HA 1ZYRA 2WB1D 1IQ0A 3GEHA 3S0XA 5C44K 5TMFA 2A69A 4A3CC 2JA5K 3FOEA 4A3GK 4LQYA 2JA5A 3M3YC 3S14C
chains in the Genus database with same CATH topology
1JQWA 1JVIA 1JOEA 1YCLA 5E68A 1VH2A 4XCHA 1VGXA 1INNA 1J6VA 1J6WA 2FQOA 1J6XA 1IE0A 1VJEA 2FQTA 1J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1JVI A;  1JOE A;  1YCL A;  5E68 A;  1VH2 A;  4XCH A;  1VGX A;  1INN A;  1J6V A;  1J6W A;  2FQO A;  1J6X A;  1IE0 A;  1VJE A;  2FQT A;  1J98 A; 
#chains in the Genus database with same CATH topology
 1Y1V C;  1ZBS A;  4A93 K;  5TJ3 A;  4C3I K;  2GSO A;  3JST A;  2NVY K;  2YU9 C;  3GTM K;  4ZH4 A;  1R9T C;  2E2J C;  2JA6 K;  2NVY A;  3GTM A;  2JA6 A;  3OPF A;  1J98 A;  4LR2 A;  4KAS A;  4AYB D;  2E2H K;  1XXC A;  3S17 C;  3RZD C;  3AD9 C;  2XCO A;  3EQL A;  3HOV C;  2E2H A;  3FHZ A;  4YFN A;  3AQO A;  3N0B A;  5C4X K;  4KB4 A;  3CQZ K;  5EGE A;  2R92 A;  3CQZ A;  3GEE A;  3S1N K;  4ILD A;  4XLN A;  2BE5 A;  1PJ7 A;  3AH5 A;  1EK8 A;  3ORE A;  4OIP A;  2E2I C;  3I4M C;  1IW7 A;  4KMD A;  2GSN A;  1O25 A;  3S1R K;  1I3Q K;  4BY1 K;  1XXA A;  2GSU A;  5IOR A;  1I3Q A;  1VLO A;  1F93 A;  3N0C A;  1O28 A;  4Q4Z A;  1DCO A;  1JVI A;  1TWC C;  4KAR A;  5IYB K;  4J3N A;  4LK1 A;  2Y0S D;  3PO3 K;  4GTF A;  1WOS A;  4A3K K;  1K83 A;  4C2M C;  1RU0 A;  4GTE A;  1DD5 A;  1X31 C;  2VUM K;  1Y1W K;  3G4C A;  2VUM A;  1KQ4 A;  3IPJ A;  4LK0 A;  1YNJ A;  1TWH C;  1Y1W A;  5EGH A;  1WOR A;  3HXA A;  1O26 A;  1SFO K;  4A3L C;  4BBR K;  1VRQ C;  1WCM C;  1SFO A;  4A3I K;  3S2H K;  2WB1 L;  3AQP A;  3RZO C;  4BXX C;  1TWF C;  2NVT C;  5M5X K;  3FKI C;  5CJ9 A;  3SZY A;  3WOD A;  4FM9 A;  4MEX A;  2KWA A;  4BKW A;  1I50 K;  1IS1 A;  4JK1 A;  3BP3 A;  4Q5S A;  3T01 A;  3T02 A;  1I50 A;  4WJ3 M;  5IP7 K;  4QJV B;  2FQO A;  3S1Q K;  1XZP B;  2P8T A;  3T00 A;  1WQH A;  1WOO A;  3K7A C;  1TWA A;  3S1M K;  4LOW A;  3M4O K;  5FLM K;  3L4J A;  4BLB A;  4A3E C;  2NVY C;  3GTM C;  4MEY A;  2JA6 C;  1WSV A;  4MQ9 A;  3HOW K;  1V5V A;  4QJV A;  1XZP A;  3TFH A;  5C4J K;  5C3E C;  4X6A K;  2NVX K;  4Y52 C;  1B4B A;  4Y7N C;  2ZUF A;  2GAH C;  2V6S A;  3S16 C;  1J6V A;  2EBB A;  4XLP A;  3GTJ A;  4OIO A;  2R92 C;  4A3J K;  4KAT A;  2D6F C;  4A3F C;  5IOT A;  5M5Y K;  3LAP A;  1DCH A;  1GE9 A;  4KMA A;  4A3B C;  2NVQ K;  1C0A A;  1I6V A;  4P5B A;  1BDF A;  3GEI A;  2JA7 C;  4A3D K;  2Y0S L;  2B63 K;  5IP9 K;  2O5I A;  2PHC B;  3H0G K;  1PJ5 A;  1WIH A;  3H0G A;  1I6H C;  1K83 C;  4BY7 K;  3HOY C;  2CFA B;  3S2D K;  2XCR B;  4GTA A;  4M1X A;  1YX2 A;  3S15 K;  2R93 C;  2VUM C;  4G0W A;  5JVO A;  1ZXO A;  3BUE A;  1Y1W C;  3PO2 K;  2A6E A;  3A8K A;  4A3M C;  4QIW L;  4C3H K;  3NUH A;  1TWG C;  2CFA A;  4OIR A;  3I4N C;  4G0V A;  4G7Z A;  4BBR C;  3HOX C;  1UV7 A;  3TFJ A;  4A3I C;  4C45 A;  1WQG A;  1O2A A;  4A3C K;  3OEP A;  3G4A A;  1BGW A;  4OIN A;  5IOQ A;  1Y1V K;  1INN A;  3BP8 C;  3GTL K;  3GTG C;  1I50 C;  4P5A A;  1Y1V A;  3GTL A;  2YU9 K;  5TMC A;  1R9T K;  1BS2 A;  2YU9 A;  1WOP A;  3VA7 A;  1R9T A;  2JA8 C;  4WJ4 A;  4YFK A;  1TWA C;  3S1Q C;  2V6T A;  4C3J C;  4KMU A;  4WIL A;  3V4G A;  5FLM C;  3RZD K;  3HOV K;  3GTK C;  2O5J A;  2R7Z K;  4QIW D;  2R7Z A;  1L0W A;  3GDZ A;  4PAA A;  1G51 A;  1ZVU A;  2P5M A;  3HOU C;  3SZZ A;  3FOF A;  5IYD C;  3GTQ K;  4X6A C;  4KM8 A;  4KM9 A;  3GTQ A;  1XZQ B;  3GTJ C;  2WAQ D;  4GTB A;  5C44 C;  1USO A;  2W7V A;  4LJZ A;  1O27 A;  2JA5 C;  1O24 A;  3CAG A;  4A3G C;  1EH1 A;  4YG2 A;  1XZQ A;  1B4A A;  1TWC K;  2NVQ C;  4A93 C;  4GTD A;  4C3I C;  5M3F K;  1O2B A;  1TWC A;  4DDQ A;  5M3M K;  4A3D C;  4C2M K;  5IOS A;  1J6X A;  4XSZ A;  3QX3 A;  4GT9 A;  3H0G C;  1O2F B;  1ZQ1 C;  1VJE A;  1TWH K;  2ZUE A;  2E2H C;  2NVX A;  1XXB A;  1VGX A;  4KN4 A;  4BBS K;  3S2D C;  3GTO K;  4A3L K;  5C4X C;  3CQZ C;  4GTL A;  2V6U A;  4XSX A;  3GTO A;  3GTP K;  1WSR A;  2A68 A;  1IE0 A;  4BXX K;  3RZO K;  3S1N C;  1TWF K;  3GTP A;  4FZB A;  4C3H C;  5E68 A;  2NVT K;  2RH6 A;  2ZFZ A;  1HQM A;  3FKI K;  2PMZ D;  4G7O A;  4G0U A;  3DXJ A;  3FKI A;  3S1R C;  1I3Q C;  4BY1 C;  1AB4 A;  2B63 A;  4KB2 A;  3ERE D;  3H3V D;  5IYB C;  1EQR A;  5IYC K;  1XPP A;  3PO3 C;  1YCL A;  4LLG A;  4XCH A;  4A3K C;  3K7A K;  3TFI A;  3HOZ K;  3GTL C;  4A3E K;  4KAW X;  4GFQ A;  1JQW A;  3LAJ A;  3MML B;  4KN7 A;  5C3E K;  5CHP A;  4Y52 K;  4Y7N K;  1SFO C;  1IL2 A;  3S16 K;  3HKZ D;  2R7Z C;  2R92 K;  3S2H C;  2WAQ L;  4A3F K;  3GIR A;  1F7U A;  4AH6 A;  3A8I A;  3TTG A;  1WQF A;  4P9S A;  1DCP A;  3GTQ C;  3M3Y K;  3S14 K;  4A3B K;  1EFW A;  2JA7 K;  2E2J K;  1YNN A;  5IP7 C;  2JA7 A;  2FQT A;  4GZY A;  1VH2 A;  2CW0 A;  3Q3Q A;  1HI9 A;  1I6H K;  4KC6 A;  3S1M C;  3S17 K;  1K83 K;  3N3Y A;  3M4O C;  5D4D A;  3HOY K;  1PJ6 A;  2PPB A;  5JFE A;  3LPX A;  1BJT A;  4G7H A;  4RMF A;  2R93 K;  3HOW C;  3L4K A;  1EI6 A;  2R93 A;  5FJ8 K;  5C4J C;  2NVX C;  2PA8 L;  4A3M K;  1TWG K;  3A8J A;  3I4N K;  2JH3 A;  4BBS C;  2E2I K;  3I4M K;  1TWG A;  3GTO C;  1IBA A;  2PMZ L;  3HOX K;  1USM A;  2E2I A;  4A3J C;  5M5W K;  3GTP C;  1F9N A;  1SMY A;  1O29 A;  1F7V A;  4KDD A;  3H3V L;  3ADA C;  2XCQ A;  3GSI A;  2B63 C;  5IP9 C;  3GTG K;  3GTG A;  4O2D A;  4BLA A;  1JOE A;  2JA8 K;  4BY7 C;  1TWA K;  5IYC C;  1TWH A;  4C3J K;  4KMH A;  3HOZ C;  3S15 C;  1WCM K;  4NOI A;  5HL8 A;  4AYB L;  3GTK K;  2PA8 D;  1WCM A;  3HKZ L;  3PO2 C;  3GTK A;  1ISE A;  2RGR A;  4PAB A;  3HOU K;  1TWF A;  5IYD K;  3AD7 C;  5L46 A;  2GAG C;  1J6W A;  2Y3P A;  4YFX A;  3GTJ K;  4GTC A;  4OIQ A;  3AD8 C;  2A6H A;  1ZYR A;  2WB1 D;  1IQ0 A;  3GEH A;  3S0X A;  5C44 K;  5TMF A;  2A69 A;  4A3C C;  2JA5 K;  3FOE A;  4A3G K;  4LQY A;  2JA5 A;  3M3Y C;  3S14 C; 
#chains in the Genus database with same CATH homology
 1JQW A;  1JVI A;  1JOE A;  1YCL A;  5E68 A;  1VH2 A;  4XCH A;  1VGX A;  1INN A;  1J6V A;  1J6W A;  2FQO A;  1J6X A;  1IE0 A;  1VJE A;  2FQT A;  1J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...