1INNA

Crystal structure of d. radiodurans luxs, p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
NVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1innA00
1YCLA 1JQWA 1VGXA 2FQTA 1J6XA 1IE0A 5E68A 1VH2A 1VJEA 2FQOA 1JVIA 4XCHA 1J6WA 1J6VA 1INNA 1J98A 1JOEA
chains in the Genus database with same CATH superfamily
1X31C 1O2FB 2JA7A 4BBRK 3I4MC 3OEPA 2GAGC 2Y3PA 4G7HA 1KQ4A 4ZH4A 4KDDA 1WCMC 3S2HK 4QJVB 1L0WA 3GTKA 1SFOC 4JK1A 1INNA 2NVXA 2XCQA 4QJVA 3GTMA 5IORA 4FM9A 4A3MK 3N3YA 4WILA 4A3LC 4M1XA 2A6HA 2JA6C 4NOIA 1I6VA 3K7AK 4YG2A 2R92K 4A3KK 2A6EA 2XCOA 1EI6A 4LK1A 3M3YK 4KMDA 2EBBA 2ZUFA 1WIHA 1IQ0A 3ADAC 4C3IC 3GTPC 1PJ7A 1TWGK 1F9NA 3S16K 4BXXC 3GTGA 1TWHC 4PAAA 1YX2A 2PHCB 1IE0A 1XZQB 1IL2A 4GTBA 2NVTK 3H3VD 3HOZC 3GTOK 1O26A 3GEHA 4AH6A 1XZQA 1TWFK 3V4GA 3N0CA 2VUMK 1I50C 4AYBL 4P9SA 4A3EK 3AD9C 4YFKA 4A3JK 3SZYA 1Y1VA 1YCLA 4XSXA 2R92A 3IPJA 2R93A 3RZOC 3FOFA 2JH3A 4X6AC 3T01A 2NVQK 4A93K 3GSIA 3ERED 3BP8C 2YU9A 5IP9K 4KASA 3VA7A 4BBSC 1B4AA 1G51A 4LJZA 1I3QC 1USMA 4RMFA 3CQZK 2WB1D 4KM9A 1TWCK 1K83K 3S1MK 2B63C 3OPFA 2RH6A 2JA7K 5IYCC 3S1NK 2JA5C 1SFOA 4XCHA 3HOUK 5FLMC 1WOSA 1TWAC 4G0VA 3TTGA 2A68A 2V6TA 4A3BK 4LOWA 4KM8A 2JA6A 3GTKK 2E2IK 2WAQL 1WSRA 2NVYC 4GTDA 1YNJA 5C4JK 3Q3QA 5IP7K 3N0BA 4C3JK 3G4AA 1Y1WC 4G7ZA 3GTJC 1EQRA 3GTPA 4GTFA 4G7OA 3M4OC 3CQZA 1TWHA 2PMZL 2RGRA 4Y52K 2P5MA 4A3MC 1O27A 3OREA 4KARA 1I6HK 1XZPA 3GTGK 3S14K 4A3IC 1I50A 3FOEA 1VJEA 1O24A 1PJ6A 3M3YC 3HOWC 3NUHA 2FQTA 4OIPA 1RU0A 2E2JC 1O25A 4BLAA 1R9TC 2A69A 1WQFA 1IW7A 2E2IA 3H0GC 4KB4A 3FKIC 4KB2A 4BLBA 2R7ZC 1DCOA 1Y1VK 5IYBC 4WJ4A 5M5XK 1WQHA 1O29A 4O2DA 4AYBD 5JFEA 2VUMC 3HOVC 4BY7C 3S1QK 2R93K 5HL8A 3GIRA 5EGEA 3WODA 4OIOA 5TJ3A 1DD5A 1I3QA 4A3JC 1J98A 3AD7C 4GTCA 2PA8L 2YU9K 4XSZA 4A3GC 3SZZA 4QIWL 4Y7NC 4MEXA 4P5AA 3G4CA 4C2MK 4G0WA 3GTLC 2B63A 1V5VA 4KMHA 1XPPA 1WQGA 4KN4A 3RZDC 3T00A 2D6FC 3I4MK 3S2DK 4A3CC 5IOSA 1HQMA 1J6VA 4A3DC 4LQYA 5TMCA 3A8JA 1ZQ1C 1SFOK 3GTQC 3AQOA 1TWCC 5CHPA 4BY1C 2GSNA 2CFAB 3HOXC 4GTAA 2CFAA 3FHZA 4A3LK 3AH5A 5FJ8K 1Y1WA 2JA6K 4C3HC 1USOA 3I4NC 3HOUC 5E68A 5IYDC 5IOTA 2E2HA 4C3IK 3GTPK 2WAQD 3S17C 2NVXC 4BXXK 2JA8C 4KN7A 4OIQA 1WORA 1TWHK 3PO3C 2CW0A 1UV7A 3GTMC 3S1RC 2ZFZA 4P5BA 3LPXA 1EK8A 5D4DA 3CAGA 3HOZK 2ZUEA 3GEEA 1WCMA 5M3MK 1R9TA 3A8KA 5C4XK 1BS2A 3BP3A 3T02A 2PMZD 1I50K 3S15C 3PO2K 4A3FC 3FKIA 5EGHA 2R7ZA 5CJ9A 1JQWA 4BBRC 1IBAA 3RZOK 3L4JA 1ZBSA 3AD8C 4LR2A 4G0UA 1ZVUA 3S2HC 4Q5SA 4KC6A 3L4KA 5L46A 2XCRB 4BBSK 1JOEA 2BE5A 1AB4A 1I3QK 1DCHA 1J6XA 3GTLA 2O5JA 1XZPB 4Q4ZA 2FQOA 2O5IA 4MQ9A 3K7AC 2R92C 4A3KC 4C45A 4FZBA 3DXJA 3TFHA 5C3EK 1XXBA 2B63K 3JSTA 2PA8D 3HOYK 5IYCK 4A3FK 3HXAA 2JA5K 1TWGC 4KMUA 3LAPA 2YU9C 3S16C 4QIWD 1ZYRA 1VGXA 5FLMK 1YNNA 2GAHC 1TWAK 4C2MC 1HI9A 2NVTC 3HKZL 3GTOC 1TWFC 1WOPA 5C44K 2GSOA 3S2DC 2NVYK 3GEIA 4KAWX 1XXCA 4A3EC 4OINA 2Y0SL 1IS1A 1Y1WK 3GTJK 4DDQA 4GZYA 1JVIA 5M5YK 3M4OK 2V6UA 4ILDA 1BGWA 2E2HK 4KMAA 5M5WK 2NVQC 4A93C 4LLGA 4BKWA 2JA5A 4A3IK 5IP9C 2W7VA 3HOWK 1TWAA 2E2JK 1WCMK 1F7UA 1R9TK 4LK0A 3A8IA 3CQZC 3TFJA 1WOOA 5TMFA 3H0GK 1K83C 2NVYA 3S1MC 4KATA 3FKIK 2R7ZK 3GDZA 5IYBK 2JA7C 1O28A 3S1NC 2P8TA 5C4XC 3GTJA 3HOVK 4BY7K 1B4BA 3PO2C 5M3FK 5IOQA 4GT9A 1O2AA 1PJ5A 4A3BC 4GTEA 3GTKC 2E2IC 4GTLA 4A3GK 4XLNA 3QX3A 3AQPA 5C4JC 4Y7NK 4YFNA 3GTLK 1F93A 5IP7C 4PABA 4C3JC 3H3VL 1EH1A 1C0AA 1XXAA 3RZDK 1J6WA 1TWGA 4A3CK 1BDFA 3H0GA 4A3DK 3LAJA 4Y52C 1ISEA 3TFIA 1ZXOA 2PPBA 3GTOA 1I6HC 4GFQA 3GTGC 1O2BA 1VRQC 1TWFA 3GTQK 3S14C 4BY1K 1VH2A 2VUMA 3HOXK 5C3EC 4OIRA 3BUEA 3HOYC 4X6AK 4C3HK 4MEYA 4XLPA 3I4NK 5IYDK 3EQLA 2GSUA 3HKZD 1WSVA 4J3NA 1Y1VC 4YFXA 5JVOA 3S17K 1BJTA 2NVXK 5C44C 2JA8K 1VLOA 3PO3K 3MMLB 3S1QC 2R93C 2WB1L 3GTMK 2V6SA 1SMYA 3S1RK 2Y0SD 1F7VA 4WJ3M 1DCPA 3S0XA 3GTQA 3S15K 1TWCA 1EFWA 1K83A 2KWAA 1GE9A 2E2HC
chains in the Genus database with same CATH topology
1YCLA 1JQWA 1VGXA 2FQTA 1J6XA 1IE0A 5E68A 1VH2A 1VJEA 2FQOA 1JVIA 4XCHA 1J6WA 1J6VA 1INNA 1J98A 1JOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  1JQW A;  1VGX A;  2FQT A;  1J6X A;  1IE0 A;  5E68 A;  1VH2 A;  1VJE A;  2FQO A;  1JVI A;  4XCH A;  1J6W A;  1J6V A;  1INN A;  1J98 A;  1JOE A; 
#chains in the Genus database with same CATH topology
 1X31 C;  1O2F B;  2JA7 A;  4BBR K;  3I4M C;  3OEP A;  2GAG C;  2Y3P A;  4G7H A;  1KQ4 A;  4ZH4 A;  4KDD A;  1WCM C;  3S2H K;  4QJV B;  1L0W A;  3GTK A;  1SFO C;  4JK1 A;  1INN A;  2NVX A;  2XCQ A;  4QJV A;  3GTM A;  5IOR A;  4FM9 A;  4A3M K;  3N3Y A;  4WIL A;  4A3L C;  4M1X A;  2A6H A;  2JA6 C;  4NOI A;  1I6V A;  3K7A K;  4YG2 A;  2R92 K;  4A3K K;  2A6E A;  2XCO A;  1EI6 A;  4LK1 A;  3M3Y K;  4KMD A;  2EBB A;  2ZUF A;  1WIH A;  1IQ0 A;  3ADA C;  4C3I C;  3GTP C;  1PJ7 A;  1TWG K;  1F9N A;  3S16 K;  4BXX C;  3GTG A;  1TWH C;  4PAA A;  1YX2 A;  2PHC B;  1IE0 A;  1XZQ B;  1IL2 A;  4GTB A;  2NVT K;  3H3V D;  3HOZ C;  3GTO K;  1O26 A;  3GEH A;  4AH6 A;  1XZQ A;  1TWF K;  3V4G A;  3N0C A;  2VUM K;  1I50 C;  4AYB L;  4P9S A;  4A3E K;  3AD9 C;  4YFK A;  4A3J K;  3SZY A;  1Y1V A;  1YCL A;  4XSX A;  2R92 A;  3IPJ A;  2R93 A;  3RZO C;  3FOF A;  2JH3 A;  4X6A C;  3T01 A;  2NVQ K;  4A93 K;  3GSI A;  3ERE D;  3BP8 C;  2YU9 A;  5IP9 K;  4KAS A;  3VA7 A;  4BBS C;  1B4A A;  1G51 A;  4LJZ A;  1I3Q C;  1USM A;  4RMF A;  3CQZ K;  2WB1 D;  4KM9 A;  1TWC K;  1K83 K;  3S1M K;  2B63 C;  3OPF A;  2RH6 A;  2JA7 K;  5IYC C;  3S1N K;  2JA5 C;  1SFO A;  4XCH A;  3HOU K;  5FLM C;  1WOS A;  1TWA C;  4G0V A;  3TTG A;  2A68 A;  2V6T A;  4A3B K;  4LOW A;  4KM8 A;  2JA6 A;  3GTK K;  2E2I K;  2WAQ L;  1WSR A;  2NVY C;  4GTD A;  1YNJ A;  5C4J K;  3Q3Q A;  5IP7 K;  3N0B A;  4C3J K;  3G4A A;  1Y1W C;  4G7Z A;  3GTJ C;  1EQR A;  3GTP A;  4GTF A;  4G7O A;  3M4O C;  3CQZ A;  1TWH A;  2PMZ L;  2RGR A;  4Y52 K;  2P5M A;  4A3M C;  1O27 A;  3ORE A;  4KAR A;  1I6H K;  1XZP A;  3GTG K;  3S14 K;  4A3I C;  1I50 A;  3FOE A;  1VJE A;  1O24 A;  1PJ6 A;  3M3Y C;  3HOW C;  3NUH A;  2FQT A;  4OIP A;  1RU0 A;  2E2J C;  1O25 A;  4BLA A;  1R9T C;  2A69 A;  1WQF A;  1IW7 A;  2E2I A;  3H0G C;  4KB4 A;  3FKI C;  4KB2 A;  4BLB A;  2R7Z C;  1DCO A;  1Y1V K;  5IYB C;  4WJ4 A;  5M5X K;  1WQH A;  1O29 A;  4O2D A;  4AYB D;  5JFE A;  2VUM C;  3HOV C;  4BY7 C;  3S1Q K;  2R93 K;  5HL8 A;  3GIR A;  5EGE A;  3WOD A;  4OIO A;  5TJ3 A;  1DD5 A;  1I3Q A;  4A3J C;  1J98 A;  3AD7 C;  4GTC A;  2PA8 L;  2YU9 K;  4XSZ A;  4A3G C;  3SZZ A;  4QIW L;  4Y7N C;  4MEX A;  4P5A A;  3G4C A;  4C2M K;  4G0W A;  3GTL C;  2B63 A;  1V5V A;  4KMH A;  1XPP A;  1WQG A;  4KN4 A;  3RZD C;  3T00 A;  2D6F C;  3I4M K;  3S2D K;  4A3C C;  5IOS A;  1HQM A;  1J6V A;  4A3D C;  4LQY A;  5TMC A;  3A8J A;  1ZQ1 C;  1SFO K;  3GTQ C;  3AQO A;  1TWC C;  5CHP A;  4BY1 C;  2GSN A;  2CFA B;  3HOX C;  4GTA A;  2CFA A;  3FHZ A;  4A3L K;  3AH5 A;  5FJ8 K;  1Y1W A;  2JA6 K;  4C3H C;  1USO A;  3I4N C;  3HOU C;  5E68 A;  5IYD C;  5IOT A;  2E2H A;  4C3I K;  3GTP K;  2WAQ D;  3S17 C;  2NVX C;  4BXX K;  2JA8 C;  4KN7 A;  4OIQ A;  1WOR A;  1TWH K;  3PO3 C;  2CW0 A;  1UV7 A;  3GTM C;  3S1R C;  2ZFZ A;  4P5B A;  3LPX A;  1EK8 A;  5D4D A;  3CAG A;  3HOZ K;  2ZUE A;  3GEE A;  1WCM A;  5M3M K;  1R9T A;  3A8K A;  5C4X K;  1BS2 A;  3BP3 A;  3T02 A;  2PMZ D;  1I50 K;  3S15 C;  3PO2 K;  4A3F C;  3FKI A;  5EGH A;  2R7Z A;  5CJ9 A;  1JQW A;  4BBR C;  1IBA A;  3RZO K;  3L4J A;  1ZBS A;  3AD8 C;  4LR2 A;  4G0U A;  1ZVU A;  3S2H C;  4Q5S A;  4KC6 A;  3L4K A;  5L46 A;  2XCR B;  4BBS K;  1JOE A;  2BE5 A;  1AB4 A;  1I3Q K;  1DCH A;  1J6X A;  3GTL A;  2O5J A;  1XZP B;  4Q4Z A;  2FQO A;  2O5I A;  4MQ9 A;  3K7A C;  2R92 C;  4A3K C;  4C45 A;  4FZB A;  3DXJ A;  3TFH A;  5C3E K;  1XXB A;  2B63 K;  3JST A;  2PA8 D;  3HOY K;  5IYC K;  4A3F K;  3HXA A;  2JA5 K;  1TWG C;  4KMU A;  3LAP A;  2YU9 C;  3S16 C;  4QIW D;  1ZYR A;  1VGX A;  5FLM K;  1YNN A;  2GAH C;  1TWA K;  4C2M C;  1HI9 A;  2NVT C;  3HKZ L;  3GTO C;  1TWF C;  1WOP A;  5C44 K;  2GSO A;  3S2D C;  2NVY K;  3GEI A;  4KAW X;  1XXC A;  4A3E C;  4OIN A;  2Y0S L;  1IS1 A;  1Y1W K;  3GTJ K;  4DDQ A;  4GZY A;  1JVI A;  5M5Y K;  3M4O K;  2V6U A;  4ILD A;  1BGW A;  2E2H K;  4KMA A;  5M5W K;  2NVQ C;  4A93 C;  4LLG A;  4BKW A;  2JA5 A;  4A3I K;  5IP9 C;  2W7V A;  3HOW K;  1TWA A;  2E2J K;  1WCM K;  1F7U A;  1R9T K;  4LK0 A;  3A8I A;  3CQZ C;  3TFJ A;  1WOO A;  5TMF A;  3H0G K;  1K83 C;  2NVY A;  3S1M C;  4KAT A;  3FKI K;  2R7Z K;  3GDZ A;  5IYB K;  2JA7 C;  1O28 A;  3S1N C;  2P8T A;  5C4X C;  3GTJ A;  3HOV K;  4BY7 K;  1B4B A;  3PO2 C;  5M3F K;  5IOQ A;  4GT9 A;  1O2A A;  1PJ5 A;  4A3B C;  4GTE A;  3GTK C;  2E2I C;  4GTL A;  4A3G K;  4XLN A;  3QX3 A;  3AQP A;  5C4J C;  4Y7N K;  4YFN A;  3GTL K;  1F93 A;  5IP7 C;  4PAB A;  4C3J C;  3H3V L;  1EH1 A;  1C0A A;  1XXA A;  3RZD K;  1J6W A;  1TWG A;  4A3C K;  1BDF A;  3H0G A;  4A3D K;  3LAJ A;  4Y52 C;  1ISE A;  3TFI A;  1ZXO A;  2PPB A;  3GTO A;  1I6H C;  4GFQ A;  3GTG C;  1O2B A;  1VRQ C;  1TWF A;  3GTQ K;  3S14 C;  4BY1 K;  1VH2 A;  2VUM A;  3HOX K;  5C3E C;  4OIR A;  3BUE A;  3HOY C;  4X6A K;  4C3H K;  4MEY A;  4XLP A;  3I4N K;  5IYD K;  3EQL A;  2GSU A;  3HKZ D;  1WSV A;  4J3N A;  1Y1V C;  4YFX A;  5JVO A;  3S17 K;  1BJT A;  2NVX K;  5C44 C;  2JA8 K;  1VLO A;  3PO3 K;  3MML B;  3S1Q C;  2R93 C;  2WB1 L;  3GTM K;  2V6S A;  1SMY A;  3S1R K;  2Y0S D;  1F7V A;  4WJ3 M;  1DCP A;  3S0X A;  3GTQ A;  3S15 K;  1TWC A;  1EFW A;  1K83 A;  2KWA A;  1GE9 A;  2E2H C; 
#chains in the Genus database with same CATH homology
 1YCL A;  1JQW A;  1VGX A;  2FQT A;  1J6X A;  1IE0 A;  5E68 A;  1VH2 A;  1VJE A;  2FQO A;  1JVI A;  4XCH A;  1J6W A;  1J6V A;  1INN A;  1J98 A;  1JOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...