1INNA

Crystal structure of d. radiodurans luxs, p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
NVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1innA00
1VJEA 2FQOA 1INNA 5E68A 1JQWA 1VGXA 2FQTA 1J98A 1J6XA 1IE0A 1VH2A 1J6WA 1J6VA 1JVIA 1YCLA 4XCHA 1JOEA
chains in the Genus database with same CATH superfamily
1F93A 4OINA 4A3IC 1I50C 4FM9A 4KAWX 3HOVC 3S17K 3FOFA 4MQ9A 2FQTA 4A3GC 5IOQA 3S2DC 1XZPB 2JA6A 1I6HC 2R93K 1XZPA 3CQZA 4G7OA 2E2JK 2PA8L 4A93K 4BLAA 4G0UA 3GTKA 3RZOK 2W7VA 2JA7C 1TWFC 3H3VL 3H3VD 4OIRA 2VUMA 1WSRA 1TWAK 1O25A 1VLOA 4LK0A 4KM8A 1VH2A 4XSZA 4BY1K 3S1NC 4GTDA 1WOPA 2E2IC 3AD8C 3PO3K 4OIPA 1SMYA 4GFQA 3HKZL 3HKZD 4RMFA 5TMCA 3VA7A 1TWFA 4AH6A 2V6UA 2JA7A 2KWAA 3AD7C 3H0GA 4QIWD 2E2IK 1JVIA 3RZDK 3N0CA 1WQGA 3CQZC 3GTKC 4C2MC 5C44K 3V4GA 3PO2K 1VRQC 4A3DC 5IP7K 4LR2A 2A6HA 1TWHA 1HQMA 1K83C 3GTMK 2A69A 3I4MK 4A3DK 4A3KC 2JA5C 1Y1VC 4GTAA 4XCHA 4KMDA 1O27A 2JA8K 4OIQA 1Y1WC 4C3HC 5IYDC 3GTOA 3Q3QA 3FKIK 3GTMC 3GTOC 1XPPA 1TWAC 4G0VA 4XLPA 1SFOK 1O2BA 3S1RK 4A3BC 5C4XK 3M4OC 5EGHA 1AB4A 4XSXA 4A3CK 5JFEA 3GEIA 1YX2A 2WB1L 4QIWL 2YU9A 1O2AA 2EBBA 5IP7C 1VGXA 3GSIA 4A3KK 3FKIC 3S1MC 3GTJC 1INNA 1JQWA 2GAGC 1WCMK 3GTGK 4J3NA 3QX3A 3ERED 1ZQ1C 2NVXK 2NVTC 2JA6K 3HOYC 2FQOA 3H0GC 1Y1WK 3S1QC 1WIHA 1J6XA 3CQZK 3S2HK 4Q4ZA 2R92C 3JSTA 4KB4A 4C2MK 5IYCC 4BY7C 3AH5A 2CFAB 4GTLA 4O2DA 5M5WK 4G7ZA 2VUMK 4MEXA 1ZBSA 4A3JK 1R9TK 2B63A 1XZQB 1WQHA 2E2HC 4DDQA 5M5XK 5TMFA 1HI9A 1XZQA 1TWGK 1F9NA 3LAJA 5IORA 1G51A 3NUHA 2GSOA 1TWGC 1IL2A 5L46A 2D6FC 1J6VA 3HOXK 4BLBA 4LK1A 5JVOA 2R7ZA 4Y52C 2O5IA 4Y52K 3HXAA 2A6EA 1TWCA 5M3FK 1WOSA 1WORA 3FHZA 3FOEA 4BKWA 1BGWA 3H0GK 3S1QK 4Y7NK 3BP8C 3IPJA 1EK8A 2JH3A 4YG2A 3GEEA 3A8JA 2RH6A 3AQPA 1C0AA 4KDDA 1VJEA 3GTLK 1TWHC 1TWCC 3TFHA 1O26A 5IP9C 3GTQK 3S17C 1J6WA 2BE5A 4GTFA 3WODA 2E2HK 4LLGA 2WAQD 1I3QA 5IOSA 4C45A 3PO3C 1PJ7A 1ZYRA 2NVQC 1IW7A 3HOWC 2XCRB 1L0WA 2NVQK 2PMZL 4KARA 1YNNA 4ILDA 3S16C 3S15C 1PJ5A 4A3EC 2R93A 4LOWA 4KMHA 2B63C 4A3FK 3SZZA 3GTPK 3GTPC 2V6SA 3L4JA 2V6TA 3OEPA 3MMLB 1I3QC 2R92A 2ZUEA 5TJ3A 3EQLA 3I4MC 1EH1A 4LJZA 2JA5K 1I50K 1Y1VK 4BY1C 4GZYA 1WCMA 4A3GK 3GTGA 4FZBA 3HOZC 2CFAA 4KMUA 1ISEA 3I4NC 1WQFA 1KQ4A 3HOUC 1TWFK 3HOWK 3HOUK 3RZOC 1K83K 1WSVA 4PAAA 2JA7K 1JOEA 3SZYA 4KN7A 3BP3A 4C3JK 2ZUFA 1IQ0A 4WILA 4ZH4A 3S1RC 3RZDC 4KMAA 1TWGA 1YNJA 4AYBD 3HOZK 4GTBA 1EI6A 3A8KA 1ZVUA 2RGRA 4M1XA 1XXBA 2WB1D 4NOIA 4A3IK 4A3LC 1V5VA 1PJ6A 4KASA 1O24A 1BDFA 4WJ3M 3G4AA 2NVYK 5FJ8K 2JA8C 1WCMC 5CJ9A 4PABA 1IS1A 1ZXOA 3CAGA 5FLMC 4GT9A 1USOA 1BS2A 1DD5A 2Y0SD 5IYDK 5C44C 2XCQA 3T01A 3GTJA 1WOOA 4KATA 3ADAC 4OIOA 3G4CA 4BBSK 2P8TA 4BXXC 4BBSC 4A3JC 5C4XC 5E68A 3N0BA 1X31C 2NVYC 4BXXK 3OREA 4AYBL 2R93C 1EQRA 3HOYK 1B4AA 5C4JK 1IBAA 4A93C 4YFKA 5C3EC 4WJ4A 3GEHA 3M3YK 5M5YK 2PA8D 5IYCK 2E2IA 1BJTA 4BBRC 3PO2C 3BUEA 1DCHA 5D4DA 4BBRK 1O29A 2PHCB 3S0XA 4QJVB 3GTMA 1USMA 2NVXA 4X6AC 4XLNA 3TFJA 4LQYA 2O5JA 4Y7NC 5FLMK 1O2FB 3N3YA 1RU0A 3M3YC 4GTEA 5EGEA 4KC6A 4YFXA 1XXAA 4A3LK 3GTOK 2JA5A 3FKIA 1I50A 4A3MC 4P9SA 1Y1VA 1SFOC 4GTCA 1EFWA 2JA6C 4X6AK 1SFOA 3A8IA 3K7AC 5C4JC 4C3HK 1DCOA 1XXCA 3GTKK 4JK1A 3OPFA 2Y3PA 4QJVA 4KN4A 5HL8A 2YU9K 3GDZA 1TWCK 4G7HA 1TWAA 2R7ZC 4A3MK 3T02A 4A3EK 3M4OK 3S14C 2NVXC 2NVTK 3K7AK 3AD9C 4KB2A 5C3EK 2WAQL 4Q5SA 1O28A 4P5AA 1Y1WA 4C3IC 3LPXA 4BY7K 1YCLA 2GSUA 1UV7A 3S1MK 4G0WA 2VUMC 3T00A 3S15K 3TFIA 4A3BK 1GE9A 3GTGC 2NVYA 3S2DK 1R9TA 2B63K 1I6VA 1I6HK 3S14K 4A3FC 2GAHC 4A3CC 5IYBK 3S2HC 3TTGA 2ZFZA 2Y0SL 3I4NK 1TWHK 2YU9C 3HOVK 3GTJK 2R7ZK 1DCPA 1R9TC 2CW0A 3GTPA 4C3JC 3S1NK 5IOTA 1F7VA 3L4KA 2E2JC 2R92K 2GSNA 4P5BA 4MEYA 3AQOA 3HOXC 3LAPA 1J98A 4YFNA 3GTLC 2XCOA 5IP9K 3GTQC 3GTLA 1F7UA 4KM9A 2PPBA 3GTQA 3S16K 2P5MA 1IE0A 3GIRA 5M3MK 3DXJA 2A68A 5IYBC 2E2HA 1I3QK 1B4BA 5CHPA 4C3IK 1K83A 2PMZD
chains in the Genus database with same CATH topology
1VJEA 2FQOA 1INNA 5E68A 1JQWA 1VGXA 2FQTA 1J98A 1J6XA 1IE0A 1VH2A 1J6WA 1J6VA 1JVIA 1YCLA 4XCHA 1JOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJE A;  2FQO A;  1INN A;  5E68 A;  1JQW A;  1VGX A;  2FQT A;  1J98 A;  1J6X A;  1IE0 A;  1VH2 A;  1J6W A;  1J6V A;  1JVI A;  1YCL A;  4XCH A;  1JOE A; 
#chains in the Genus database with same CATH topology
 1F93 A;  4OIN A;  4A3I C;  1I50 C;  4FM9 A;  4KAW X;  3HOV C;  3S17 K;  3FOF A;  4MQ9 A;  2FQT A;  4A3G C;  5IOQ A;  3S2D C;  1XZP B;  2JA6 A;  1I6H C;  2R93 K;  1XZP A;  3CQZ A;  4G7O A;  2E2J K;  2PA8 L;  4A93 K;  4BLA A;  4G0U A;  3GTK A;  3RZO K;  2W7V A;  2JA7 C;  1TWF C;  3H3V L;  3H3V D;  4OIR A;  2VUM A;  1WSR A;  1TWA K;  1O25 A;  1VLO A;  4LK0 A;  4KM8 A;  1VH2 A;  4XSZ A;  4BY1 K;  3S1N C;  4GTD A;  1WOP A;  2E2I C;  3AD8 C;  3PO3 K;  4OIP A;  1SMY A;  4GFQ A;  3HKZ L;  3HKZ D;  4RMF A;  5TMC A;  3VA7 A;  1TWF A;  4AH6 A;  2V6U A;  2JA7 A;  2KWA A;  3AD7 C;  3H0G A;  4QIW D;  2E2I K;  1JVI A;  3RZD K;  3N0C A;  1WQG A;  3CQZ C;  3GTK C;  4C2M C;  5C44 K;  3V4G A;  3PO2 K;  1VRQ C;  4A3D C;  5IP7 K;  4LR2 A;  2A6H A;  1TWH A;  1HQM A;  1K83 C;  3GTM K;  2A69 A;  3I4M K;  4A3D K;  4A3K C;  2JA5 C;  1Y1V C;  4GTA A;  4XCH A;  4KMD A;  1O27 A;  2JA8 K;  4OIQ A;  1Y1W C;  4C3H C;  5IYD C;  3GTO A;  3Q3Q A;  3FKI K;  3GTM C;  3GTO C;  1XPP A;  1TWA C;  4G0V A;  4XLP A;  1SFO K;  1O2B A;  3S1R K;  4A3B C;  5C4X K;  3M4O C;  5EGH A;  1AB4 A;  4XSX A;  4A3C K;  5JFE A;  3GEI A;  1YX2 A;  2WB1 L;  4QIW L;  2YU9 A;  1O2A A;  2EBB A;  5IP7 C;  1VGX A;  3GSI A;  4A3K K;  3FKI C;  3S1M C;  3GTJ C;  1INN A;  1JQW A;  2GAG C;  1WCM K;  3GTG K;  4J3N A;  3QX3 A;  3ERE D;  1ZQ1 C;  2NVX K;  2NVT C;  2JA6 K;  3HOY C;  2FQO A;  3H0G C;  1Y1W K;  3S1Q C;  1WIH A;  1J6X A;  3CQZ K;  3S2H K;  4Q4Z A;  2R92 C;  3JST A;  4KB4 A;  4C2M K;  5IYC C;  4BY7 C;  3AH5 A;  2CFA B;  4GTL A;  4O2D A;  5M5W K;  4G7Z A;  2VUM K;  4MEX A;  1ZBS A;  4A3J K;  1R9T K;  2B63 A;  1XZQ B;  1WQH A;  2E2H C;  4DDQ A;  5M5X K;  5TMF A;  1HI9 A;  1XZQ A;  1TWG K;  1F9N A;  3LAJ A;  5IOR A;  1G51 A;  3NUH A;  2GSO A;  1TWG C;  1IL2 A;  5L46 A;  2D6F C;  1J6V A;  3HOX K;  4BLB A;  4LK1 A;  5JVO A;  2R7Z A;  4Y52 C;  2O5I A;  4Y52 K;  3HXA A;  2A6E A;  1TWC A;  5M3F K;  1WOS A;  1WOR A;  3FHZ A;  3FOE A;  4BKW A;  1BGW A;  3H0G K;  3S1Q K;  4Y7N K;  3BP8 C;  3IPJ A;  1EK8 A;  2JH3 A;  4YG2 A;  3GEE A;  3A8J A;  2RH6 A;  3AQP A;  1C0A A;  4KDD A;  1VJE A;  3GTL K;  1TWH C;  1TWC C;  3TFH A;  1O26 A;  5IP9 C;  3GTQ K;  3S17 C;  1J6W A;  2BE5 A;  4GTF A;  3WOD A;  2E2H K;  4LLG A;  2WAQ D;  1I3Q A;  5IOS A;  4C45 A;  3PO3 C;  1PJ7 A;  1ZYR A;  2NVQ C;  1IW7 A;  3HOW C;  2XCR B;  1L0W A;  2NVQ K;  2PMZ L;  4KAR A;  1YNN A;  4ILD A;  3S16 C;  3S15 C;  1PJ5 A;  4A3E C;  2R93 A;  4LOW A;  4KMH A;  2B63 C;  4A3F K;  3SZZ A;  3GTP K;  3GTP C;  2V6S A;  3L4J A;  2V6T A;  3OEP A;  3MML B;  1I3Q C;  2R92 A;  2ZUE A;  5TJ3 A;  3EQL A;  3I4M C;  1EH1 A;  4LJZ A;  2JA5 K;  1I50 K;  1Y1V K;  4BY1 C;  4GZY A;  1WCM A;  4A3G K;  3GTG A;  4FZB A;  3HOZ C;  2CFA A;  4KMU A;  1ISE A;  3I4N C;  1WQF A;  1KQ4 A;  3HOU C;  1TWF K;  3HOW K;  3HOU K;  3RZO C;  1K83 K;  1WSV A;  4PAA A;  2JA7 K;  1JOE A;  3SZY A;  4KN7 A;  3BP3 A;  4C3J K;  2ZUF A;  1IQ0 A;  4WIL A;  4ZH4 A;  3S1R C;  3RZD C;  4KMA A;  1TWG A;  1YNJ A;  4AYB D;  3HOZ K;  4GTB A;  1EI6 A;  3A8K A;  1ZVU A;  2RGR A;  4M1X A;  1XXB A;  2WB1 D;  4NOI A;  4A3I K;  4A3L C;  1V5V A;  1PJ6 A;  4KAS A;  1O24 A;  1BDF A;  4WJ3 M;  3G4A A;  2NVY K;  5FJ8 K;  2JA8 C;  1WCM C;  5CJ9 A;  4PAB A;  1IS1 A;  1ZXO A;  3CAG A;  5FLM C;  4GT9 A;  1USO A;  1BS2 A;  1DD5 A;  2Y0S D;  5IYD K;  5C44 C;  2XCQ A;  3T01 A;  3GTJ A;  1WOO A;  4KAT A;  3ADA C;  4OIO A;  3G4C A;  4BBS K;  2P8T A;  4BXX C;  4BBS C;  4A3J C;  5C4X C;  5E68 A;  3N0B A;  1X31 C;  2NVY C;  4BXX K;  3ORE A;  4AYB L;  2R93 C;  1EQR A;  3HOY K;  1B4A A;  5C4J K;  1IBA A;  4A93 C;  4YFK A;  5C3E C;  4WJ4 A;  3GEH A;  3M3Y K;  5M5Y K;  2PA8 D;  5IYC K;  2E2I A;  1BJT A;  4BBR C;  3PO2 C;  3BUE A;  1DCH A;  5D4D A;  4BBR K;  1O29 A;  2PHC B;  3S0X A;  4QJV B;  3GTM A;  1USM A;  2NVX A;  4X6A C;  4XLN A;  3TFJ A;  4LQY A;  2O5J A;  4Y7N C;  5FLM K;  1O2F B;  3N3Y A;  1RU0 A;  3M3Y C;  4GTE A;  5EGE A;  4KC6 A;  4YFX A;  1XXA A;  4A3L K;  3GTO K;  2JA5 A;  3FKI A;  1I50 A;  4A3M C;  4P9S A;  1Y1V A;  1SFO C;  4GTC A;  1EFW A;  2JA6 C;  4X6A K;  1SFO A;  3A8I A;  3K7A C;  5C4J C;  4C3H K;  1DCO A;  1XXC A;  3GTK K;  4JK1 A;  3OPF A;  2Y3P A;  4QJV A;  4KN4 A;  5HL8 A;  2YU9 K;  3GDZ A;  1TWC K;  4G7H A;  1TWA A;  2R7Z C;  4A3M K;  3T02 A;  4A3E K;  3M4O K;  3S14 C;  2NVX C;  2NVT K;  3K7A K;  3AD9 C;  4KB2 A;  5C3E K;  2WAQ L;  4Q5S A;  1O28 A;  4P5A A;  1Y1W A;  4C3I C;  3LPX A;  4BY7 K;  1YCL A;  2GSU A;  1UV7 A;  3S1M K;  4G0W A;  2VUM C;  3T00 A;  3S15 K;  3TFI A;  4A3B K;  1GE9 A;  3GTG C;  2NVY A;  3S2D K;  1R9T A;  2B63 K;  1I6V A;  1I6H K;  3S14 K;  4A3F C;  2GAH C;  4A3C C;  5IYB K;  3S2H C;  3TTG A;  2ZFZ A;  2Y0S L;  3I4N K;  1TWH K;  2YU9 C;  3HOV K;  3GTJ K;  2R7Z K;  1DCP A;  1R9T C;  2CW0 A;  3GTP A;  4C3J C;  3S1N K;  5IOT A;  1F7V A;  3L4K A;  2E2J C;  2R92 K;  2GSN A;  4P5B A;  4MEY A;  3AQO A;  3HOX C;  3LAP A;  1J98 A;  4YFN A;  3GTL C;  2XCO A;  5IP9 K;  3GTQ C;  3GTL A;  1F7U A;  4KM9 A;  2PPB A;  3GTQ A;  3S16 K;  2P5M A;  1IE0 A;  3GIR A;  5M3M K;  3DXJ A;  2A68 A;  5IYB C;  2E2H A;  1I3Q K;  1B4B A;  5CHP A;  4C3I K;  1K83 A;  2PMZ D; 
#chains in the Genus database with same CATH homology
 1VJE A;  2FQO A;  1INN A;  5E68 A;  1JQW A;  1VGX A;  2FQT A;  1J98 A;  1J6X A;  1IE0 A;  1VH2 A;  1J6W A;  1J6V A;  1JVI A;  1YCL A;  4XCH A;  1JOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...