1INNA

Crystal structure of d. radiodurans luxs, p21
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
NVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1innA00
1J6WA 1VGXA 1J6XA 1J98A 1IE0A 1JQWA 1VH2A 1VJEA 4XCHA 1YCLA 1JVIA 2FQOA 1J6VA 5E68A 2FQTA 1JOEA 1INNA
chains in the Genus database with same CATH superfamily
2GSUA 2RH6A 3S2DK 1Y1VA 1TWHC 3L4JA 3GTGK 4Q5SA 2R7ZC 4A3JK 4KARA 1O29A 4KMUA 2WB1D 3GTGC 1WORA 4NOIA 4A93K 1WSRA 4LQYA 3S2DC 4C2MK 2R7ZK 3AH5A 1VH2A 3GTMA 4GTAA 1TWCK 5CJ9A 1EQRA 2PMZD 3LAPA 4A3MK 3GTOC 3S1NK 4A3CC 3GTKC 1IE0A 3DXJA 2NVQK 1I3QK 3HOVC 1R9TA 3GTQC 5C4XK 4BXXK 2KWAA 4LOWA 3SZZA 1KQ4A 1V5VA 3M3YK 3AQPA 1BJTA 3OREA 3FOEA 4YFNA 1WQFA 3N0CA 5IYDC 1USOA 3G4CA 5D4DA 1VGXA 5TMFA 1XXCA 2GAGC 3HOZC 4A3EK 3PO3K 1YNNA 4PAAA 1Y1WK 5TMCA 1B4AA 3I4MK 4C3IC 4WJ4A 4GTDA 3GTOK 3S1NC 2VUMK 2V6UA 4MQ9A 2XCOA 3GTPK 1DCOA 3H0GC 3RZDC 4C3HC 2E2HA 4YFXA 4KMDA 4LK1A 5TJ3A 3FKIC 3PO2K 3H0GK 4C45A 1XXBA 5C4JK 3N3YA 1J6VA 4C3HK 5E68A 4P9SA 4GFQA 5HL8A 2WAQD 5C44K 1XZPA 5EGEA 3CQZC 1EI6A 4P5BA 1JQWA 4O2DA 2GSOA 1YCLA 3HKZL 1EK8A 4FM9A 4BY1K 5IYBK 2YU9A 1TWFK 5M5WK 4Y7NC 1SFOK 3EQLA 4A3GC 4KM8A 1AB4A 2E2HC 4OIQA 3VA7A 1XZQA 3A8IA 4KMAA 3GTLA 1L0WA 1F7UA 1WSVA 2PPBA 2R92A 4GTEA 3FHZA 3TFHA 4Y52K 5M3MK 3CQZK 4OINA 1DCHA 2Y3PA 1DD5A 2R7ZA 4G7HA 1DCPA 1TWFA 1WCMA 2JA8K 2GSNA 3HOWK 4C2MC 1Y1WA 1EFWA 4XSZA 3I4MC 3H3VD 1K83C 3GTQA 1Y1WC 1IS1A 4KAWX 2ZUFA 4BY1C 2JA6K 1WOOA 4A3KC 3RZOC 3S1RK 1HI9A 5IYBC 2NVXK 4KATA 3GTJA 3HOVK 2NVYC 3S1MK 4KASA 2W7VA 2NVTC 1G51A 2R92C 5JVOA 5EGHA 5IOQA 2E2JK 1J98A 3ADAC 1SFOA 4Q4ZA 4A3KK 3RZOK 3HXAA 1I6HK 5L46A 4A3CK 4BBSK 1Y1VK 3GTMK 3T01A 2YU9C 1WCMC 2Y0SL 5M5YK 1TWGK 1B4BA 3LPXA 2O5IA 3S2HK 2B63C 4A3BK 4GTCA 2D6FC 3HOWC 3PO3C 1VRQC 3HOZK 1TWAC 4C3IK 4BLBA 3BP3A 1WIHA 3S2HC 2A6HA 1TWGC 4AYBL 1TWHK 3HOYK 2E2HK 3GSIA 5IYDK 2E2IK 1GE9A 3S15K 1IBAA 1F9NA 2JA5C 3S17C 4GTLA 1I6HC 5FLMK 4X6AC 4GTFA 3MMLB 1R9TK 3HOUC 5C4XC 2NVQC 3A8KA 2NVTK 1O26A 1JVIA 4ILDA 2CW0A 4LK0A 2NVXC 2JA6A 1I50C 3A8JA 3GTKK 3S1MC 1C0AA 1TWFC 3M4OC 5FLMC 4A3LC 3Q3QA 3BP8C 1TWCA 3GTJK 1TWCC 4QIWD 3HOXK 5M5XK 3HOYC 1ZQ1C 1WQGA 4BY7C 1I6VA 3IPJA 3QX3A 3I4NK 1IW7A 3CQZA 3K7AK 1O2BA 4A3DK 1BGWA 3CAGA 4JK1A 3K7AC 2P8TA 3I4NC 1I3QA 4J3NA 4DDQA 3FKIK 4BY7K 4BBSC 4ZH4A 1TWGA 5IP9C 3GTMC 5IP7C 1YNJA 1YX2A 1TWAA 4LJZA 4XLNA 2B63A 3OPFA 3S14C 3GEEA 1R9TC 1VJEA 3S14K 4A3IK 1TWHA 2A6EA 1PJ5A 4AH6A 2JA6C 1RU0A 2Y0SD 2NVXA 4Y7NK 3HKZD 3FKIA 5FJ8K 1XZPB 3AQOA 3TTGA 3GTOA 4BXXC 1J6WA 4MEXA 1F7VA 3JSTA 3GTPA 2E2IC 2WB1L 2A69A 4PABA 4G0UA 2B63K 4A3BC 5C3EK 3GIRA 4KMHA 3S16K 2JA7A 1XPPA 4KB4A 2GAHC 4A3JC 5C4JC 4A3MC 5C44C 5IYCC 4A3DC 1WCMK 4C3JC 1WOSA 1Y1VC 2RGRA 3GDZA 4LR2A 2VUMC 1HQMA 3S16C 4RMFA 3GTPC 4G0VA 1JOEA 4WJ3M 4BBRC 1PJ6A 2XCQA 4Y52C 4M1XA 3BUEA 4BKWA 4A3FC 1ZXOA 3GTLK 4A3EC 1XXAA 2PA8L 1IL2A 3S1QC 1ZVUA 3H3VL 4KB2A 1INNA 2ZUEA 1O25A 3L4KA 3M3YC 2R93A 3GEIA 5IOTA 4XLPA 4A3IC 3S1QK 2JA5K 4OIOA 3GTLC 4XSXA 1K83K 3TFIA 3GTGA 1XZQB 2EBBA 2FQOA 4KM9A 1WQHA 5CHPA 4BBRK 1O2FB 3S17K 4BLAA 1O2AA 1K83A 3N0BA 4C3JK 3AD8C 2WAQL 4LLGA 5IYCK 3ERED 1ZBSA 1TWAK 1VLOA 4KDDA 1X31C 1J6XA 3OEPA 4QJVB 1IQ0A 3HOXC 2FQTA 2NVYK 2CFAB 3G4AA 2PHCB 1BDFA 2ZFZA 3H0GA 4AYBD 1O28A 3AD9C 4YG2A 5IORA 3V4GA 4G7OA 2PMZL 4WILA 3LAJA 3TFJA 4OIRA 4G0WA 1I50K 3GTQK 1I3QC 2O5JA 1BS2A 1UV7A 3S1RC 1USMA 1O24A 2P5MA 4XCHA 2CFAA 3PO2C 5IP7K 5IOSA 3SZYA 3RZDK 4QIWL 3T02A 3S0XA 4A93C 4GT9A 4P5AA 4YFKA 4GTBA 1SMYA 2PA8D 2JA8C 5C3EC 1I50A 3GTKA 4FZBA 1O27A 2BE5A 4KC6A 4GZYA 1F93A 2JH3A 3WODA 4MEYA 2A68A 1PJ7A 1SFOC 4A3GK 2YU9K 3GEHA 3T00A 2V6SA 2NVYA 2JA5A 3GTJC 2R93C 1WOPA 3M4OK 4A3LK 1ZYRA 2JA7C 2V6TA 4KN4A 2E2JC 4QJVA 2R92K 2R93K 4A3FK 2JA7K 4X6AK 4KN7A 2E2IA 4OIPA 1ISEA 3HOUK 2XCRB 3NUHA 5JFEA 3S15C 5IP9K 2VUMA 3FOFA 1EH1A 5M3FK 3AD7C 4G7ZA
chains in the Genus database with same CATH topology
1J6WA 1VGXA 1J6XA 1J98A 1IE0A 1JQWA 1VH2A 1VJEA 4XCHA 1YCLA 1JVIA 2FQOA 1J6VA 5E68A 2FQTA 1JOEA 1INNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6W A;  1VGX A;  1J6X A;  1J98 A;  1IE0 A;  1JQW A;  1VH2 A;  1VJE A;  4XCH A;  1YCL A;  1JVI A;  2FQO A;  1J6V A;  5E68 A;  2FQT A;  1JOE A;  1INN A; 
#chains in the Genus database with same CATH topology
 2GSU A;  2RH6 A;  3S2D K;  1Y1V A;  1TWH C;  3L4J A;  3GTG K;  4Q5S A;  2R7Z C;  4A3J K;  4KAR A;  1O29 A;  4KMU A;  2WB1 D;  3GTG C;  1WOR A;  4NOI A;  4A93 K;  1WSR A;  4LQY A;  3S2D C;  4C2M K;  2R7Z K;  3AH5 A;  1VH2 A;  3GTM A;  4GTA A;  1TWC K;  5CJ9 A;  1EQR A;  2PMZ D;  3LAP A;  4A3M K;  3GTO C;  3S1N K;  4A3C C;  3GTK C;  1IE0 A;  3DXJ A;  2NVQ K;  1I3Q K;  3HOV C;  1R9T A;  3GTQ C;  5C4X K;  4BXX K;  2KWA A;  4LOW A;  3SZZ A;  1KQ4 A;  1V5V A;  3M3Y K;  3AQP A;  1BJT A;  3ORE A;  3FOE A;  4YFN A;  1WQF A;  3N0C A;  5IYD C;  1USO A;  3G4C A;  5D4D A;  1VGX A;  5TMF A;  1XXC A;  2GAG C;  3HOZ C;  4A3E K;  3PO3 K;  1YNN A;  4PAA A;  1Y1W K;  5TMC A;  1B4A A;  3I4M K;  4C3I C;  4WJ4 A;  4GTD A;  3GTO K;  3S1N C;  2VUM K;  2V6U A;  4MQ9 A;  2XCO A;  3GTP K;  1DCO A;  3H0G C;  3RZD C;  4C3H C;  2E2H A;  4YFX A;  4KMD A;  4LK1 A;  5TJ3 A;  3FKI C;  3PO2 K;  3H0G K;  4C45 A;  1XXB A;  5C4J K;  3N3Y A;  1J6V A;  4C3H K;  5E68 A;  4P9S A;  4GFQ A;  5HL8 A;  2WAQ D;  5C44 K;  1XZP A;  5EGE A;  3CQZ C;  1EI6 A;  4P5B A;  1JQW A;  4O2D A;  2GSO A;  1YCL A;  3HKZ L;  1EK8 A;  4FM9 A;  4BY1 K;  5IYB K;  2YU9 A;  1TWF K;  5M5W K;  4Y7N C;  1SFO K;  3EQL A;  4A3G C;  4KM8 A;  1AB4 A;  2E2H C;  4OIQ A;  3VA7 A;  1XZQ A;  3A8I A;  4KMA A;  3GTL A;  1L0W A;  1F7U A;  1WSV A;  2PPB A;  2R92 A;  4GTE A;  3FHZ A;  3TFH A;  4Y52 K;  5M3M K;  3CQZ K;  4OIN A;  1DCH A;  2Y3P A;  1DD5 A;  2R7Z A;  4G7H A;  1DCP A;  1TWF A;  1WCM A;  2JA8 K;  2GSN A;  3HOW K;  4C2M C;  1Y1W A;  1EFW A;  4XSZ A;  3I4M C;  3H3V D;  1K83 C;  3GTQ A;  1Y1W C;  1IS1 A;  4KAW X;  2ZUF A;  4BY1 C;  2JA6 K;  1WOO A;  4A3K C;  3RZO C;  3S1R K;  1HI9 A;  5IYB C;  2NVX K;  4KAT A;  3GTJ A;  3HOV K;  2NVY C;  3S1M K;  4KAS A;  2W7V A;  2NVT C;  1G51 A;  2R92 C;  5JVO A;  5EGH A;  5IOQ A;  2E2J K;  1J98 A;  3ADA C;  1SFO A;  4Q4Z A;  4A3K K;  3RZO K;  3HXA A;  1I6H K;  5L46 A;  4A3C K;  4BBS K;  1Y1V K;  3GTM K;  3T01 A;  2YU9 C;  1WCM C;  2Y0S L;  5M5Y K;  1TWG K;  1B4B A;  3LPX A;  2O5I A;  3S2H K;  2B63 C;  4A3B K;  4GTC A;  2D6F C;  3HOW C;  3PO3 C;  1VRQ C;  3HOZ K;  1TWA C;  4C3I K;  4BLB A;  3BP3 A;  1WIH A;  3S2H C;  2A6H A;  1TWG C;  4AYB L;  1TWH K;  3HOY K;  2E2H K;  3GSI A;  5IYD K;  2E2I K;  1GE9 A;  3S15 K;  1IBA A;  1F9N A;  2JA5 C;  3S17 C;  4GTL A;  1I6H C;  5FLM K;  4X6A C;  4GTF A;  3MML B;  1R9T K;  3HOU C;  5C4X C;  2NVQ C;  3A8K A;  2NVT K;  1O26 A;  1JVI A;  4ILD A;  2CW0 A;  4LK0 A;  2NVX C;  2JA6 A;  1I50 C;  3A8J A;  3GTK K;  3S1M C;  1C0A A;  1TWF C;  3M4O C;  5FLM C;  4A3L C;  3Q3Q A;  3BP8 C;  1TWC A;  3GTJ K;  1TWC C;  4QIW D;  3HOX K;  5M5X K;  3HOY C;  1ZQ1 C;  1WQG A;  4BY7 C;  1I6V A;  3IPJ A;  3QX3 A;  3I4N K;  1IW7 A;  3CQZ A;  3K7A K;  1O2B A;  4A3D K;  1BGW A;  3CAG A;  4JK1 A;  3K7A C;  2P8T A;  3I4N C;  1I3Q A;  4J3N A;  4DDQ A;  3FKI K;  4BY7 K;  4BBS C;  4ZH4 A;  1TWG A;  5IP9 C;  3GTM C;  5IP7 C;  1YNJ A;  1YX2 A;  1TWA A;  4LJZ A;  4XLN A;  2B63 A;  3OPF A;  3S14 C;  3GEE A;  1R9T C;  1VJE A;  3S14 K;  4A3I K;  1TWH A;  2A6E A;  1PJ5 A;  4AH6 A;  2JA6 C;  1RU0 A;  2Y0S D;  2NVX A;  4Y7N K;  3HKZ D;  3FKI A;  5FJ8 K;  1XZP B;  3AQO A;  3TTG A;  3GTO A;  4BXX C;  1J6W A;  4MEX A;  1F7V A;  3JST A;  3GTP A;  2E2I C;  2WB1 L;  2A69 A;  4PAB A;  4G0U A;  2B63 K;  4A3B C;  5C3E K;  3GIR A;  4KMH A;  3S16 K;  2JA7 A;  1XPP A;  4KB4 A;  2GAH C;  4A3J C;  5C4J C;  4A3M C;  5C44 C;  5IYC C;  4A3D C;  1WCM K;  4C3J C;  1WOS A;  1Y1V C;  2RGR A;  3GDZ A;  4LR2 A;  2VUM C;  1HQM A;  3S16 C;  4RMF A;  3GTP C;  4G0V A;  1JOE A;  4WJ3 M;  4BBR C;  1PJ6 A;  2XCQ A;  4Y52 C;  4M1X A;  3BUE A;  4BKW A;  4A3F C;  1ZXO A;  3GTL K;  4A3E C;  1XXA A;  2PA8 L;  1IL2 A;  3S1Q C;  1ZVU A;  3H3V L;  4KB2 A;  1INN A;  2ZUE A;  1O25 A;  3L4K A;  3M3Y C;  2R93 A;  3GEI A;  5IOT A;  4XLP A;  4A3I C;  3S1Q K;  2JA5 K;  4OIO A;  3GTL C;  4XSX A;  1K83 K;  3TFI A;  3GTG A;  1XZQ B;  2EBB A;  2FQO A;  4KM9 A;  1WQH A;  5CHP A;  4BBR K;  1O2F B;  3S17 K;  4BLA A;  1O2A A;  1K83 A;  3N0B A;  4C3J K;  3AD8 C;  2WAQ L;  4LLG A;  5IYC K;  3ERE D;  1ZBS A;  1TWA K;  1VLO A;  4KDD A;  1X31 C;  1J6X A;  3OEP A;  4QJV B;  1IQ0 A;  3HOX C;  2FQT A;  2NVY K;  2CFA B;  3G4A A;  2PHC B;  1BDF A;  2ZFZ A;  3H0G A;  4AYB D;  1O28 A;  3AD9 C;  4YG2 A;  5IOR A;  3V4G A;  4G7O A;  2PMZ L;  4WIL A;  3LAJ A;  3TFJ A;  4OIR A;  4G0W A;  1I50 K;  3GTQ K;  1I3Q C;  2O5J A;  1BS2 A;  1UV7 A;  3S1R C;  1USM A;  1O24 A;  2P5M A;  4XCH A;  2CFA A;  3PO2 C;  5IP7 K;  5IOS A;  3SZY A;  3RZD K;  4QIW L;  3T02 A;  3S0X A;  4A93 C;  4GT9 A;  4P5A A;  4YFK A;  4GTB A;  1SMY A;  2PA8 D;  2JA8 C;  5C3E C;  1I50 A;  3GTK A;  4FZB A;  1O27 A;  2BE5 A;  4KC6 A;  4GZY A;  1F93 A;  2JH3 A;  3WOD A;  4MEY A;  2A68 A;  1PJ7 A;  1SFO C;  4A3G K;  2YU9 K;  3GEH A;  3T00 A;  2V6S A;  2NVY A;  2JA5 A;  3GTJ C;  2R93 C;  1WOP A;  3M4O K;  4A3L K;  1ZYR A;  2JA7 C;  2V6T A;  4KN4 A;  2E2J C;  4QJV A;  2R92 K;  2R93 K;  4A3F K;  2JA7 K;  4X6A K;  4KN7 A;  2E2I A;  4OIP A;  1ISE A;  3HOU K;  2XCR B;  3NUH A;  5JFE A;  3S15 C;  5IP9 K;  2VUM A;  3FOF A;  1EH1 A;  5M3F K;  3AD7 C;  4G7Z A; 
#chains in the Genus database with same CATH homology
 1J6W A;  1VGX A;  1J6X A;  1J98 A;  1IE0 A;  1JQW A;  1VH2 A;  1VJE A;  4XCH A;  1YCL A;  1JVI A;  2FQO A;  1J6V A;  5E68 A;  2FQT A;  1JOE A;  1INN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...