4BY1K

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by1K00
5FLMK 1HQMA 2JA6K 3S1MK 2R7ZC 2A6EA 3H3VL 2NVYC 4Y7NK 1IW7A 4A3FK 3I4NC 1XPPA 2PMZL 4A3DC 3GTQC 4OIPA 3S1RK 5IP9K 3HOWC 5M5XK 3GTKK 2NVYK 4MQ9A 4A3IK 2YU9C 3H3VD 1SFOK 4XLPA 4A3DK 2PMZD 5M5YK 3GTPC 1TWAK 5C44K 1I6HC 3S16C 5C4XC 3HOWK 4C2MK 2PA8D 4A3BK 5TMFA 3GTJC 2YU9K 3GTGK 3H0GC 4A3CK 3GTLK 4YFXA 4A3MC 5FLMC 4A3GK 2E2JK 2JA6C 3GTPK 4OIOA 3M3YC 2Y0SL 1I6HK 3HOUC 1R9TC 3HOXK 1SMYA 5M3FK 3H0GK 3S1RC 1TWGK 5IP9C 4BY1K 2JA5K 3GTKC 3M3YK 2Y0SD 4A3IC 1R9TK 3HOUK 3S14C 1SFOC 3RZDK 2NVXC 2VUMK 4OIQA 1TWHK 1I3QK 1TWAC 5C44C 2NVTK 2JA7C 4BY7C 4KN7A 2PA8L 3HOVC 4OIRA 3RZOC 4A3BC 3DXJA 3S14K 4YFKA 3GTGC 4A3CC 2NVXK 3GTLC 3PO2K 4A3GC 2E2JC 4BY7K 2PPBA 2JA7K 2E2HC 3HOVK 3RZOK 4X6AK 3S1QC 1Y1VC 1TWFK 3HOXC 4G7HA 3S1NK 4QIWD 3GTOK 1TWGC 2R93K 4KMUA 1BDFA 4BY1C 2JA5C 1TWCK 3EQLA 4XSZA 2E2HK 4Y52K 4G7ZA 2NVQK 4NOIA 1Y1VK 3RZDC 2VUMC 3M4OK 3S1QK 1TWHC 1I3QC 3FKIC 2NVTC 4AYBL 4MEXA 1YNJA 4A3JK 3HKZL 2E2IK 4LK1A 3S2DK 2CW0A 3PO2C 4A3EK 4BBRC 1WCMK 3FKIK 3S2HC 4AYBD 4XSXA 4A3MK 4X6AC 1TWFC 2B63K 3S1NC 3I4MC 3CQZK 3HKZD 2A6HA 4QIWL 3GTOC 5C4JK 5IYDK 4Q4ZA 2R93C 4BBRK 1I50C 1YNNA 5M5WK 1TWCC 5C3EK 4Y52C 3GTMK 3S2HK 2NVQC 4BXXK 5M3MK 4LK0A 4C3IK 3M4OC 5IYBC 1Y1WK 5IYCC 2A68A 3I4MK 3PO3K 2BE5A 1ZYRA 3K7AK 4ZH4A 4A93C 1I50K 4A3JC 4C3JK 3S17K 4A3KC 2O5IA 5IP7K 2E2IC 3S2DC 2WB1L 4MEYA 4C3HK 3HOYC 4BBSK 4QJVA 5IYBK 5IYCK 4A3EC 4QJVB 1WCMC 4YFNA 5D4DA 4A93K 1K83C 2JA8C 2B63C 4LJZA 4A3KK 2WAQL 3CQZC 2R7ZK 4XLNA 5IYDC 2WB1D 4JK1A 5C4JC 2R92C 2A69A 3HOYK 3I4NK 5FJ8K 4GZYA 5C3EC 3GTMC 3GTQK 4BXXC 4OINA 1K83K 2JA8K 1Y1WC 2O5JA 2WAQD 3PO3C 2R92K 3HOZC 3K7AC 4A3LC 3S15C 3S17C 4KN4A 4YG2A 3S1MC 5IP7C 4G7OA 4BBSC 5C4XK 3S16K 1I6VA 4Y7NC 4A3FC 4Q5SA 3GTJK 5TMCA 3HOZK 4A3LK 4LLGA 3S15K 3WODA
chains in the Genus database with same CATH superfamily
1F7UA 2PMZL 3FOEA 4KC6A 3V4GA 5IP9K 1O28A 3GTKK 1SFOK 2RGRA 4A3DK 3Q3QA 3GTJA 1TWAK 1IS1A 3S16C 3HOWK 4XCHA 4A3BK 4WJ4A 3AD8C 3GTJC 3AH5A 5FLMC 2VUMA 4OIOA 1I6HK 3MMLB 5M3FK 1R9TK 4KMHA 1PJ7A 2RH6A 1I3QK 3G4CA 2NVTK 1WSVA 3GTGA 1WOOA 3RZOC 3GTLA 3JSTA 1V5VA 3DXJA 3S14K 2E2HA 2XCRB 3GTGC 3GTLC 3AD7C 3PO2K 4A3GC 4GTBA 5IORA 2E2HC 2V6TA 3L4KA 1XXBA 3HOXC 3AQOA 3GTOK 1BDFA 4Y52K 1GE9A 4G7ZA 4KM8A 5JVOA 3S1QK 1WQHA 3M4OK 2ZUEA 3QX3A 4BBRC 1YX2A 3S0XA 4KATA 4AYBD 4FM9A 4X6AC 4C3IC 1I50A 2B63K 4LOWA 4QIWL 1WSRA 4Q4ZA 1I50C 4C3JC 1JVIA 5M3MK 4LK0A 4G0WA 2E2IA 3K7AK 1WORA 5IOQA 1EFWA 2O5IA 5IP7K 2E2IC 3S2DC 4MEYA 1JQWA 5IYCK 3CQZA 4YFNA 2JA8C 2WAQL 3CQZC 1HI9A 2R7ZK 3GTMA 3I4NK 5FJ8K 4GZYA 3GTMC 4OINA 1ZXOA 1DCOA 1B4BA 2PHCB 4KN4A 3TFIA 5C4XK 4BKWA 3A8JA 3T00A 4BLBA 4A3LK 1XZQA 1INNA 3N0CA 1USOA 3H3VL 5TJ3A 1JOEA 4A3DC 4OIPA 5HL8A 4AH6A 3HOWC 2NVYK 4A3IK 5M5YK 4KMAA 5C44K 1I6HC 3T02A 3VA7A 2JA6A 2YU9K 1R9TA 4YFXA 2E2JK 2JA6C 3GTPK 1XXCA 1R9TC 5EGEA 1ISEA 2KWAA 1SMYA 3H0GK 2W7VA 3S1RC 4BLAA 4BY1K 2JA5K 3M3YK 2Y0SD 3HOUK 3S14C 3AQPA 3RZDK 1TWHK 1XZPA 4KN7A 2PA8L 4OIRA 1XXAA 4A3CC 2NVXK 1WOPA 1O25A 3LPXA 4BY7K 1VH2A 1J6XA 1TWGA 1C0AA 4KB2A 3S1QC 1TWFK 4G7HA 3S1NK 2FQTA 4QIWD 2V6SA 1TWGC 1ZVUA 3A8KA 4GFQA 1F7VA 3LAPA 2NVQK 1Y1VK 2VUMC 1O29A 4LR2A 4MEXA 2D6FC 3GEIA 2XCQA 2CW0A 4A3EK 2CFAB 4GTLA 3FKIK 1VRQC 2R93A 1F93A 1TWCA 3A8IA 3BP3A 3HKZD 5IYDK 5C4JK 2R93C 1YNNA 1TWCC 5C3EK 3S2HK 4BXXK 4C45A 1Y1WK 1IL2A 4P9SA 5IYCC 3PO3K 3FHZA 4A3JC 1EH1A 1WCMA 1IQ0A 4BBSK 4QJVA 1WCMC 5D4DA 3GSIA 4LJZA 4A3KK 2GAHC 2WB1D 4JK1A 1K83K 2O5JA 5CHPA 4M1XA 2R92K 4A3LC 2GSUA 3S17C 4C3HC 4G7OA 3S16K 3GTJK 3ERED 1DCPA 2NVYA 3S15K 5FLMK 3S1MK 3GTQA 2NVYC 4Y7NK 1IW7A 1USMA 3GTQC 1O2FB 2YU9A 1XZPB 5M5XK 3GTPA 2YU9C 5IOSA 2PMZD 3GTPC 1X31C 4GTDA 3H0GA 4C2MK 2PA8D 5CJ9A 1WQGA 3GTGK 3H0GC 3GTLK 2P5MA 4A3MC 4A3GK 1KQ4A 5L46A 3M3YC 3HOUC 3HOXK 3SZZA 3GTKA 1BS2A 1SFOA 5IP9C 2NVXA 3AD9C 1TWAA 3GTKC 1SFOC 2NVXC 3ADAC 4BY7C 1TWAC 4GTAA 4A3BC 4YFKA 1Y1VA 3N0BA 2Y3PA 2JA7K 3HOVK 4X6AK 1Y1VC 3FOFA 1G51A 4GTFA 1I3QA 3EQLA 3FKIA 4NOIA 3SZYA 1EI6A 1I3QC 1IE0A 3FKIC 2NVTC 4AYBL 4J3NA 3GDZA 2E2IK 3S2DK 3PO2C 3HXAA 3G4AA 1B4AA 3S2HC 3GTOA 4XSXA 3TTGA 2ZFZA 3CQZK 3GTOC 1WIHA 4KMDA 4Y52C 2GSNA 3GTMK 3M4OC 3I4MK 2A68A 3OPFA 2BE5A 4ILDA 4A3KC 1VGXA 1K83A 5IYBK 2B63A 1O2AA 4DDQA 4A93K 2R92A 1K83C 2B63C 2P8TA 3HOYK 2R92C 2A69A 1ZQ1C 1DD5A 3BP8C 2WAQD 3BUEA 4KDDA 3K7AC 3S15C 4O2DA 1J6WA 3S1MC 5IP7C 1I6VA 4Y7NC 4KASA 4P5AA 1EQRA 2R7ZA 3HOZK 1DCHA 3WODA 1XZQB 1HQMA 2JA6K 2R7ZC 2A6EA 5EGHA 4A3FK 1IBAA 3I4NC 1XPPA 1EK8A 3S1RK 1UV7A 3TFHA 2GSOA 4PABA 1L0WA 4C2MC 3TFJA 1BJTA 1VLOA 4MQ9A 2ZUFA 1WOSA 3H3VD 4XLPA 3GEEA 5C4XC 5TMFA 1J6VA 5IOTA 4A3CK 4RMFA 2Y0SL 1PJ6A 1YCLA 3GEHA 4WILA 2EBBA 1TWGK 4FZBA 2JH3A 4GTEA 5E68A 3OEPA 4A3IC 2JA7A 2VUMK 4OIQA 1VJEA 5C44C 2JA7C 2FQOA 3HOVC 3NUHA 2E2JC 4KM9A 2PPBA 1O27A 3T01A 3RZOK 1O24A 2JA5A 4GT9A 2R93K 4KMUA 4BY1C 1TWHA 2JA5C 1TWCK 2E2HK 4XSZA 4WJ3M 4P5BA 1J98A 4PAAA 3RZDC 1TWHC 4G0VA 1F9NA 4KARA 1YNJA 4A3JK 1BGWA 3HKZL 4LK1A 3N3YA 2CFAA 1TWFA 1WCMK 2GAGC 1TWFC 4LQYA 3S1NC 3I4MC 2A6HA 3CAGA 4BBRK 5M5WK 2NVQC 2XCOA 4C3IK 5JFEA 5IYBC 3L4JA 1ZYRA 4ZH4A 4A93C 1I50K 1AB4A 3GIRA 4C3JK 4G0UA 3S17K 1PJ5A 1ZBSA 2WB1L 4C3HK 3HOYC 4A3EC 4QJVB 1WQFA 3OREA 4XLNA 1O26A 5IYDC 5C4JC 3LAJA 1Y1WA 4GTCA 1RU0A 5C3EC 3GTQK 4BXXC 1O2BA 2JA8K 4KAWX 1Y1WC 2V6UA 3PO3C 3IPJA 3HOZC 4YG2A 4KB4A 4BBSC 4A3FC 4Q5SA 5TMCA 4LLGA 4A3MK
chains in the Genus database with same CATH topology
5FLMK 1HQMA 2JA6K 3S1MK 2R7ZC 2A6EA 3H3VL 2NVYC 4Y7NK 1IW7A 4A3FK 3I4NC 1XPPA 2PMZL 4A3DC 3GTQC 4OIPA 3S1RK 5IP9K 3HOWC 5M5XK 3GTKK 2NVYK 4MQ9A 4A3IK 2YU9C 3H3VD 1SFOK 4XLPA 4A3DK 2PMZD 5M5YK 3GTPC 1TWAK 5C44K 1I6HC 3S16C 5C4XC 3HOWK 4C2MK 2PA8D 4A3BK 5TMFA 3GTJC 2YU9K 3GTGK 3H0GC 4A3CK 3GTLK 4YFXA 4A3MC 5FLMC 4A3GK 2E2JK 2JA6C 3GTPK 4OIOA 3M3YC 2Y0SL 1I6HK 3HOUC 1R9TC 3HOXK 1SMYA 5M3FK 3H0GK 3S1RC 1TWGK 5IP9C 4BY1K 2JA5K 3GTKC 3M3YK 2Y0SD 4A3IC 1R9TK 3HOUK 3S14C 1SFOC 3RZDK 2NVXC 2VUMK 4OIQA 1TWHK 1I3QK 1TWAC 5C44C 2NVTK 2JA7C 4BY7C 4KN7A 2PA8L 3HOVC 4OIRA 3RZOC 4A3BC 3DXJA 3S14K 4YFKA 3GTGC 4A3CC 2NVXK 3GTLC 3PO2K 4A3GC 2E2JC 4BY7K 2PPBA 2JA7K 2E2HC 3HOVK 3RZOK 4X6AK 3S1QC 1Y1VC 1TWFK 3HOXC 4G7HA 3S1NK 4QIWD 3GTOK 1TWGC 2R93K 4KMUA 1BDFA 4BY1C 2JA5C 1TWCK 3EQLA 4XSZA 2E2HK 4Y52K 4G7ZA 2NVQK 4NOIA 1Y1VK 3RZDC 2VUMC 3M4OK 3S1QK 1TWHC 1I3QC 3FKIC 2NVTC 4AYBL 4MEXA 1YNJA 4A3JK 3HKZL 2E2IK 4LK1A 3S2DK 2CW0A 3PO2C 4A3EK 4BBRC 1WCMK 3FKIK 3S2HC 4AYBD 4XSXA 4A3MK 4X6AC 1TWFC 2B63K 3S1NC 3I4MC 3CQZK 3HKZD 2A6HA 4QIWL 3GTOC 5C4JK 5IYDK 4Q4ZA 2R93C 4BBRK 1I50C 1YNNA 5M5WK 1TWCC 5C3EK 4Y52C 3GTMK 3S2HK 2NVQC 4BXXK 5M3MK 4LK0A 4C3IK 3M4OC 5IYBC 1Y1WK 5IYCC 2A68A 3I4MK 3PO3K 2BE5A 1ZYRA 3K7AK 4ZH4A 4A93C 1I50K 4A3JC 4C3JK 3S17K 4A3KC 2O5IA 5IP7K 2E2IC 3S2DC 2WB1L 4MEYA 4C3HK 3HOYC 4BBSK 4QJVA 5IYBK 5IYCK 4A3EC 4QJVB 1WCMC 4YFNA 5D4DA 4A93K 1K83C 2JA8C 2B63C 4LJZA 4A3KK 2WAQL 3CQZC 2R7ZK 4XLNA 5IYDC 2WB1D 4JK1A 5C4JC 2R92C 2A69A 3HOYK 3I4NK 5FJ8K 4GZYA 5C3EC 3GTMC 3GTQK 4BXXC 4OINA 1K83K 2JA8K 1Y1WC 2O5JA 2WAQD 3PO3C 2R92K 3HOZC 3K7AC 4A3LC 3S15C 3S17C 4KN4A 4YG2A 3S1MC 5IP7C 4G7OA 4BBSC 5C4XK 3S16K 1I6VA 4Y7NC 4A3FC 4Q5SA 3GTJK 5TMCA 3HOZK 4A3LK 4LLGA 3S15K 3WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM K;  1HQM A;  2JA6 K;  3S1M K;  2R7Z C;  2A6E A;  3H3V L;  2NVY C;  4Y7N K;  1IW7 A;  4A3F K;  3I4N C;  1XPP A;  2PMZ L;  4A3D C;  3GTQ C;  4OIP A;  3S1R K;  5IP9 K;  3HOW C;  5M5X K;  3GTK K;  2NVY K;  4MQ9 A;  4A3I K;  2YU9 C;  3H3V D;  1SFO K;  4XLP A;  4A3D K;  2PMZ D;  5M5Y K;  3GTP C;  1TWA K;  5C44 K;  1I6H C;  3S16 C;  5C4X C;  3HOW K;  4C2M K;  2PA8 D;  4A3B K;  5TMF A;  3GTJ C;  2YU9 K;  3GTG K;  3H0G C;  4A3C K;  3GTL K;  4YFX A;  4A3M C;  5FLM C;  4A3G K;  2E2J K;  2JA6 C;  3GTP K;  4OIO A;  3M3Y C;  2Y0S L;  1I6H K;  3HOU C;  1R9T C;  3HOX K;  1SMY A;  5M3F K;  3H0G K;  3S1R C;  1TWG K;  5IP9 C;  4BY1 K;  2JA5 K;  3GTK C;  3M3Y K;  2Y0S D;  4A3I C;  1R9T K;  3HOU K;  3S14 C;  1SFO C;  3RZD K;  2NVX C;  2VUM K;  4OIQ A;  1TWH K;  1I3Q K;  1TWA C;  5C44 C;  2NVT K;  2JA7 C;  4BY7 C;  4KN7 A;  2PA8 L;  3HOV C;  4OIR A;  3RZO C;  4A3B C;  3DXJ A;  3S14 K;  4YFK A;  3GTG C;  4A3C C;  2NVX K;  3GTL C;  3PO2 K;  4A3G C;  2E2J C;  4BY7 K;  2PPB A;  2JA7 K;  2E2H C;  3HOV K;  3RZO K;  4X6A K;  3S1Q C;  1Y1V C;  1TWF K;  3HOX C;  4G7H A;  3S1N K;  4QIW D;  3GTO K;  1TWG C;  2R93 K;  4KMU A;  1BDF A;  4BY1 C;  2JA5 C;  1TWC K;  3EQL A;  4XSZ A;  2E2H K;  4Y52 K;  4G7Z A;  2NVQ K;  4NOI A;  1Y1V K;  3RZD C;  2VUM C;  3M4O K;  3S1Q K;  1TWH C;  1I3Q C;  3FKI C;  2NVT C;  4AYB L;  4MEX A;  1YNJ A;  4A3J K;  3HKZ L;  2E2I K;  4LK1 A;  3S2D K;  2CW0 A;  3PO2 C;  4A3E K;  4BBR C;  1WCM K;  3FKI K;  3S2H C;  4AYB D;  4XSX A;  4A3M K;  4X6A C;  1TWF C;  2B63 K;  3S1N C;  3I4M C;  3CQZ K;  3HKZ D;  2A6H A;  4QIW L;  3GTO C;  5C4J K;  5IYD K;  4Q4Z A;  2R93 C;  4BBR K;  1I50 C;  1YNN A;  5M5W K;  1TWC C;  5C3E K;  4Y52 C;  3GTM K;  3S2H K;  2NVQ C;  4BXX K;  5M3M K;  4LK0 A;  4C3I K;  3M4O C;  5IYB C;  1Y1W K;  5IYC C;  2A68 A;  3I4M K;  3PO3 K;  2BE5 A;  1ZYR A;  3K7A K;  4ZH4 A;  4A93 C;  1I50 K;  4A3J C;  4C3J K;  3S17 K;  4A3K C;  2O5I A;  5IP7 K;  2E2I C;  3S2D C;  2WB1 L;  4MEY A;  4C3H K;  3HOY C;  4BBS K;  4QJV A;  5IYB K;  5IYC K;  4A3E C;  4QJV B;  1WCM C;  4YFN A;  5D4D A;  4A93 K;  1K83 C;  2JA8 C;  2B63 C;  4LJZ A;  4A3K K;  2WAQ L;  3CQZ C;  2R7Z K;  4XLN A;  5IYD C;  2WB1 D;  4JK1 A;  5C4J C;  2R92 C;  2A69 A;  3HOY K;  3I4N K;  5FJ8 K;  4GZY A;  5C3E C;  3GTM C;  3GTQ K;  4BXX C;  4OIN A;  1K83 K;  2JA8 K;  1Y1W C;  2O5J A;  2WAQ D;  3PO3 C;  2R92 K;  3HOZ C;  3K7A C;  4A3L C;  3S15 C;  3S17 C;  4KN4 A;  4YG2 A;  3S1M C;  5IP7 C;  4G7O A;  4BBS C;  5C4X K;  3S16 K;  1I6V A;  4Y7N C;  4A3F C;  4Q5S A;  3GTJ K;  5TMC A;  3HOZ K;  4A3L K;  4LLG A;  3S15 K;  3WOD A; 
#chains in the Genus database with same CATH topology
 1F7U A;  2PMZ L;  3FOE A;  4KC6 A;  3V4G A;  5IP9 K;  1O28 A;  3GTK K;  1SFO K;  2RGR A;  4A3D K;  3Q3Q A;  3GTJ A;  1TWA K;  1IS1 A;  3S16 C;  3HOW K;  4XCH A;  4A3B K;  4WJ4 A;  3AD8 C;  3GTJ C;  3AH5 A;  5FLM C;  2VUM A;  4OIO A;  1I6H K;  3MML B;  5M3F K;  1R9T K;  4KMH A;  1PJ7 A;  2RH6 A;  1I3Q K;  3G4C A;  2NVT K;  1WSV A;  3GTG A;  1WOO A;  3RZO C;  3GTL A;  3JST A;  1V5V A;  3DXJ A;  3S14 K;  2E2H A;  2XCR B;  3GTG C;  3GTL C;  3AD7 C;  3PO2 K;  4A3G C;  4GTB A;  5IOR A;  2E2H C;  2V6T A;  3L4K A;  1XXB A;  3HOX C;  3AQO A;  3GTO K;  1BDF A;  4Y52 K;  1GE9 A;  4G7Z A;  4KM8 A;  5JVO A;  3S1Q K;  1WQH A;  3M4O K;  2ZUE A;  3QX3 A;  4BBR C;  1YX2 A;  3S0X A;  4KAT A;  4AYB D;  4FM9 A;  4X6A C;  4C3I C;  1I50 A;  2B63 K;  4LOW A;  4QIW L;  1WSR A;  4Q4Z A;  1I50 C;  4C3J C;  1JVI A;  5M3M K;  4LK0 A;  4G0W A;  2E2I A;  3K7A K;  1WOR A;  5IOQ A;  1EFW A;  2O5I A;  5IP7 K;  2E2I C;  3S2D C;  4MEY A;  1JQW A;  5IYC K;  3CQZ A;  4YFN A;  2JA8 C;  2WAQ L;  3CQZ C;  1HI9 A;  2R7Z K;  3GTM A;  3I4N K;  5FJ8 K;  4GZY A;  3GTM C;  4OIN A;  1ZXO A;  1DCO A;  1B4B A;  2PHC B;  4KN4 A;  3TFI A;  5C4X K;  4BKW A;  3A8J A;  3T00 A;  4BLB A;  4A3L K;  1XZQ A;  1INN A;  3N0C A;  1USO A;  3H3V L;  5TJ3 A;  1JOE A;  4A3D C;  4OIP A;  5HL8 A;  4AH6 A;  3HOW C;  2NVY K;  4A3I K;  5M5Y K;  4KMA A;  5C44 K;  1I6H C;  3T02 A;  3VA7 A;  2JA6 A;  2YU9 K;  1R9T A;  4YFX A;  2E2J K;  2JA6 C;  3GTP K;  1XXC A;  1R9T C;  5EGE A;  1ISE A;  2KWA A;  1SMY A;  3H0G K;  2W7V A;  3S1R C;  4BLA A;  4BY1 K;  2JA5 K;  3M3Y K;  2Y0S D;  3HOU K;  3S14 C;  3AQP A;  3RZD K;  1TWH K;  1XZP A;  4KN7 A;  2PA8 L;  4OIR A;  1XXA A;  4A3C C;  2NVX K;  1WOP A;  1O25 A;  3LPX A;  4BY7 K;  1VH2 A;  1J6X A;  1TWG A;  1C0A A;  4KB2 A;  3S1Q C;  1TWF K;  4G7H A;  3S1N K;  2FQT A;  4QIW D;  2V6S A;  1TWG C;  1ZVU A;  3A8K A;  4GFQ A;  1F7V A;  3LAP A;  2NVQ K;  1Y1V K;  2VUM C;  1O29 A;  4LR2 A;  4MEX A;  2D6F C;  3GEI A;  2XCQ A;  2CW0 A;  4A3E K;  2CFA B;  4GTL A;  3FKI K;  1VRQ C;  2R93 A;  1F93 A;  1TWC A;  3A8I A;  3BP3 A;  3HKZ D;  5IYD K;  5C4J K;  2R93 C;  1YNN A;  1TWC C;  5C3E K;  3S2H K;  4BXX K;  4C45 A;  1Y1W K;  1IL2 A;  4P9S A;  5IYC C;  3PO3 K;  3FHZ A;  4A3J C;  1EH1 A;  1WCM A;  1IQ0 A;  4BBS K;  4QJV A;  1WCM C;  5D4D A;  3GSI A;  4LJZ A;  4A3K K;  2GAH C;  2WB1 D;  4JK1 A;  1K83 K;  2O5J A;  5CHP A;  4M1X A;  2R92 K;  4A3L C;  2GSU A;  3S17 C;  4C3H C;  4G7O A;  3S16 K;  3GTJ K;  3ERE D;  1DCP A;  2NVY A;  3S15 K;  5FLM K;  3S1M K;  3GTQ A;  2NVY C;  4Y7N K;  1IW7 A;  1USM A;  3GTQ C;  1O2F B;  2YU9 A;  1XZP B;  5M5X K;  3GTP A;  2YU9 C;  5IOS A;  2PMZ D;  3GTP C;  1X31 C;  4GTD A;  3H0G A;  4C2M K;  2PA8 D;  5CJ9 A;  1WQG A;  3GTG K;  3H0G C;  3GTL K;  2P5M A;  4A3M C;  4A3G K;  1KQ4 A;  5L46 A;  3M3Y C;  3HOU C;  3HOX K;  3SZZ A;  3GTK A;  1BS2 A;  1SFO A;  5IP9 C;  2NVX A;  3AD9 C;  1TWA A;  3GTK C;  1SFO C;  2NVX C;  3ADA C;  4BY7 C;  1TWA C;  4GTA A;  4A3B C;  4YFK A;  1Y1V A;  3N0B A;  2Y3P A;  2JA7 K;  3HOV K;  4X6A K;  1Y1V C;  3FOF A;  1G51 A;  4GTF A;  1I3Q A;  3EQL A;  3FKI A;  4NOI A;  3SZY A;  1EI6 A;  1I3Q C;  1IE0 A;  3FKI C;  2NVT C;  4AYB L;  4J3N A;  3GDZ A;  2E2I K;  3S2D K;  3PO2 C;  3HXA A;  3G4A A;  1B4A A;  3S2H C;  3GTO A;  4XSX A;  3TTG A;  2ZFZ A;  3CQZ K;  3GTO C;  1WIH A;  4KMD A;  4Y52 C;  2GSN A;  3GTM K;  3M4O C;  3I4M K;  2A68 A;  3OPF A;  2BE5 A;  4ILD A;  4A3K C;  1VGX A;  1K83 A;  5IYB K;  2B63 A;  1O2A A;  4DDQ A;  4A93 K;  2R92 A;  1K83 C;  2B63 C;  2P8T A;  3HOY K;  2R92 C;  2A69 A;  1ZQ1 C;  1DD5 A;  3BP8 C;  2WAQ D;  3BUE A;  4KDD A;  3K7A C;  3S15 C;  4O2D A;  1J6W A;  3S1M C;  5IP7 C;  1I6V A;  4Y7N C;  4KAS A;  4P5A A;  1EQR A;  2R7Z A;  3HOZ K;  1DCH A;  3WOD A;  1XZQ B;  1HQM A;  2JA6 K;  2R7Z C;  2A6E A;  5EGH A;  4A3F K;  1IBA A;  3I4N C;  1XPP A;  1EK8 A;  3S1R K;  1UV7 A;  3TFH A;  2GSO A;  4PAB A;  1L0W A;  4C2M C;  3TFJ A;  1BJT A;  1VLO A;  4MQ9 A;  2ZUF A;  1WOS A;  3H3V D;  4XLP A;  3GEE A;  5C4X C;  5TMF A;  1J6V A;  5IOT A;  4A3C K;  4RMF A;  2Y0S L;  1PJ6 A;  1YCL A;  3GEH A;  4WIL A;  2EBB A;  1TWG K;  4FZB A;  2JH3 A;  4GTE A;  5E68 A;  3OEP A;  4A3I C;  2JA7 A;  2VUM K;  4OIQ A;  1VJE A;  5C44 C;  2JA7 C;  2FQO A;  3HOV C;  3NUH A;  2E2J C;  4KM9 A;  2PPB A;  1O27 A;  3T01 A;  3RZO K;  1O24 A;  2JA5 A;  4GT9 A;  2R93 K;  4KMU A;  4BY1 C;  1TWH A;  2JA5 C;  1TWC K;  2E2H K;  4XSZ A;  4WJ3 M;  4P5B A;  1J98 A;  4PAA A;  3RZD C;  1TWH C;  4G0V A;  1F9N A;  4KAR A;  1YNJ A;  4A3J K;  1BGW A;  3HKZ L;  4LK1 A;  3N3Y A;  2CFA A;  1TWF A;  1WCM K;  2GAG C;  1TWF C;  4LQY A;  3S1N C;  3I4M C;  2A6H A;  3CAG A;  4BBR K;  5M5W K;  2NVQ C;  2XCO A;  4C3I K;  5JFE A;  5IYB C;  3L4J A;  1ZYR A;  4ZH4 A;  4A93 C;  1I50 K;  1AB4 A;  3GIR A;  4C3J K;  4G0U A;  3S17 K;  1PJ5 A;  1ZBS A;  2WB1 L;  4C3H K;  3HOY C;  4A3E C;  4QJV B;  1WQF A;  3ORE A;  4XLN A;  1O26 A;  5IYD C;  5C4J C;  3LAJ A;  1Y1W A;  4GTC A;  1RU0 A;  5C3E C;  3GTQ K;  4BXX C;  1O2B A;  2JA8 K;  4KAW X;  1Y1W C;  2V6U A;  3PO3 C;  3IPJ A;  3HOZ C;  4YG2 A;  4KB4 A;  4BBS C;  4A3F C;  4Q5S A;  5TMC A;  4LLG A;  4A3M K; 
#chains in the Genus database with same CATH homology
 5FLM K;  1HQM A;  2JA6 K;  3S1M K;  2R7Z C;  2A6E A;  3H3V L;  2NVY C;  4Y7N K;  1IW7 A;  4A3F K;  3I4N C;  1XPP A;  2PMZ L;  4A3D C;  3GTQ C;  4OIP A;  3S1R K;  5IP9 K;  3HOW C;  5M5X K;  3GTK K;  2NVY K;  4MQ9 A;  4A3I K;  2YU9 C;  3H3V D;  1SFO K;  4XLP A;  4A3D K;  2PMZ D;  5M5Y K;  3GTP C;  1TWA K;  5C44 K;  1I6H C;  3S16 C;  5C4X C;  3HOW K;  4C2M K;  2PA8 D;  4A3B K;  5TMF A;  3GTJ C;  2YU9 K;  3GTG K;  3H0G C;  4A3C K;  3GTL K;  4YFX A;  4A3M C;  5FLM C;  4A3G K;  2E2J K;  2JA6 C;  3GTP K;  4OIO A;  3M3Y C;  2Y0S L;  1I6H K;  3HOU C;  1R9T C;  3HOX K;  1SMY A;  5M3F K;  3H0G K;  3S1R C;  1TWG K;  5IP9 C;  4BY1 K;  2JA5 K;  3GTK C;  3M3Y K;  2Y0S D;  4A3I C;  1R9T K;  3HOU K;  3S14 C;  1SFO C;  3RZD K;  2NVX C;  2VUM K;  4OIQ A;  1TWH K;  1I3Q K;  1TWA C;  5C44 C;  2NVT K;  2JA7 C;  4BY7 C;  4KN7 A;  2PA8 L;  3HOV C;  4OIR A;  3RZO C;  4A3B C;  3DXJ A;  3S14 K;  4YFK A;  3GTG C;  4A3C C;  2NVX K;  3GTL C;  3PO2 K;  4A3G C;  2E2J C;  4BY7 K;  2PPB A;  2JA7 K;  2E2H C;  3HOV K;  3RZO K;  4X6A K;  3S1Q C;  1Y1V C;  1TWF K;  3HOX C;  4G7H A;  3S1N K;  4QIW D;  3GTO K;  1TWG C;  2R93 K;  4KMU A;  1BDF A;  4BY1 C;  2JA5 C;  1TWC K;  3EQL A;  4XSZ A;  2E2H K;  4Y52 K;  4G7Z A;  2NVQ K;  4NOI A;  1Y1V K;  3RZD C;  2VUM C;  3M4O K;  3S1Q K;  1TWH C;  1I3Q C;  3FKI C;  2NVT C;  4AYB L;  4MEX A;  1YNJ A;  4A3J K;  3HKZ L;  2E2I K;  4LK1 A;  3S2D K;  2CW0 A;  3PO2 C;  4A3E K;  4BBR C;  1WCM K;  3FKI K;  3S2H C;  4AYB D;  4XSX A;  4A3M K;  4X6A C;  1TWF C;  2B63 K;  3S1N C;  3I4M C;  3CQZ K;  3HKZ D;  2A6H A;  4QIW L;  3GTO C;  5C4J K;  5IYD K;  4Q4Z A;  2R93 C;  4BBR K;  1I50 C;  1YNN A;  5M5W K;  1TWC C;  5C3E K;  4Y52 C;  3GTM K;  3S2H K;  2NVQ C;  4BXX K;  5M3M K;  4LK0 A;  4C3I K;  3M4O C;  5IYB C;  1Y1W K;  5IYC C;  2A68 A;  3I4M K;  3PO3 K;  2BE5 A;  1ZYR A;  3K7A K;  4ZH4 A;  4A93 C;  1I50 K;  4A3J C;  4C3J K;  3S17 K;  4A3K C;  2O5I A;  5IP7 K;  2E2I C;  3S2D C;  2WB1 L;  4MEY A;  4C3H K;  3HOY C;  4BBS K;  4QJV A;  5IYB K;  5IYC K;  4A3E C;  4QJV B;  1WCM C;  4YFN A;  5D4D A;  4A93 K;  1K83 C;  2JA8 C;  2B63 C;  4LJZ A;  4A3K K;  2WAQ L;  3CQZ C;  2R7Z K;  4XLN A;  5IYD C;  2WB1 D;  4JK1 A;  5C4J C;  2R92 C;  2A69 A;  3HOY K;  3I4N K;  5FJ8 K;  4GZY A;  5C3E C;  3GTM C;  3GTQ K;  4BXX C;  4OIN A;  1K83 K;  2JA8 K;  1Y1W C;  2O5J A;  2WAQ D;  3PO3 C;  2R92 K;  3HOZ C;  3K7A C;  4A3L C;  3S15 C;  3S17 C;  4KN4 A;  4YG2 A;  3S1M C;  5IP7 C;  4G7O A;  4BBS C;  5C4X K;  3S16 K;  1I6V A;  4Y7N C;  4A3F C;  4Q5S A;  3GTJ K;  5TMC A;  3HOZ K;  4A3L K;  4LLG A;  3S15 K;  3WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...