4BY1K

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by1K00
4A93C 3M4OC 3S17K 1I3QC 3FKIC 2YU9C 3S14K 1I6HK 3GTLC 4A3KK 5C4XK 4Y7NC 5C4JK 3HOWK 4KN7A 4KMUA 2E2IK 2E2JK 1WCMC 5TMFA 2VUMK 3PO2C 5FLMK 1TWAC 4BY1C 4A3EK 4BXXK 4G7OA 4Q5SA 1Y1VK 1K83K 3HOXC 1IW7A 3RZDC 1Y1WK 4A3BK 2NVYC 3GTPC 4XLPA 4A3GK 5M5WK 3HOVC 3M3YK 4A3CK 2JA8C 3S2DK 3GTMC 1TWFK 4LLGA 3K7AK 2PMZL 4BBSK 3S15K 4YFNA 4X6AK 5IP9C 3M4OK 4A93K 3RZOK 1I3QK 1TWCC 3FKIK 1R9TC 1I50C 3GTLK 4YFXA 4BBRK 3S1RC 2O5JA 2BE5A 3CQZC 3DXJA 3HKZD 2NVXC 4C3JK 2R92C 3PO2K 4BY7K 2Y0SL 5M5YK 4MEXA 3HOYK 3GTOC 3HOZC 1TWAK 4A3MC 4QIWL 3GTQK 4AYBL 2R7ZK 3S16K 3HOXK 4GZYA 1XPPA 2WAQD 4XSZA 2A6EA 2NVYK 3H3VL 2WB1D 3HOVK 4LK0A 2JA8K 3S1QC 4MEYA 4A3LC 4OIQA 1TWHC 2PA8L 5M5XK 2A69A 5IP9K 1SMYA 5IYBC 1TWCK 1R9TK 2JA6K 1ZYRA 2B63C 3S1RK 2R93K 1I6VA 2O5IA 2A6HA 2JA5K 2NVXK 2R92K 3HOZK 1SFOC 3GTOK 3EQLA 4A3MK 2E2HC 5IP7C 4A3IC 2YU9K 4BBSC 4Y7NK 5IYDC 3GTGC 4XSXA 3S1MC 3I4NC 1WCMK 1YNJA 4A3LK 3GTJC 1BDFA 2PMZD 5C3EC 2NVQC 2JA7C 4A3FC 4BY1K 3GTKC 3S1NC 2NVTC 1YNNA 4A3DC 3PO3C 3RZDK 4A3KC 3GTPK 3HOWC 3WODA 2B63K 4OINA 2CW0A 5FJ8K 2E2IC 3H0GC 3GTMK 3I4MC 2Y0SD 4LK1A 4YG2A 4QIWD 4OIPA 4AYBD 5D4DA 4A3EC 4A3JC 5IP7K 1I50K 1Y1VC 4A3IK 1SFOK 2E2HK 1Y1WC 3H3VD 3GTGK 4A3GC 4OIOA 3S1MK 3CQZK 3S2DC 3I4NK 1TWGC 4OIRA 4QJVB 3K7AC 5C3EK 2JA7K 2PA8D 4C3IK 4Y52C 4A3FK 2NVQK 3S1NK 3S15C 2NVTK 3RZOC 4A3DK 4G7ZA 1HQMA 4YFKA 5C44C 3PO3K 4G7HA 3S2HC 4BBRC 4C2MK 5TMCA 4XLNA 4Q4ZA 5M3MK 3H0GK 5IYCC 3HOUC 3S1QK 3I4MK 1TWHK 4MQ9A 4BY7C 3S17C 3HOYC 2R7ZC 1I6HC 3GTQC 3S14C 5IYBK 4A3JK 3S16C 5C4XC 5C4JC 4C3HK 5M3FK 2E2JC 4JK1A 4ZH4A 4QJVA 2VUMC 4X6AC 1TWGK 3HKZL 5FLMC 4KN4A 4BXXC 4Y52K 1K83C 2PPBA 2WAQL 5C44K 2JA6C 4A3BC 5IYDK 2A68A 3S2HK 2WB1L 3M3YC 4A3CC 1TWFC 4LJZA 5IYCK 3GTJK 3HOUK 3GTKK 4NOIA 2R93C 2JA5C
chains in the Genus database with same CATH superfamily
2YU9A 3S17K 2P5MA 3FKIC 4G0WA 4A3KK 4KN7A 3T02A 1WCMA 1XZQA 3PO2C 1TWAC 4BLBA 4BLAA 1Y1VK 2NVYA 4A3BK 3GTPC 4XLPA 1XZPA 2JA8C 3GTMC 3K7AK 1IS1A 4A93K 1XXBA 1I3QK 1R9TC 3CQZA 3S1RC 2NVXA 2O5JA 3G4CA 4C3JK 2R92C 4BY7K 2Y0SL 3GTQK 2GAHC 4GZYA 3HOXK 2D6FC 2WAQD 2KWAA 2RH6A 2WB1D 4C2MC 2Y3PA 4LK0A 4MEYA 1TWHA 4KATA 5M5XK 1IL2A 2A69A 1INNA 2JA6K 2V6UA 3ERED 2B63C 1IBAA 4J3NA 1G51A 2JA5K 3EQLA 4XCHA 4XSXA 3I4NC 3GTKA 3BUEA 1BDFA 2GSUA 3S0XA 1V5VA 2NVTC 5IOQA 3RZDK 3WODA 1JVIA 1WSVA 3H0GC 4WJ3M 1PJ6A 4KMDA 4KAWX 4LK1A 3I4MC 1Y1VA 4QIWD 4OIPA 4AYBD 2GSOA 3GTGK 1DD5A 4RMFA 3A8KA 4OIRA 4QJVB 1VGXA 2PA8D 4FZBA 4C3IK 4A3FK 3S15C 1AB4A 3RZOC 4A3DK 4G7ZA 1HQMA 1X31C 4GTBA 4G7HA 4BBRC 2P8TA 1USOA 1EH1A 3MMLB 3GTQA 1JOEA 4A3JK 2XCOA 3S16C 5M3FK 4QJVA 1O24A 4GTLA 2VUMC 4KN4A 4Y52K 1WORA 2JA6A 4KM8A 2PPBA 2WAQL 5IYDK 4ILDA 1WOPA 3SZYA 2WB1L 1RU0A 1O28A 1B4AA 2JA5A 3GTJK 4O2DA 4FM9A 3GTLA 2YU9C 5C4XK 3A8JA 5C4JK 2E2JK 1J6WA 1WCMC 5TMFA 1VRQC 4BY1C 4A3EK 4BXXK 4G7OA 1IQ0A 1K83K 2NVYC 4A3CK 1WQHA 1J6XA 1TWFK 3CAGA 4DDQA 4BBSK 1TWCA 5IP9C 3FKIK 1WOSA 4YFXA 4LOWA 3CQZC 3DXJA 3HKZD 2NVXC 3PO2K 3GTOA 3HOZC 3HOYK 1B4BA 2R7ZK 1TWAK 4A3MC 4QIWL 4AYBL 2ZFZA 5JVOA 1BS2A 2JA8K 3S1QC 1TWHC 2PA8L 4P5BA 5IYBC 1R9TK 3LAPA 1XXAA 3S1RK 3GSIA 2R93K 2A6HA 3FOEA 1SFOA 2R92K 2E2HA 1WOOA 5EGHA 3TFIA 3TTGA 4Y7NK 3S1MC 3GTJA 1YNJA 2JA7A 2PMZD 3GTKC 2NVQC 3S1NC 5L46A 3PO3C 2FQOA 4A3KC 2B63K 4OINA 1YCLA 3AD7C 1WIHA 2GAGC 2CFAB 4WILA 1K83A 1I50K 1Y1VC 2V6TA 2V6SA 1O29A 1DCPA 1PJ7A 1TWGA 3OEPA 3I4NK 1C0AA 3K7AC 1PJ5A 2ZUEA 1O26A 2NVTK 5C44C 1EK8A 3S2HC 4Q4ZA 2CFAA 3H0GK 5IYCC 4KM9A 2R7ZA 3I4MK 4BY7C 5IOSA 1ZBSA 1ISEA 3FHZA 1I6HC 3GTQC 3S14C 4GTFA 2XCRB 3AQPA 3N3YA 4JK1A 3Q3QA 1VH2A 3HKZL 1F9NA 5FLMC 3BP8C 3GIRA 2JA6C 3FOFA 2A68A 2R93A 3M3YC 2JA5C 1I3QA 3M4OC 3QX3A 3GTLC 3HOWK 3GDZA 3LPXA 2E2IK 2W7VA 1F7VA 2VUMK 1J6VA 4GTDA 3A8IA 4Q5SA 1IW7A 3RZDC 1L0WA 1Y1WK 4A3GK 4GTAA 1O25A 3HOVC 3S2DK 2PMZL 4X6AK 1XXCA 4YFNA 1HI9A 3N0CA 1I50A 1TWCC 1UV7A 3T01A 5M5YK 3GTOC 4C3IC 1O27A 1XPPA 2NVYK 1YX2A 1USMA 4A3LC 4OIQA 5IP9K 4AH6A 4BKWA 1SMYA 1ZYRA 4WJ4A 1I6VA 2NVXK 3HOZK 1SFOC 4A3MK 2E2HC 5IP7C 4A3IC 3GTGA 2PHCB 5IYDC 1GE9A 1ZVUA 1O2AA 3GTJC 5C3EC 5TJ3A 2JA7C 1YNNA 3GTPK 3G4AA 2E2IA 1WQFA 2RGRA 5FJ8K 4G0VA 3GTMK 4LQYA 1XZQB 5D4DA 4A3EC 1Y1WA 4C3HC 3T00A 5IORA 3H3VD 4KDDA 3S1MK 1TWGC 1XZPB 4PABA 2NVQK 3S1NK 4KB4A 4KARA 3PO3K 4YFKA 5TMCA 4C2MK 4XLNA 5M3MK 3L4JA 3HOUC 4LR2A 3BP3A 3ADAC 5CHPA 3S17C 3HOYC 2R7ZC 2ZUFA 1DCHA 4ZH4A 1JQWA 5JFEA 3HXAA 1BGWA 4GT9A 3GEHA 5C44K 4G0UA 4A3BC 3S2HK 1TWFA 4P5AA 1EQRA 2R93C 5IYCK 3N0BA 2EBBA 3FKIA 4A93C 4C45A 1I3QC 3S14K 1I6HK 4KASA 4Y7NC 4KMUA 4C3JC 1TWAA 5FLMK 1VJEA 3LAJA 3HOXC 3L4KA 3GTPA 3GTMA 5M5WK 3M3YK 1J98A 1ZXOA 4M1XA 4LLGA 3S15K 5EGEA 1R9TA 3M4OK 3RZOK 4GFQA 1KQ4A 1I50C 3GTLK 4BBRK 2R92A 2BE5A 3AD8C 4MEXA 3V4GA 1ZQ1C 1IE0A 3S16K 4XSZA 2A6EA 3H3VL 3NUHA 4P9SA 3HOVK 4KB2A 5CJ9A 3TFHA 4PAAA 1TWCK 1WSRA 2B63A 4GTEA 2O5IA 3OREA 3GTOK 2YU9K 3AQOA 3GTGC 2JH3A 1VLOA 1F93A 1WCMK 4A3LK 1O2FB 3JSTA 4A3FC 4BY1K 4A3DC 2XCQA 3IPJA 3HOWC 3H0GA 2CW0A 2E2IC 3GEEA 2Y0SD 4YG2A 1SFOK 1EI6A 4A3JC 2E2HK 5IP7K 4A3IK 1O2BA 3TFJA 4GTCA 1Y1WC 4A3GC 4OIOA 3CQZK 3S2DC 3VA7A 2FQTA 5C3EK 2JA7K 4X6AC 4Y52C 1DCOA 4KC6A 3SZZA 5IOTA 3S1QK 4KMAA 1TWHK 4MQ9A 5E68A 5IYBK 3GEIA 1WQGA 5C4XC 2GSNA 4C3HK 5C4JC 1F7UA 2E2JC 2VUMA 3AH5A 3AD9C 1TWGK 4KMHA 5HL8A 4BXXC 1K83C 1BJTA 4A3CC 1TWFC 4LJZA 3OPFA 1EFWA 3HOUK 3GTKK 4NOIA 4BBSC
chains in the Genus database with same CATH topology
4A93C 3M4OC 3S17K 1I3QC 3FKIC 2YU9C 3S14K 1I6HK 3GTLC 4A3KK 5C4XK 4Y7NC 5C4JK 3HOWK 4KN7A 4KMUA 2E2IK 2E2JK 1WCMC 5TMFA 2VUMK 3PO2C 5FLMK 1TWAC 4BY1C 4A3EK 4BXXK 4G7OA 4Q5SA 1Y1VK 1K83K 3HOXC 1IW7A 3RZDC 1Y1WK 4A3BK 2NVYC 3GTPC 4XLPA 4A3GK 5M5WK 3HOVC 3M3YK 4A3CK 2JA8C 3S2DK 3GTMC 1TWFK 4LLGA 3K7AK 2PMZL 4BBSK 3S15K 4YFNA 4X6AK 5IP9C 3M4OK 4A93K 3RZOK 1I3QK 1TWCC 3FKIK 1R9TC 1I50C 3GTLK 4YFXA 4BBRK 3S1RC 2O5JA 2BE5A 3CQZC 3DXJA 3HKZD 2NVXC 4C3JK 2R92C 3PO2K 4BY7K 2Y0SL 5M5YK 4MEXA 3HOYK 3GTOC 3HOZC 1TWAK 4A3MC 4QIWL 3GTQK 4AYBL 2R7ZK 3S16K 3HOXK 4GZYA 1XPPA 2WAQD 4XSZA 2A6EA 2NVYK 3H3VL 2WB1D 3HOVK 4LK0A 2JA8K 3S1QC 4MEYA 4A3LC 4OIQA 1TWHC 2PA8L 5M5XK 2A69A 5IP9K 1SMYA 5IYBC 1TWCK 1R9TK 2JA6K 1ZYRA 2B63C 3S1RK 2R93K 1I6VA 2O5IA 2A6HA 2JA5K 2NVXK 2R92K 3HOZK 1SFOC 3GTOK 3EQLA 4A3MK 2E2HC 5IP7C 4A3IC 2YU9K 4BBSC 4Y7NK 5IYDC 3GTGC 4XSXA 3S1MC 3I4NC 1WCMK 1YNJA 4A3LK 3GTJC 1BDFA 2PMZD 5C3EC 2NVQC 2JA7C 4A3FC 4BY1K 3GTKC 3S1NC 2NVTC 1YNNA 4A3DC 3PO3C 3RZDK 4A3KC 3GTPK 3HOWC 3WODA 2B63K 4OINA 2CW0A 5FJ8K 2E2IC 3H0GC 3GTMK 3I4MC 2Y0SD 4LK1A 4YG2A 4QIWD 4OIPA 4AYBD 5D4DA 4A3EC 4A3JC 5IP7K 1I50K 1Y1VC 4A3IK 1SFOK 2E2HK 1Y1WC 3H3VD 3GTGK 4A3GC 4OIOA 3S1MK 3CQZK 3S2DC 3I4NK 1TWGC 4OIRA 4QJVB 3K7AC 5C3EK 2JA7K 2PA8D 4C3IK 4Y52C 4A3FK 2NVQK 3S1NK 3S15C 2NVTK 3RZOC 4A3DK 4G7ZA 1HQMA 4YFKA 5C44C 3PO3K 4G7HA 3S2HC 4BBRC 4C2MK 5TMCA 4XLNA 4Q4ZA 5M3MK 3H0GK 5IYCC 3HOUC 3S1QK 3I4MK 1TWHK 4MQ9A 4BY7C 3S17C 3HOYC 2R7ZC 1I6HC 3GTQC 3S14C 5IYBK 4A3JK 3S16C 5C4XC 5C4JC 4C3HK 5M3FK 2E2JC 4JK1A 4ZH4A 4QJVA 2VUMC 4X6AC 1TWGK 3HKZL 5FLMC 4KN4A 4BXXC 4Y52K 1K83C 2PPBA 2WAQL 5C44K 2JA6C 4A3BC 5IYDK 2A68A 3S2HK 2WB1L 3M3YC 4A3CC 1TWFC 4LJZA 5IYCK 3GTJK 3HOUK 3GTKK 4NOIA 2R93C 2JA5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 C;  3M4O C;  3S17 K;  1I3Q C;  3FKI C;  2YU9 C;  3S14 K;  1I6H K;  3GTL C;  4A3K K;  5C4X K;  4Y7N C;  5C4J K;  3HOW K;  4KN7 A;  4KMU A;  2E2I K;  2E2J K;  1WCM C;  5TMF A;  2VUM K;  3PO2 C;  5FLM K;  1TWA C;  4BY1 C;  4A3E K;  4BXX K;  4G7O A;  4Q5S A;  1Y1V K;  1K83 K;  3HOX C;  1IW7 A;  3RZD C;  1Y1W K;  4A3B K;  2NVY C;  3GTP C;  4XLP A;  4A3G K;  5M5W K;  3HOV C;  3M3Y K;  4A3C K;  2JA8 C;  3S2D K;  3GTM C;  1TWF K;  4LLG A;  3K7A K;  2PMZ L;  4BBS K;  3S15 K;  4YFN A;  4X6A K;  5IP9 C;  3M4O K;  4A93 K;  3RZO K;  1I3Q K;  1TWC C;  3FKI K;  1R9T C;  1I50 C;  3GTL K;  4YFX A;  4BBR K;  3S1R C;  2O5J A;  2BE5 A;  3CQZ C;  3DXJ A;  3HKZ D;  2NVX C;  4C3J K;  2R92 C;  3PO2 K;  4BY7 K;  2Y0S L;  5M5Y K;  4MEX A;  3HOY K;  3GTO C;  3HOZ C;  1TWA K;  4A3M C;  4QIW L;  3GTQ K;  4AYB L;  2R7Z K;  3S16 K;  3HOX K;  4GZY A;  1XPP A;  2WAQ D;  4XSZ A;  2A6E A;  2NVY K;  3H3V L;  2WB1 D;  3HOV K;  4LK0 A;  2JA8 K;  3S1Q C;  4MEY A;  4A3L C;  4OIQ A;  1TWH C;  2PA8 L;  5M5X K;  2A69 A;  5IP9 K;  1SMY A;  5IYB C;  1TWC K;  1R9T K;  2JA6 K;  1ZYR A;  2B63 C;  3S1R K;  2R93 K;  1I6V A;  2O5I A;  2A6H A;  2JA5 K;  2NVX K;  2R92 K;  3HOZ K;  1SFO C;  3GTO K;  3EQL A;  4A3M K;  2E2H C;  5IP7 C;  4A3I C;  2YU9 K;  4BBS C;  4Y7N K;  5IYD C;  3GTG C;  4XSX A;  3S1M C;  3I4N C;  1WCM K;  1YNJ A;  4A3L K;  3GTJ C;  1BDF A;  2PMZ D;  5C3E C;  2NVQ C;  2JA7 C;  4A3F C;  4BY1 K;  3GTK C;  3S1N C;  2NVT C;  1YNN A;  4A3D C;  3PO3 C;  3RZD K;  4A3K C;  3GTP K;  3HOW C;  3WOD A;  2B63 K;  4OIN A;  2CW0 A;  5FJ8 K;  2E2I C;  3H0G C;  3GTM K;  3I4M C;  2Y0S D;  4LK1 A;  4YG2 A;  4QIW D;  4OIP A;  4AYB D;  5D4D A;  4A3E C;  4A3J C;  5IP7 K;  1I50 K;  1Y1V C;  4A3I K;  1SFO K;  2E2H K;  1Y1W C;  3H3V D;  3GTG K;  4A3G C;  4OIO A;  3S1M K;  3CQZ K;  3S2D C;  3I4N K;  1TWG C;  4OIR A;  4QJV B;  3K7A C;  5C3E K;  2JA7 K;  2PA8 D;  4C3I K;  4Y52 C;  4A3F K;  2NVQ K;  3S1N K;  3S15 C;  2NVT K;  3RZO C;  4A3D K;  4G7Z A;  1HQM A;  4YFK A;  5C44 C;  3PO3 K;  4G7H A;  3S2H C;  4BBR C;  4C2M K;  5TMC A;  4XLN A;  4Q4Z A;  5M3M K;  3H0G K;  5IYC C;  3HOU C;  3S1Q K;  3I4M K;  1TWH K;  4MQ9 A;  4BY7 C;  3S17 C;  3HOY C;  2R7Z C;  1I6H C;  3GTQ C;  3S14 C;  5IYB K;  4A3J K;  3S16 C;  5C4X C;  5C4J C;  4C3H K;  5M3F K;  2E2J C;  4JK1 A;  4ZH4 A;  4QJV A;  2VUM C;  4X6A C;  1TWG K;  3HKZ L;  5FLM C;  4KN4 A;  4BXX C;  4Y52 K;  1K83 C;  2PPB A;  2WAQ L;  5C44 K;  2JA6 C;  4A3B C;  5IYD K;  2A68 A;  3S2H K;  2WB1 L;  3M3Y C;  4A3C C;  1TWF C;  4LJZ A;  5IYC K;  3GTJ K;  3HOU K;  3GTK K;  4NOI A;  2R93 C;  2JA5 C; 
#chains in the Genus database with same CATH topology
 2YU9 A;  3S17 K;  2P5M A;  3FKI C;  4G0W A;  4A3K K;  4KN7 A;  3T02 A;  1WCM A;  1XZQ A;  3PO2 C;  1TWA C;  4BLB A;  4BLA A;  1Y1V K;  2NVY A;  4A3B K;  3GTP C;  4XLP A;  1XZP A;  2JA8 C;  3GTM C;  3K7A K;  1IS1 A;  4A93 K;  1XXB A;  1I3Q K;  1R9T C;  3CQZ A;  3S1R C;  2NVX A;  2O5J A;  3G4C A;  4C3J K;  2R92 C;  4BY7 K;  2Y0S L;  3GTQ K;  2GAH C;  4GZY A;  3HOX K;  2D6F C;  2WAQ D;  2KWA A;  2RH6 A;  2WB1 D;  4C2M C;  2Y3P A;  4LK0 A;  4MEY A;  1TWH A;  4KAT A;  5M5X K;  1IL2 A;  2A69 A;  1INN A;  2JA6 K;  2V6U A;  3ERE D;  2B63 C;  1IBA A;  4J3N A;  1G51 A;  2JA5 K;  3EQL A;  4XCH A;  4XSX A;  3I4N C;  3GTK A;  3BUE A;  1BDF A;  2GSU A;  3S0X A;  1V5V A;  2NVT C;  5IOQ A;  3RZD K;  3WOD A;  1JVI A;  1WSV A;  3H0G C;  4WJ3 M;  1PJ6 A;  4KMD A;  4KAW X;  4LK1 A;  3I4M C;  1Y1V A;  4QIW D;  4OIP A;  4AYB D;  2GSO A;  3GTG K;  1DD5 A;  4RMF A;  3A8K A;  4OIR A;  4QJV B;  1VGX A;  2PA8 D;  4FZB A;  4C3I K;  4A3F K;  3S15 C;  1AB4 A;  3RZO C;  4A3D K;  4G7Z A;  1HQM A;  1X31 C;  4GTB A;  4G7H A;  4BBR C;  2P8T A;  1USO A;  1EH1 A;  3MML B;  3GTQ A;  1JOE A;  4A3J K;  2XCO A;  3S16 C;  5M3F K;  4QJV A;  1O24 A;  4GTL A;  2VUM C;  4KN4 A;  4Y52 K;  1WOR A;  2JA6 A;  4KM8 A;  2PPB A;  2WAQ L;  5IYD K;  4ILD A;  1WOP A;  3SZY A;  2WB1 L;  1RU0 A;  1O28 A;  1B4A A;  2JA5 A;  3GTJ K;  4O2D A;  4FM9 A;  3GTL A;  2YU9 C;  5C4X K;  3A8J A;  5C4J K;  2E2J K;  1J6W A;  1WCM C;  5TMF A;  1VRQ C;  4BY1 C;  4A3E K;  4BXX K;  4G7O A;  1IQ0 A;  1K83 K;  2NVY C;  4A3C K;  1WQH A;  1J6X A;  1TWF K;  3CAG A;  4DDQ A;  4BBS K;  1TWC A;  5IP9 C;  3FKI K;  1WOS A;  4YFX A;  4LOW A;  3CQZ C;  3DXJ A;  3HKZ D;  2NVX C;  3PO2 K;  3GTO A;  3HOZ C;  3HOY K;  1B4B A;  2R7Z K;  1TWA K;  4A3M C;  4QIW L;  4AYB L;  2ZFZ A;  5JVO A;  1BS2 A;  2JA8 K;  3S1Q C;  1TWH C;  2PA8 L;  4P5B A;  5IYB C;  1R9T K;  3LAP A;  1XXA A;  3S1R K;  3GSI A;  2R93 K;  2A6H A;  3FOE A;  1SFO A;  2R92 K;  2E2H A;  1WOO A;  5EGH A;  3TFI A;  3TTG A;  4Y7N K;  3S1M C;  3GTJ A;  1YNJ A;  2JA7 A;  2PMZ D;  3GTK C;  2NVQ C;  3S1N C;  5L46 A;  3PO3 C;  2FQO A;  4A3K C;  2B63 K;  4OIN A;  1YCL A;  3AD7 C;  1WIH A;  2GAG C;  2CFA B;  4WIL A;  1K83 A;  1I50 K;  1Y1V C;  2V6T A;  2V6S A;  1O29 A;  1DCP A;  1PJ7 A;  1TWG A;  3OEP A;  3I4N K;  1C0A A;  3K7A C;  1PJ5 A;  2ZUE A;  1O26 A;  2NVT K;  5C44 C;  1EK8 A;  3S2H C;  4Q4Z A;  2CFA A;  3H0G K;  5IYC C;  4KM9 A;  2R7Z A;  3I4M K;  4BY7 C;  5IOS A;  1ZBS A;  1ISE A;  3FHZ A;  1I6H C;  3GTQ C;  3S14 C;  4GTF A;  2XCR B;  3AQP A;  3N3Y A;  4JK1 A;  3Q3Q A;  1VH2 A;  3HKZ L;  1F9N A;  5FLM C;  3BP8 C;  3GIR A;  2JA6 C;  3FOF A;  2A68 A;  2R93 A;  3M3Y C;  2JA5 C;  1I3Q A;  3M4O C;  3QX3 A;  3GTL C;  3HOW K;  3GDZ A;  3LPX A;  2E2I K;  2W7V A;  1F7V A;  2VUM K;  1J6V A;  4GTD A;  3A8I A;  4Q5S A;  1IW7 A;  3RZD C;  1L0W A;  1Y1W K;  4A3G K;  4GTA A;  1O25 A;  3HOV C;  3S2D K;  2PMZ L;  4X6A K;  1XXC A;  4YFN A;  1HI9 A;  3N0C A;  1I50 A;  1TWC C;  1UV7 A;  3T01 A;  5M5Y K;  3GTO C;  4C3I C;  1O27 A;  1XPP A;  2NVY K;  1YX2 A;  1USM A;  4A3L C;  4OIQ A;  5IP9 K;  4AH6 A;  4BKW A;  1SMY A;  1ZYR A;  4WJ4 A;  1I6V A;  2NVX K;  3HOZ K;  1SFO C;  4A3M K;  2E2H C;  5IP7 C;  4A3I C;  3GTG A;  2PHC B;  5IYD C;  1GE9 A;  1ZVU A;  1O2A A;  3GTJ C;  5C3E C;  5TJ3 A;  2JA7 C;  1YNN A;  3GTP K;  3G4A A;  2E2I A;  1WQF A;  2RGR A;  5FJ8 K;  4G0V A;  3GTM K;  4LQY A;  1XZQ B;  5D4D A;  4A3E C;  1Y1W A;  4C3H C;  3T00 A;  5IOR A;  3H3V D;  4KDD A;  3S1M K;  1TWG C;  1XZP B;  4PAB A;  2NVQ K;  3S1N K;  4KB4 A;  4KAR A;  3PO3 K;  4YFK A;  5TMC A;  4C2M K;  4XLN A;  5M3M K;  3L4J A;  3HOU C;  4LR2 A;  3BP3 A;  3ADA C;  5CHP A;  3S17 C;  3HOY C;  2R7Z C;  2ZUF A;  1DCH A;  4ZH4 A;  1JQW A;  5JFE A;  3HXA A;  1BGW A;  4GT9 A;  3GEH A;  5C44 K;  4G0U A;  4A3B C;  3S2H K;  1TWF A;  4P5A A;  1EQR A;  2R93 C;  5IYC K;  3N0B A;  2EBB A;  3FKI A;  4A93 C;  4C45 A;  1I3Q C;  3S14 K;  1I6H K;  4KAS A;  4Y7N C;  4KMU A;  4C3J C;  1TWA A;  5FLM K;  1VJE A;  3LAJ A;  3HOX C;  3L4K A;  3GTP A;  3GTM A;  5M5W K;  3M3Y K;  1J98 A;  1ZXO A;  4M1X A;  4LLG A;  3S15 K;  5EGE A;  1R9T A;  3M4O K;  3RZO K;  4GFQ A;  1KQ4 A;  1I50 C;  3GTL K;  4BBR K;  2R92 A;  2BE5 A;  3AD8 C;  4MEX A;  3V4G A;  1ZQ1 C;  1IE0 A;  3S16 K;  4XSZ A;  2A6E A;  3H3V L;  3NUH A;  4P9S A;  3HOV K;  4KB2 A;  5CJ9 A;  3TFH A;  4PAA A;  1TWC K;  1WSR A;  2B63 A;  4GTE A;  2O5I A;  3ORE A;  3GTO K;  2YU9 K;  3AQO A;  3GTG C;  2JH3 A;  1VLO A;  1F93 A;  1WCM K;  4A3L K;  1O2F B;  3JST A;  4A3F C;  4BY1 K;  4A3D C;  2XCQ A;  3IPJ A;  3HOW C;  3H0G A;  2CW0 A;  2E2I C;  3GEE A;  2Y0S D;  4YG2 A;  1SFO K;  1EI6 A;  4A3J C;  2E2H K;  5IP7 K;  4A3I K;  1O2B A;  3TFJ A;  4GTC A;  1Y1W C;  4A3G C;  4OIO A;  3CQZ K;  3S2D C;  3VA7 A;  2FQT A;  5C3E K;  2JA7 K;  4X6A C;  4Y52 C;  1DCO A;  4KC6 A;  3SZZ A;  5IOT A;  3S1Q K;  4KMA A;  1TWH K;  4MQ9 A;  5E68 A;  5IYB K;  3GEI A;  1WQG A;  5C4X C;  2GSN A;  4C3H K;  5C4J C;  1F7U A;  2E2J C;  2VUM A;  3AH5 A;  3AD9 C;  1TWG K;  4KMH A;  5HL8 A;  4BXX C;  1K83 C;  1BJT A;  4A3C C;  1TWF C;  4LJZ A;  3OPF A;  1EFW A;  3HOU K;  3GTK K;  4NOI A;  4BBS C; 
#chains in the Genus database with same CATH homology
 4A93 C;  3M4O C;  3S17 K;  1I3Q C;  3FKI C;  2YU9 C;  3S14 K;  1I6H K;  3GTL C;  4A3K K;  5C4X K;  4Y7N C;  5C4J K;  3HOW K;  4KN7 A;  4KMU A;  2E2I K;  2E2J K;  1WCM C;  5TMF A;  2VUM K;  3PO2 C;  5FLM K;  1TWA C;  4BY1 C;  4A3E K;  4BXX K;  4G7O A;  4Q5S A;  1Y1V K;  1K83 K;  3HOX C;  1IW7 A;  3RZD C;  1Y1W K;  4A3B K;  2NVY C;  3GTP C;  4XLP A;  4A3G K;  5M5W K;  3HOV C;  3M3Y K;  4A3C K;  2JA8 C;  3S2D K;  3GTM C;  1TWF K;  4LLG A;  3K7A K;  2PMZ L;  4BBS K;  3S15 K;  4YFN A;  4X6A K;  5IP9 C;  3M4O K;  4A93 K;  3RZO K;  1I3Q K;  1TWC C;  3FKI K;  1R9T C;  1I50 C;  3GTL K;  4YFX A;  4BBR K;  3S1R C;  2O5J A;  2BE5 A;  3CQZ C;  3DXJ A;  3HKZ D;  2NVX C;  4C3J K;  2R92 C;  3PO2 K;  4BY7 K;  2Y0S L;  5M5Y K;  4MEX A;  3HOY K;  3GTO C;  3HOZ C;  1TWA K;  4A3M C;  4QIW L;  3GTQ K;  4AYB L;  2R7Z K;  3S16 K;  3HOX K;  4GZY A;  1XPP A;  2WAQ D;  4XSZ A;  2A6E A;  2NVY K;  3H3V L;  2WB1 D;  3HOV K;  4LK0 A;  2JA8 K;  3S1Q C;  4MEY A;  4A3L C;  4OIQ A;  1TWH C;  2PA8 L;  5M5X K;  2A69 A;  5IP9 K;  1SMY A;  5IYB C;  1TWC K;  1R9T K;  2JA6 K;  1ZYR A;  2B63 C;  3S1R K;  2R93 K;  1I6V A;  2O5I A;  2A6H A;  2JA5 K;  2NVX K;  2R92 K;  3HOZ K;  1SFO C;  3GTO K;  3EQL A;  4A3M K;  2E2H C;  5IP7 C;  4A3I C;  2YU9 K;  4BBS C;  4Y7N K;  5IYD C;  3GTG C;  4XSX A;  3S1M C;  3I4N C;  1WCM K;  1YNJ A;  4A3L K;  3GTJ C;  1BDF A;  2PMZ D;  5C3E C;  2NVQ C;  2JA7 C;  4A3F C;  4BY1 K;  3GTK C;  3S1N C;  2NVT C;  1YNN A;  4A3D C;  3PO3 C;  3RZD K;  4A3K C;  3GTP K;  3HOW C;  3WOD A;  2B63 K;  4OIN A;  2CW0 A;  5FJ8 K;  2E2I C;  3H0G C;  3GTM K;  3I4M C;  2Y0S D;  4LK1 A;  4YG2 A;  4QIW D;  4OIP A;  4AYB D;  5D4D A;  4A3E C;  4A3J C;  5IP7 K;  1I50 K;  1Y1V C;  4A3I K;  1SFO K;  2E2H K;  1Y1W C;  3H3V D;  3GTG K;  4A3G C;  4OIO A;  3S1M K;  3CQZ K;  3S2D C;  3I4N K;  1TWG C;  4OIR A;  4QJV B;  3K7A C;  5C3E K;  2JA7 K;  2PA8 D;  4C3I K;  4Y52 C;  4A3F K;  2NVQ K;  3S1N K;  3S15 C;  2NVT K;  3RZO C;  4A3D K;  4G7Z A;  1HQM A;  4YFK A;  5C44 C;  3PO3 K;  4G7H A;  3S2H C;  4BBR C;  4C2M K;  5TMC A;  4XLN A;  4Q4Z A;  5M3M K;  3H0G K;  5IYC C;  3HOU C;  3S1Q K;  3I4M K;  1TWH K;  4MQ9 A;  4BY7 C;  3S17 C;  3HOY C;  2R7Z C;  1I6H C;  3GTQ C;  3S14 C;  5IYB K;  4A3J K;  3S16 C;  5C4X C;  5C4J C;  4C3H K;  5M3F K;  2E2J C;  4JK1 A;  4ZH4 A;  4QJV A;  2VUM C;  4X6A C;  1TWG K;  3HKZ L;  5FLM C;  4KN4 A;  4BXX C;  4Y52 K;  1K83 C;  2PPB A;  2WAQ L;  5C44 K;  2JA6 C;  4A3B C;  5IYD K;  2A68 A;  3S2H K;  2WB1 L;  3M3Y C;  4A3C C;  1TWF C;  4LJZ A;  5IYC K;  3GTJ K;  3HOU K;  3GTK K;  4NOI A;  2R93 C;  2JA5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...