4BY1K

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by1K00
4G7ZA 3S2HK 3GTMK 4BBRC 1BDFA 3S1MK 3FKIK 4C3JK 2E2IK 3S15K 4A3LC 2YU9C 1HQMA 1R9TC 3HOUK 4OIRA 4A3CK 3HOWK 3CQZK 5IYCK 4QJVB 5IP9K 5TMCA 3S2DC 3GTPC 3H0GK 3M3YK 5M3MK 3S1RC 5C44K 1SFOK 3HOVC 3GTMC 2E2JK 3S1MC 2E2IC 4XSXA 4Y7NK 3S15C 3S14K 3GTGC 4A3EK 4BXXC 3RZOK 2A68A 2JA5K 4NOIA 3S1QK 3GTQK 4BY7K 3S16C 2O5JA 4BBSK 2NVTK 4A3CC 3CQZC 1YNJA 5IYCC 3HOXK 4LK0A 1I50K 5IP9C 5M5WK 5FLMC 4G7HA 3HOZC 3H0GC 2R92C 3I4MK 4GZYA 4Q5SA 2NVYK 4OINA 1SFOC 2E2JC 3PO3C 1Y1VK 4XLPA 4LJZA 3RZDK 3RZOC 1I6VA 5C4XK 3GTQC 4BY7C 4G7OA 3GTOK 4KN7A 2NVTC 4BBSC 1YNNA 5FJ8K 3HOXC 1I50C 2NVQC 5IP7K 3GTPK 3DXJA 4A3FK 3I4MC 1IW7A 1TWHC 1ZYRA 2NVYC 2NVXK 2VUMK 3GTKC 2JA7K 4BY1K 1Y1WK 4ZH4A 2JA6K 2PMZL 4C3HK 2JA8K 3S2HC 4A3DK 1I3QK 3FKIC 4A3GK 2A69A 4A3BK 1WCMK 3GTOC 2WAQD 2B63K 4XLNA 3GTJK 4A93K 3K7AK 4OIPA 5C4JK 3HOUC 2PA8L 3HOWC 4YFKA 5M5XK 4A3FC 2VUMC 4A3IK 2NVXC 2O5IA 3M3YC 2JA7C 5C44C 3S1NK 4YG2A 2A6HA 5D4DA 1Y1WC 3GTLK 2WAQL 4A3DC 1I6HK 4A3BC 4A3GC 2WB1D 4Y7NC 3HOYK 3I4NK 3S14C 1WCMC 4A3EC 4MEYA 4XSZA 4A3MK 2B63C 2JA5C 3GTJC 4QIWL 3S1QC 3K7AC 5C4JC 2PMZD 4A93C 2CW0A 5TMFA 4X6AK 3HKZL 2WB1L 4A3JK 2PPBA 4BBRK 4LK1A 5IYBK 3PO2K 2E2HK 3S17K 3S1NC 2PA8D 1TWFK 1Y1VC 1I6HC 2R7ZK 2YU9K 4A3LK 4Y52K 3I4NC 4KN4A 3RZDC 4A3MC 2R93C 1R9TK 4YFNA 5C4XC 5IYDK 1SMYA 3H3VD 4X6AC 5IP7C 4AYBD 5C3EK 1K83K 3HOVK 1TWCK 4QIWD 5IYBC 4A3JC 4KMUA 5M5YK 2E2HC 3PO2C 3S17C 4QJVA 1TWFC 5M3FK 4BY1C 2JA8C 1XPPA 4Y52C 2JA6C 2R7ZC 3GTGK 1I3QC 3H3VL 1TWGK 4BXXK 3HKZD 4C3IK 3S16K 5IYDC 3M4OK 2Y0SD 4AYBL 1TWAK 3HOZK 5FLMK 4A3KK 2R92K 4MQ9A 5C3EC 1K83C 4Q4ZA 1TWCC 4A3IC 4OIQA 2NVQK 3PO3K 2Y0SL 2BE5A 3GTLC 4YFXA 1TWGC 4C2MK 3M4OC 4JK1A 3HOYC 1TWAC 2R93K 4LLGA 4OIOA 4A3KC 4MEXA 1TWHK 3GTKK 3EQLA 3S2DK 2A6EA 3S1RK 3WODA
chains in the Genus database with same CATH superfamily
4G7ZA 1BDFA 2XCRB 1EFWA 4C2MC 1WOPA 1HQMA 3ADAC 3A8KA 3GTPC 3H0GK 3M3YK 1TWFA 3JSTA 1WIHA 2GSOA 1SFOK 1DCOA 3GSIA 2E2JK 3GTMC 2XCOA 4C3JC 2E2IC 4Y7NK 2A68A 2JA5K 2XCQA 4NOIA 3GTQK 4BY7K 1ZQ1C 3S16C 4WJ3M 4GTEA 4BLBA 3HOXK 3HOZC 5M5WK 5FLMC 4Q5SA 2R92C 4GZYA 3LAJA 2NVYK 4KMDA 3GTLA 3BP3A 1TWGA 5CHPA 1Y1VK 3A8IA 3RZOC 1I6VA 4G7OA 3AQOA 5CJ9A 1I50C 1USOA 4A3FK 2P5MA 2NVXK 3BP8C 4GTCA 1EK8A 1O2FB 2JA6K 4C3HK 1L0WA 3FKIC 4FZBA 4J3NA 4A3BK 1WCMK 3GTJK 4A93K 2PA8L 3HOWC 1B4BA 4YFKA 1J98A 2VUMC 5C44C 5D4DA 2A6HA 2RGRA 3I4NK 1WSRA 4A3EC 4MEYA 5C4JC 3H0GA 2CW0A 1SFOA 1B4AA 2V6UA 3HKZL 1EH1A 3Q3QA 4LK1A 5IYBK 4G0UA 3S17K 3GTQA 2FQOA 2R93C 4A3MC 4FM9A 1J6VA 5E68A 1AB4A 2NVYA 4AH6A 1V5VA 3FHZA 4AYBD 1ZVUA 1O2BA 4KMUA 5M5YK 3GEEA 2E2HC 3S16K 3M4OK 4AYBL 4G0VA 1TWAK 3IPJA 3HOZK 2NVXA 5FLMK 2R92K 4MQ9A 4Q4ZA 4GTFA 1TWCC 4A3IC 4OIQA 1VGXA 1WCMA 4PABA 3GTJA 2GAHC 3OEPA 4LLGA 4KC6A 4OIOA 4A3KC 4MEXA 3S2DK 3A8JA 3FKIK 1VRQC 1X31C 1XXAA 5IOSA 1USMA 4GFQA 2YU9C 3TFHA 3T01A 1JOEA 1R9TC 4A3CK 3HOWK 3CQZK 5IYCK 4QJVB 4XCHA 1O27A 5IP9K 1IE0A 3S1RC 5C44K 3HOVC 1BGWA 1I3QA 3S1MC 4KDDA 3S15C 3BUEA 4A3EK 3GTGC 2O5JA 2P8TA 4KMAA 3V4GA 4G0WA 3AQPA 3PO3C 1EI6A 1TWAA 1O28A 1EQRA 4GT9A 3GTOK 4GTDA 4LQYA 2NVTC 4BBSC 1INNA 1WSVA 3DXJA 3I4MC 1IW7A 1TWHC 5TJ3A 1O25A 1Y1WK 4ZH4A 3S2HC 2A69A 1IBAA 4XLNA 1JVIA 3K7AK 4GTBA 3HOUC 2ZFZA 4A3IK 2JA7C 3S1NK 4YG2A 1J6WA 4A3DC 4A3GC 3N0CA 3N0BA 2W7VA 4M1XA 3S14C 3CQZA 4XSZA 4KAWX 4KATA 2B63C 4QIWL 2V6SA 5HL8A 5JVOA 1KQ4A 2PA8D 3VA7A 1I6HC 2R7ZK 1J6XA 4KB4A 2YU9K 2RH6A 4Y52K 1XZPB 1R9TK 2V6TA 5C4XC 3AD7C 3LAPA 3H3VD 3GTKA 4X6AC 4LR2A 5C3EK 1K83K 3HOVK 4A3JC 3PO2C 4QJVA 1TWFC 4BY1C 2JA8C 3GTOA 3GTGK 3H3VL 3HKZD 5IYDC 2Y0SD 2CFAB 1Y1WA 2ZUFA 1PJ5A 2NVQK 3PO3K 2Y0SL 3GTLC 2JA5A 1TWGC 4C2MK 4BLAA 4C3IC 4JK1A 3HOYC 1WOOA 1TWHK 3GTPK 1Y1VA 3WODA 3S2HK 3GTMK 3GEIA 4C3JK 2E2IK 4A3LC 1O24A 3HOUK 2FQTA 4LOWA 1WORA 3T00A 2R7ZA 2JA6A 4XSXA 3S14K 3TFIA 4BXXC 1XXBA 3RZOK 3L4KA 1G51A 2GSNA 1YNJA 4ILDA 1K83A 1VJEA 4LK0A 1I50K 4P5AA 4G7HA 3H0GC 4OINA 1SFOC 3GDZA 2E2JC 1PJ6A 4KMHA 4LJZA 2JH3A 4WILA 5IOTA 4GTLA 5C4XK 3LPXA 3GTQC 4BY7C 4KN7A 3HOXC 1XZPA 3AH5A 2VUMK 2NVYC 3ERED 1F9NA 1HI9A 4BY1K 2JA8K 2PMZL 3TFJA 1F7VA 4OIPA 5C4JK 3GTPA 1XZQB 1VLOA 5M5XK 4A3FC 2ZUEA 3GTMA 1RU0A 2NVXC 2E2IA 3NUHA 4C3HC 3GTLK 2CFAA 5JFEA 2WB1D 3HOYK 4A3BC 2PHCB 1WCMC 4A3MK 2R93K 3S1QC 3GTJC 4A93C 2Y3PA 2R92A 3TTGA 3FOFA 1WQGA 2WB1L 1F93A 2E2HK 1DD5A 4A3LK 3I4NC 3RZDC 4GTAA 1WOSA 4KARA 4YFNA 1I50A 5IOQA 1SMYA 5IP7C 1TWCK 4QIWD 5IYBC 3FKIA 3S17C 1XPPA 4BXXK 1I3QC 4P5BA 2VUMA 4A3KK 3GIRA 3OREA 3OPFA 2D6FC 4KM9A 1PJ7A 2BE5A 4BKWA 4YFXA 3M4OC 1IL2A 1TWAC 5EGHA 1XXCA 1IQ0A 3EQLA 2A6EA 4KASA 1DCPA 3S1RK 4BBRC 3S1MK 2R93A 3SZYA 3S15K 1ISEA 4OIRA 5L46A 1C0AA 4KM8A 5TMCA 3S2DC 2E2HA 3G4CA 5M3MK 1XZQA 5EGEA 1O2AA 1O26A 3S1QK 3T02A 4BBSK 2NVTK 4A3CC 3CQZC 5IYCC 1TWCA 5IP9C 3I4MK 1ZXOA 2GAGC 3AD8C 3QX3A 1BJTA 4XLPA 1DCHA 3G4AA 4C45A 1F7UA 3RZDK 3GEHA 1YNNA 5FJ8K 3S0XA 5IP7K 1ZYRA 3MMLB 3GTKC 1VH2A 4P9SA 2JA7K 2YU9A 5IORA 4A3DK 1I3QK 4A3GK 1R9TA 1YX2A 3GTOC 2WAQD 2B63K 1BS2A 2EBBA 3HXAA 2O5IA 3M3YC 3FOEA 1Y1WC 3GTGA 2WAQL 1I6HK 4Y7NC 3L4JA 2JA5C 3K7AC 2PMZD 5TMFA 4X6AK 4KB2A 4A3JK 2PPBA 4BBRK 3PO2K 3S1NC 1WQHA 1TWFK 1Y1VC 1IS1A 2GSUA 4KN4A 4RMFA 5IYDK 3SZZA 1UV7A 1TWHA 4WJ4A 1O29A 4DDQA 5M3FK 2JA6C 2R7ZC 4Y52C 1TWGK 4C3IK 3AD9C 1WQFA 2JA7A 5C3EC 1K83C 4O2DA 1JQWA 2B63A 4PAAA 2KWAA 1ZBSA 3CAGA 3GTKK 1GE9A 3N3YA 2NVQC 1YCLA
chains in the Genus database with same CATH topology
4G7ZA 3S2HK 3GTMK 4BBRC 1BDFA 3S1MK 3FKIK 4C3JK 2E2IK 3S15K 4A3LC 2YU9C 1HQMA 1R9TC 3HOUK 4OIRA 4A3CK 3HOWK 3CQZK 5IYCK 4QJVB 5IP9K 5TMCA 3S2DC 3GTPC 3H0GK 3M3YK 5M3MK 3S1RC 5C44K 1SFOK 3HOVC 3GTMC 2E2JK 3S1MC 2E2IC 4XSXA 4Y7NK 3S15C 3S14K 3GTGC 4A3EK 4BXXC 3RZOK 2A68A 2JA5K 4NOIA 3S1QK 3GTQK 4BY7K 3S16C 2O5JA 4BBSK 2NVTK 4A3CC 3CQZC 1YNJA 5IYCC 3HOXK 4LK0A 1I50K 5IP9C 5M5WK 5FLMC 4G7HA 3HOZC 3H0GC 2R92C 3I4MK 4GZYA 4Q5SA 2NVYK 4OINA 1SFOC 2E2JC 3PO3C 1Y1VK 4XLPA 4LJZA 3RZDK 3RZOC 1I6VA 5C4XK 3GTQC 4BY7C 4G7OA 3GTOK 4KN7A 2NVTC 4BBSC 1YNNA 5FJ8K 3HOXC 1I50C 2NVQC 5IP7K 3GTPK 3DXJA 4A3FK 3I4MC 1IW7A 1TWHC 1ZYRA 2NVYC 2NVXK 2VUMK 3GTKC 2JA7K 4BY1K 1Y1WK 4ZH4A 2JA6K 2PMZL 4C3HK 2JA8K 3S2HC 4A3DK 1I3QK 3FKIC 4A3GK 2A69A 4A3BK 1WCMK 3GTOC 2WAQD 2B63K 4XLNA 3GTJK 4A93K 3K7AK 4OIPA 5C4JK 3HOUC 2PA8L 3HOWC 4YFKA 5M5XK 4A3FC 2VUMC 4A3IK 2NVXC 2O5IA 3M3YC 2JA7C 5C44C 3S1NK 4YG2A 2A6HA 5D4DA 1Y1WC 3GTLK 2WAQL 4A3DC 1I6HK 4A3BC 4A3GC 2WB1D 4Y7NC 3HOYK 3I4NK 3S14C 1WCMC 4A3EC 4MEYA 4XSZA 4A3MK 2B63C 2JA5C 3GTJC 4QIWL 3S1QC 3K7AC 5C4JC 2PMZD 4A93C 2CW0A 5TMFA 4X6AK 3HKZL 2WB1L 4A3JK 2PPBA 4BBRK 4LK1A 5IYBK 3PO2K 2E2HK 3S17K 3S1NC 2PA8D 1TWFK 1Y1VC 1I6HC 2R7ZK 2YU9K 4A3LK 4Y52K 3I4NC 4KN4A 3RZDC 4A3MC 2R93C 1R9TK 4YFNA 5C4XC 5IYDK 1SMYA 3H3VD 4X6AC 5IP7C 4AYBD 5C3EK 1K83K 3HOVK 1TWCK 4QIWD 5IYBC 4A3JC 4KMUA 5M5YK 2E2HC 3PO2C 3S17C 4QJVA 1TWFC 5M3FK 4BY1C 2JA8C 1XPPA 4Y52C 2JA6C 2R7ZC 3GTGK 1I3QC 3H3VL 1TWGK 4BXXK 3HKZD 4C3IK 3S16K 5IYDC 3M4OK 2Y0SD 4AYBL 1TWAK 3HOZK 5FLMK 4A3KK 2R92K 4MQ9A 5C3EC 1K83C 4Q4ZA 1TWCC 4A3IC 4OIQA 2NVQK 3PO3K 2Y0SL 2BE5A 3GTLC 4YFXA 1TWGC 4C2MK 3M4OC 4JK1A 3HOYC 1TWAC 2R93K 4LLGA 4OIOA 4A3KC 4MEXA 1TWHK 3GTKK 3EQLA 3S2DK 2A6EA 3S1RK 3WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z A;  3S2H K;  3GTM K;  4BBR C;  1BDF A;  3S1M K;  3FKI K;  4C3J K;  2E2I K;  3S15 K;  4A3L C;  2YU9 C;  1HQM A;  1R9T C;  3HOU K;  4OIR A;  4A3C K;  3HOW K;  3CQZ K;  5IYC K;  4QJV B;  5IP9 K;  5TMC A;  3S2D C;  3GTP C;  3H0G K;  3M3Y K;  5M3M K;  3S1R C;  5C44 K;  1SFO K;  3HOV C;  3GTM C;  2E2J K;  3S1M C;  2E2I C;  4XSX A;  4Y7N K;  3S15 C;  3S14 K;  3GTG C;  4A3E K;  4BXX C;  3RZO K;  2A68 A;  2JA5 K;  4NOI A;  3S1Q K;  3GTQ K;  4BY7 K;  3S16 C;  2O5J A;  4BBS K;  2NVT K;  4A3C C;  3CQZ C;  1YNJ A;  5IYC C;  3HOX K;  4LK0 A;  1I50 K;  5IP9 C;  5M5W K;  5FLM C;  4G7H A;  3HOZ C;  3H0G C;  2R92 C;  3I4M K;  4GZY A;  4Q5S A;  2NVY K;  4OIN A;  1SFO C;  2E2J C;  3PO3 C;  1Y1V K;  4XLP A;  4LJZ A;  3RZD K;  3RZO C;  1I6V A;  5C4X K;  3GTQ C;  4BY7 C;  4G7O A;  3GTO K;  4KN7 A;  2NVT C;  4BBS C;  1YNN A;  5FJ8 K;  3HOX C;  1I50 C;  2NVQ C;  5IP7 K;  3GTP K;  3DXJ A;  4A3F K;  3I4M C;  1IW7 A;  1TWH C;  1ZYR A;  2NVY C;  2NVX K;  2VUM K;  3GTK C;  2JA7 K;  4BY1 K;  1Y1W K;  4ZH4 A;  2JA6 K;  2PMZ L;  4C3H K;  2JA8 K;  3S2H C;  4A3D K;  1I3Q K;  3FKI C;  4A3G K;  2A69 A;  4A3B K;  1WCM K;  3GTO C;  2WAQ D;  2B63 K;  4XLN A;  3GTJ K;  4A93 K;  3K7A K;  4OIP A;  5C4J K;  3HOU C;  2PA8 L;  3HOW C;  4YFK A;  5M5X K;  4A3F C;  2VUM C;  4A3I K;  2NVX C;  2O5I A;  3M3Y C;  2JA7 C;  5C44 C;  3S1N K;  4YG2 A;  2A6H A;  5D4D A;  1Y1W C;  3GTL K;  2WAQ L;  4A3D C;  1I6H K;  4A3B C;  4A3G C;  2WB1 D;  4Y7N C;  3HOY K;  3I4N K;  3S14 C;  1WCM C;  4A3E C;  4MEY A;  4XSZ A;  4A3M K;  2B63 C;  2JA5 C;  3GTJ C;  4QIW L;  3S1Q C;  3K7A C;  5C4J C;  2PMZ D;  4A93 C;  2CW0 A;  5TMF A;  4X6A K;  3HKZ L;  2WB1 L;  4A3J K;  2PPB A;  4BBR K;  4LK1 A;  5IYB K;  3PO2 K;  2E2H K;  3S17 K;  3S1N C;  2PA8 D;  1TWF K;  1Y1V C;  1I6H C;  2R7Z K;  2YU9 K;  4A3L K;  4Y52 K;  3I4N C;  4KN4 A;  3RZD C;  4A3M C;  2R93 C;  1R9T K;  4YFN A;  5C4X C;  5IYD K;  1SMY A;  3H3V D;  4X6A C;  5IP7 C;  4AYB D;  5C3E K;  1K83 K;  3HOV K;  1TWC K;  4QIW D;  5IYB C;  4A3J C;  4KMU A;  5M5Y K;  2E2H C;  3PO2 C;  3S17 C;  4QJV A;  1TWF C;  5M3F K;  4BY1 C;  2JA8 C;  1XPP A;  4Y52 C;  2JA6 C;  2R7Z C;  3GTG K;  1I3Q C;  3H3V L;  1TWG K;  4BXX K;  3HKZ D;  4C3I K;  3S16 K;  5IYD C;  3M4O K;  2Y0S D;  4AYB L;  1TWA K;  3HOZ K;  5FLM K;  4A3K K;  2R92 K;  4MQ9 A;  5C3E C;  1K83 C;  4Q4Z A;  1TWC C;  4A3I C;  4OIQ A;  2NVQ K;  3PO3 K;  2Y0S L;  2BE5 A;  3GTL C;  4YFX A;  1TWG C;  4C2M K;  3M4O C;  4JK1 A;  3HOY C;  1TWA C;  2R93 K;  4LLG A;  4OIO A;  4A3K C;  4MEX A;  1TWH K;  3GTK K;  3EQL A;  3S2D K;  2A6E A;  3S1R K;  3WOD A; 
#chains in the Genus database with same CATH topology
 4G7Z A;  1BDF A;  2XCR B;  1EFW A;  4C2M C;  1WOP A;  1HQM A;  3ADA C;  3A8K A;  3GTP C;  3H0G K;  3M3Y K;  1TWF A;  3JST A;  1WIH A;  2GSO A;  1SFO K;  1DCO A;  3GSI A;  2E2J K;  3GTM C;  2XCO A;  4C3J C;  2E2I C;  4Y7N K;  2A68 A;  2JA5 K;  2XCQ A;  4NOI A;  3GTQ K;  4BY7 K;  1ZQ1 C;  3S16 C;  4WJ3 M;  4GTE A;  4BLB A;  3HOX K;  3HOZ C;  5M5W K;  5FLM C;  4Q5S A;  2R92 C;  4GZY A;  3LAJ A;  2NVY K;  4KMD A;  3GTL A;  3BP3 A;  1TWG A;  5CHP A;  1Y1V K;  3A8I A;  3RZO C;  1I6V A;  4G7O A;  3AQO A;  5CJ9 A;  1I50 C;  1USO A;  4A3F K;  2P5M A;  2NVX K;  3BP8 C;  4GTC A;  1EK8 A;  1O2F B;  2JA6 K;  4C3H K;  1L0W A;  3FKI C;  4FZB A;  4J3N A;  4A3B K;  1WCM K;  3GTJ K;  4A93 K;  2PA8 L;  3HOW C;  1B4B A;  4YFK A;  1J98 A;  2VUM C;  5C44 C;  5D4D A;  2A6H A;  2RGR A;  3I4N K;  1WSR A;  4A3E C;  4MEY A;  5C4J C;  3H0G A;  2CW0 A;  1SFO A;  1B4A A;  2V6U A;  3HKZ L;  1EH1 A;  3Q3Q A;  4LK1 A;  5IYB K;  4G0U A;  3S17 K;  3GTQ A;  2FQO A;  2R93 C;  4A3M C;  4FM9 A;  1J6V A;  5E68 A;  1AB4 A;  2NVY A;  4AH6 A;  1V5V A;  3FHZ A;  4AYB D;  1ZVU A;  1O2B A;  4KMU A;  5M5Y K;  3GEE A;  2E2H C;  3S16 K;  3M4O K;  4AYB L;  4G0V A;  1TWA K;  3IPJ A;  3HOZ K;  2NVX A;  5FLM K;  2R92 K;  4MQ9 A;  4Q4Z A;  4GTF A;  1TWC C;  4A3I C;  4OIQ A;  1VGX A;  1WCM A;  4PAB A;  3GTJ A;  2GAH C;  3OEP A;  4LLG A;  4KC6 A;  4OIO A;  4A3K C;  4MEX A;  3S2D K;  3A8J A;  3FKI K;  1VRQ C;  1X31 C;  1XXA A;  5IOS A;  1USM A;  4GFQ A;  2YU9 C;  3TFH A;  3T01 A;  1JOE A;  1R9T C;  4A3C K;  3HOW K;  3CQZ K;  5IYC K;  4QJV B;  4XCH A;  1O27 A;  5IP9 K;  1IE0 A;  3S1R C;  5C44 K;  3HOV C;  1BGW A;  1I3Q A;  3S1M C;  4KDD A;  3S15 C;  3BUE A;  4A3E K;  3GTG C;  2O5J A;  2P8T A;  4KMA A;  3V4G A;  4G0W A;  3AQP A;  3PO3 C;  1EI6 A;  1TWA A;  1O28 A;  1EQR A;  4GT9 A;  3GTO K;  4GTD A;  4LQY A;  2NVT C;  4BBS C;  1INN A;  1WSV A;  3DXJ A;  3I4M C;  1IW7 A;  1TWH C;  5TJ3 A;  1O25 A;  1Y1W K;  4ZH4 A;  3S2H C;  2A69 A;  1IBA A;  4XLN A;  1JVI A;  3K7A K;  4GTB A;  3HOU C;  2ZFZ A;  4A3I K;  2JA7 C;  3S1N K;  4YG2 A;  1J6W A;  4A3D C;  4A3G C;  3N0C A;  3N0B A;  2W7V A;  4M1X A;  3S14 C;  3CQZ A;  4XSZ A;  4KAW X;  4KAT A;  2B63 C;  4QIW L;  2V6S A;  5HL8 A;  5JVO A;  1KQ4 A;  2PA8 D;  3VA7 A;  1I6H C;  2R7Z K;  1J6X A;  4KB4 A;  2YU9 K;  2RH6 A;  4Y52 K;  1XZP B;  1R9T K;  2V6T A;  5C4X C;  3AD7 C;  3LAP A;  3H3V D;  3GTK A;  4X6A C;  4LR2 A;  5C3E K;  1K83 K;  3HOV K;  4A3J C;  3PO2 C;  4QJV A;  1TWF C;  4BY1 C;  2JA8 C;  3GTO A;  3GTG K;  3H3V L;  3HKZ D;  5IYD C;  2Y0S D;  2CFA B;  1Y1W A;  2ZUF A;  1PJ5 A;  2NVQ K;  3PO3 K;  2Y0S L;  3GTL C;  2JA5 A;  1TWG C;  4C2M K;  4BLA A;  4C3I C;  4JK1 A;  3HOY C;  1WOO A;  1TWH K;  3GTP K;  1Y1V A;  3WOD A;  3S2H K;  3GTM K;  3GEI A;  4C3J K;  2E2I K;  4A3L C;  1O24 A;  3HOU K;  2FQT A;  4LOW A;  1WOR A;  3T00 A;  2R7Z A;  2JA6 A;  4XSX A;  3S14 K;  3TFI A;  4BXX C;  1XXB A;  3RZO K;  3L4K A;  1G51 A;  2GSN A;  1YNJ A;  4ILD A;  1K83 A;  1VJE A;  4LK0 A;  1I50 K;  4P5A A;  4G7H A;  3H0G C;  4OIN A;  1SFO C;  3GDZ A;  2E2J C;  1PJ6 A;  4KMH A;  4LJZ A;  2JH3 A;  4WIL A;  5IOT A;  4GTL A;  5C4X K;  3LPX A;  3GTQ C;  4BY7 C;  4KN7 A;  3HOX C;  1XZP A;  3AH5 A;  2VUM K;  2NVY C;  3ERE D;  1F9N A;  1HI9 A;  4BY1 K;  2JA8 K;  2PMZ L;  3TFJ A;  1F7V A;  4OIP A;  5C4J K;  3GTP A;  1XZQ B;  1VLO A;  5M5X K;  4A3F C;  2ZUE A;  3GTM A;  1RU0 A;  2NVX C;  2E2I A;  3NUH A;  4C3H C;  3GTL K;  2CFA A;  5JFE A;  2WB1 D;  3HOY K;  4A3B C;  2PHC B;  1WCM C;  4A3M K;  2R93 K;  3S1Q C;  3GTJ C;  4A93 C;  2Y3P A;  2R92 A;  3TTG A;  3FOF A;  1WQG A;  2WB1 L;  1F93 A;  2E2H K;  1DD5 A;  4A3L K;  3I4N C;  3RZD C;  4GTA A;  1WOS A;  4KAR A;  4YFN A;  1I50 A;  5IOQ A;  1SMY A;  5IP7 C;  1TWC K;  4QIW D;  5IYB C;  3FKI A;  3S17 C;  1XPP A;  4BXX K;  1I3Q C;  4P5B A;  2VUM A;  4A3K K;  3GIR A;  3ORE A;  3OPF A;  2D6F C;  4KM9 A;  1PJ7 A;  2BE5 A;  4BKW A;  4YFX A;  3M4O C;  1IL2 A;  1TWA C;  5EGH A;  1XXC A;  1IQ0 A;  3EQL A;  2A6E A;  4KAS A;  1DCP A;  3S1R K;  4BBR C;  3S1M K;  2R93 A;  3SZY A;  3S15 K;  1ISE A;  4OIR A;  5L46 A;  1C0A A;  4KM8 A;  5TMC A;  3S2D C;  2E2H A;  3G4C A;  5M3M K;  1XZQ A;  5EGE A;  1O2A A;  1O26 A;  3S1Q K;  3T02 A;  4BBS K;  2NVT K;  4A3C C;  3CQZ C;  5IYC C;  1TWC A;  5IP9 C;  3I4M K;  1ZXO A;  2GAG C;  3AD8 C;  3QX3 A;  1BJT A;  4XLP A;  1DCH A;  3G4A A;  4C45 A;  1F7U A;  3RZD K;  3GEH A;  1YNN A;  5FJ8 K;  3S0X A;  5IP7 K;  1ZYR A;  3MML B;  3GTK C;  1VH2 A;  4P9S A;  2JA7 K;  2YU9 A;  5IOR A;  4A3D K;  1I3Q K;  4A3G K;  1R9T A;  1YX2 A;  3GTO C;  2WAQ D;  2B63 K;  1BS2 A;  2EBB A;  3HXA A;  2O5I A;  3M3Y C;  3FOE A;  1Y1W C;  3GTG A;  2WAQ L;  1I6H K;  4Y7N C;  3L4J A;  2JA5 C;  3K7A C;  2PMZ D;  5TMF A;  4X6A K;  4KB2 A;  4A3J K;  2PPB A;  4BBR K;  3PO2 K;  3S1N C;  1WQH A;  1TWF K;  1Y1V C;  1IS1 A;  2GSU A;  4KN4 A;  4RMF A;  5IYD K;  3SZZ A;  1UV7 A;  1TWH A;  4WJ4 A;  1O29 A;  4DDQ A;  5M3F K;  2JA6 C;  2R7Z C;  4Y52 C;  1TWG K;  4C3I K;  3AD9 C;  1WQF A;  2JA7 A;  5C3E C;  1K83 C;  4O2D A;  1JQW A;  2B63 A;  4PAA A;  2KWA A;  1ZBS A;  3CAG A;  3GTK K;  1GE9 A;  3N3Y A;  2NVQ C;  1YCL A; 
#chains in the Genus database with same CATH homology
 4G7Z A;  3S2H K;  3GTM K;  4BBR C;  1BDF A;  3S1M K;  3FKI K;  4C3J K;  2E2I K;  3S15 K;  4A3L C;  2YU9 C;  1HQM A;  1R9T C;  3HOU K;  4OIR A;  4A3C K;  3HOW K;  3CQZ K;  5IYC K;  4QJV B;  5IP9 K;  5TMC A;  3S2D C;  3GTP C;  3H0G K;  3M3Y K;  5M3M K;  3S1R C;  5C44 K;  1SFO K;  3HOV C;  3GTM C;  2E2J K;  3S1M C;  2E2I C;  4XSX A;  4Y7N K;  3S15 C;  3S14 K;  3GTG C;  4A3E K;  4BXX C;  3RZO K;  2A68 A;  2JA5 K;  4NOI A;  3S1Q K;  3GTQ K;  4BY7 K;  3S16 C;  2O5J A;  4BBS K;  2NVT K;  4A3C C;  3CQZ C;  1YNJ A;  5IYC C;  3HOX K;  4LK0 A;  1I50 K;  5IP9 C;  5M5W K;  5FLM C;  4G7H A;  3HOZ C;  3H0G C;  2R92 C;  3I4M K;  4GZY A;  4Q5S A;  2NVY K;  4OIN A;  1SFO C;  2E2J C;  3PO3 C;  1Y1V K;  4XLP A;  4LJZ A;  3RZD K;  3RZO C;  1I6V A;  5C4X K;  3GTQ C;  4BY7 C;  4G7O A;  3GTO K;  4KN7 A;  2NVT C;  4BBS C;  1YNN A;  5FJ8 K;  3HOX C;  1I50 C;  2NVQ C;  5IP7 K;  3GTP K;  3DXJ A;  4A3F K;  3I4M C;  1IW7 A;  1TWH C;  1ZYR A;  2NVY C;  2NVX K;  2VUM K;  3GTK C;  2JA7 K;  4BY1 K;  1Y1W K;  4ZH4 A;  2JA6 K;  2PMZ L;  4C3H K;  2JA8 K;  3S2H C;  4A3D K;  1I3Q K;  3FKI C;  4A3G K;  2A69 A;  4A3B K;  1WCM K;  3GTO C;  2WAQ D;  2B63 K;  4XLN A;  3GTJ K;  4A93 K;  3K7A K;  4OIP A;  5C4J K;  3HOU C;  2PA8 L;  3HOW C;  4YFK A;  5M5X K;  4A3F C;  2VUM C;  4A3I K;  2NVX C;  2O5I A;  3M3Y C;  2JA7 C;  5C44 C;  3S1N K;  4YG2 A;  2A6H A;  5D4D A;  1Y1W C;  3GTL K;  2WAQ L;  4A3D C;  1I6H K;  4A3B C;  4A3G C;  2WB1 D;  4Y7N C;  3HOY K;  3I4N K;  3S14 C;  1WCM C;  4A3E C;  4MEY A;  4XSZ A;  4A3M K;  2B63 C;  2JA5 C;  3GTJ C;  4QIW L;  3S1Q C;  3K7A C;  5C4J C;  2PMZ D;  4A93 C;  2CW0 A;  5TMF A;  4X6A K;  3HKZ L;  2WB1 L;  4A3J K;  2PPB A;  4BBR K;  4LK1 A;  5IYB K;  3PO2 K;  2E2H K;  3S17 K;  3S1N C;  2PA8 D;  1TWF K;  1Y1V C;  1I6H C;  2R7Z K;  2YU9 K;  4A3L K;  4Y52 K;  3I4N C;  4KN4 A;  3RZD C;  4A3M C;  2R93 C;  1R9T K;  4YFN A;  5C4X C;  5IYD K;  1SMY A;  3H3V D;  4X6A C;  5IP7 C;  4AYB D;  5C3E K;  1K83 K;  3HOV K;  1TWC K;  4QIW D;  5IYB C;  4A3J C;  4KMU A;  5M5Y K;  2E2H C;  3PO2 C;  3S17 C;  4QJV A;  1TWF C;  5M3F K;  4BY1 C;  2JA8 C;  1XPP A;  4Y52 C;  2JA6 C;  2R7Z C;  3GTG K;  1I3Q C;  3H3V L;  1TWG K;  4BXX K;  3HKZ D;  4C3I K;  3S16 K;  5IYD C;  3M4O K;  2Y0S D;  4AYB L;  1TWA K;  3HOZ K;  5FLM K;  4A3K K;  2R92 K;  4MQ9 A;  5C3E C;  1K83 C;  4Q4Z A;  1TWC C;  4A3I C;  4OIQ A;  2NVQ K;  3PO3 K;  2Y0S L;  2BE5 A;  3GTL C;  4YFX A;  1TWG C;  4C2M K;  3M4O C;  4JK1 A;  3HOY C;  1TWA C;  2R93 K;  4LLG A;  4OIO A;  4A3K C;  4MEX A;  1TWH K;  3GTK K;  3EQL A;  3S2D K;  2A6E A;  3S1R K;  3WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...