4BY1K

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by1K00
4A3MK 2R93K 3GTPC 3PO3C 1TWGC 3H3VL 5C4JC 1TWFK 3S16K 2JA5C 2VUMK 3HOWC 1I3QC 4JK1A 3RZDC 4MEYA 2CW0A 3H3VD 3S2HC 1BDFA 5IP7K 3HOVK 5IP9K 2PPBA 3PO2K 4NOIA 3WODA 4BXXK 3FKIC 2Y0SL 3HOYK 5M3FK 2NVXC 3S17K 5TMCA 5C3EC 2E2IK 1ZYRA 4MQ9A 2BE5A 4YG2A 1TWHC 2Y0SD 3RZOC 3EQLA 3S1MK 5IYBC 3HOUC 3HOZC 4Q4ZA 3S1RC 4BY7K 4QIWL 4A3BC 1TWAC 2JA7C 5D4DA 2PMZL 4GZYA 2NVTC 3S14K 2O5JA 1K83K 1TWCC 4QIWD 4A3DK 5M5YK 4XSXA 4A3JC 2PMZD 3GTMC 3S1NK 3M4OC 1YNJA 3S15C 1I6HK 4LJZA 4C3IK 4Y52C 4A3FK 4BBSK 1Y1VC 5C44K 4BY1C 4A3EC 3S16C 4A93C 1Y1WK 3H0GC 2WB1L 4XSZA 2B63C 3HOVC 1IW7A 4C2MK 2YU9K 4A3IC 4BBRC 2A68A 4A3KK 4G7OA 2WB1D 4A3GK 5M3MK 2E2JC 4XLPA 3I4NK 3CQZK 3GTGC 4BY7C 3S2DK 1WCMC 5IYCC 4Y7NC 2E2HC 2JA8K 3HOXK 2NVQC 5IYDC 4OIRA 3GTOK 4A3CK 2WAQL 3K7AK 2A6EA 2JA6C 4MEXA 2R92C 3I4MC 3M3YK 4X6AK 1I50C 3GTJK 5FLMK 1SFOK 1R9TC 2WAQD 3GTLC 4BBSC 4YFKA 3GTKC 4A3MC 2R93C 4OIOA 2NVYK 3GTQK 1TWFC 1XPPA 3GTPK 1TWGK 2VUMC 3PO3K 5C4XK 5C4JK 2R7ZK 5IP7C 3PO2C 1I3QK 5IP9C 3RZDK 3S1QK 4C3JK 3S2HK 1SMYA 4BXXC 3HOYC 3S2DC 3S17C 3FKIK 4A3JK 4C3HK 4G7HA 2E2IC 2NVXK 3S1MC 4A3CC 5C3EK 3RZOK 1TWHK 2O5IA 5IYBK 3HOUK 3HOZK 3S1RK 1YNNA 3GTQC 3S14C 3GTJC 1TWAK 1K83C 2JA7K 3HKZL 1HQMA 4A3DC 2NVTK 3S1NC 5FJ8K 1TWCK 1I6HC 4LK1A 4Q5SA 3S15K 5M5WK 3HKZD 3GTMK 4A3FC 4A3LK 5C44C 4KN7A 5C4XC 4Y52K 1Y1WC 3DXJA 2JA6K 1Y1VK 4LK0A 4ZH4A 4A3EK 4BY1K 5M5XK 2R7ZC 2YU9C 3M4OK 4A93K 3S1QC 3H0GK 3GTKK 4AYBL 4A3KC 2B63K 4KN4A 2JA5K 3HOWK 4A3GC 1I6VA 4BBRK 4A3IK 5TMFA 4AYBD 3I4NC 3CQZC 4OIPA 2E2JK 4QJVB 2JA8C 3HOXC 3GTGK 4LLGA 1WCMK 5IYCK 2PA8L 4Y7NK 2E2HK 4QJVA 3GTOC 2NVQK 3K7AC 5IYDK 3M3YC 4X6AC 2PA8D 5FLMC 1SFOC 4A3BK 4A3LC 2R92K 4OIQA 2A6HA 3I4MK 1I50K 4YFXA 1R9TK 4YFNA 2A69A 3GTLK 4G7ZA 2NVYC 4OINA 4KMUA 4XLNA
chains in the Genus database with same CATH superfamily
3GTPC 2RGRA 3H3VL 4AH6A 4BKWA 2JA5C 2D6FC 2JH3A 3H3VD 1BDFA 3G4AA 4NOIA 1ZXOA 2Y0SL 5M3FK 2NVXC 4GTLA 3S17K 1EI6A 1O29A 1ZYRA 3A8IA 2Y0SD 3GSIA 3VA7A 3RZOC 5IYBC 1K83A 5TJ3A 4QIWL 4GZYA 1O2BA 3N0CA 4QIWD 4G0WA 4A3JC 3GTMC 2Y3PA 1USMA 1I6HK 2R7ZA 5C44K 2GSUA 4XSZA 4BLBA 1IW7A 1V5VA 3FKIA 3TFJA 2A68A 1ZBSA 1WQGA 4A3KK 4KB4A 5CHPA 5M3MK 5IORA 1PJ5A 1USOA 5IYCC 4OIRA 4A3CK 2R92C 4LOWA 4OIOA 3H0GA 2NVYK 3AH5A 2JA5A 2XCOA 2R7ZK 3S1QK 3S2HK 3S2DC 3S17C 3FKIK 1EQRA 1VJEA 2EBBA 1X31C 2O5IA 1IQ0A 2GAHC 1I6HC 2VUMA 5C44C 4KN7A 4KMHA 3L4JA 3HXAA 3H0GK 4A3KC 2JA5K 4WJ4A 5IOSA 4KATA 3GEIA 4Y7NK 3ERED 1AB4A 4GTFA 4P5AA 3Q3QA 3I4MK 1R9TK 2CFAA 4G7ZA 2NVYC 4A3JK 4GTCA 1WQFA 1TWFK 1G51A 1O28A 2VUMK 4MEYA 3S2HC 1JOEA 3WODA 4BXXK 3FKIC 3HOYK 2GSOA 5TMCA 4YG2A 3IPJA 4LR2A 3A8KA 3S14K 4KM9A 2O5JA 5M5YK 4XSXA 3M4OC 4GTBA 3BUEA 2GSNA 1IS1A 1I3QA 1Y1WK 3H0GC 2FQOA 2P5MA 1BJTA 4G7OA 4A3GK 3CQZK 1WQHA 4BY7C 3S2DK 4Y7NC 3HOXK 3MMLB 3GTOK 5JVOA 2WAQL 3K7AK 3AD7C 3I4MC 3SZYA 1XXBA 1EH1A 5FLMK 1SFOK 1R9TC 2WAQD 2NVYA 4O2DA 1TWFC 1VH2A 2VUMC 5C4JK 1F7UA 1J6XA 1I3QK 3RZDK 4BXXC 3HOYC 2KWAA 4KMAA 2E2HA 4GTAA 4C3HK 4G0UA 1WIHA 1XXCA 3S14C 3GTJC 1TWAK 3GTLA 4KM8A 2NVTK 4KAWX 5FJ8K 3TFIA 5M5WK 3S15K 4Y52K 1Y1WC 3DXJA 1O27A 4BY1K 3FOEA 2PHCB 3T01A 3OPFA 1F93A 4A3GC 4A3IK 4BBRK 1HI9A 3CQZC 4GFQA 4OIPA 1VGXA 1DD5A 3HOXC 1L0WA 1WCMK 2E2HK 2PA8L 1O26A 3GTOC 3K7AC 1VLOA 2PA8D 1R9TA 2CFAB 5FLMC 1SFOC 1XXAA 4A3LC 4OIQA 1I50K 4WJ3M 3GTLK 4OINA 3M4OK 1TWFA 3GTKK 4A3MK 2R93K 1GE9A 5C4JC 5L46A 1I3QC 3RZDC 2CW0A 3TTGA 5IP7K 1XZPA 2GAGC 3PO2K 2P8TA 4C3HC 3NUHA 2E2IK 1J98A 1PJ7A 1JQWA 4MQ9A 3S1MK 4BY7K 3QX3A 4Q4ZA 4KASA 5E68A 3GTJA 1VRQC 1TWAC 3N0BA 2NVTC 2ZFZA 2XCQA 4A3DK 3S1NK 3S15C 3AD9C 3BP8C 4LJZA 2W7VA 4C3IK 1Y1WA 4Y52C 4A3FK 4BY1C 3S16C 1WOOA 2V6UA 1DCOA 2WB1L 3HOVC 2YU9K 4C2MK 4A3IC 4BBRC 3CQZA 2WB1D 4XLPA 1J6WA 1BGWA 1WCMC 3GTOA 2E2HC 5CJ9A 3AD8C 2JA8K 4M1XA 1WORA 3LAPA 3G4CA 3OEPA 1WSRA 1SFOA 1IE0A 4MEXA 3M3YK 1I50C 3GTJK 5HL8A 1B4BA 3GTLC 4BBSC 4YFKA 1XZQB 3GTKC 4A3MC 2R93C 4WILA 3GIRA 2B63A 1IL2A 3PO3K 1TWGK 2FQTA 1WOSA 1KQ4A 5IP7C 3AQOA 3PO2C 2RH6A 3GEHA 4XCHA 1RU0A 2E2IC 3S1MC 4C45A 5C3EK 1TWAA 1TWHK 3HOUK 3HOZK 1O24A 3S1RK 5EGHA 2ZUEA 2JA7K 3HKZL 4A3DC 3S1NC 1TWCK 3SZZA 4Q5SA 4A3LK 4C3IC 3HKZD 4A3FC 3S0XA 5C4XC 1Y1VK 3CAGA 4LK0A 4ZH4A 4A3EK 1XZQA 5M5XK 1ISEA 4C2MC 2YU9C 4A93K 4C3JC 4AYBL 2B63K 4KN4A 1O2FB 1I6VA 5TMFA 1F7VA 4AYBD 5IOQA 1WCMA 2E2JK 4FZBA 1EFWA 2JA8C 3GTGK 4LLGA 1JVIA 1DCPA 4QJVA 2NVQK 1ZVUA 1BS2A 4KDDA 1I50A 3M3YC 1WOPA 5IYDK 1WSVA 3AQPA 3GEEA 3GTKA 2XCRB 4YFXA 2R93A 4YFNA 2A69A 3GTQC 2JA6C 4KMUA 1B4AA 3N3YA 3PO3C 1TWGC 1O2AA 1XZPB 3HOWC 3S16K 4JK1A 5IOTA 3HOVK 5IP9K 2PPBA 2E2IA 1YCLA 5C3EC 2BE5A 1TWHC 3EQLA 3HOUC 3HOZC 3S1RC 4PABA 4PAAA 4A3BC 4GTEA 4ILDA 2PMZL 5D4DA 2JA7C 1K83K 1TWCC 3GTQA 3T00A 2PMZD 3L4KA 3LAJA 1EK8A 1YNJA 3GTPA 1ZQ1C 2V6TA 3V4GA 4BBSK 1Y1VC 2YU9A 4A3EC 4A93C 1PJ6A 3JSTA 2B63C 2NVXA 4G0VA 3OREA 1C0AA 2E2JC 5JFEA 4P5BA 3I4NK 3GTGC 4KMDA 2NVQC 5IYDC 5EGEA 3GTMA 2A6EA 3LPXA 3TFHA 4X6AK 2ZUFA 2JA6A 1O25A 1TWGA 4BLAA 1J6VA 3GTQK 3A8JA 3GTPK 1XPPA 4RMFA 5C4XK 4LQYA 4KC6A 5IP9C 4C3JK 1SMYA 3ADAC 1F9NA 4KARA 1TWHA 4G7HA 2NVXK 4GTDA 4A3CC 3RZOK 2R92A 2JA7A 5IYBK 1YNNA 3BP3A 1TWCA 1K83C 3FHZA 1HQMA 2V6SA 4LK1A 3GTMK 1Y1VA 4KB2A 1DCHA 2JA6K 2R7ZC 3GDZA 3S1QC 1IBAA 4P9SA 4J3NA 4DDQA 1UV7A 3T02A 3HOWK 1YX2A 3GTGA 3I4NC 3FOFA 4QJVB 5IYCK 1INNA 4X6AC 4FM9A 4A3BK 4GT9A 2R92K 2A6HA 4XLNA
chains in the Genus database with same CATH topology
4A3MK 2R93K 3GTPC 3PO3C 1TWGC 3H3VL 5C4JC 1TWFK 3S16K 2JA5C 2VUMK 3HOWC 1I3QC 4JK1A 3RZDC 4MEYA 2CW0A 3H3VD 3S2HC 1BDFA 5IP7K 3HOVK 5IP9K 2PPBA 3PO2K 4NOIA 3WODA 4BXXK 3FKIC 2Y0SL 3HOYK 5M3FK 2NVXC 3S17K 5TMCA 5C3EC 2E2IK 1ZYRA 4MQ9A 2BE5A 4YG2A 1TWHC 2Y0SD 3RZOC 3EQLA 3S1MK 5IYBC 3HOUC 3HOZC 4Q4ZA 3S1RC 4BY7K 4QIWL 4A3BC 1TWAC 2JA7C 5D4DA 2PMZL 4GZYA 2NVTC 3S14K 2O5JA 1K83K 1TWCC 4QIWD 4A3DK 5M5YK 4XSXA 4A3JC 2PMZD 3GTMC 3S1NK 3M4OC 1YNJA 3S15C 1I6HK 4LJZA 4C3IK 4Y52C 4A3FK 4BBSK 1Y1VC 5C44K 4BY1C 4A3EC 3S16C 4A93C 1Y1WK 3H0GC 2WB1L 4XSZA 2B63C 3HOVC 1IW7A 4C2MK 2YU9K 4A3IC 4BBRC 2A68A 4A3KK 4G7OA 2WB1D 4A3GK 5M3MK 2E2JC 4XLPA 3I4NK 3CQZK 3GTGC 4BY7C 3S2DK 1WCMC 5IYCC 4Y7NC 2E2HC 2JA8K 3HOXK 2NVQC 5IYDC 4OIRA 3GTOK 4A3CK 2WAQL 3K7AK 2A6EA 2JA6C 4MEXA 2R92C 3I4MC 3M3YK 4X6AK 1I50C 3GTJK 5FLMK 1SFOK 1R9TC 2WAQD 3GTLC 4BBSC 4YFKA 3GTKC 4A3MC 2R93C 4OIOA 2NVYK 3GTQK 1TWFC 1XPPA 3GTPK 1TWGK 2VUMC 3PO3K 5C4XK 5C4JK 2R7ZK 5IP7C 3PO2C 1I3QK 5IP9C 3RZDK 3S1QK 4C3JK 3S2HK 1SMYA 4BXXC 3HOYC 3S2DC 3S17C 3FKIK 4A3JK 4C3HK 4G7HA 2E2IC 2NVXK 3S1MC 4A3CC 5C3EK 3RZOK 1TWHK 2O5IA 5IYBK 3HOUK 3HOZK 3S1RK 1YNNA 3GTQC 3S14C 3GTJC 1TWAK 1K83C 2JA7K 3HKZL 1HQMA 4A3DC 2NVTK 3S1NC 5FJ8K 1TWCK 1I6HC 4LK1A 4Q5SA 3S15K 5M5WK 3HKZD 3GTMK 4A3FC 4A3LK 5C44C 4KN7A 5C4XC 4Y52K 1Y1WC 3DXJA 2JA6K 1Y1VK 4LK0A 4ZH4A 4A3EK 4BY1K 5M5XK 2R7ZC 2YU9C 3M4OK 4A93K 3S1QC 3H0GK 3GTKK 4AYBL 4A3KC 2B63K 4KN4A 2JA5K 3HOWK 4A3GC 1I6VA 4BBRK 4A3IK 5TMFA 4AYBD 3I4NC 3CQZC 4OIPA 2E2JK 4QJVB 2JA8C 3HOXC 3GTGK 4LLGA 1WCMK 5IYCK 2PA8L 4Y7NK 2E2HK 4QJVA 3GTOC 2NVQK 3K7AC 5IYDK 3M3YC 4X6AC 2PA8D 5FLMC 1SFOC 4A3BK 4A3LC 2R92K 4OIQA 2A6HA 3I4MK 1I50K 4YFXA 1R9TK 4YFNA 2A69A 3GTLK 4G7ZA 2NVYC 4OINA 4KMUA 4XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M K;  2R93 K;  3GTP C;  3PO3 C;  1TWG C;  3H3V L;  5C4J C;  1TWF K;  3S16 K;  2JA5 C;  2VUM K;  3HOW C;  1I3Q C;  4JK1 A;  3RZD C;  4MEY A;  2CW0 A;  3H3V D;  3S2H C;  1BDF A;  5IP7 K;  3HOV K;  5IP9 K;  2PPB A;  3PO2 K;  4NOI A;  3WOD A;  4BXX K;  3FKI C;  2Y0S L;  3HOY K;  5M3F K;  2NVX C;  3S17 K;  5TMC A;  5C3E C;  2E2I K;  1ZYR A;  4MQ9 A;  2BE5 A;  4YG2 A;  1TWH C;  2Y0S D;  3RZO C;  3EQL A;  3S1M K;  5IYB C;  3HOU C;  3HOZ C;  4Q4Z A;  3S1R C;  4BY7 K;  4QIW L;  4A3B C;  1TWA C;  2JA7 C;  5D4D A;  2PMZ L;  4GZY A;  2NVT C;  3S14 K;  2O5J A;  1K83 K;  1TWC C;  4QIW D;  4A3D K;  5M5Y K;  4XSX A;  4A3J C;  2PMZ D;  3GTM C;  3S1N K;  3M4O C;  1YNJ A;  3S15 C;  1I6H K;  4LJZ A;  4C3I K;  4Y52 C;  4A3F K;  4BBS K;  1Y1V C;  5C44 K;  4BY1 C;  4A3E C;  3S16 C;  4A93 C;  1Y1W K;  3H0G C;  2WB1 L;  4XSZ A;  2B63 C;  3HOV C;  1IW7 A;  4C2M K;  2YU9 K;  4A3I C;  4BBR C;  2A68 A;  4A3K K;  4G7O A;  2WB1 D;  4A3G K;  5M3M K;  2E2J C;  4XLP A;  3I4N K;  3CQZ K;  3GTG C;  4BY7 C;  3S2D K;  1WCM C;  5IYC C;  4Y7N C;  2E2H C;  2JA8 K;  3HOX K;  2NVQ C;  5IYD C;  4OIR A;  3GTO K;  4A3C K;  2WAQ L;  3K7A K;  2A6E A;  2JA6 C;  4MEX A;  2R92 C;  3I4M C;  3M3Y K;  4X6A K;  1I50 C;  3GTJ K;  5FLM K;  1SFO K;  1R9T C;  2WAQ D;  3GTL C;  4BBS C;  4YFK A;  3GTK C;  4A3M C;  2R93 C;  4OIO A;  2NVY K;  3GTQ K;  1TWF C;  1XPP A;  3GTP K;  1TWG K;  2VUM C;  3PO3 K;  5C4X K;  5C4J K;  2R7Z K;  5IP7 C;  3PO2 C;  1I3Q K;  5IP9 C;  3RZD K;  3S1Q K;  4C3J K;  3S2H K;  1SMY A;  4BXX C;  3HOY C;  3S2D C;  3S17 C;  3FKI K;  4A3J K;  4C3H K;  4G7H A;  2E2I C;  2NVX K;  3S1M C;  4A3C C;  5C3E K;  3RZO K;  1TWH K;  2O5I A;  5IYB K;  3HOU K;  3HOZ K;  3S1R K;  1YNN A;  3GTQ C;  3S14 C;  3GTJ C;  1TWA K;  1K83 C;  2JA7 K;  3HKZ L;  1HQM A;  4A3D C;  2NVT K;  3S1N C;  5FJ8 K;  1TWC K;  1I6H C;  4LK1 A;  4Q5S A;  3S15 K;  5M5W K;  3HKZ D;  3GTM K;  4A3F C;  4A3L K;  5C44 C;  4KN7 A;  5C4X C;  4Y52 K;  1Y1W C;  3DXJ A;  2JA6 K;  1Y1V K;  4LK0 A;  4ZH4 A;  4A3E K;  4BY1 K;  5M5X K;  2R7Z C;  2YU9 C;  3M4O K;  4A93 K;  3S1Q C;  3H0G K;  3GTK K;  4AYB L;  4A3K C;  2B63 K;  4KN4 A;  2JA5 K;  3HOW K;  4A3G C;  1I6V A;  4BBR K;  4A3I K;  5TMF A;  4AYB D;  3I4N C;  3CQZ C;  4OIP A;  2E2J K;  4QJV B;  2JA8 C;  3HOX C;  3GTG K;  4LLG A;  1WCM K;  5IYC K;  2PA8 L;  4Y7N K;  2E2H K;  4QJV A;  3GTO C;  2NVQ K;  3K7A C;  5IYD K;  3M3Y C;  4X6A C;  2PA8 D;  5FLM C;  1SFO C;  4A3B K;  4A3L C;  2R92 K;  4OIQ A;  2A6H A;  3I4M K;  1I50 K;  4YFX A;  1R9T K;  4YFN A;  2A69 A;  3GTL K;  4G7Z A;  2NVY C;  4OIN A;  4KMU A;  4XLN A; 
#chains in the Genus database with same CATH topology
 3GTP C;  2RGR A;  3H3V L;  4AH6 A;  4BKW A;  2JA5 C;  2D6F C;  2JH3 A;  3H3V D;  1BDF A;  3G4A A;  4NOI A;  1ZXO A;  2Y0S L;  5M3F K;  2NVX C;  4GTL A;  3S17 K;  1EI6 A;  1O29 A;  1ZYR A;  3A8I A;  2Y0S D;  3GSI A;  3VA7 A;  3RZO C;  5IYB C;  1K83 A;  5TJ3 A;  4QIW L;  4GZY A;  1O2B A;  3N0C A;  4QIW D;  4G0W A;  4A3J C;  3GTM C;  2Y3P A;  1USM A;  1I6H K;  2R7Z A;  5C44 K;  2GSU A;  4XSZ A;  4BLB A;  1IW7 A;  1V5V A;  3FKI A;  3TFJ A;  2A68 A;  1ZBS A;  1WQG A;  4A3K K;  4KB4 A;  5CHP A;  5M3M K;  5IOR A;  1PJ5 A;  1USO A;  5IYC C;  4OIR A;  4A3C K;  2R92 C;  4LOW A;  4OIO A;  3H0G A;  2NVY K;  3AH5 A;  2JA5 A;  2XCO A;  2R7Z K;  3S1Q K;  3S2H K;  3S2D C;  3S17 C;  3FKI K;  1EQR A;  1VJE A;  2EBB A;  1X31 C;  2O5I A;  1IQ0 A;  2GAH C;  1I6H C;  2VUM A;  5C44 C;  4KN7 A;  4KMH A;  3L4J A;  3HXA A;  3H0G K;  4A3K C;  2JA5 K;  4WJ4 A;  5IOS A;  4KAT A;  3GEI A;  4Y7N K;  3ERE D;  1AB4 A;  4GTF A;  4P5A A;  3Q3Q A;  3I4M K;  1R9T K;  2CFA A;  4G7Z A;  2NVY C;  4A3J K;  4GTC A;  1WQF A;  1TWF K;  1G51 A;  1O28 A;  2VUM K;  4MEY A;  3S2H C;  1JOE A;  3WOD A;  4BXX K;  3FKI C;  3HOY K;  2GSO A;  5TMC A;  4YG2 A;  3IPJ A;  4LR2 A;  3A8K A;  3S14 K;  4KM9 A;  2O5J A;  5M5Y K;  4XSX A;  3M4O C;  4GTB A;  3BUE A;  2GSN A;  1IS1 A;  1I3Q A;  1Y1W K;  3H0G C;  2FQO A;  2P5M A;  1BJT A;  4G7O A;  4A3G K;  3CQZ K;  1WQH A;  4BY7 C;  3S2D K;  4Y7N C;  3HOX K;  3MML B;  3GTO K;  5JVO A;  2WAQ L;  3K7A K;  3AD7 C;  3I4M C;  3SZY A;  1XXB A;  1EH1 A;  5FLM K;  1SFO K;  1R9T C;  2WAQ D;  2NVY A;  4O2D A;  1TWF C;  1VH2 A;  2VUM C;  5C4J K;  1F7U A;  1J6X A;  1I3Q K;  3RZD K;  4BXX C;  3HOY C;  2KWA A;  4KMA A;  2E2H A;  4GTA A;  4C3H K;  4G0U A;  1WIH A;  1XXC A;  3S14 C;  3GTJ C;  1TWA K;  3GTL A;  4KM8 A;  2NVT K;  4KAW X;  5FJ8 K;  3TFI A;  5M5W K;  3S15 K;  4Y52 K;  1Y1W C;  3DXJ A;  1O27 A;  4BY1 K;  3FOE A;  2PHC B;  3T01 A;  3OPF A;  1F93 A;  4A3G C;  4A3I K;  4BBR K;  1HI9 A;  3CQZ C;  4GFQ A;  4OIP A;  1VGX A;  1DD5 A;  3HOX C;  1L0W A;  1WCM K;  2E2H K;  2PA8 L;  1O26 A;  3GTO C;  3K7A C;  1VLO A;  2PA8 D;  1R9T A;  2CFA B;  5FLM C;  1SFO C;  1XXA A;  4A3L C;  4OIQ A;  1I50 K;  4WJ3 M;  3GTL K;  4OIN A;  3M4O K;  1TWF A;  3GTK K;  4A3M K;  2R93 K;  1GE9 A;  5C4J C;  5L46 A;  1I3Q C;  3RZD C;  2CW0 A;  3TTG A;  5IP7 K;  1XZP A;  2GAG C;  3PO2 K;  2P8T A;  4C3H C;  3NUH A;  2E2I K;  1J98 A;  1PJ7 A;  1JQW A;  4MQ9 A;  3S1M K;  4BY7 K;  3QX3 A;  4Q4Z A;  4KAS A;  5E68 A;  3GTJ A;  1VRQ C;  1TWA C;  3N0B A;  2NVT C;  2ZFZ A;  2XCQ A;  4A3D K;  3S1N K;  3S15 C;  3AD9 C;  3BP8 C;  4LJZ A;  2W7V A;  4C3I K;  1Y1W A;  4Y52 C;  4A3F K;  4BY1 C;  3S16 C;  1WOO A;  2V6U A;  1DCO A;  2WB1 L;  3HOV C;  2YU9 K;  4C2M K;  4A3I C;  4BBR C;  3CQZ A;  2WB1 D;  4XLP A;  1J6W A;  1BGW A;  1WCM C;  3GTO A;  2E2H C;  5CJ9 A;  3AD8 C;  2JA8 K;  4M1X A;  1WOR A;  3LAP A;  3G4C A;  3OEP A;  1WSR A;  1SFO A;  1IE0 A;  4MEX A;  3M3Y K;  1I50 C;  3GTJ K;  5HL8 A;  1B4B A;  3GTL C;  4BBS C;  4YFK A;  1XZQ B;  3GTK C;  4A3M C;  2R93 C;  4WIL A;  3GIR A;  2B63 A;  1IL2 A;  3PO3 K;  1TWG K;  2FQT A;  1WOS A;  1KQ4 A;  5IP7 C;  3AQO A;  3PO2 C;  2RH6 A;  3GEH A;  4XCH A;  1RU0 A;  2E2I C;  3S1M C;  4C45 A;  5C3E K;  1TWA A;  1TWH K;  3HOU K;  3HOZ K;  1O24 A;  3S1R K;  5EGH A;  2ZUE A;  2JA7 K;  3HKZ L;  4A3D C;  3S1N C;  1TWC K;  3SZZ A;  4Q5S A;  4A3L K;  4C3I C;  3HKZ D;  4A3F C;  3S0X A;  5C4X C;  1Y1V K;  3CAG A;  4LK0 A;  4ZH4 A;  4A3E K;  1XZQ A;  5M5X K;  1ISE A;  4C2M C;  2YU9 C;  4A93 K;  4C3J C;  4AYB L;  2B63 K;  4KN4 A;  1O2F B;  1I6V A;  5TMF A;  1F7V A;  4AYB D;  5IOQ A;  1WCM A;  2E2J K;  4FZB A;  1EFW A;  2JA8 C;  3GTG K;  4LLG A;  1JVI A;  1DCP A;  4QJV A;  2NVQ K;  1ZVU A;  1BS2 A;  4KDD A;  1I50 A;  3M3Y C;  1WOP A;  5IYD K;  1WSV A;  3AQP A;  3GEE A;  3GTK A;  2XCR B;  4YFX A;  2R93 A;  4YFN A;  2A69 A;  3GTQ C;  2JA6 C;  4KMU A;  1B4A A;  3N3Y A;  3PO3 C;  1TWG C;  1O2A A;  1XZP B;  3HOW C;  3S16 K;  4JK1 A;  5IOT A;  3HOV K;  5IP9 K;  2PPB A;  2E2I A;  1YCL A;  5C3E C;  2BE5 A;  1TWH C;  3EQL A;  3HOU C;  3HOZ C;  3S1R C;  4PAB A;  4PAA A;  4A3B C;  4GTE A;  4ILD A;  2PMZ L;  5D4D A;  2JA7 C;  1K83 K;  1TWC C;  3GTQ A;  3T00 A;  2PMZ D;  3L4K A;  3LAJ A;  1EK8 A;  1YNJ A;  3GTP A;  1ZQ1 C;  2V6T A;  3V4G A;  4BBS K;  1Y1V C;  2YU9 A;  4A3E C;  4A93 C;  1PJ6 A;  3JST A;  2B63 C;  2NVX A;  4G0V A;  3ORE A;  1C0A A;  2E2J C;  5JFE A;  4P5B A;  3I4N K;  3GTG C;  4KMD A;  2NVQ C;  5IYD C;  5EGE A;  3GTM A;  2A6E A;  3LPX A;  3TFH A;  4X6A K;  2ZUF A;  2JA6 A;  1O25 A;  1TWG A;  4BLA A;  1J6V A;  3GTQ K;  3A8J A;  3GTP K;  1XPP A;  4RMF A;  5C4X K;  4LQY A;  4KC6 A;  5IP9 C;  4C3J K;  1SMY A;  3ADA C;  1F9N A;  4KAR A;  1TWH A;  4G7H A;  2NVX K;  4GTD A;  4A3C C;  3RZO K;  2R92 A;  2JA7 A;  5IYB K;  1YNN A;  3BP3 A;  1TWC A;  1K83 C;  3FHZ A;  1HQM A;  2V6S A;  4LK1 A;  3GTM K;  1Y1V A;  4KB2 A;  1DCH A;  2JA6 K;  2R7Z C;  3GDZ A;  3S1Q C;  1IBA A;  4P9S A;  4J3N A;  4DDQ A;  1UV7 A;  3T02 A;  3HOW K;  1YX2 A;  3GTG A;  3I4N C;  3FOF A;  4QJV B;  5IYC K;  1INN A;  4X6A C;  4FM9 A;  4A3B K;  4GT9 A;  2R92 K;  2A6H A;  4XLN A; 
#chains in the Genus database with same CATH homology
 4A3M K;  2R93 K;  3GTP C;  3PO3 C;  1TWG C;  3H3V L;  5C4J C;  1TWF K;  3S16 K;  2JA5 C;  2VUM K;  3HOW C;  1I3Q C;  4JK1 A;  3RZD C;  4MEY A;  2CW0 A;  3H3V D;  3S2H C;  1BDF A;  5IP7 K;  3HOV K;  5IP9 K;  2PPB A;  3PO2 K;  4NOI A;  3WOD A;  4BXX K;  3FKI C;  2Y0S L;  3HOY K;  5M3F K;  2NVX C;  3S17 K;  5TMC A;  5C3E C;  2E2I K;  1ZYR A;  4MQ9 A;  2BE5 A;  4YG2 A;  1TWH C;  2Y0S D;  3RZO C;  3EQL A;  3S1M K;  5IYB C;  3HOU C;  3HOZ C;  4Q4Z A;  3S1R C;  4BY7 K;  4QIW L;  4A3B C;  1TWA C;  2JA7 C;  5D4D A;  2PMZ L;  4GZY A;  2NVT C;  3S14 K;  2O5J A;  1K83 K;  1TWC C;  4QIW D;  4A3D K;  5M5Y K;  4XSX A;  4A3J C;  2PMZ D;  3GTM C;  3S1N K;  3M4O C;  1YNJ A;  3S15 C;  1I6H K;  4LJZ A;  4C3I K;  4Y52 C;  4A3F K;  4BBS K;  1Y1V C;  5C44 K;  4BY1 C;  4A3E C;  3S16 C;  4A93 C;  1Y1W K;  3H0G C;  2WB1 L;  4XSZ A;  2B63 C;  3HOV C;  1IW7 A;  4C2M K;  2YU9 K;  4A3I C;  4BBR C;  2A68 A;  4A3K K;  4G7O A;  2WB1 D;  4A3G K;  5M3M K;  2E2J C;  4XLP A;  3I4N K;  3CQZ K;  3GTG C;  4BY7 C;  3S2D K;  1WCM C;  5IYC C;  4Y7N C;  2E2H C;  2JA8 K;  3HOX K;  2NVQ C;  5IYD C;  4OIR A;  3GTO K;  4A3C K;  2WAQ L;  3K7A K;  2A6E A;  2JA6 C;  4MEX A;  2R92 C;  3I4M C;  3M3Y K;  4X6A K;  1I50 C;  3GTJ K;  5FLM K;  1SFO K;  1R9T C;  2WAQ D;  3GTL C;  4BBS C;  4YFK A;  3GTK C;  4A3M C;  2R93 C;  4OIO A;  2NVY K;  3GTQ K;  1TWF C;  1XPP A;  3GTP K;  1TWG K;  2VUM C;  3PO3 K;  5C4X K;  5C4J K;  2R7Z K;  5IP7 C;  3PO2 C;  1I3Q K;  5IP9 C;  3RZD K;  3S1Q K;  4C3J K;  3S2H K;  1SMY A;  4BXX C;  3HOY C;  3S2D C;  3S17 C;  3FKI K;  4A3J K;  4C3H K;  4G7H A;  2E2I C;  2NVX K;  3S1M C;  4A3C C;  5C3E K;  3RZO K;  1TWH K;  2O5I A;  5IYB K;  3HOU K;  3HOZ K;  3S1R K;  1YNN A;  3GTQ C;  3S14 C;  3GTJ C;  1TWA K;  1K83 C;  2JA7 K;  3HKZ L;  1HQM A;  4A3D C;  2NVT K;  3S1N C;  5FJ8 K;  1TWC K;  1I6H C;  4LK1 A;  4Q5S A;  3S15 K;  5M5W K;  3HKZ D;  3GTM K;  4A3F C;  4A3L K;  5C44 C;  4KN7 A;  5C4X C;  4Y52 K;  1Y1W C;  3DXJ A;  2JA6 K;  1Y1V K;  4LK0 A;  4ZH4 A;  4A3E K;  4BY1 K;  5M5X K;  2R7Z C;  2YU9 C;  3M4O K;  4A93 K;  3S1Q C;  3H0G K;  3GTK K;  4AYB L;  4A3K C;  2B63 K;  4KN4 A;  2JA5 K;  3HOW K;  4A3G C;  1I6V A;  4BBR K;  4A3I K;  5TMF A;  4AYB D;  3I4N C;  3CQZ C;  4OIP A;  2E2J K;  4QJV B;  2JA8 C;  3HOX C;  3GTG K;  4LLG A;  1WCM K;  5IYC K;  2PA8 L;  4Y7N K;  2E2H K;  4QJV A;  3GTO C;  2NVQ K;  3K7A C;  5IYD K;  3M3Y C;  4X6A C;  2PA8 D;  5FLM C;  1SFO C;  4A3B K;  4A3L C;  2R92 K;  4OIQ A;  2A6H A;  3I4M K;  1I50 K;  4YFX A;  1R9T K;  4YFN A;  2A69 A;  3GTL K;  4G7Z A;  2NVY C;  4OIN A;  4KMU A;  4XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...