2PA8L

X-ray crystal structure of the d/l subcomplex of the sulfolobus solfataricus rna polymerase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 26
structure length 92
sequence length 92
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pa8L00
3HKZL 2JA5K 1TWHC 3GTJC 4A3KK 1Y1WC 4A3DK 4KMUA 3H3VD 3S1RC 4YFKA 1TWAC 2PMZL 2NVXC 4A3EK 1I3QK 1TWHK 4XSZA 4BY7K 5FLMK 3S1RK 2JA6C 2YU9C 1TWGK 3GTPC 1SFOK 4XSXA 3HOWC 3M4OK 4Q4ZA 3CQZK 3GTGK 4OIOA 3S2DK 4YFNA 4C2MK 4A3BC 2JA6K 3GTQC 1WCMC 4QJVA 5C3EC 2E2HC 3GTKK 4LLGA 2A69A 3GTMC 4BBSK 2JA7C 3GTLK 4A3IC 4BY1K 4X6AK 1I50K 1K83C 2WAQD 1TWCC 4BXXK 4C3JK 2E2HK 2E2JC 5M5XK 2R93C 3FKIC 1Y1VC 1SMYA 1YNNA 5IYCC 4YFXA 3GTOK 3M3YK 2R92C 4Q5SA 1TWCK 2Y0SD 2WB1L 4XLPA 4A3JC 5C4JC 3DXJA 3I4MC 2R93K 3RZDC 1Y1VK 3FKIK 3RZOC 2O5IA 4GZYA 5IYDC 4JK1A 1TWFK 1HQMA 3PO3C 2NVYC 4A3JK 3S14C 5FJ8K 3GTJK 1Y1WK 1XPPA 4MEYA 5M3MK 3RZOK 4QIWL 2PA8L 3S15C 4XLNA 4A3FC 1I6HC 5IYDK 4KN4A 1TWAK 5D4DA 5M5YK 5IYBC 2NVXK 5IP9C 3S14K 3S2HC 4A3MC 4BBRC 3S15K 2A6HA 4A93C 4A3FK 4Y7NC 3GTPK 2YU9K 4AYBD 2NVQC 3HOWK 3HOUC 4G7ZA 2NVTC 4A93K 4G7HA 5C44C 4A3BK 3HOZC 3GTQK 3HOYC 2CW0A 5C4XC 3HOUK 1WCMK 3H3VL 5C3EK 4A3GC 3GTMK 5M3FK 3I4NC 2JA7K 4MEXA 2JA8C 4A3IK 1K83K 3S17C 4A3CC 4Y52C 3K7AC 1YNJA 2E2JK 3HKZD 5IYCK 2O5JA 4MQ9A 3PO2C 2R92K 2VUMC 3H0GC 4A3CK 3I4MK 3WODA 5C4JK 1BDFA 3S1MC 3RZDK 4Y52K 2PMZD 4LK1A 4A3LC 5IP7C 3HOVC 3HOXC 3S1QC 3S16C 3PO3K 3H0GK 2NVYK 5TMFA 4LJZA 2WAQL 1ZYRA 5IP7K 1I6HK 3S16K 2A68A 5IYBK 3S2HK 5IP9K 4C3IK 4A3MK 4BBRK 4A3KC 2Y0SL 2BE5A 4Y7NK 3EQLA 4KN7A 4OIRA 2NVQK 4A3EC 4OIPA 2R7ZC 2A6EA 1I3QC 4BY7C 2NVTK 5FLMC 5C44K 4C3HK 3HOZK 1TWGC 4YG2A 5M5WK 1SFOC 2E2IC 5C4XK 1R9TC 3HOYK 3CQZC 3GTGC 2R7ZK 3M4OC 3S1NC 3S2DC 4A3GK 4G7OA 3I4NK 2WB1D 2JA8K 4OINA 4LK0A 2E2IK 3S17K 1R9TK 3S1NK 3GTKC 3K7AK 4AYBL 1IW7A 4NOIA 4BBSC 5TMCA 3GTLC 4X6AC 4BY1C 2B63C 3PO2K 1I50C 2VUMK 4QIWD 2PA8D 4BXXC 3S1MK 4A3LK 1I6VA 3HOVK 3HOXK 3S1QK 4ZH4A 2B63K 3GTOC 3M3YC 2JA5C 2PPBA 4A3DC 4OIQA 4QJVB 1TWFC
chains in the Genus database with same CATH superfamily
2CFAA 1TWHC 1F9NA 1RU0A 2FQTA 5CJ9A 4GFQA 2NVXC 1INNA 1PJ5A 5FLMK 3S1RK 3GTPC 4OIOA 4YFNA 1O28A 1HI9A 1ZBSA 3L4KA 2JA7C 3GTLK 4BY1K 3GTGA 1K83C 2GSUA 1IQ0A 2E2HK 1DD5A 5IYCC 2VUMA 1WOOA 4YFXA 3GTOK 2WB1L 1VLOA 5C4JC 3RZDC 3FKIK 2XCRB 3RZOC 2O5IA 4GZYA 5IYDC 4JK1A 1HQMA 4A3JK 5FJ8K 4KDDA 1XPPA 4XLNA 2NVXK 5M5YK 1BJTA 4BBRC 3S15K 3GTPK 3SZYA 2NVQC 3HOUC 4G7ZA 1TWAA 5JVOA 4G7HA 5IOQA 3HOYC 5C4XC 3N0CA 2PHCB 3I4NC 1IBAA 2JA7K 4KM9A 1K83K 3GTLA 1YNJA 3FOEA 1C0AA 5IYCK 2E2HA 3PO2C 1VH2A 4A3CK 3WODA 5C4JK 3S1MC 3RZDK 2ZFZA 3HOVC 1X31C 3FKIA 4C45A 4LJZA 1ZYRA 1V5VA 4KB2A 1ZQ1C 1VGXA 4BBRK 4A3KC 4KMHA 1WOPA 4KN7A 4J3NA 4PABA 1O25A 1WORA 4OIRA 4LR2A 4OIPA 2NVQK 3GTPA 1TWGC 4YG2A 3HOYK 5C4XK 3S1NC 2R7ZK 3GTGC 1WSVA 3S2DC 3I4NK 4RMFA 4OINA 4WILA 1XXAA 1R9TK 4BBSC 4FM9A 3SZZA 3N3YA 3PO2K 2PA8D 1DCPA 3S1MK 3T02A 3HOVK 2B63K 2RH6A 3M3YC 2ZUFA 3CAGA 3MMLB 1VJEA 2JA5K 4A3KK 3H3VD 3S1RC 1PJ6A 1TWAC 2KWAA 4WJ4A 1O26A 2YU9C 1TWGK 4XSXA 3LPXA 3HOWC 4Q4ZA 3GTGK 4GTCA 3S2DK 4C2MK 2EBBA 2R7ZA 2JA6K 2E2HC 1IE0A 4LLGA 3GTMC 4BBSK 1EQRA 1R9TA 1WIHA 4A3IC 3ERED 3G4CA 3FKIC 1YNNA 3M3YK 1TWCK 4A3JC 3I4MC 1JVIA 3DXJA 2B63A 1IS1A 4KC6A 3PO3C 4MEYA 5M3MK 3S15C 2JA5A 2PA8L 1I6HC 1F7VA 4KN4A 1TWAK 1XXBA 3S14K 4A3MC 1TWFA 3A8IA 4WJ3M 1XZPA 2YU9K 3OREA 3HOWK 1TWGA 2NVTC 4C3HC 3FHZA 3H3VL 5CHPA 2JA6A 3GTMK 3OPFA 4MEXA 2JA8C 1XZQA 4A3IK 1AB4A 4A3CC 2P8TA 3HKZD 1O29A 1DCOA 3I4MK 2PMZD 4A3LC 1TWCA 3VA7A 3OEPA 3PO3K 3H0GK 1DCHA 3IPJA 1GE9A 1O2BA 2V6SA 1I6HK 3L4JA 2A68A 1L0WA 1BS2A 4A3MK 2BE5A 2V6UA 4A3EC 2R7ZC 2GSNA 2A6EA 3T00A 2YU9A 2NVTK 3GIRA 1J6WA 4C3HK 4FZBA 1SFOC 2XCQA 1R9TC 1WSRA 3M4OC 2CFAB 2JA8K 4LK0A 3GTMA 4X6AC 2B63C 4QIWD 3HXAA 4A3LK 3GSIA 2JA5C 2PPBA 3S0XA 3H0GA 1TWFC 3HKZL 4P5AA 3GTJC 1O24A 5E68A 4A3DK 1USMA 5HL8A 2PMZL 4A3EK 3TFJA 4C2MC 2JA6C 1VRQC 1O27A 1SFOK 3M4OK 4KARA 1G51A 1I3QA 3GTQC 4QJVA 4X6AK 3CQZA 4G0VA 5L46A 1TWCC 2E2JC 1YCLA 1SMYA 3ADAC 3GTKA 4Q5SA 1J98A 4XLPA 4ILDA 2R93K 1Y1VK 1I50A 4BKWA 1TWFK 3GEIA 3S14C 2JH3A 3GTJK 4QIWL 3TTGA 3AD7C 5D4DA 5IP9C 4C3IC 3TFHA 4A3FK 4Y7NC 4AYBD 5TJ3A 4LQYA 2V6TA 4GT9A 1SFOA 4A93K 3HOZC 3LAPA 3GTQK 5M3FK 3N0BA 3K7AC 2GSOA 2E2JK 2O5JA 1WCMA 4MQ9A 3H0GC 4Y52K 2GAHC 1WQGA 3A8JA 3HOXC 3S1QC 2GAGC 2R93A 1Y1VA 2RGRA 5TMFA 2R92A 5IP7K 3LAJA 3S16K 3GTJA 3JSTA 5EGEA 5IP9K 4C3IK 2ZUEA 4M1XA 4Y7NK 2P5MA 3AD8C 3EQLA 3GEHA 2Y3PA 3NUHA 1I3QC 4BY7C 4GTFA 3HOZK 1KQ4A 4G0WA 4KB4A 3CQZC 1F7UA 4BLAA 3GTQA 3T01A 5IOSA 4G7OA 2E2IK 1JOEA 3G4AA 3K7AK 3GTKC 4AYBL 1IW7A 2D6FC 5TMCA 1I50C 4BXXC 4C3JC 1PJ7A 3AD9C 1B4AA 1I6VA 3HOXK 3S1QK 4DDQA 4P5BA 4A3DC 4OIQA 3TFIA 1EK8A 4GTDA 1Y1WC 4KMUA 4YFKA 3GEEA 3BP3A 1WQFA 1I3QK 1TWHK 3FOFA 4XSZA 4BY7K 2FQOA 1UV7A 5IORA 4LOWA 3CQZK 2W7VA 4A3BC 3V4GA 4GTAA 1WCMC 5C3EC 3GTKK 5JFEA 2A69A 2E2IA 3A8KA 1I50K 2WAQD 4P9SA 4BXXK 4C3JK 2R93C 1XZPB 5M5XK 1Y1VC 1B4BA 2R92C 4PAAA 2Y0SD 3QX3A 1IL2A 4KM8A 1EFWA 1ZVUA 2NVYC 1USOA 1XZQB 1Y1WK 3GTOA 4XCHA 3RZOK 3AQPA 4A3FC 5IYDK 3Q3QA 1O2AA 5IYBC 3S2HC 1EH1A 2A6HA 4A93C 1TWHA 4G0UA 3BP8C 1J6XA 2NVXA 5C44C 4A3BK 2CW0A 3HOUK 1WCMK 5C3EK 4A3GC 4BLBA 5EGHA 3S17C 4Y52C 1XXCA 4GTEA 1F93A 3AH5A 2R92K 2VUMC 1WQHA 2JA7A 1BDFA 1EI6A 4LK1A 1K83A 5IP7C 1ZXOA 3AQOA 3S16C 2NVYK 4KASA 2WAQL 1WOSA 4O2DA 1Y1WA 5IYBK 3S2HK 4KAWX 2Y0SL 4KMAA 3BUEA 3GDZA 5FLMC 5C44K 1ISEA 5M5WK 2E2IC 4KMDA 1BGWA 4KATA 4A3GK 2WB1D 1O2FB 3S17K 3S1NK 5IOTA 1YX2A 4NOIA 3GTLC 1JQWA 4BY1C 2VUMK 4GTBA 4ZH4A 3GTOC 1J6VA 4AH6A 4QJVB 2NVYA 4GTLA 2XCOA
chains in the Genus database with same CATH topology
3HKZL 2JA5K 1TWHC 3GTJC 4A3KK 1Y1WC 4A3DK 4KMUA 3H3VD 3S1RC 4YFKA 1TWAC 2PMZL 2NVXC 4A3EK 1I3QK 1TWHK 4XSZA 4BY7K 5FLMK 3S1RK 2JA6C 2YU9C 1TWGK 3GTPC 1SFOK 4XSXA 3HOWC 3M4OK 4Q4ZA 3CQZK 3GTGK 4OIOA 3S2DK 4YFNA 4C2MK 4A3BC 2JA6K 3GTQC 1WCMC 4QJVA 5C3EC 2E2HC 3GTKK 4LLGA 2A69A 3GTMC 4BBSK 2JA7C 3GTLK 4A3IC 4BY1K 4X6AK 1I50K 1K83C 2WAQD 1TWCC 4BXXK 4C3JK 2E2HK 2E2JC 5M5XK 2R93C 3FKIC 1Y1VC 1SMYA 1YNNA 5IYCC 4YFXA 3GTOK 3M3YK 2R92C 4Q5SA 1TWCK 2Y0SD 2WB1L 4XLPA 4A3JC 5C4JC 3DXJA 3I4MC 2R93K 3RZDC 1Y1VK 3FKIK 3RZOC 2O5IA 4GZYA 5IYDC 4JK1A 1TWFK 1HQMA 3PO3C 2NVYC 4A3JK 3S14C 5FJ8K 3GTJK 1Y1WK 1XPPA 4MEYA 5M3MK 3RZOK 4QIWL 2PA8L 3S15C 4XLNA 4A3FC 1I6HC 5IYDK 4KN4A 1TWAK 5D4DA 5M5YK 5IYBC 2NVXK 5IP9C 3S14K 3S2HC 4A3MC 4BBRC 3S15K 2A6HA 4A93C 4A3FK 4Y7NC 3GTPK 2YU9K 4AYBD 2NVQC 3HOWK 3HOUC 4G7ZA 2NVTC 4A93K 4G7HA 5C44C 4A3BK 3HOZC 3GTQK 3HOYC 2CW0A 5C4XC 3HOUK 1WCMK 3H3VL 5C3EK 4A3GC 3GTMK 5M3FK 3I4NC 2JA7K 4MEXA 2JA8C 4A3IK 1K83K 3S17C 4A3CC 4Y52C 3K7AC 1YNJA 2E2JK 3HKZD 5IYCK 2O5JA 4MQ9A 3PO2C 2R92K 2VUMC 3H0GC 4A3CK 3I4MK 3WODA 5C4JK 1BDFA 3S1MC 3RZDK 4Y52K 2PMZD 4LK1A 4A3LC 5IP7C 3HOVC 3HOXC 3S1QC 3S16C 3PO3K 3H0GK 2NVYK 5TMFA 4LJZA 2WAQL 1ZYRA 5IP7K 1I6HK 3S16K 2A68A 5IYBK 3S2HK 5IP9K 4C3IK 4A3MK 4BBRK 4A3KC 2Y0SL 2BE5A 4Y7NK 3EQLA 4KN7A 4OIRA 2NVQK 4A3EC 4OIPA 2R7ZC 2A6EA 1I3QC 4BY7C 2NVTK 5FLMC 5C44K 4C3HK 3HOZK 1TWGC 4YG2A 5M5WK 1SFOC 2E2IC 5C4XK 1R9TC 3HOYK 3CQZC 3GTGC 2R7ZK 3M4OC 3S1NC 3S2DC 4A3GK 4G7OA 3I4NK 2WB1D 2JA8K 4OINA 4LK0A 2E2IK 3S17K 1R9TK 3S1NK 3GTKC 3K7AK 4AYBL 1IW7A 4NOIA 4BBSC 5TMCA 3GTLC 4X6AC 4BY1C 2B63C 3PO2K 1I50C 2VUMK 4QIWD 2PA8D 4BXXC 3S1MK 4A3LK 1I6VA 3HOVK 3HOXK 3S1QK 4ZH4A 2B63K 3GTOC 3M3YC 2JA5C 2PPBA 4A3DC 4OIQA 4QJVB 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ L;  2JA5 K;  1TWH C;  3GTJ C;  4A3K K;  1Y1W C;  4A3D K;  4KMU A;  3H3V D;  3S1R C;  4YFK A;  1TWA C;  2PMZ L;  2NVX C;  4A3E K;  1I3Q K;  1TWH K;  4XSZ A;  4BY7 K;  5FLM K;  3S1R K;  2JA6 C;  2YU9 C;  1TWG K;  3GTP C;  1SFO K;  4XSX A;  3HOW C;  3M4O K;  4Q4Z A;  3CQZ K;  3GTG K;  4OIO A;  3S2D K;  4YFN A;  4C2M K;  4A3B C;  2JA6 K;  3GTQ C;  1WCM C;  4QJV A;  5C3E C;  2E2H C;  3GTK K;  4LLG A;  2A69 A;  3GTM C;  4BBS K;  2JA7 C;  3GTL K;  4A3I C;  4BY1 K;  4X6A K;  1I50 K;  1K83 C;  2WAQ D;  1TWC C;  4BXX K;  4C3J K;  2E2H K;  2E2J C;  5M5X K;  2R93 C;  3FKI C;  1Y1V C;  1SMY A;  1YNN A;  5IYC C;  4YFX A;  3GTO K;  3M3Y K;  2R92 C;  4Q5S A;  1TWC K;  2Y0S D;  2WB1 L;  4XLP A;  4A3J C;  5C4J C;  3DXJ A;  3I4M C;  2R93 K;  3RZD C;  1Y1V K;  3FKI K;  3RZO C;  2O5I A;  4GZY A;  5IYD C;  4JK1 A;  1TWF K;  1HQM A;  3PO3 C;  2NVY C;  4A3J K;  3S14 C;  5FJ8 K;  3GTJ K;  1Y1W K;  1XPP A;  4MEY A;  5M3M K;  3RZO K;  4QIW L;  2PA8 L;  3S15 C;  4XLN A;  4A3F C;  1I6H C;  5IYD K;  4KN4 A;  1TWA K;  5D4D A;  5M5Y K;  5IYB C;  2NVX K;  5IP9 C;  3S14 K;  3S2H C;  4A3M C;  4BBR C;  3S15 K;  2A6H A;  4A93 C;  4A3F K;  4Y7N C;  3GTP K;  2YU9 K;  4AYB D;  2NVQ C;  3HOW K;  3HOU C;  4G7Z A;  2NVT C;  4A93 K;  4G7H A;  5C44 C;  4A3B K;  3HOZ C;  3GTQ K;  3HOY C;  2CW0 A;  5C4X C;  3HOU K;  1WCM K;  3H3V L;  5C3E K;  4A3G C;  3GTM K;  5M3F K;  3I4N C;  2JA7 K;  4MEX A;  2JA8 C;  4A3I K;  1K83 K;  3S17 C;  4A3C C;  4Y52 C;  3K7A C;  1YNJ A;  2E2J K;  3HKZ D;  5IYC K;  2O5J A;  4MQ9 A;  3PO2 C;  2R92 K;  2VUM C;  3H0G C;  4A3C K;  3I4M K;  3WOD A;  5C4J K;  1BDF A;  3S1M C;  3RZD K;  4Y52 K;  2PMZ D;  4LK1 A;  4A3L C;  5IP7 C;  3HOV C;  3HOX C;  3S1Q C;  3S16 C;  3PO3 K;  3H0G K;  2NVY K;  5TMF A;  4LJZ A;  2WAQ L;  1ZYR A;  5IP7 K;  1I6H K;  3S16 K;  2A68 A;  5IYB K;  3S2H K;  5IP9 K;  4C3I K;  4A3M K;  4BBR K;  4A3K C;  2Y0S L;  2BE5 A;  4Y7N K;  3EQL A;  4KN7 A;  4OIR A;  2NVQ K;  4A3E C;  4OIP A;  2R7Z C;  2A6E A;  1I3Q C;  4BY7 C;  2NVT K;  5FLM C;  5C44 K;  4C3H K;  3HOZ K;  1TWG C;  4YG2 A;  5M5W K;  1SFO C;  2E2I C;  5C4X K;  1R9T C;  3HOY K;  3CQZ C;  3GTG C;  2R7Z K;  3M4O C;  3S1N C;  3S2D C;  4A3G K;  4G7O A;  3I4N K;  2WB1 D;  2JA8 K;  4OIN A;  4LK0 A;  2E2I K;  3S17 K;  1R9T K;  3S1N K;  3GTK C;  3K7A K;  4AYB L;  1IW7 A;  4NOI A;  4BBS C;  5TMC A;  3GTL C;  4X6A C;  4BY1 C;  2B63 C;  3PO2 K;  1I50 C;  2VUM K;  4QIW D;  2PA8 D;  4BXX C;  3S1M K;  4A3L K;  1I6V A;  3HOV K;  3HOX K;  3S1Q K;  4ZH4 A;  2B63 K;  3GTO C;  3M3Y C;  2JA5 C;  2PPB A;  4A3D C;  4OIQ A;  4QJV B;  1TWF C; 
#chains in the Genus database with same CATH topology
 2CFA A;  1TWH C;  1F9N A;  1RU0 A;  2FQT A;  5CJ9 A;  4GFQ A;  2NVX C;  1INN A;  1PJ5 A;  5FLM K;  3S1R K;  3GTP C;  4OIO A;  4YFN A;  1O28 A;  1HI9 A;  1ZBS A;  3L4K A;  2JA7 C;  3GTL K;  4BY1 K;  3GTG A;  1K83 C;  2GSU A;  1IQ0 A;  2E2H K;  1DD5 A;  5IYC C;  2VUM A;  1WOO A;  4YFX A;  3GTO K;  2WB1 L;  1VLO A;  5C4J C;  3RZD C;  3FKI K;  2XCR B;  3RZO C;  2O5I A;  4GZY A;  5IYD C;  4JK1 A;  1HQM A;  4A3J K;  5FJ8 K;  4KDD A;  1XPP A;  4XLN A;  2NVX K;  5M5Y K;  1BJT A;  4BBR C;  3S15 K;  3GTP K;  3SZY A;  2NVQ C;  3HOU C;  4G7Z A;  1TWA A;  5JVO A;  4G7H A;  5IOQ A;  3HOY C;  5C4X C;  3N0C A;  2PHC B;  3I4N C;  1IBA A;  2JA7 K;  4KM9 A;  1K83 K;  3GTL A;  1YNJ A;  3FOE A;  1C0A A;  5IYC K;  2E2H A;  3PO2 C;  1VH2 A;  4A3C K;  3WOD A;  5C4J K;  3S1M C;  3RZD K;  2ZFZ A;  3HOV C;  1X31 C;  3FKI A;  4C45 A;  4LJZ A;  1ZYR A;  1V5V A;  4KB2 A;  1ZQ1 C;  1VGX A;  4BBR K;  4A3K C;  4KMH A;  1WOP A;  4KN7 A;  4J3N A;  4PAB A;  1O25 A;  1WOR A;  4OIR A;  4LR2 A;  4OIP A;  2NVQ K;  3GTP A;  1TWG C;  4YG2 A;  3HOY K;  5C4X K;  3S1N C;  2R7Z K;  3GTG C;  1WSV A;  3S2D C;  3I4N K;  4RMF A;  4OIN A;  4WIL A;  1XXA A;  1R9T K;  4BBS C;  4FM9 A;  3SZZ A;  3N3Y A;  3PO2 K;  2PA8 D;  1DCP A;  3S1M K;  3T02 A;  3HOV K;  2B63 K;  2RH6 A;  3M3Y C;  2ZUF A;  3CAG A;  3MML B;  1VJE A;  2JA5 K;  4A3K K;  3H3V D;  3S1R C;  1PJ6 A;  1TWA C;  2KWA A;  4WJ4 A;  1O26 A;  2YU9 C;  1TWG K;  4XSX A;  3LPX A;  3HOW C;  4Q4Z A;  3GTG K;  4GTC A;  3S2D K;  4C2M K;  2EBB A;  2R7Z A;  2JA6 K;  2E2H C;  1IE0 A;  4LLG A;  3GTM C;  4BBS K;  1EQR A;  1R9T A;  1WIH A;  4A3I C;  3ERE D;  3G4C A;  3FKI C;  1YNN A;  3M3Y K;  1TWC K;  4A3J C;  3I4M C;  1JVI A;  3DXJ A;  2B63 A;  1IS1 A;  4KC6 A;  3PO3 C;  4MEY A;  5M3M K;  3S15 C;  2JA5 A;  2PA8 L;  1I6H C;  1F7V A;  4KN4 A;  1TWA K;  1XXB A;  3S14 K;  4A3M C;  1TWF A;  3A8I A;  4WJ3 M;  1XZP A;  2YU9 K;  3ORE A;  3HOW K;  1TWG A;  2NVT C;  4C3H C;  3FHZ A;  3H3V L;  5CHP A;  2JA6 A;  3GTM K;  3OPF A;  4MEX A;  2JA8 C;  1XZQ A;  4A3I K;  1AB4 A;  4A3C C;  2P8T A;  3HKZ D;  1O29 A;  1DCO A;  3I4M K;  2PMZ D;  4A3L C;  1TWC A;  3VA7 A;  3OEP A;  3PO3 K;  3H0G K;  1DCH A;  3IPJ A;  1GE9 A;  1O2B A;  2V6S A;  1I6H K;  3L4J A;  2A68 A;  1L0W A;  1BS2 A;  4A3M K;  2BE5 A;  2V6U A;  4A3E C;  2R7Z C;  2GSN A;  2A6E A;  3T00 A;  2YU9 A;  2NVT K;  3GIR A;  1J6W A;  4C3H K;  4FZB A;  1SFO C;  2XCQ A;  1R9T C;  1WSR A;  3M4O C;  2CFA B;  2JA8 K;  4LK0 A;  3GTM A;  4X6A C;  2B63 C;  4QIW D;  3HXA A;  4A3L K;  3GSI A;  2JA5 C;  2PPB A;  3S0X A;  3H0G A;  1TWF C;  3HKZ L;  4P5A A;  3GTJ C;  1O24 A;  5E68 A;  4A3D K;  1USM A;  5HL8 A;  2PMZ L;  4A3E K;  3TFJ A;  4C2M C;  2JA6 C;  1VRQ C;  1O27 A;  1SFO K;  3M4O K;  4KAR A;  1G51 A;  1I3Q A;  3GTQ C;  4QJV A;  4X6A K;  3CQZ A;  4G0V A;  5L46 A;  1TWC C;  2E2J C;  1YCL A;  1SMY A;  3ADA C;  3GTK A;  4Q5S A;  1J98 A;  4XLP A;  4ILD A;  2R93 K;  1Y1V K;  1I50 A;  4BKW A;  1TWF K;  3GEI A;  3S14 C;  2JH3 A;  3GTJ K;  4QIW L;  3TTG A;  3AD7 C;  5D4D A;  5IP9 C;  4C3I C;  3TFH A;  4A3F K;  4Y7N C;  4AYB D;  5TJ3 A;  4LQY A;  2V6T A;  4GT9 A;  1SFO A;  4A93 K;  3HOZ C;  3LAP A;  3GTQ K;  5M3F K;  3N0B A;  3K7A C;  2GSO A;  2E2J K;  2O5J A;  1WCM A;  4MQ9 A;  3H0G C;  4Y52 K;  2GAH C;  1WQG A;  3A8J A;  3HOX C;  3S1Q C;  2GAG C;  2R93 A;  1Y1V A;  2RGR A;  5TMF A;  2R92 A;  5IP7 K;  3LAJ A;  3S16 K;  3GTJ A;  3JST A;  5EGE A;  5IP9 K;  4C3I K;  2ZUE A;  4M1X A;  4Y7N K;  2P5M A;  3AD8 C;  3EQL A;  3GEH A;  2Y3P A;  3NUH A;  1I3Q C;  4BY7 C;  4GTF A;  3HOZ K;  1KQ4 A;  4G0W A;  4KB4 A;  3CQZ C;  1F7U A;  4BLA A;  3GTQ A;  3T01 A;  5IOS A;  4G7O A;  2E2I K;  1JOE A;  3G4A A;  3K7A K;  3GTK C;  4AYB L;  1IW7 A;  2D6F C;  5TMC A;  1I50 C;  4BXX C;  4C3J C;  1PJ7 A;  3AD9 C;  1B4A A;  1I6V A;  3HOX K;  3S1Q K;  4DDQ A;  4P5B A;  4A3D C;  4OIQ A;  3TFI A;  1EK8 A;  4GTD A;  1Y1W C;  4KMU A;  4YFK A;  3GEE A;  3BP3 A;  1WQF A;  1I3Q K;  1TWH K;  3FOF A;  4XSZ A;  4BY7 K;  2FQO A;  1UV7 A;  5IOR A;  4LOW A;  3CQZ K;  2W7V A;  4A3B C;  3V4G A;  4GTA A;  1WCM C;  5C3E C;  3GTK K;  5JFE A;  2A69 A;  2E2I A;  3A8K A;  1I50 K;  2WAQ D;  4P9S A;  4BXX K;  4C3J K;  2R93 C;  1XZP B;  5M5X K;  1Y1V C;  1B4B A;  2R92 C;  4PAA A;  2Y0S D;  3QX3 A;  1IL2 A;  4KM8 A;  1EFW A;  1ZVU A;  2NVY C;  1USO A;  1XZQ B;  1Y1W K;  3GTO A;  4XCH A;  3RZO K;  3AQP A;  4A3F C;  5IYD K;  3Q3Q A;  1O2A A;  5IYB C;  3S2H C;  1EH1 A;  2A6H A;  4A93 C;  1TWH A;  4G0U A;  3BP8 C;  1J6X A;  2NVX A;  5C44 C;  4A3B K;  2CW0 A;  3HOU K;  1WCM K;  5C3E K;  4A3G C;  4BLB A;  5EGH A;  3S17 C;  4Y52 C;  1XXC A;  4GTE A;  1F93 A;  3AH5 A;  2R92 K;  2VUM C;  1WQH A;  2JA7 A;  1BDF A;  1EI6 A;  4LK1 A;  1K83 A;  5IP7 C;  1ZXO A;  3AQO A;  3S16 C;  2NVY K;  4KAS A;  2WAQ L;  1WOS A;  4O2D A;  1Y1W A;  5IYB K;  3S2H K;  4KAW X;  2Y0S L;  4KMA A;  3BUE A;  3GDZ A;  5FLM C;  5C44 K;  1ISE A;  5M5W K;  2E2I C;  4KMD A;  1BGW A;  4KAT A;  4A3G K;  2WB1 D;  1O2F B;  3S17 K;  3S1N K;  5IOT A;  1YX2 A;  4NOI A;  3GTL C;  1JQW A;  4BY1 C;  2VUM K;  4GTB A;  4ZH4 A;  3GTO C;  1J6V A;  4AH6 A;  4QJV B;  2NVY A;  4GTL A;  2XCO A; 
#chains in the Genus database with same CATH homology
 3HKZ L;  2JA5 K;  1TWH C;  3GTJ C;  4A3K K;  1Y1W C;  4A3D K;  4KMU A;  3H3V D;  3S1R C;  4YFK A;  1TWA C;  2PMZ L;  2NVX C;  4A3E K;  1I3Q K;  1TWH K;  4XSZ A;  4BY7 K;  5FLM K;  3S1R K;  2JA6 C;  2YU9 C;  1TWG K;  3GTP C;  1SFO K;  4XSX A;  3HOW C;  3M4O K;  4Q4Z A;  3CQZ K;  3GTG K;  4OIO A;  3S2D K;  4YFN A;  4C2M K;  4A3B C;  2JA6 K;  3GTQ C;  1WCM C;  4QJV A;  5C3E C;  2E2H C;  3GTK K;  4LLG A;  2A69 A;  3GTM C;  4BBS K;  2JA7 C;  3GTL K;  4A3I C;  4BY1 K;  4X6A K;  1I50 K;  1K83 C;  2WAQ D;  1TWC C;  4BXX K;  4C3J K;  2E2H K;  2E2J C;  5M5X K;  2R93 C;  3FKI C;  1Y1V C;  1SMY A;  1YNN A;  5IYC C;  4YFX A;  3GTO K;  3M3Y K;  2R92 C;  4Q5S A;  1TWC K;  2Y0S D;  2WB1 L;  4XLP A;  4A3J C;  5C4J C;  3DXJ A;  3I4M C;  2R93 K;  3RZD C;  1Y1V K;  3FKI K;  3RZO C;  2O5I A;  4GZY A;  5IYD C;  4JK1 A;  1TWF K;  1HQM A;  3PO3 C;  2NVY C;  4A3J K;  3S14 C;  5FJ8 K;  3GTJ K;  1Y1W K;  1XPP A;  4MEY A;  5M3M K;  3RZO K;  4QIW L;  2PA8 L;  3S15 C;  4XLN A;  4A3F C;  1I6H C;  5IYD K;  4KN4 A;  1TWA K;  5D4D A;  5M5Y K;  5IYB C;  2NVX K;  5IP9 C;  3S14 K;  3S2H C;  4A3M C;  4BBR C;  3S15 K;  2A6H A;  4A93 C;  4A3F K;  4Y7N C;  3GTP K;  2YU9 K;  4AYB D;  2NVQ C;  3HOW K;  3HOU C;  4G7Z A;  2NVT C;  4A93 K;  4G7H A;  5C44 C;  4A3B K;  3HOZ C;  3GTQ K;  3HOY C;  2CW0 A;  5C4X C;  3HOU K;  1WCM K;  3H3V L;  5C3E K;  4A3G C;  3GTM K;  5M3F K;  3I4N C;  2JA7 K;  4MEX A;  2JA8 C;  4A3I K;  1K83 K;  3S17 C;  4A3C C;  4Y52 C;  3K7A C;  1YNJ A;  2E2J K;  3HKZ D;  5IYC K;  2O5J A;  4MQ9 A;  3PO2 C;  2R92 K;  2VUM C;  3H0G C;  4A3C K;  3I4M K;  3WOD A;  5C4J K;  1BDF A;  3S1M C;  3RZD K;  4Y52 K;  2PMZ D;  4LK1 A;  4A3L C;  5IP7 C;  3HOV C;  3HOX C;  3S1Q C;  3S16 C;  3PO3 K;  3H0G K;  2NVY K;  5TMF A;  4LJZ A;  2WAQ L;  1ZYR A;  5IP7 K;  1I6H K;  3S16 K;  2A68 A;  5IYB K;  3S2H K;  5IP9 K;  4C3I K;  4A3M K;  4BBR K;  4A3K C;  2Y0S L;  2BE5 A;  4Y7N K;  3EQL A;  4KN7 A;  4OIR A;  2NVQ K;  4A3E C;  4OIP A;  2R7Z C;  2A6E A;  1I3Q C;  4BY7 C;  2NVT K;  5FLM C;  5C44 K;  4C3H K;  3HOZ K;  1TWG C;  4YG2 A;  5M5W K;  1SFO C;  2E2I C;  5C4X K;  1R9T C;  3HOY K;  3CQZ C;  3GTG C;  2R7Z K;  3M4O C;  3S1N C;  3S2D C;  4A3G K;  4G7O A;  3I4N K;  2WB1 D;  2JA8 K;  4OIN A;  4LK0 A;  2E2I K;  3S17 K;  1R9T K;  3S1N K;  3GTK C;  3K7A K;  4AYB L;  1IW7 A;  4NOI A;  4BBS C;  5TMC A;  3GTL C;  4X6A C;  4BY1 C;  2B63 C;  3PO2 K;  1I50 C;  2VUM K;  4QIW D;  2PA8 D;  4BXX C;  3S1M K;  4A3L K;  1I6V A;  3HOV K;  3HOX K;  3S1Q K;  4ZH4 A;  2B63 K;  3GTO C;  3M3Y C;  2JA5 C;  2PPB A;  4A3D C;  4OIQ A;  4QJV B;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...