2PA8L

X-ray crystal structure of the d/l subcomplex of the sulfolobus solfataricus rna polymerase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 26
structure length 92
sequence length 92
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pa8L00
3EQLA 4LJZA 1Y1WK 2JA7C 5C3EK 4A3IK 3M4OK 3HOYK 1TWCK 4KN4A 1I3QK 3H0GK 4Y52K 2R92C 2YU9C 4BY7K 4LLGA 2R93K 3FKIC 3GTLC 2JA5K 3K7AC 4A3MK 3I4NK 1TWGC 1K83K 3GTGC 5M5WK 1WCMK 5D4DA 3GTPC 3GTKC 3CQZC 3GTOC 5IYDK 2PMZD 5M3FK 4YG2A 2E2JC 2WAQD 4NOIA 2R7ZC 3PO3K 4BXXK 5FLMK 2E2IK 4C3HK 4JK1A 1HQMA 5FJ8K 3S15C 1TWFK 4LK0A 3HOVC 2R92K 2PA8D 2YU9K 4A3BC 4A93C 4YFNA 3FKIK 4A3EC 3RZDC 3GTLK 4Q5SA 3HOZK 3S2DC 1TWGK 3S1QC 4A3FC 2PMZL 2A6EA 5IP7C 3S17C 3GTPK 1Y1VC 3S1RC 2A69A 3CQZK 5C44C 4AYBD 4A3JK 3GTOK 3GTKK 3S1NC 4A3CC 2B63C 4BBSK 4A3LC 2PA8L 4BBRC 1R9TC 3PO2K 2JA6K 3S15K 3S14K 3HOVK 4YFKA 5IP9C 3S16C 1YNNA 2WB1D 4A3BK 4A93K 4A3EK 3RZDK 2BE5A 4A3GC 4A3KC 2E2HC 3S2DK 5TMCA 3S1QK 4AYBL 3S17K 1XPPA 4Y7NK 2JA7K 5C4XC 1Y1VK 2JA8C 4XLPA 3S1NK 4A3CK 3GTJC 1TWAC 2WB1L 1R9TK 4G7ZA 3HOWC 1YNJA 3S2HC 5IP9K 3S16K 3HOXC 3K7AK 2O5JA 4A3KK 2NVXC 2O5IA 3GTGK 2E2HK 3HKZL 3GTMC 5C4JC 5C4XK 4QIWD 5IYCC 2E2JK 1SFOC 2JA8K 2R7ZK 3HOUC 2VUMC 3S1MC 1TWAK 3H3VD 4YFXA 4XLNA 3S2HK 4Q4ZA 4ZH4A 2CW0A 3M3YC 1IW7A 4G7HA 4BY1C 4XSXA 2NVXK 3HOYC 4A3FK 2Y0SD 4QIWL 5IP7K 4A3DC 3S1RK 4OIOA 5C44K 1SMYA 3HKZD 5TMFA 5IYCK 5C4JK 2PPBA 2B63K 4X6AC 3H3VL 4OIPA 3HOUK 4A3LK 2VUMK 3S1MK 1I6VA 4BBRK 1WCMC 4C2MK 1ZYRA 3M3YK 4OIRA 4BXXC 4A3GK 2NVTC 5M5XK 2Y0SL 5FLMC 2E2IC 1I6HC 4LK1A 4BY1K 2NVYC 4G7OA 1TWHC 1TWFC 4XSZA 4OINA 4A3DK 3RZOC 1I50C 4C3JK 5IYBC 3I4MC 3HOZC 4X6AK 3GTJK 4QJVA 3GTQK 4GZYA 2NVQC 4MQ9A 4MEXA 3GTQC 3HOWK 4A3JC 3M4OC 4OIQA 1Y1WC 3HOXK 4BBSC 5C3EC 4A3IC 1I6HK 2NVTK 4QJVB 1TWCC 2A6HA 1I3QC 3H0GC 4Y52C 3PO2C 2NVYK 2JA6C 1TWHK 3S14C 4BY7C 2R93C 1BDFA 3GTMK 2JA5C 2A68A 4MEYA 1I50K 3RZOK 4A3MC 5IYBK 1SFOK 4KMUA 3I4MK 4KN7A 3WODA 3I4NC 1K83C 2NVQK 4C3IK 5M3MK 5IYDC 2WAQL 4Y7NC 5M5YK 3DXJA 3PO3C
chains in the Genus database with same CATH superfamily
1WCMA 3EQLA 1Y1WK 3HOYK 1I3QK 4Y52K 5IOSA 2YU9C 4BY7K 1TWFA 3AH5A 4A3MK 1TWGC 1K83K 4KMAA 4C45A 1WIHA 5L46A 3GTKC 5IYDK 2WAQD 3QX3A 4BXXK 3AD8C 5HL8A 2E2IK 3AD7C 1HQMA 3MMLB 1EK8A 4LK0A 3HOVC 2GAGC 2JA6A 4YFNA 4GTEA 1G51A 4KATA 3GTLK 2GAHC 4Q5SA 3S2DC 3S1QC 4FM9A 3S1NC 4A3CC 5EGEA 2JA7A 2PA8L 3L4JA 4KAWX 5EGHA 1R9TC 3S15K 2WB1D 4A3BK 2R92A 4A3GC 4A3KC 3FKIA 1DCPA 4GTAA 4AYBL 4XLPA 3CQZA 3GTOA 1TWAC 5IOTA 3FOFA 2JH3A 3HOXC 1GE9A 2NVXC 2O5IA 2V6UA 3ADAC 3FHZA 2E2HK 1JVIA 5IYCC 4M1XA 1Y1VA 3HOUC 4G0WA 3S2HK 2XCRB 1J98A 1USOA 2Y0SD 4WJ4A 4C3JC 1SMYA 1F7UA 3S1MK 5TJ3A 1VRQC 1ZYRA 3G4AA 4A3GK 3T02A 5M5XK 5FLMC 1XZQB 4LK1A 2V6TA 1XZPB 3RZOC 4KB2A 3N0BA 3I4MC 3GTMA 4X6AK 2RH6A 3TFHA 1O2FB 1SFOA 3T00A 1JQWA 3GTQC 1Y1WC 3HOXK 2A6HA 1I3QC 3AQPA 3G4CA 4Y52C 3PO2C 3N3YA 3S14C 4BY7C 2XCQA 1PJ6A 1WSRA 4A3MC 4KN7A 1XZQA 1K83C 4AH6A 1XZPA 5M3MK 5IYDC 2P8TA 3TFIA 5C3EK 3N0CA 4KN4A 4BKWA 3TTGA 1EI6A 2NVYA 3AQOA 4GFQA 2JA5K 3GTLC 4WJ3M 1I50A 3GTGC 1B4AA 3HXAA 5M3FK 1VJEA 2R7ZC 5FLMK 3S15C 2R92K 4KASA 2PA8D 3H0GA 4FZBA 4A3BC 3FKIK 3LAPA 2A6EA 4BLAA 5CJ9A 3CQZK 3SZYA 3GTOK 4AYBD 3BP8C 2B63C 4A3LC 3SZZA 4BBRC 3PO2K 3S14K 1YNNA 4A3EK 3RZDK 1ZVUA 1O2BA 2E2HC 5TMCA 3GDZA 1O26A 1F7VA 3S17K 3GSIA 1Y1VK 3GTPA 3T01A 4LOWA 3HOWC 1YNJA 3S2HC 5IP9K 4PAAA 3GTGK 5JVOA 2NVXA 5C4XK 4PABA 2R7ZK 4P5BA 3S1MC 1XXAA 4ZH4A 2CW0A 1EFWA 1IW7A 4KARA 1ZXOA 4XSXA 3FOEA 1O29A 1F93A 1AB4A 3HKZD 5TMFA 2PPBA 1WOSA 4X6AC 2B63K 4OIPA 1X31C 3JSTA 4A3LK 1C0AA 3AD9C 4O2DA 4BBRK 3GTJA 1WCMC 4GTCA 3VA7A 3M3YK 4OIRA 1TWFC 4XSZA 4OINA 3HOZC 4QJVA 1YCLA 2VUMA 3HOWK 5C3EC 1J6XA 2NVTK 2NVYK 2JA6C 4GTBA 3OPFA 2JA5C 3BP3A 1I50K 4MEYA 4KMUA 4GTDA 4GTFA 2NVQK 1RU0A 1VLOA 2WAQL 4ILDA 3OEPA 4C3HK 2JA7C 3M4OK 5IORA 4A3IK 3H0GK 2R92C 2E2IA 1TWHA 3FKIC 2W7VA 3K7AC 3I4NK 3TFJA 5M5WK 2FQTA 1WCMK 3CQZC 3GTOC 2E2JC 3PO3K 4NOIA 1BJTA 1BS2A 3OREA 4JK1A 5FJ8K 1ISEA 1TWFK 1TWCA 1WQGA 4A3EC 3RZDC 2R93A 4KMDA 3HOZK 1IL2A 4A3FC 2PMZL 3LAJA 3S17C 4G0UA 1Y1VC 3S1RC 5C44C 3GTPK 1JOEA 4P9SA 2JA6K 4YFKA 5IOQA 5IP9C 4A93K 2YU9A 2BE5A 2ZFZA 1J6WA 1DCHA 1TWGA 2JA7K 5C4XC 3GTKA 3S16K 3K7AK 1ZBSA 4BLBA 3A8IA 2CFAA 4KB4A 3V4GA 3GTMC 1VGXA 1WOOA 2E2JK 1SFOC 2JA8K 1B4BA 2P5MA 4C3IC 1O24A 4Q4ZA 1R9TA 1UV7A 3M3YC 3Q3QA 3BUEA 1O2AA 4KM9A 4A3FK 4QIWL 3S1RK 4OIOA 5C44K 1IS1A 5C4JK 5E68A 3H3VL 1IBAA 2VUMK 4C2MK 1TWAA 1EH1A 2EBBA 1DD5A 1WQFA 1WSVA 2NVTC 2GSNA 4BY1K 2NVYC 1VH2A 4G7OA 4A3DK 1I50C 2ZUFA 3GTQK 2NVQC 1INNA 2ZUEA 3M4OC 4MEXA 4C3HC 2D6FC 4A3JC 4OIQA 4BBSC 4A3IC 1I6HK 4QJVB 3L4KA 1O28A 3H0GC 1O25A 3GEIA 1TWHK 4DDQA 2XCOA 3GTMK 2A68A 1PJ7A 5IYBK 1SFOK 3I4NC 2JA5A 4KM8A 4KMHA 4C3IK 2PHCB 4Y7NC 3PO3C 4LJZA 1L0WA 1PJ5A 4GT9A 1TWCK 4LLGA 2R93K 1J6VA 3NUHA 5CHPA 5D4DA 3GTPC 5JFEA 2PMZD 4YG2A 1F9NA 3GTQA 4J3NA 3ERED 1Y1WA 1WORA 1I3QA 2YU9K 1KQ4A 4A93C 1TWGK 5IP7C 1K83A 3GTKK 2A69A 4A3JK 3LPXA 4BBSK 3HOVK 3S16C 2RGRA 1WQHA 3GTLA 3S2DK 3S1QK 3GTGA 1XPPA 4Y7NK 2JA8C 3S1NK 4A3CK 4RMFA 4WILA 3GTJC 1DCOA 2R7ZA 2WB1L 1HI9A 4LR2A 1XXBA 4G7ZA 1R9TK 4G0VA 4XCHA 1IE0A 1EQRA 2V6SA 4A3KK 2O5JA 1V5VA 2KWAA 1WOPA 3HKZL 5C4JC 4QIWD 1BGWA 4P5AA 2VUMC 1TWAK 2B63A 2CFAB 3CAGA 4C2MC 3H3VD 4GTLA 4YFXA 4XLNA 1USMA 2GSUA 4G7HA 4BY1C 3HOYC 2NVXK 5IP7K 4A3DC 2E2HA 1IQ0A 5IYCK 2Y3PA 3HOUK 1I6VA 4BXXC 1I6HC 3IPJA 2Y0SL 3GEEA 2E2IC 4KC6A 1TWHC 1ZQ1C 3S0XA 4C3JK 5IYBC 3GTJK 4GZYA 3A8KA 1O27A 4MQ9A 1TWCC 1XXCA 4LQYA 2R93C 1BDFA 3RZOK 2FQOA 3I4MK 3GEHA 3WODA 1YX2A 3GIRA 2GSOA 3A8JA 5M5YK 3DXJA 4KDDA
chains in the Genus database with same CATH topology
3EQLA 4LJZA 1Y1WK 2JA7C 5C3EK 4A3IK 3M4OK 3HOYK 1TWCK 4KN4A 1I3QK 3H0GK 4Y52K 2R92C 2YU9C 4BY7K 4LLGA 2R93K 3FKIC 3GTLC 2JA5K 3K7AC 4A3MK 3I4NK 1TWGC 1K83K 3GTGC 5M5WK 1WCMK 5D4DA 3GTPC 3GTKC 3CQZC 3GTOC 5IYDK 2PMZD 5M3FK 4YG2A 2E2JC 2WAQD 4NOIA 2R7ZC 3PO3K 4BXXK 5FLMK 2E2IK 4C3HK 4JK1A 1HQMA 5FJ8K 3S15C 1TWFK 4LK0A 3HOVC 2R92K 2PA8D 2YU9K 4A3BC 4A93C 4YFNA 3FKIK 4A3EC 3RZDC 3GTLK 4Q5SA 3HOZK 3S2DC 1TWGK 3S1QC 4A3FC 2PMZL 2A6EA 5IP7C 3S17C 3GTPK 1Y1VC 3S1RC 2A69A 3CQZK 5C44C 4AYBD 4A3JK 3GTOK 3GTKK 3S1NC 4A3CC 2B63C 4BBSK 4A3LC 2PA8L 4BBRC 1R9TC 3PO2K 2JA6K 3S15K 3S14K 3HOVK 4YFKA 5IP9C 3S16C 1YNNA 2WB1D 4A3BK 4A93K 4A3EK 3RZDK 2BE5A 4A3GC 4A3KC 2E2HC 3S2DK 5TMCA 3S1QK 4AYBL 3S17K 1XPPA 4Y7NK 2JA7K 5C4XC 1Y1VK 2JA8C 4XLPA 3S1NK 4A3CK 3GTJC 1TWAC 2WB1L 1R9TK 4G7ZA 3HOWC 1YNJA 3S2HC 5IP9K 3S16K 3HOXC 3K7AK 2O5JA 4A3KK 2NVXC 2O5IA 3GTGK 2E2HK 3HKZL 3GTMC 5C4JC 5C4XK 4QIWD 5IYCC 2E2JK 1SFOC 2JA8K 2R7ZK 3HOUC 2VUMC 3S1MC 1TWAK 3H3VD 4YFXA 4XLNA 3S2HK 4Q4ZA 4ZH4A 2CW0A 3M3YC 1IW7A 4G7HA 4BY1C 4XSXA 2NVXK 3HOYC 4A3FK 2Y0SD 4QIWL 5IP7K 4A3DC 3S1RK 4OIOA 5C44K 1SMYA 3HKZD 5TMFA 5IYCK 5C4JK 2PPBA 2B63K 4X6AC 3H3VL 4OIPA 3HOUK 4A3LK 2VUMK 3S1MK 1I6VA 4BBRK 1WCMC 4C2MK 1ZYRA 3M3YK 4OIRA 4BXXC 4A3GK 2NVTC 5M5XK 2Y0SL 5FLMC 2E2IC 1I6HC 4LK1A 4BY1K 2NVYC 4G7OA 1TWHC 1TWFC 4XSZA 4OINA 4A3DK 3RZOC 1I50C 4C3JK 5IYBC 3I4MC 3HOZC 4X6AK 3GTJK 4QJVA 3GTQK 4GZYA 2NVQC 4MQ9A 4MEXA 3GTQC 3HOWK 4A3JC 3M4OC 4OIQA 1Y1WC 3HOXK 4BBSC 5C3EC 4A3IC 1I6HK 2NVTK 4QJVB 1TWCC 2A6HA 1I3QC 3H0GC 4Y52C 3PO2C 2NVYK 2JA6C 1TWHK 3S14C 4BY7C 2R93C 1BDFA 3GTMK 2JA5C 2A68A 4MEYA 1I50K 3RZOK 4A3MC 5IYBK 1SFOK 4KMUA 3I4MK 4KN7A 3WODA 3I4NC 1K83C 2NVQK 4C3IK 5M3MK 5IYDC 2WAQL 4Y7NC 5M5YK 3DXJA 3PO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQL A;  4LJZ A;  1Y1W K;  2JA7 C;  5C3E K;  4A3I K;  3M4O K;  3HOY K;  1TWC K;  4KN4 A;  1I3Q K;  3H0G K;  4Y52 K;  2R92 C;  2YU9 C;  4BY7 K;  4LLG A;  2R93 K;  3FKI C;  3GTL C;  2JA5 K;  3K7A C;  4A3M K;  3I4N K;  1TWG C;  1K83 K;  3GTG C;  5M5W K;  1WCM K;  5D4D A;  3GTP C;  3GTK C;  3CQZ C;  3GTO C;  5IYD K;  2PMZ D;  5M3F K;  4YG2 A;  2E2J C;  2WAQ D;  4NOI A;  2R7Z C;  3PO3 K;  4BXX K;  5FLM K;  2E2I K;  4C3H K;  4JK1 A;  1HQM A;  5FJ8 K;  3S15 C;  1TWF K;  4LK0 A;  3HOV C;  2R92 K;  2PA8 D;  2YU9 K;  4A3B C;  4A93 C;  4YFN A;  3FKI K;  4A3E C;  3RZD C;  3GTL K;  4Q5S A;  3HOZ K;  3S2D C;  1TWG K;  3S1Q C;  4A3F C;  2PMZ L;  2A6E A;  5IP7 C;  3S17 C;  3GTP K;  1Y1V C;  3S1R C;  2A69 A;  3CQZ K;  5C44 C;  4AYB D;  4A3J K;  3GTO K;  3GTK K;  3S1N C;  4A3C C;  2B63 C;  4BBS K;  4A3L C;  2PA8 L;  4BBR C;  1R9T C;  3PO2 K;  2JA6 K;  3S15 K;  3S14 K;  3HOV K;  4YFK A;  5IP9 C;  3S16 C;  1YNN A;  2WB1 D;  4A3B K;  4A93 K;  4A3E K;  3RZD K;  2BE5 A;  4A3G C;  4A3K C;  2E2H C;  3S2D K;  5TMC A;  3S1Q K;  4AYB L;  3S17 K;  1XPP A;  4Y7N K;  2JA7 K;  5C4X C;  1Y1V K;  2JA8 C;  4XLP A;  3S1N K;  4A3C K;  3GTJ C;  1TWA C;  2WB1 L;  1R9T K;  4G7Z A;  3HOW C;  1YNJ A;  3S2H C;  5IP9 K;  3S16 K;  3HOX C;  3K7A K;  2O5J A;  4A3K K;  2NVX C;  2O5I A;  3GTG K;  2E2H K;  3HKZ L;  3GTM C;  5C4J C;  5C4X K;  4QIW D;  5IYC C;  2E2J K;  1SFO C;  2JA8 K;  2R7Z K;  3HOU C;  2VUM C;  3S1M C;  1TWA K;  3H3V D;  4YFX A;  4XLN A;  3S2H K;  4Q4Z A;  4ZH4 A;  2CW0 A;  3M3Y C;  1IW7 A;  4G7H A;  4BY1 C;  4XSX A;  2NVX K;  3HOY C;  4A3F K;  2Y0S D;  4QIW L;  5IP7 K;  4A3D C;  3S1R K;  4OIO A;  5C44 K;  1SMY A;  3HKZ D;  5TMF A;  5IYC K;  5C4J K;  2PPB A;  2B63 K;  4X6A C;  3H3V L;  4OIP A;  3HOU K;  4A3L K;  2VUM K;  3S1M K;  1I6V A;  4BBR K;  1WCM C;  4C2M K;  1ZYR A;  3M3Y K;  4OIR A;  4BXX C;  4A3G K;  2NVT C;  5M5X K;  2Y0S L;  5FLM C;  2E2I C;  1I6H C;  4LK1 A;  4BY1 K;  2NVY C;  4G7O A;  1TWH C;  1TWF C;  4XSZ A;  4OIN A;  4A3D K;  3RZO C;  1I50 C;  4C3J K;  5IYB C;  3I4M C;  3HOZ C;  4X6A K;  3GTJ K;  4QJV A;  3GTQ K;  4GZY A;  2NVQ C;  4MQ9 A;  4MEX A;  3GTQ C;  3HOW K;  4A3J C;  3M4O C;  4OIQ A;  1Y1W C;  3HOX K;  4BBS C;  5C3E C;  4A3I C;  1I6H K;  2NVT K;  4QJV B;  1TWC C;  2A6H A;  1I3Q C;  3H0G C;  4Y52 C;  3PO2 C;  2NVY K;  2JA6 C;  1TWH K;  3S14 C;  4BY7 C;  2R93 C;  1BDF A;  3GTM K;  2JA5 C;  2A68 A;  4MEY A;  1I50 K;  3RZO K;  4A3M C;  5IYB K;  1SFO K;  4KMU A;  3I4M K;  4KN7 A;  3WOD A;  3I4N C;  1K83 C;  2NVQ K;  4C3I K;  5M3M K;  5IYD C;  2WAQ L;  4Y7N C;  5M5Y K;  3DXJ A;  3PO3 C; 
#chains in the Genus database with same CATH topology
 1WCM A;  3EQL A;  1Y1W K;  3HOY K;  1I3Q K;  4Y52 K;  5IOS A;  2YU9 C;  4BY7 K;  1TWF A;  3AH5 A;  4A3M K;  1TWG C;  1K83 K;  4KMA A;  4C45 A;  1WIH A;  5L46 A;  3GTK C;  5IYD K;  2WAQ D;  3QX3 A;  4BXX K;  3AD8 C;  5HL8 A;  2E2I K;  3AD7 C;  1HQM A;  3MML B;  1EK8 A;  4LK0 A;  3HOV C;  2GAG C;  2JA6 A;  4YFN A;  4GTE A;  1G51 A;  4KAT A;  3GTL K;  2GAH C;  4Q5S A;  3S2D C;  3S1Q C;  4FM9 A;  3S1N C;  4A3C C;  5EGE A;  2JA7 A;  2PA8 L;  3L4J A;  4KAW X;  5EGH A;  1R9T C;  3S15 K;  2WB1 D;  4A3B K;  2R92 A;  4A3G C;  4A3K C;  3FKI A;  1DCP A;  4GTA A;  4AYB L;  4XLP A;  3CQZ A;  3GTO A;  1TWA C;  5IOT A;  3FOF A;  2JH3 A;  3HOX C;  1GE9 A;  2NVX C;  2O5I A;  2V6U A;  3ADA C;  3FHZ A;  2E2H K;  1JVI A;  5IYC C;  4M1X A;  1Y1V A;  3HOU C;  4G0W A;  3S2H K;  2XCR B;  1J98 A;  1USO A;  2Y0S D;  4WJ4 A;  4C3J C;  1SMY A;  1F7U A;  3S1M K;  5TJ3 A;  1VRQ C;  1ZYR A;  3G4A A;  4A3G K;  3T02 A;  5M5X K;  5FLM C;  1XZQ B;  4LK1 A;  2V6T A;  1XZP B;  3RZO C;  4KB2 A;  3N0B A;  3I4M C;  3GTM A;  4X6A K;  2RH6 A;  3TFH A;  1O2F B;  1SFO A;  3T00 A;  1JQW A;  3GTQ C;  1Y1W C;  3HOX K;  2A6H A;  1I3Q C;  3AQP A;  3G4C A;  4Y52 C;  3PO2 C;  3N3Y A;  3S14 C;  4BY7 C;  2XCQ A;  1PJ6 A;  1WSR A;  4A3M C;  4KN7 A;  1XZQ A;  1K83 C;  4AH6 A;  1XZP A;  5M3M K;  5IYD C;  2P8T A;  3TFI A;  5C3E K;  3N0C A;  4KN4 A;  4BKW A;  3TTG A;  1EI6 A;  2NVY A;  3AQO A;  4GFQ A;  2JA5 K;  3GTL C;  4WJ3 M;  1I50 A;  3GTG C;  1B4A A;  3HXA A;  5M3F K;  1VJE A;  2R7Z C;  5FLM K;  3S15 C;  2R92 K;  4KAS A;  2PA8 D;  3H0G A;  4FZB A;  4A3B C;  3FKI K;  3LAP A;  2A6E A;  4BLA A;  5CJ9 A;  3CQZ K;  3SZY A;  3GTO K;  4AYB D;  3BP8 C;  2B63 C;  4A3L C;  3SZZ A;  4BBR C;  3PO2 K;  3S14 K;  1YNN A;  4A3E K;  3RZD K;  1ZVU A;  1O2B A;  2E2H C;  5TMC A;  3GDZ A;  1O26 A;  1F7V A;  3S17 K;  3GSI A;  1Y1V K;  3GTP A;  3T01 A;  4LOW A;  3HOW C;  1YNJ A;  3S2H C;  5IP9 K;  4PAA A;  3GTG K;  5JVO A;  2NVX A;  5C4X K;  4PAB A;  2R7Z K;  4P5B A;  3S1M C;  1XXA A;  4ZH4 A;  2CW0 A;  1EFW A;  1IW7 A;  4KAR A;  1ZXO A;  4XSX A;  3FOE A;  1O29 A;  1F93 A;  1AB4 A;  3HKZ D;  5TMF A;  2PPB A;  1WOS A;  4X6A C;  2B63 K;  4OIP A;  1X31 C;  3JST A;  4A3L K;  1C0A A;  3AD9 C;  4O2D A;  4BBR K;  3GTJ A;  1WCM C;  4GTC A;  3VA7 A;  3M3Y K;  4OIR A;  1TWF C;  4XSZ A;  4OIN A;  3HOZ C;  4QJV A;  1YCL A;  2VUM A;  3HOW K;  5C3E C;  1J6X A;  2NVT K;  2NVY K;  2JA6 C;  4GTB A;  3OPF A;  2JA5 C;  3BP3 A;  1I50 K;  4MEY A;  4KMU A;  4GTD A;  4GTF A;  2NVQ K;  1RU0 A;  1VLO A;  2WAQ L;  4ILD A;  3OEP A;  4C3H K;  2JA7 C;  3M4O K;  5IOR A;  4A3I K;  3H0G K;  2R92 C;  2E2I A;  1TWH A;  3FKI C;  2W7V A;  3K7A C;  3I4N K;  3TFJ A;  5M5W K;  2FQT A;  1WCM K;  3CQZ C;  3GTO C;  2E2J C;  3PO3 K;  4NOI A;  1BJT A;  1BS2 A;  3ORE A;  4JK1 A;  5FJ8 K;  1ISE A;  1TWF K;  1TWC A;  1WQG A;  4A3E C;  3RZD C;  2R93 A;  4KMD A;  3HOZ K;  1IL2 A;  4A3F C;  2PMZ L;  3LAJ A;  3S17 C;  4G0U A;  1Y1V C;  3S1R C;  5C44 C;  3GTP K;  1JOE A;  4P9S A;  2JA6 K;  4YFK A;  5IOQ A;  5IP9 C;  4A93 K;  2YU9 A;  2BE5 A;  2ZFZ A;  1J6W A;  1DCH A;  1TWG A;  2JA7 K;  5C4X C;  3GTK A;  3S16 K;  3K7A K;  1ZBS A;  4BLB A;  3A8I A;  2CFA A;  4KB4 A;  3V4G A;  3GTM C;  1VGX A;  1WOO A;  2E2J K;  1SFO C;  2JA8 K;  1B4B A;  2P5M A;  4C3I C;  1O24 A;  4Q4Z A;  1R9T A;  1UV7 A;  3M3Y C;  3Q3Q A;  3BUE A;  1O2A A;  4KM9 A;  4A3F K;  4QIW L;  3S1R K;  4OIO A;  5C44 K;  1IS1 A;  5C4J K;  5E68 A;  3H3V L;  1IBA A;  2VUM K;  4C2M K;  1TWA A;  1EH1 A;  2EBB A;  1DD5 A;  1WQF A;  1WSV A;  2NVT C;  2GSN A;  4BY1 K;  2NVY C;  1VH2 A;  4G7O A;  4A3D K;  1I50 C;  2ZUF A;  3GTQ K;  2NVQ C;  1INN A;  2ZUE A;  3M4O C;  4MEX A;  4C3H C;  2D6F C;  4A3J C;  4OIQ A;  4BBS C;  4A3I C;  1I6H K;  4QJV B;  3L4K A;  1O28 A;  3H0G C;  1O25 A;  3GEI A;  1TWH K;  4DDQ A;  2XCO A;  3GTM K;  2A68 A;  1PJ7 A;  5IYB K;  1SFO K;  3I4N C;  2JA5 A;  4KM8 A;  4KMH A;  4C3I K;  2PHC B;  4Y7N C;  3PO3 C;  4LJZ A;  1L0W A;  1PJ5 A;  4GT9 A;  1TWC K;  4LLG A;  2R93 K;  1J6V A;  3NUH A;  5CHP A;  5D4D A;  3GTP C;  5JFE A;  2PMZ D;  4YG2 A;  1F9N A;  3GTQ A;  4J3N A;  3ERE D;  1Y1W A;  1WOR A;  1I3Q A;  2YU9 K;  1KQ4 A;  4A93 C;  1TWG K;  5IP7 C;  1K83 A;  3GTK K;  2A69 A;  4A3J K;  3LPX A;  4BBS K;  3HOV K;  3S16 C;  2RGR A;  1WQH A;  3GTL A;  3S2D K;  3S1Q K;  3GTG A;  1XPP A;  4Y7N K;  2JA8 C;  3S1N K;  4A3C K;  4RMF A;  4WIL A;  3GTJ C;  1DCO A;  2R7Z A;  2WB1 L;  1HI9 A;  4LR2 A;  1XXB A;  4G7Z A;  1R9T K;  4G0V A;  4XCH A;  1IE0 A;  1EQR A;  2V6S A;  4A3K K;  2O5J A;  1V5V A;  2KWA A;  1WOP A;  3HKZ L;  5C4J C;  4QIW D;  1BGW A;  4P5A A;  2VUM C;  1TWA K;  2B63 A;  2CFA B;  3CAG A;  4C2M C;  3H3V D;  4GTL A;  4YFX A;  4XLN A;  1USM A;  2GSU A;  4G7H A;  4BY1 C;  3HOY C;  2NVX K;  5IP7 K;  4A3D C;  2E2H A;  1IQ0 A;  5IYC K;  2Y3P A;  3HOU K;  1I6V A;  4BXX C;  1I6H C;  3IPJ A;  2Y0S L;  3GEE A;  2E2I C;  4KC6 A;  1TWH C;  1ZQ1 C;  3S0X A;  4C3J K;  5IYB C;  3GTJ K;  4GZY A;  3A8K A;  1O27 A;  4MQ9 A;  1TWC C;  1XXC A;  4LQY A;  2R93 C;  1BDF A;  3RZO K;  2FQO A;  3I4M K;  3GEH A;  3WOD A;  1YX2 A;  3GIR A;  2GSO A;  3A8J A;  5M5Y K;  3DXJ A;  4KDD A; 
#chains in the Genus database with same CATH homology
 3EQL A;  4LJZ A;  1Y1W K;  2JA7 C;  5C3E K;  4A3I K;  3M4O K;  3HOY K;  1TWC K;  4KN4 A;  1I3Q K;  3H0G K;  4Y52 K;  2R92 C;  2YU9 C;  4BY7 K;  4LLG A;  2R93 K;  3FKI C;  3GTL C;  2JA5 K;  3K7A C;  4A3M K;  3I4N K;  1TWG C;  1K83 K;  3GTG C;  5M5W K;  1WCM K;  5D4D A;  3GTP C;  3GTK C;  3CQZ C;  3GTO C;  5IYD K;  2PMZ D;  5M3F K;  4YG2 A;  2E2J C;  2WAQ D;  4NOI A;  2R7Z C;  3PO3 K;  4BXX K;  5FLM K;  2E2I K;  4C3H K;  4JK1 A;  1HQM A;  5FJ8 K;  3S15 C;  1TWF K;  4LK0 A;  3HOV C;  2R92 K;  2PA8 D;  2YU9 K;  4A3B C;  4A93 C;  4YFN A;  3FKI K;  4A3E C;  3RZD C;  3GTL K;  4Q5S A;  3HOZ K;  3S2D C;  1TWG K;  3S1Q C;  4A3F C;  2PMZ L;  2A6E A;  5IP7 C;  3S17 C;  3GTP K;  1Y1V C;  3S1R C;  2A69 A;  3CQZ K;  5C44 C;  4AYB D;  4A3J K;  3GTO K;  3GTK K;  3S1N C;  4A3C C;  2B63 C;  4BBS K;  4A3L C;  2PA8 L;  4BBR C;  1R9T C;  3PO2 K;  2JA6 K;  3S15 K;  3S14 K;  3HOV K;  4YFK A;  5IP9 C;  3S16 C;  1YNN A;  2WB1 D;  4A3B K;  4A93 K;  4A3E K;  3RZD K;  2BE5 A;  4A3G C;  4A3K C;  2E2H C;  3S2D K;  5TMC A;  3S1Q K;  4AYB L;  3S17 K;  1XPP A;  4Y7N K;  2JA7 K;  5C4X C;  1Y1V K;  2JA8 C;  4XLP A;  3S1N K;  4A3C K;  3GTJ C;  1TWA C;  2WB1 L;  1R9T K;  4G7Z A;  3HOW C;  1YNJ A;  3S2H C;  5IP9 K;  3S16 K;  3HOX C;  3K7A K;  2O5J A;  4A3K K;  2NVX C;  2O5I A;  3GTG K;  2E2H K;  3HKZ L;  3GTM C;  5C4J C;  5C4X K;  4QIW D;  5IYC C;  2E2J K;  1SFO C;  2JA8 K;  2R7Z K;  3HOU C;  2VUM C;  3S1M C;  1TWA K;  3H3V D;  4YFX A;  4XLN A;  3S2H K;  4Q4Z A;  4ZH4 A;  2CW0 A;  3M3Y C;  1IW7 A;  4G7H A;  4BY1 C;  4XSX A;  2NVX K;  3HOY C;  4A3F K;  2Y0S D;  4QIW L;  5IP7 K;  4A3D C;  3S1R K;  4OIO A;  5C44 K;  1SMY A;  3HKZ D;  5TMF A;  5IYC K;  5C4J K;  2PPB A;  2B63 K;  4X6A C;  3H3V L;  4OIP A;  3HOU K;  4A3L K;  2VUM K;  3S1M K;  1I6V A;  4BBR K;  1WCM C;  4C2M K;  1ZYR A;  3M3Y K;  4OIR A;  4BXX C;  4A3G K;  2NVT C;  5M5X K;  2Y0S L;  5FLM C;  2E2I C;  1I6H C;  4LK1 A;  4BY1 K;  2NVY C;  4G7O A;  1TWH C;  1TWF C;  4XSZ A;  4OIN A;  4A3D K;  3RZO C;  1I50 C;  4C3J K;  5IYB C;  3I4M C;  3HOZ C;  4X6A K;  3GTJ K;  4QJV A;  3GTQ K;  4GZY A;  2NVQ C;  4MQ9 A;  4MEX A;  3GTQ C;  3HOW K;  4A3J C;  3M4O C;  4OIQ A;  1Y1W C;  3HOX K;  4BBS C;  5C3E C;  4A3I C;  1I6H K;  2NVT K;  4QJV B;  1TWC C;  2A6H A;  1I3Q C;  3H0G C;  4Y52 C;  3PO2 C;  2NVY K;  2JA6 C;  1TWH K;  3S14 C;  4BY7 C;  2R93 C;  1BDF A;  3GTM K;  2JA5 C;  2A68 A;  4MEY A;  1I50 K;  3RZO K;  4A3M C;  5IYB K;  1SFO K;  4KMU A;  3I4M K;  4KN7 A;  3WOD A;  3I4N C;  1K83 C;  2NVQ K;  4C3I K;  5M3M K;  5IYD C;  2WAQ L;  4Y7N C;  5M5Y K;  3DXJ A;  3PO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...