2PA8L

X-ray crystal structure of the d/l subcomplex of the sulfolobus solfataricus rna polymerase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
b'MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit D
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 26
structure length 92
sequence length 92
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pa8L00
3K7AC 1R9TC 4A3CK 2NVXC 3S14C 3HOWK 4KN4A 1I6VA 2JA7C 5IYBK 2A68A 5C44C 3S1QK 4A3GC 5IP7C 3CQZK 4NOIA 4ZH4A 4QIWL 3WODA 4OIRA 3PO2K 4BXXK 3H3VL 4MEXA 3S1MK 1TWAK 3FKIK 1TWGC 3HOYK 3M4OC 2NVQK 3GTOC 4MEYA 4QJVB 3DXJA 1XPPA 5IP9C 4BY1C 1I3QK 4A3FK 4BBRC 3GTPK 3S2HK 3I4NK 1SFOC 3GTLC 4G7ZA 4LLGA 4A3MK 2B63C 2A6HA 4Q5SA 1TWFK 1I6HC 5C4XC 3S16C 3S1NK 1WCMK 5C4JC 4A3IC 4A3EK 4C3IK 4A3CC 3GTMK 4KMUA 2PA8L 3HOWC 2E2HK 1SMYA 5IYBC 3S1QC 3HOVK 2WB1D 3CQZC 3HOZK 3HKZD 3EQLA 1Y1WK 4BXXC 2BE5A 3PO2C 4A93K 2O5JA 2WAQD 2R93K 4Y52K 3I4MK 3S1MC 1TWAC 3FKIC 3HOYC 4G7HA 4LK0A 2NVQC 4A3DK 4YFNA 2JA5K 1I3QC 4MQ9A 4JK1A 4Y7NK 4A3FC 1HQMA 4C3HK 3GTPC 3S2HC 3I4NC 1TWCK 3S2DK 2YU9K 4A3MC 2PMZL 1Y1VK 2Y0SD 1I50K 5FLMK 3S1NC 1WCMC 2E2IK 2R7ZK 5IYCK 4YG2A 3S15K 3GTKK 1TWHK 5M3MK 3GTMC 2E2HC 4AYBD 3H0GK 1K83K 2NVTK 3RZDK 5IYDK 3PO3K 2NVYK 3S1RK 3HOVC 3HOZC 1Y1WC 3HKZL 2R92K 4A93C 5M5WK 2R93C 2E2JK 4XLNA 4C3JK 3GTGK 3HOXK 4A3JK 4BY7K 4A3DC 5M5YK 4XSXA 2VUMK 3H3VD 4Y7NC 4YFKA 3S2DC 1TWCC 1YNNA 2YU9C 3GTJK 3GTQK 1IW7A 1Y1VC 4BY1K 4BBSK 2Y0SL 3HOUK 4YFXA 1I50C 4BBRK 5FLMC 2E2IC 2R7ZC 5IYCC 4A3BK 3S15C 3GTKC 1TWFC 1TWHC 1YNJA 5C3EK 2NVTC 1K83C 3H0GC 4X6AK 2JA8K 4A3EC 3RZDC 2O5IA 5IYDC 4A3KK 3RZOK 4Q4ZA 3PO3C 2NVYC 3M3YK 3S1RC 1BDFA 2PPBA 3S17K 2PA8D 4A3LK 1ZYRA 2R92C 2JA6K 4C2MK 3K7AK 1R9TK 2E2JC 3GTGC 2NVXK 2WB1L 3HOXC 4A3JC 3S14K 4BY7C 2A69A 4G7OA 2JA7K 4KN7A 2WAQL 4Y52C 2VUMC 3I4MC 4QJVA 5C44K 4A3GK 2A6EA 5IP7K 4QIWD 2JA5C 3GTJC 5D4DA 5TMFA 3GTQC 5M5XK 4OIQA 4GZYA 4LK1A 4BBSC 5M3FK 1TWGK 3HOUC 4OIPA 3M4OK 3GTOK 4A3BC 5IP9K 5FJ8K 2PMZD 4XLPA 1SFOK 5C3EC 3GTLK 4X6AC 5TMCA 4XSZA 2JA8C 3RZOC 4A3KC 4OINA 4LJZA 2B63K 3M3YC 3S17C 5C4XK 1I6HK 2CW0A 4OIOA 4AYBL 3S16K 4A3LC 5C4JK 2JA6C 4A3IK
chains in the Genus database with same CATH superfamily
4WILA 3S14C 1F9NA 4A3GC 4NOIA 4QIWL 4OIRA 4WJ4A 3HOYK 4QJVB 5IP9C 4A3FK 4KDDA 3GTLC 5CJ9A 1WIHA 4A3MK 2B63C 2A6HA 4DDQA 1TWFK 3V4GA 4C3IK 3GSIA 3OEPA 4BLBA 3S1QC 1C0AA 1BJTA 3CQZC 3EQLA 5JFEA 4BXXC 2O5JA 4GTLA 2WAQD 3I4MK 3GTMA 3FKIC 4G7HA 4KMHA 2NVQC 4YFNA 2JA5K 4M1XA 4G0WA 1I3QC 4C3HK 3I4NC 2YU9K 2PMZL 1Y1VK 3CQZA 3S1NC 5IYCK 3S15K 1XXCA 2E2HC 1K83K 2Y3PA 1I3QA 3HOZC 2R92K 3SZYA 5M5WK 2R93C 2E2JK 3GTGK 4BY7K 1WOOA 1J6XA 1XZQB 4Y7NC 2E2HA 1TWCC 4LR2A 4BKWA 1O26A 1IW7A 1IL2A 3A8KA 4BBSK 3HOUK 4YFXA 5FLMC 2R93A 4J3NA 2VUMA 3GTKC 1J6WA 3GIRA 1KQ4A 5C3EK 3H0GC 2JA8K 2O5IA 2NVYC 1ZBSA 1TWCA 2PPBA 2PA8D 4GTAA 2JA6K 4ILDA 3GTKA 2JA7K 5IOTA 3H0GA 5IP7K 4KARA 3GTQC 2NVYA 1R9TA 3LPXA 1B4AA 4GT9A 1WQFA 1INNA 1JOEA 1GE9A 4A3KC 2GAHC 5EGEA 4KC6A 4OIOA 4A3LC 2GSOA 4KM9A 4C2MC 3A8JA 4A3CK 2CFAA 3TTGA 3LAJA 4KN4A 2A68A 4P9SA 4ZH4A 3PO2K 4MEXA 3VA7A 3S1MK 1TWGC 3MMLB 3M4OC 3GTOC 3L4JA 3GTPK 1WOSA 4Q5SA 1I6HC 1O25A 5C4XC 2RGRA 1WCMK 5C4JC 3Q3QA 1F93A 4A3IC 1J6VA 3GEHA 3GTOA 3HOWC 3ERED 1ZQ1C 4FZBA 5IYBC 1UV7A 3FOEA 4GTEA 3HKZD 1Y1WK 2BE5A 1EFWA 1BGWA 1TWAC 1F7UA 4GTBA 4JK1A 3S2HC 1HQMA 2PHCB 1PJ5A 4KB4A 1I50K 3N3YA 4O2DA 5L46A 2E2IK 5E68A 2R7ZK 1TWAA 1EK8A 3GTMC 3OREA 2XCOA 2YU9A 3GEIA 1XXAA 5IYDK 3PO3K 3HOVC 3HKZL 4A93C 3AD8C 3BP8C 1USOA 1XXBA 3HOXK 5IORA 4A3JK 4LQYA 1WOPA 1K83A 4A3DC 3H3VD 1O27A 4KMDA 3S2DC 1YNNA 4PABA 4P5BA 1XZPA 1EQRA 1G51A 3LAPA 1TWHC 1YNJA 2NVTC 3RZDC 3RZOK 4Q4ZA 3M3YK 5HL8A 3S1RC 4GFQA 4KATA 1L0WA 2W7VA 4C3JC 3S14K 2GSNA 2WAQL 2VUMC 1TWHA 4A3GK 2P8TA 3GTJC 3AH5A 5TMFA 4OIQA 4GZYA 3GEEA 5M3FK 4A3BC 4KASA 2JA7A 5IP9K 5FJ8K 3A8IA 4P5AA 3GTLK 4X6AC 1WQGA 5IOSA 4LJZA 2B63K 3S17C 3GTJA 3K7AC 1R9TC 4WJ3M 2NVXC 1I6VA 2ZFZA 1DD5A 4PAAA 1PJ7A 5C44C 3S1QK 3CQZK 3T01A 4BXXK 1O2AA 3AD7C 3FKIK 3NUHA 5TJ3A 2NVQK 4MEYA 3DXJA 1WSVA 2NVXA 2ZUEA 1I3QK 3I4NK 1SFOC 2V6TA 4LLGA 3S16C 3S1NK 4LOWA 4KMAA 1AB4A 1VRQC 3GTPA 2PA8L 2E2HK 1YCLA 2GAGC 1SFOA 3FOFA 2WB1D 3HOZK 3JSTA 1WCMA 1O28A 2CFAB 1VLOA 2R93K 1O24A 3HOYC 4LK0A 1IQ0A 1VH2A 4MQ9A 4Y7NK 4A3FC 4C45A 1Y1WA 1TWCK 4A3MC 1JQWA 2KWAA 5FLMK 4FM9A 3BP3A 3GTKK 4C3IC 4GTFA 1PJ6A 3H0GK 4AYBD 2D6FC 3T00A 2NVYK 1I50A 1HI9A 1TWFA 4XLNA 3AQPA 5M5YK 4YFKA 4C3HC 1RU0A 2YU9C 3TFJA 3GTQK 1Y1VC 5IYCC 3S15C 5CHPA 4KB2A 3G4CA 1K83C 2JA5A 1ISEA 4A3EC 4A3KK 2XCQA 4RMFA 1BDFA 3OPFA 4A3LK 1ZYRA 2R92C 1Y1VA 4C2MK 2E2JC 3GTGC 4BY7C 1IBAA 2A69A 3GDZA 1ZXOA 4Y52C 1F7VA 1O2FB 4QJVA 2A6EA 4KM8A 5D4DA 5M5XK 3L4KA 4BBSC 3HOUC 1TWGK 2RH6A 1X31C 2R92A 3M4OK 3GTOK 3FHZA 3GTGA 2PMZD 4XLPA 4BLAA 5C3EC 1ZVUA 5TMCA 2JA8C 1XZPB 3TFIA 5C4XK 1I6HK 2CW0A 1EI6A 5C4JK 2JA6C 4A3IK 3CAGA 3GTLA 3HOWK 2JA7C 5IYBK 5IOQA 2B63A 3ADAC 1EH1A 5IP7C 3WODA 2FQOA 3H3VL 1WQHA 1TWAK 1USMA 2JA6A 4BY1C 1XPPA 4AH6A 1WSRA 3S2HK 4BBRC 3IPJA 3TFHA 4G7ZA 2EBBA 4KAWX 3FKIA 1DCOA 2P5MA 2XCRB 4A3EK 4A3CC 4XCHA 3GTMK 4KMUA 1B4BA 1SMYA 1YX2A 1XZQA 2ZUFA 2GSUA 3HOVK 3PO2C 4A93K 2FQTA 4Y52K 3S1MC 3AQOA 4GTDA 3BUEA 4A3DK 2JH3A 3N0CA 1J98A 1VJEA 3GTPC 3S2DK 1WORA 3AD9C 1IE0A 2Y0SD 1WCMC 1DCPA 1IS1A 4YG2A 1TWHK 5M3MK 2NVTK 3RZDK 1DCHA 3S1RK 1Y1WC 3N0BA 4C3JK 4XSXA 2VUMK 4G0UA 2V6SA 3GTJK 3QX3A 4BY1K 2Y0SL 1I50C 1JVIA 4BBRK 2V6UA 2E2IC 2R7ZC 4A3BK 1TWFC 4X6AK 3GTQA 5IYDC 3PO3C 3S17K 5EGHA 1V5VA 3K7AK 1R9TK 3HXAA 2WB1L 3HOXC 4A3JC 2NVXK 3T02A 4G0VA 4G7OA 2R7ZA 2E2IA 4KN7A 3I4MC 5JVOA 5C44K 3S0XA 4QIWD 4GTCA 2JA5C 4LK1A 4OIPA 1VGXA 1SFOK 4XSZA 3RZOC 4OINA 1O2BA 3G4AA 3M3YC 1TWGA 1BS2A 3SZZA 4AYBL 1O29A 3S16K
chains in the Genus database with same CATH topology
3K7AC 1R9TC 4A3CK 2NVXC 3S14C 3HOWK 4KN4A 1I6VA 2JA7C 5IYBK 2A68A 5C44C 3S1QK 4A3GC 5IP7C 3CQZK 4NOIA 4ZH4A 4QIWL 3WODA 4OIRA 3PO2K 4BXXK 3H3VL 4MEXA 3S1MK 1TWAK 3FKIK 1TWGC 3HOYK 3M4OC 2NVQK 3GTOC 4MEYA 4QJVB 3DXJA 1XPPA 5IP9C 4BY1C 1I3QK 4A3FK 4BBRC 3GTPK 3S2HK 3I4NK 1SFOC 3GTLC 4G7ZA 4LLGA 4A3MK 2B63C 2A6HA 4Q5SA 1TWFK 1I6HC 5C4XC 3S16C 3S1NK 1WCMK 5C4JC 4A3IC 4A3EK 4C3IK 4A3CC 3GTMK 4KMUA 2PA8L 3HOWC 2E2HK 1SMYA 5IYBC 3S1QC 3HOVK 2WB1D 3CQZC 3HOZK 3HKZD 3EQLA 1Y1WK 4BXXC 2BE5A 3PO2C 4A93K 2O5JA 2WAQD 2R93K 4Y52K 3I4MK 3S1MC 1TWAC 3FKIC 3HOYC 4G7HA 4LK0A 2NVQC 4A3DK 4YFNA 2JA5K 1I3QC 4MQ9A 4JK1A 4Y7NK 4A3FC 1HQMA 4C3HK 3GTPC 3S2HC 3I4NC 1TWCK 3S2DK 2YU9K 4A3MC 2PMZL 1Y1VK 2Y0SD 1I50K 5FLMK 3S1NC 1WCMC 2E2IK 2R7ZK 5IYCK 4YG2A 3S15K 3GTKK 1TWHK 5M3MK 3GTMC 2E2HC 4AYBD 3H0GK 1K83K 2NVTK 3RZDK 5IYDK 3PO3K 2NVYK 3S1RK 3HOVC 3HOZC 1Y1WC 3HKZL 2R92K 4A93C 5M5WK 2R93C 2E2JK 4XLNA 4C3JK 3GTGK 3HOXK 4A3JK 4BY7K 4A3DC 5M5YK 4XSXA 2VUMK 3H3VD 4Y7NC 4YFKA 3S2DC 1TWCC 1YNNA 2YU9C 3GTJK 3GTQK 1IW7A 1Y1VC 4BY1K 4BBSK 2Y0SL 3HOUK 4YFXA 1I50C 4BBRK 5FLMC 2E2IC 2R7ZC 5IYCC 4A3BK 3S15C 3GTKC 1TWFC 1TWHC 1YNJA 5C3EK 2NVTC 1K83C 3H0GC 4X6AK 2JA8K 4A3EC 3RZDC 2O5IA 5IYDC 4A3KK 3RZOK 4Q4ZA 3PO3C 2NVYC 3M3YK 3S1RC 1BDFA 2PPBA 3S17K 2PA8D 4A3LK 1ZYRA 2R92C 2JA6K 4C2MK 3K7AK 1R9TK 2E2JC 3GTGC 2NVXK 2WB1L 3HOXC 4A3JC 3S14K 4BY7C 2A69A 4G7OA 2JA7K 4KN7A 2WAQL 4Y52C 2VUMC 3I4MC 4QJVA 5C44K 4A3GK 2A6EA 5IP7K 4QIWD 2JA5C 3GTJC 5D4DA 5TMFA 3GTQC 5M5XK 4OIQA 4GZYA 4LK1A 4BBSC 5M3FK 1TWGK 3HOUC 4OIPA 3M4OK 3GTOK 4A3BC 5IP9K 5FJ8K 2PMZD 4XLPA 1SFOK 5C3EC 3GTLK 4X6AC 5TMCA 4XSZA 2JA8C 3RZOC 4A3KC 4OINA 4LJZA 2B63K 3M3YC 3S17C 5C4XK 1I6HK 2CW0A 4OIOA 4AYBL 3S16K 4A3LC 5C4JK 2JA6C 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A C;  1R9T C;  4A3C K;  2NVX C;  3S14 C;  3HOW K;  4KN4 A;  1I6V A;  2JA7 C;  5IYB K;  2A68 A;  5C44 C;  3S1Q K;  4A3G C;  5IP7 C;  3CQZ K;  4NOI A;  4ZH4 A;  4QIW L;  3WOD A;  4OIR A;  3PO2 K;  4BXX K;  3H3V L;  4MEX A;  3S1M K;  1TWA K;  3FKI K;  1TWG C;  3HOY K;  3M4O C;  2NVQ K;  3GTO C;  4MEY A;  4QJV B;  3DXJ A;  1XPP A;  5IP9 C;  4BY1 C;  1I3Q K;  4A3F K;  4BBR C;  3GTP K;  3S2H K;  3I4N K;  1SFO C;  3GTL C;  4G7Z A;  4LLG A;  4A3M K;  2B63 C;  2A6H A;  4Q5S A;  1TWF K;  1I6H C;  5C4X C;  3S16 C;  3S1N K;  1WCM K;  5C4J C;  4A3I C;  4A3E K;  4C3I K;  4A3C C;  3GTM K;  4KMU A;  2PA8 L;  3HOW C;  2E2H K;  1SMY A;  5IYB C;  3S1Q C;  3HOV K;  2WB1 D;  3CQZ C;  3HOZ K;  3HKZ D;  3EQL A;  1Y1W K;  4BXX C;  2BE5 A;  3PO2 C;  4A93 K;  2O5J A;  2WAQ D;  2R93 K;  4Y52 K;  3I4M K;  3S1M C;  1TWA C;  3FKI C;  3HOY C;  4G7H A;  4LK0 A;  2NVQ C;  4A3D K;  4YFN A;  2JA5 K;  1I3Q C;  4MQ9 A;  4JK1 A;  4Y7N K;  4A3F C;  1HQM A;  4C3H K;  3GTP C;  3S2H C;  3I4N C;  1TWC K;  3S2D K;  2YU9 K;  4A3M C;  2PMZ L;  1Y1V K;  2Y0S D;  1I50 K;  5FLM K;  3S1N C;  1WCM C;  2E2I K;  2R7Z K;  5IYC K;  4YG2 A;  3S15 K;  3GTK K;  1TWH K;  5M3M K;  3GTM C;  2E2H C;  4AYB D;  3H0G K;  1K83 K;  2NVT K;  3RZD K;  5IYD K;  3PO3 K;  2NVY K;  3S1R K;  3HOV C;  3HOZ C;  1Y1W C;  3HKZ L;  2R92 K;  4A93 C;  5M5W K;  2R93 C;  2E2J K;  4XLN A;  4C3J K;  3GTG K;  3HOX K;  4A3J K;  4BY7 K;  4A3D C;  5M5Y K;  4XSX A;  2VUM K;  3H3V D;  4Y7N C;  4YFK A;  3S2D C;  1TWC C;  1YNN A;  2YU9 C;  3GTJ K;  3GTQ K;  1IW7 A;  1Y1V C;  4BY1 K;  4BBS K;  2Y0S L;  3HOU K;  4YFX A;  1I50 C;  4BBR K;  5FLM C;  2E2I C;  2R7Z C;  5IYC C;  4A3B K;  3S15 C;  3GTK C;  1TWF C;  1TWH C;  1YNJ A;  5C3E K;  2NVT C;  1K83 C;  3H0G C;  4X6A K;  2JA8 K;  4A3E C;  3RZD C;  2O5I A;  5IYD C;  4A3K K;  3RZO K;  4Q4Z A;  3PO3 C;  2NVY C;  3M3Y K;  3S1R C;  1BDF A;  2PPB A;  3S17 K;  2PA8 D;  4A3L K;  1ZYR A;  2R92 C;  2JA6 K;  4C2M K;  3K7A K;  1R9T K;  2E2J C;  3GTG C;  2NVX K;  2WB1 L;  3HOX C;  4A3J C;  3S14 K;  4BY7 C;  2A69 A;  4G7O A;  2JA7 K;  4KN7 A;  2WAQ L;  4Y52 C;  2VUM C;  3I4M C;  4QJV A;  5C44 K;  4A3G K;  2A6E A;  5IP7 K;  4QIW D;  2JA5 C;  3GTJ C;  5D4D A;  5TMF A;  3GTQ C;  5M5X K;  4OIQ A;  4GZY A;  4LK1 A;  4BBS C;  5M3F K;  1TWG K;  3HOU C;  4OIP A;  3M4O K;  3GTO K;  4A3B C;  5IP9 K;  5FJ8 K;  2PMZ D;  4XLP A;  1SFO K;  5C3E C;  3GTL K;  4X6A C;  5TMC A;  4XSZ A;  2JA8 C;  3RZO C;  4A3K C;  4OIN A;  4LJZ A;  2B63 K;  3M3Y C;  3S17 C;  5C4X K;  1I6H K;  2CW0 A;  4OIO A;  4AYB L;  3S16 K;  4A3L C;  5C4J K;  2JA6 C;  4A3I K; 
#chains in the Genus database with same CATH topology
 4WIL A;  3S14 C;  1F9N A;  4A3G C;  4NOI A;  4QIW L;  4OIR A;  4WJ4 A;  3HOY K;  4QJV B;  5IP9 C;  4A3F K;  4KDD A;  3GTL C;  5CJ9 A;  1WIH A;  4A3M K;  2B63 C;  2A6H A;  4DDQ A;  1TWF K;  3V4G A;  4C3I K;  3GSI A;  3OEP A;  4BLB A;  3S1Q C;  1C0A A;  1BJT A;  3CQZ C;  3EQL A;  5JFE A;  4BXX C;  2O5J A;  4GTL A;  2WAQ D;  3I4M K;  3GTM A;  3FKI C;  4G7H A;  4KMH A;  2NVQ C;  4YFN A;  2JA5 K;  4M1X A;  4G0W A;  1I3Q C;  4C3H K;  3I4N C;  2YU9 K;  2PMZ L;  1Y1V K;  3CQZ A;  3S1N C;  5IYC K;  3S15 K;  1XXC A;  2E2H C;  1K83 K;  2Y3P A;  1I3Q A;  3HOZ C;  2R92 K;  3SZY A;  5M5W K;  2R93 C;  2E2J K;  3GTG K;  4BY7 K;  1WOO A;  1J6X A;  1XZQ B;  4Y7N C;  2E2H A;  1TWC C;  4LR2 A;  4BKW A;  1O26 A;  1IW7 A;  1IL2 A;  3A8K A;  4BBS K;  3HOU K;  4YFX A;  5FLM C;  2R93 A;  4J3N A;  2VUM A;  3GTK C;  1J6W A;  3GIR A;  1KQ4 A;  5C3E K;  3H0G C;  2JA8 K;  2O5I A;  2NVY C;  1ZBS A;  1TWC A;  2PPB A;  2PA8 D;  4GTA A;  2JA6 K;  4ILD A;  3GTK A;  2JA7 K;  5IOT A;  3H0G A;  5IP7 K;  4KAR A;  3GTQ C;  2NVY A;  1R9T A;  3LPX A;  1B4A A;  4GT9 A;  1WQF A;  1INN A;  1JOE A;  1GE9 A;  4A3K C;  2GAH C;  5EGE A;  4KC6 A;  4OIO A;  4A3L C;  2GSO A;  4KM9 A;  4C2M C;  3A8J A;  4A3C K;  2CFA A;  3TTG A;  3LAJ A;  4KN4 A;  2A68 A;  4P9S A;  4ZH4 A;  3PO2 K;  4MEX A;  3VA7 A;  3S1M K;  1TWG C;  3MML B;  3M4O C;  3GTO C;  3L4J A;  3GTP K;  1WOS A;  4Q5S A;  1I6H C;  1O25 A;  5C4X C;  2RGR A;  1WCM K;  5C4J C;  3Q3Q A;  1F93 A;  4A3I C;  1J6V A;  3GEH A;  3GTO A;  3HOW C;  3ERE D;  1ZQ1 C;  4FZB A;  5IYB C;  1UV7 A;  3FOE A;  4GTE A;  3HKZ D;  1Y1W K;  2BE5 A;  1EFW A;  1BGW A;  1TWA C;  1F7U A;  4GTB A;  4JK1 A;  3S2H C;  1HQM A;  2PHC B;  1PJ5 A;  4KB4 A;  1I50 K;  3N3Y A;  4O2D A;  5L46 A;  2E2I K;  5E68 A;  2R7Z K;  1TWA A;  1EK8 A;  3GTM C;  3ORE A;  2XCO A;  2YU9 A;  3GEI A;  1XXA A;  5IYD K;  3PO3 K;  3HOV C;  3HKZ L;  4A93 C;  3AD8 C;  3BP8 C;  1USO A;  1XXB A;  3HOX K;  5IOR A;  4A3J K;  4LQY A;  1WOP A;  1K83 A;  4A3D C;  3H3V D;  1O27 A;  4KMD A;  3S2D C;  1YNN A;  4PAB A;  4P5B A;  1XZP A;  1EQR A;  1G51 A;  3LAP A;  1TWH C;  1YNJ A;  2NVT C;  3RZD C;  3RZO K;  4Q4Z A;  3M3Y K;  5HL8 A;  3S1R C;  4GFQ A;  4KAT A;  1L0W A;  2W7V A;  4C3J C;  3S14 K;  2GSN A;  2WAQ L;  2VUM C;  1TWH A;  4A3G K;  2P8T A;  3GTJ C;  3AH5 A;  5TMF A;  4OIQ A;  4GZY A;  3GEE A;  5M3F K;  4A3B C;  4KAS A;  2JA7 A;  5IP9 K;  5FJ8 K;  3A8I A;  4P5A A;  3GTL K;  4X6A C;  1WQG A;  5IOS A;  4LJZ A;  2B63 K;  3S17 C;  3GTJ A;  3K7A C;  1R9T C;  4WJ3 M;  2NVX C;  1I6V A;  2ZFZ A;  1DD5 A;  4PAA A;  1PJ7 A;  5C44 C;  3S1Q K;  3CQZ K;  3T01 A;  4BXX K;  1O2A A;  3AD7 C;  3FKI K;  3NUH A;  5TJ3 A;  2NVQ K;  4MEY A;  3DXJ A;  1WSV A;  2NVX A;  2ZUE A;  1I3Q K;  3I4N K;  1SFO C;  2V6T A;  4LLG A;  3S16 C;  3S1N K;  4LOW A;  4KMA A;  1AB4 A;  1VRQ C;  3GTP A;  2PA8 L;  2E2H K;  1YCL A;  2GAG C;  1SFO A;  3FOF A;  2WB1 D;  3HOZ K;  3JST A;  1WCM A;  1O28 A;  2CFA B;  1VLO A;  2R93 K;  1O24 A;  3HOY C;  4LK0 A;  1IQ0 A;  1VH2 A;  4MQ9 A;  4Y7N K;  4A3F C;  4C45 A;  1Y1W A;  1TWC K;  4A3M C;  1JQW A;  2KWA A;  5FLM K;  4FM9 A;  3BP3 A;  3GTK K;  4C3I C;  4GTF A;  1PJ6 A;  3H0G K;  4AYB D;  2D6F C;  3T00 A;  2NVY K;  1I50 A;  1HI9 A;  1TWF A;  4XLN A;  3AQP A;  5M5Y K;  4YFK A;  4C3H C;  1RU0 A;  2YU9 C;  3TFJ A;  3GTQ K;  1Y1V C;  5IYC C;  3S15 C;  5CHP A;  4KB2 A;  3G4C A;  1K83 C;  2JA5 A;  1ISE A;  4A3E C;  4A3K K;  2XCQ A;  4RMF A;  1BDF A;  3OPF A;  4A3L K;  1ZYR A;  2R92 C;  1Y1V A;  4C2M K;  2E2J C;  3GTG C;  4BY7 C;  1IBA A;  2A69 A;  3GDZ A;  1ZXO A;  4Y52 C;  1F7V A;  1O2F B;  4QJV A;  2A6E A;  4KM8 A;  5D4D A;  5M5X K;  3L4K A;  4BBS C;  3HOU C;  1TWG K;  2RH6 A;  1X31 C;  2R92 A;  3M4O K;  3GTO K;  3FHZ A;  3GTG A;  2PMZ D;  4XLP A;  4BLA A;  5C3E C;  1ZVU A;  5TMC A;  2JA8 C;  1XZP B;  3TFI A;  5C4X K;  1I6H K;  2CW0 A;  1EI6 A;  5C4J K;  2JA6 C;  4A3I K;  3CAG A;  3GTL A;  3HOW K;  2JA7 C;  5IYB K;  5IOQ A;  2B63 A;  3ADA C;  1EH1 A;  5IP7 C;  3WOD A;  2FQO A;  3H3V L;  1WQH A;  1TWA K;  1USM A;  2JA6 A;  4BY1 C;  1XPP A;  4AH6 A;  1WSR A;  3S2H K;  4BBR C;  3IPJ A;  3TFH A;  4G7Z A;  2EBB A;  4KAW X;  3FKI A;  1DCO A;  2P5M A;  2XCR B;  4A3E K;  4A3C C;  4XCH A;  3GTM K;  4KMU A;  1B4B A;  1SMY A;  1YX2 A;  1XZQ A;  2ZUF A;  2GSU A;  3HOV K;  3PO2 C;  4A93 K;  2FQT A;  4Y52 K;  3S1M C;  3AQO A;  4GTD A;  3BUE A;  4A3D K;  2JH3 A;  3N0C A;  1J98 A;  1VJE A;  3GTP C;  3S2D K;  1WOR A;  3AD9 C;  1IE0 A;  2Y0S D;  1WCM C;  1DCP A;  1IS1 A;  4YG2 A;  1TWH K;  5M3M K;  2NVT K;  3RZD K;  1DCH A;  3S1R K;  1Y1W C;  3N0B A;  4C3J K;  4XSX A;  2VUM K;  4G0U A;  2V6S A;  3GTJ K;  3QX3 A;  4BY1 K;  2Y0S L;  1I50 C;  1JVI A;  4BBR K;  2V6U A;  2E2I C;  2R7Z C;  4A3B K;  1TWF C;  4X6A K;  3GTQ A;  5IYD C;  3PO3 C;  3S17 K;  5EGH A;  1V5V A;  3K7A K;  1R9T K;  3HXA A;  2WB1 L;  3HOX C;  4A3J C;  2NVX K;  3T02 A;  4G0V A;  4G7O A;  2R7Z A;  2E2I A;  4KN7 A;  3I4M C;  5JVO A;  5C44 K;  3S0X A;  4QIW D;  4GTC A;  2JA5 C;  4LK1 A;  4OIP A;  1VGX A;  1SFO K;  4XSZ A;  3RZO C;  4OIN A;  1O2B A;  3G4A A;  3M3Y C;  1TWG A;  1BS2 A;  3SZZ A;  4AYB L;  1O29 A;  3S16 K; 
#chains in the Genus database with same CATH homology
 3K7A C;  1R9T C;  4A3C K;  2NVX C;  3S14 C;  3HOW K;  4KN4 A;  1I6V A;  2JA7 C;  5IYB K;  2A68 A;  5C44 C;  3S1Q K;  4A3G C;  5IP7 C;  3CQZ K;  4NOI A;  4ZH4 A;  4QIW L;  3WOD A;  4OIR A;  3PO2 K;  4BXX K;  3H3V L;  4MEX A;  3S1M K;  1TWA K;  3FKI K;  1TWG C;  3HOY K;  3M4O C;  2NVQ K;  3GTO C;  4MEY A;  4QJV B;  3DXJ A;  1XPP A;  5IP9 C;  4BY1 C;  1I3Q K;  4A3F K;  4BBR C;  3GTP K;  3S2H K;  3I4N K;  1SFO C;  3GTL C;  4G7Z A;  4LLG A;  4A3M K;  2B63 C;  2A6H A;  4Q5S A;  1TWF K;  1I6H C;  5C4X C;  3S16 C;  3S1N K;  1WCM K;  5C4J C;  4A3I C;  4A3E K;  4C3I K;  4A3C C;  3GTM K;  4KMU A;  2PA8 L;  3HOW C;  2E2H K;  1SMY A;  5IYB C;  3S1Q C;  3HOV K;  2WB1 D;  3CQZ C;  3HOZ K;  3HKZ D;  3EQL A;  1Y1W K;  4BXX C;  2BE5 A;  3PO2 C;  4A93 K;  2O5J A;  2WAQ D;  2R93 K;  4Y52 K;  3I4M K;  3S1M C;  1TWA C;  3FKI C;  3HOY C;  4G7H A;  4LK0 A;  2NVQ C;  4A3D K;  4YFN A;  2JA5 K;  1I3Q C;  4MQ9 A;  4JK1 A;  4Y7N K;  4A3F C;  1HQM A;  4C3H K;  3GTP C;  3S2H C;  3I4N C;  1TWC K;  3S2D K;  2YU9 K;  4A3M C;  2PMZ L;  1Y1V K;  2Y0S D;  1I50 K;  5FLM K;  3S1N C;  1WCM C;  2E2I K;  2R7Z K;  5IYC K;  4YG2 A;  3S15 K;  3GTK K;  1TWH K;  5M3M K;  3GTM C;  2E2H C;  4AYB D;  3H0G K;  1K83 K;  2NVT K;  3RZD K;  5IYD K;  3PO3 K;  2NVY K;  3S1R K;  3HOV C;  3HOZ C;  1Y1W C;  3HKZ L;  2R92 K;  4A93 C;  5M5W K;  2R93 C;  2E2J K;  4XLN A;  4C3J K;  3GTG K;  3HOX K;  4A3J K;  4BY7 K;  4A3D C;  5M5Y K;  4XSX A;  2VUM K;  3H3V D;  4Y7N C;  4YFK A;  3S2D C;  1TWC C;  1YNN A;  2YU9 C;  3GTJ K;  3GTQ K;  1IW7 A;  1Y1V C;  4BY1 K;  4BBS K;  2Y0S L;  3HOU K;  4YFX A;  1I50 C;  4BBR K;  5FLM C;  2E2I C;  2R7Z C;  5IYC C;  4A3B K;  3S15 C;  3GTK C;  1TWF C;  1TWH C;  1YNJ A;  5C3E K;  2NVT C;  1K83 C;  3H0G C;  4X6A K;  2JA8 K;  4A3E C;  3RZD C;  2O5I A;  5IYD C;  4A3K K;  3RZO K;  4Q4Z A;  3PO3 C;  2NVY C;  3M3Y K;  3S1R C;  1BDF A;  2PPB A;  3S17 K;  2PA8 D;  4A3L K;  1ZYR A;  2R92 C;  2JA6 K;  4C2M K;  3K7A K;  1R9T K;  2E2J C;  3GTG C;  2NVX K;  2WB1 L;  3HOX C;  4A3J C;  3S14 K;  4BY7 C;  2A69 A;  4G7O A;  2JA7 K;  4KN7 A;  2WAQ L;  4Y52 C;  2VUM C;  3I4M C;  4QJV A;  5C44 K;  4A3G K;  2A6E A;  5IP7 K;  4QIW D;  2JA5 C;  3GTJ C;  5D4D A;  5TMF A;  3GTQ C;  5M5X K;  4OIQ A;  4GZY A;  4LK1 A;  4BBS C;  5M3F K;  1TWG K;  3HOU C;  4OIP A;  3M4O K;  3GTO K;  4A3B C;  5IP9 K;  5FJ8 K;  2PMZ D;  4XLP A;  1SFO K;  5C3E C;  3GTL K;  4X6A C;  5TMC A;  4XSZ A;  2JA8 C;  3RZO C;  4A3K C;  4OIN A;  4LJZ A;  2B63 K;  3M3Y C;  3S17 C;  5C4X K;  1I6H K;  2CW0 A;  4OIO A;  4AYB L;  3S16 K;  4A3L C;  5C4J K;  2JA6 C;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...