3S14K

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s14K00
4A3MK 3S1MC 3EQLA 4Y7NK 2NVYK 3S2DK 4A3EC 3GTPC 3HOXK 3S16C 3I4MK 1ZYRA 2E2IC 4C3HK 1TWGK 4GZYA 2PPBA 4MEYA 5TMCA 5IP7K 1I6HC 4A3MC 4KN4A 5TMFA 1HQMA 1R9TC 3PO3C 5IYDC 2CW0A 1TWCK 3H0GC 4A3IC 2E2JK 2JA7C 4OINA 1TWGC 1YNJA 3S1QK 1I3QC 2PA8D 5IYCK 5C4JC 3H3VL 2PA8L 3H3VD 5FLMK 4A3LC 1WCMK 2VUMC 4Q5SA 3S15C 2R92K 4LLGA 4QIWL 5M5YK 2NVTC 3S1QC 4OIOA 4A3FK 2YU9K 4BY7C 5IYBC 4XLNA 2WAQL 1SMYA 2JA7K 1SFOK 1Y1VC 2JA6C 5C44C 4BY1C 3HOXC 1TWAK 4X6AK 2NVXC 5FLMC 2JA8C 3GTQK 3M3YC 2PMZD 2R7ZC 2R93C 3FKIK 3HOVC 5IP7C 1TWCC 3I4MC 1TWHC 2E2HK 2O5JA 4C3JK 3GTLC 3RZDK 2NVQK 4A3CK 4A3EK 4AYBL 3S16K 3S1NC 4JK1A 3HOWC 3RZOK 5IYCC 3GTLK 2A69A 2Y0SL 5FJ8K 4MEXA 3GTMK 3HOUC 1YNNA 4A3DK 1TWFC 2A68A 4A3BK 4Y7NC 1I6VA 3CQZC 4YG2A 3RZOC 5C4XC 5M5WK 1I50C 5D4DA 5C3EC 1Y1WC 1WCMC 4XSXA 5IP9C 5M5XK 4A3KK 1Y1VK 4LK1A 2JA6K 2B63K 3CQZK 5C4XK 3S2HK 4LK0A 2WAQD 4A93C 4BBRK 4C3IK 5M3MK 5IYBK 3GTKK 3I4NK 5IP9K 4OIPA 4Q4ZA 3S14C 4XSZA 4YFXA 4Y52C 3HOYC 4G7HA 3M4OC 2NVXK 5C3EK 1Y1WK 2Y0SD 3GTJC 3GTKC 4MQ9A 1I3QK 5C4JK 3I4NC 3S17K 4YFNA 4KN7A 1SFOC 3GTOK 3S2HC 4OIQA 2WB1D 4BBSK 3S1MK 3HKZD 4KMUA 3PO2C 2VUMK 3HOZC 2JA5C 4C2MK 1TWFK 1TWHK 1K83K 4BBRC 1XPPA 3K7AK 4OIRA 5IYDK 4A3GC 3DXJA 4A3KC 4A3DC 3HOWK 3FKIC 1K83C 1R9TK 3HOVK 1TWAC 4A93K 4QJVA 3K7AC 3GTGK 2JA8K 3WODA 3GTQC 3PO2K 4A3LK 4XLPA 2PMZL 2NVQC 3S1NK 3M4OK 4G7OA 2E2IK 4A3JK 3S1RC 2E2HC 3S15K 3S17C 2BE5A 3PO3K 2NVTK 2A6EA 4A3CC 2JA5K 3GTGC 4QJVB 5M3FK 3GTJK 4BBSC 3S14K 1I50K 3GTMC 5C44K 2A6HA 4BY1K 4BXXK 4A3GK 3H0GK 4A3IK 2E2JC 4A3BC 3M3YK 2B63C 4A3FC 2YU9C 4BY7K 4AYBD 3HKZL 3HOZK 1I6HK 3HOYK 4Y52K 3GTPK 4LJZA 4QIWD 1IW7A 3RZDC 4A3JC 3S1RK 2O5IA 3HOUK 4BXXC 4NOIA 2R7ZK 2R93K 2R92C 1BDFA 4G7ZA 2NVYC 4ZH4A 3GTOC 3S2DC 4X6AC 2WB1L 4YFKA
chains in the Genus database with same CATH superfamily
4A3MK 1Y1VA 3CQZA 3GIRA 3S1MC 3EQLA 2EBBA 3LAJA 1ZYRA 1XZQB 1TWAA 3LAPA 3FOEA 4GZYA 4GTAA 1IBAA 2PPBA 4MEYA 3TFJA 3GTMA 5JVOA 1TWCA 2P5MA 1O25A 3N0CA 1HQMA 5EGEA 5TMFA 3PO3C 5IYDC 2E2JK 2JA7C 4OINA 5EGHA 1KQ4A 4A3LC 1F7VA 4LLGA 4GTEA 5M5YK 1TWHA 1VRQC 2JA7K 1EH1A 4GTFA 1BS2A 4BY1C 1TWAK 2P8TA 4X6AK 3LPXA 3M3YC 2PMZD 1WSVA 1TWCC 2O5JA 3GTLC 2NVQK 5L46A 4AYBL 3AD7C 2E2HA 3GEIA 3RZOK 2Y0SL 1DCHA 3GTMK 4A3DK 1IQ0A 2A68A 3AQPA 4YG2A 3RZOC 2W7VA 4KB4A 4C2MC 2NVYA 2JA6K 4LK1A 4GTLA 4BBRK 5M3MK 5IYBK 3GTKK 3I4NK 3OREA 2Y0SD 1I3QK 3S17K 1F9NA 2RGRA 4ILDA 5IOSA 4BBSK 3HKZD 1JOEA 3PO2C 4GTCA 1XZPB 2GSUA 1K83K 3DXJA 4XCHA 4A3DC 3FKIC 3HOVK 4A93K 3A8JA 3GTQC 2Y3PA 3S1RC 3H0GA 1VJEA 4GFQA 1TWFA 4BBSC 1J6VA 4BY1K 3GTOA 4BXXK 4A3GK 3H0GK 3M3YK 2YU9C 4BY7K 1I6HK 3GTLA 1XXCA 3G4CA 3SZZA 2O5IA 3GEEA 2R93K 1IE0A 2R92C 1V5VA 1XXBA 2JA6A 3S2DK 4A3EC 3GTPC 3HOXK 4LOWA 2E2IC 4C3HK 5IP7K 1ZXOA 4G0WA 3GSIA 1R9TA 2R7ZA 4KC6A 1I3QC 5IYCK 3H3VL 3H3VD 2FQTA 2ZUFA 4Q5SA 4KAWX 1AB4A 4A3FK 4XLNA 1SMYA 4FZBA 5C44C 2R93C 5IP7C 2GSNA 1TWHC 2E2HK 1WQHA 3T00A 3S1NC 5TJ3A 2CFAA 4A3EK 4JK1A 1I3QA 5IYCC 1IL2A 3VA7A 1YNNA 3GEHA 1TWFC 3BP8C 3CAGA 4Y7NC 5C3EC 2PHCB 4XSXA 2CFAB 5IP9C 1EK8A 3NUHA 1XXAA 3N0BA 4LK0A 2WAQD 1IS1A 4C45A 1Y1WA 4C3IK 1WOOA 2JA5A 1DCPA 5IP9K 3IPJA 4G7HA 3M4OC 4FM9A 3QX3A 4KARA 5C3EK 3GTJC 5C4JK 4KN7A 3L4KA 3S2HC 3TFIA 1ZVUA 2GSOA 3S1MK 4KMUA 2FQOA 2VUMK 3HOZC 1TWHK 2XCRB 1XPPA 1ISEA 2GAGC 1JQWA 3A8KA 3A8IA 3ERED 3K7AC 2JA8K 3WODA 4A3LK 1O29A 2KWAA 1G51A 3M4OK 2B63A 5E68A 4O2DA 3S17C 1YX2A 1BJTA 4A3CC 4PABA 2JA5K 3GTGC 2JH3A 4WJ4A 1WSRA 2VUMA 1I50K 3GTMC 5C44K 4A3IK 4GTDA 4A3BC 4RMFA 4AYBD 5JFEA 3HOYK 4Y52K 3GTPK 1IW7A 3S0XA 4A3JC 1X31C 1F93A 3GTOC 2V6TA 3S2DC 1O27A 3GTPA 4YFKA 3SZYA 4Y7NK 2NVYK 2XCOA 3TTGA 3I4MK 1TWGK 5TMCA 5CHPA 1I6HC 3AQOA 4P5BA 4PAAA 4KN4A 1R9TC 3BP3A 1WQGA 3H0GC 3JSTA 1TWGC 3S1QK 5C4JC 2PA8D 2PA8L 1WCMK 3S15C 2R92K 3S1QC 5HL8A 4OIOA 1K83A 2YU9K 3GTQA 4BY7C 2WAQL 1DD5A 1SFOK 1Y1VC 5IOQA 3HOXC 2NVXC 5FLMC 3GTQK 4J3NA 4KDDA 3FKIK 1USOA 3HOVC 3I4MC 4KASA 3RZDK 3HOWC 1JVIA 2A69A 1VGXA 3ADAC 4MEXA 3HOUC 3L4JA 1WIHA 4P5AA 5M5WK 4P9SA 5D4DA 1Y1WC 3AD8C 5M5XK 1O2AA 4A3KK 3CQZK 5C4XK 3S2HK 1L0WA 1EQRA 1YCLA 4Q4ZA 4OIPA 3S14C 2ZFZA 4XSZA 3AH5A 2NVXK 1Y1WK 1C0AA 4WJ3M 4MQ9A 4YFNA 1SFOC 1WOSA 3GTOK 3G4AA 4BLAA 1O28A 2WB1D 4AH6A 4C2MK 1TWFK 4BBRC 3K7AK 4OIRA 5IYDK 4A3KC 1R9TK 1TWAC 4QJVA 3GDZA 4M1XA 3GTGK 2PMZL 2NVQC 4G7OA 1O24A 1ZQ1C 3GTGA 3S15K 1VLOA 2A6EA 4WILA 4QJVB 5M3FK 3GTJK 2A6HA 1PJ5A 3N3YA 3FOFA 2E2JC 1WCMA 2V6UA 2B63C 1HI9A 3HKZL 3HOZK 4QIWD 3RZDC 5IOTA 3S1RK 1WORA 4NOIA 2R7ZK 1WQFA 3GTKA 2NVYC 3MMLB 4KM8A 1J6XA 4GT9A 2YU9A 1J98A 3S16C 3GTJA 4C3JC 1PJ6A 3AD9C 2V6SA 4BLBA 4A3MC 3BUEA 1O2FB 4GTBA 2CW0A 1TWCK 4A3IC 1EFWA 1YNJA 4G0UA 2R93A 5FLMK 1VH2A 2VUMC 5IORA 2JA7A 4QIWL 2NVTC 3TFHA 5IYBC 1O26A 4KB2A 2JA6C 1EI6A 1TWGA 1B4BA 2JA8C 2R7ZC 4KMAA 4C3IC 1DCOA 1UV7A 1J6WA 5CJ9A 4C3JK 1USMA 4LQYA 4A3CK 3S16K 4KMDA 3FHZA 3GTLK 5FJ8K 1XZPA 4A3BK 1I6VA 3CQZC 5C4XC 4G0VA 1I50C 1WCMC 3T01A 1INNA 1Y1VK 2R92A 2B63K 4A93C 4C3HC 4YFXA 4Y52C 3OPFA 3HOYC 3OEPA 1BGWA 3GTKC 3I4NC 4BKWA 2XCQA 4OIQA 2ZUEA 2JA5C 1I50A 4KMHA 4KM9A 4A3GC 1SFOA 3T02A 3HOWK 4KATA 1K83C 1O2BA 2E2IA 1XZQA 1GE9A 3PO2K 1ZBSA 4XLPA 3FKIA 1WOPA 3S1NK 2NVXA 2E2IK 4LR2A 1PJ7A 4A3JK 2E2HC 1B4AA 2BE5A 1F7UA 3PO3K 2NVTK 2D6FC 3S14K 2GAHC 3HXAA 2RH6A 4A3FC 3V4GA 4DDQA 4LJZA 1RU0A 3HOUK 4BXXC 3Q3QA 1BDFA 4G7ZA 4ZH4A 4X6AC 2WB1L
chains in the Genus database with same CATH topology
4A3MK 3S1MC 3EQLA 4Y7NK 2NVYK 3S2DK 4A3EC 3GTPC 3HOXK 3S16C 3I4MK 1ZYRA 2E2IC 4C3HK 1TWGK 4GZYA 2PPBA 4MEYA 5TMCA 5IP7K 1I6HC 4A3MC 4KN4A 5TMFA 1HQMA 1R9TC 3PO3C 5IYDC 2CW0A 1TWCK 3H0GC 4A3IC 2E2JK 2JA7C 4OINA 1TWGC 1YNJA 3S1QK 1I3QC 2PA8D 5IYCK 5C4JC 3H3VL 2PA8L 3H3VD 5FLMK 4A3LC 1WCMK 2VUMC 4Q5SA 3S15C 2R92K 4LLGA 4QIWL 5M5YK 2NVTC 3S1QC 4OIOA 4A3FK 2YU9K 4BY7C 5IYBC 4XLNA 2WAQL 1SMYA 2JA7K 1SFOK 1Y1VC 2JA6C 5C44C 4BY1C 3HOXC 1TWAK 4X6AK 2NVXC 5FLMC 2JA8C 3GTQK 3M3YC 2PMZD 2R7ZC 2R93C 3FKIK 3HOVC 5IP7C 1TWCC 3I4MC 1TWHC 2E2HK 2O5JA 4C3JK 3GTLC 3RZDK 2NVQK 4A3CK 4A3EK 4AYBL 3S16K 3S1NC 4JK1A 3HOWC 3RZOK 5IYCC 3GTLK 2A69A 2Y0SL 5FJ8K 4MEXA 3GTMK 3HOUC 1YNNA 4A3DK 1TWFC 2A68A 4A3BK 4Y7NC 1I6VA 3CQZC 4YG2A 3RZOC 5C4XC 5M5WK 1I50C 5D4DA 5C3EC 1Y1WC 1WCMC 4XSXA 5IP9C 5M5XK 4A3KK 1Y1VK 4LK1A 2JA6K 2B63K 3CQZK 5C4XK 3S2HK 4LK0A 2WAQD 4A93C 4BBRK 4C3IK 5M3MK 5IYBK 3GTKK 3I4NK 5IP9K 4OIPA 4Q4ZA 3S14C 4XSZA 4YFXA 4Y52C 3HOYC 4G7HA 3M4OC 2NVXK 5C3EK 1Y1WK 2Y0SD 3GTJC 3GTKC 4MQ9A 1I3QK 5C4JK 3I4NC 3S17K 4YFNA 4KN7A 1SFOC 3GTOK 3S2HC 4OIQA 2WB1D 4BBSK 3S1MK 3HKZD 4KMUA 3PO2C 2VUMK 3HOZC 2JA5C 4C2MK 1TWFK 1TWHK 1K83K 4BBRC 1XPPA 3K7AK 4OIRA 5IYDK 4A3GC 3DXJA 4A3KC 4A3DC 3HOWK 3FKIC 1K83C 1R9TK 3HOVK 1TWAC 4A93K 4QJVA 3K7AC 3GTGK 2JA8K 3WODA 3GTQC 3PO2K 4A3LK 4XLPA 2PMZL 2NVQC 3S1NK 3M4OK 4G7OA 2E2IK 4A3JK 3S1RC 2E2HC 3S15K 3S17C 2BE5A 3PO3K 2NVTK 2A6EA 4A3CC 2JA5K 3GTGC 4QJVB 5M3FK 3GTJK 4BBSC 3S14K 1I50K 3GTMC 5C44K 2A6HA 4BY1K 4BXXK 4A3GK 3H0GK 4A3IK 2E2JC 4A3BC 3M3YK 2B63C 4A3FC 2YU9C 4BY7K 4AYBD 3HKZL 3HOZK 1I6HK 3HOYK 4Y52K 3GTPK 4LJZA 4QIWD 1IW7A 3RZDC 4A3JC 3S1RK 2O5IA 3HOUK 4BXXC 4NOIA 2R7ZK 2R93K 2R92C 1BDFA 4G7ZA 2NVYC 4ZH4A 3GTOC 3S2DC 4X6AC 2WB1L 4YFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M K;  3S1M C;  3EQL A;  4Y7N K;  2NVY K;  3S2D K;  4A3E C;  3GTP C;  3HOX K;  3S16 C;  3I4M K;  1ZYR A;  2E2I C;  4C3H K;  1TWG K;  4GZY A;  2PPB A;  4MEY A;  5TMC A;  5IP7 K;  1I6H C;  4A3M C;  4KN4 A;  5TMF A;  1HQM A;  1R9T C;  3PO3 C;  5IYD C;  2CW0 A;  1TWC K;  3H0G C;  4A3I C;  2E2J K;  2JA7 C;  4OIN A;  1TWG C;  1YNJ A;  3S1Q K;  1I3Q C;  2PA8 D;  5IYC K;  5C4J C;  3H3V L;  2PA8 L;  3H3V D;  5FLM K;  4A3L C;  1WCM K;  2VUM C;  4Q5S A;  3S15 C;  2R92 K;  4LLG A;  4QIW L;  5M5Y K;  2NVT C;  3S1Q C;  4OIO A;  4A3F K;  2YU9 K;  4BY7 C;  5IYB C;  4XLN A;  2WAQ L;  1SMY A;  2JA7 K;  1SFO K;  1Y1V C;  2JA6 C;  5C44 C;  4BY1 C;  3HOX C;  1TWA K;  4X6A K;  2NVX C;  5FLM C;  2JA8 C;  3GTQ K;  3M3Y C;  2PMZ D;  2R7Z C;  2R93 C;  3FKI K;  3HOV C;  5IP7 C;  1TWC C;  3I4M C;  1TWH C;  2E2H K;  2O5J A;  4C3J K;  3GTL C;  3RZD K;  2NVQ K;  4A3C K;  4A3E K;  4AYB L;  3S16 K;  3S1N C;  4JK1 A;  3HOW C;  3RZO K;  5IYC C;  3GTL K;  2A69 A;  2Y0S L;  5FJ8 K;  4MEX A;  3GTM K;  3HOU C;  1YNN A;  4A3D K;  1TWF C;  2A68 A;  4A3B K;  4Y7N C;  1I6V A;  3CQZ C;  4YG2 A;  3RZO C;  5C4X C;  5M5W K;  1I50 C;  5D4D A;  5C3E C;  1Y1W C;  1WCM C;  4XSX A;  5IP9 C;  5M5X K;  4A3K K;  1Y1V K;  4LK1 A;  2JA6 K;  2B63 K;  3CQZ K;  5C4X K;  3S2H K;  4LK0 A;  2WAQ D;  4A93 C;  4BBR K;  4C3I K;  5M3M K;  5IYB K;  3GTK K;  3I4N K;  5IP9 K;  4OIP A;  4Q4Z A;  3S14 C;  4XSZ A;  4YFX A;  4Y52 C;  3HOY C;  4G7H A;  3M4O C;  2NVX K;  5C3E K;  1Y1W K;  2Y0S D;  3GTJ C;  3GTK C;  4MQ9 A;  1I3Q K;  5C4J K;  3I4N C;  3S17 K;  4YFN A;  4KN7 A;  1SFO C;  3GTO K;  3S2H C;  4OIQ A;  2WB1 D;  4BBS K;  3S1M K;  3HKZ D;  4KMU A;  3PO2 C;  2VUM K;  3HOZ C;  2JA5 C;  4C2M K;  1TWF K;  1TWH K;  1K83 K;  4BBR C;  1XPP A;  3K7A K;  4OIR A;  5IYD K;  4A3G C;  3DXJ A;  4A3K C;  4A3D C;  3HOW K;  3FKI C;  1K83 C;  1R9T K;  3HOV K;  1TWA C;  4A93 K;  4QJV A;  3K7A C;  3GTG K;  2JA8 K;  3WOD A;  3GTQ C;  3PO2 K;  4A3L K;  4XLP A;  2PMZ L;  2NVQ C;  3S1N K;  3M4O K;  4G7O A;  2E2I K;  4A3J K;  3S1R C;  2E2H C;  3S15 K;  3S17 C;  2BE5 A;  3PO3 K;  2NVT K;  2A6E A;  4A3C C;  2JA5 K;  3GTG C;  4QJV B;  5M3F K;  3GTJ K;  4BBS C;  3S14 K;  1I50 K;  3GTM C;  5C44 K;  2A6H A;  4BY1 K;  4BXX K;  4A3G K;  3H0G K;  4A3I K;  2E2J C;  4A3B C;  3M3Y K;  2B63 C;  4A3F C;  2YU9 C;  4BY7 K;  4AYB D;  3HKZ L;  3HOZ K;  1I6H K;  3HOY K;  4Y52 K;  3GTP K;  4LJZ A;  4QIW D;  1IW7 A;  3RZD C;  4A3J C;  3S1R K;  2O5I A;  3HOU K;  4BXX C;  4NOI A;  2R7Z K;  2R93 K;  2R92 C;  1BDF A;  4G7Z A;  2NVY C;  4ZH4 A;  3GTO C;  3S2D C;  4X6A C;  2WB1 L;  4YFK A; 
#chains in the Genus database with same CATH topology
 4A3M K;  1Y1V A;  3CQZ A;  3GIR A;  3S1M C;  3EQL A;  2EBB A;  3LAJ A;  1ZYR A;  1XZQ B;  1TWA A;  3LAP A;  3FOE A;  4GZY A;  4GTA A;  1IBA A;  2PPB A;  4MEY A;  3TFJ A;  3GTM A;  5JVO A;  1TWC A;  2P5M A;  1O25 A;  3N0C A;  1HQM A;  5EGE A;  5TMF A;  3PO3 C;  5IYD C;  2E2J K;  2JA7 C;  4OIN A;  5EGH A;  1KQ4 A;  4A3L C;  1F7V A;  4LLG A;  4GTE A;  5M5Y K;  1TWH A;  1VRQ C;  2JA7 K;  1EH1 A;  4GTF A;  1BS2 A;  4BY1 C;  1TWA K;  2P8T A;  4X6A K;  3LPX A;  3M3Y C;  2PMZ D;  1WSV A;  1TWC C;  2O5J A;  3GTL C;  2NVQ K;  5L46 A;  4AYB L;  3AD7 C;  2E2H A;  3GEI A;  3RZO K;  2Y0S L;  1DCH A;  3GTM K;  4A3D K;  1IQ0 A;  2A68 A;  3AQP A;  4YG2 A;  3RZO C;  2W7V A;  4KB4 A;  4C2M C;  2NVY A;  2JA6 K;  4LK1 A;  4GTL A;  4BBR K;  5M3M K;  5IYB K;  3GTK K;  3I4N K;  3ORE A;  2Y0S D;  1I3Q K;  3S17 K;  1F9N A;  2RGR A;  4ILD A;  5IOS A;  4BBS K;  3HKZ D;  1JOE A;  3PO2 C;  4GTC A;  1XZP B;  2GSU A;  1K83 K;  3DXJ A;  4XCH A;  4A3D C;  3FKI C;  3HOV K;  4A93 K;  3A8J A;  3GTQ C;  2Y3P A;  3S1R C;  3H0G A;  1VJE A;  4GFQ A;  1TWF A;  4BBS C;  1J6V A;  4BY1 K;  3GTO A;  4BXX K;  4A3G K;  3H0G K;  3M3Y K;  2YU9 C;  4BY7 K;  1I6H K;  3GTL A;  1XXC A;  3G4C A;  3SZZ A;  2O5I A;  3GEE A;  2R93 K;  1IE0 A;  2R92 C;  1V5V A;  1XXB A;  2JA6 A;  3S2D K;  4A3E C;  3GTP C;  3HOX K;  4LOW A;  2E2I C;  4C3H K;  5IP7 K;  1ZXO A;  4G0W A;  3GSI A;  1R9T A;  2R7Z A;  4KC6 A;  1I3Q C;  5IYC K;  3H3V L;  3H3V D;  2FQT A;  2ZUF A;  4Q5S A;  4KAW X;  1AB4 A;  4A3F K;  4XLN A;  1SMY A;  4FZB A;  5C44 C;  2R93 C;  5IP7 C;  2GSN A;  1TWH C;  2E2H K;  1WQH A;  3T00 A;  3S1N C;  5TJ3 A;  2CFA A;  4A3E K;  4JK1 A;  1I3Q A;  5IYC C;  1IL2 A;  3VA7 A;  1YNN A;  3GEH A;  1TWF C;  3BP8 C;  3CAG A;  4Y7N C;  5C3E C;  2PHC B;  4XSX A;  2CFA B;  5IP9 C;  1EK8 A;  3NUH A;  1XXA A;  3N0B A;  4LK0 A;  2WAQ D;  1IS1 A;  4C45 A;  1Y1W A;  4C3I K;  1WOO A;  2JA5 A;  1DCP A;  5IP9 K;  3IPJ A;  4G7H A;  3M4O C;  4FM9 A;  3QX3 A;  4KAR A;  5C3E K;  3GTJ C;  5C4J K;  4KN7 A;  3L4K A;  3S2H C;  3TFI A;  1ZVU A;  2GSO A;  3S1M K;  4KMU A;  2FQO A;  2VUM K;  3HOZ C;  1TWH K;  2XCR B;  1XPP A;  1ISE A;  2GAG C;  1JQW A;  3A8K A;  3A8I A;  3ERE D;  3K7A C;  2JA8 K;  3WOD A;  4A3L K;  1O29 A;  2KWA A;  1G51 A;  3M4O K;  2B63 A;  5E68 A;  4O2D A;  3S17 C;  1YX2 A;  1BJT A;  4A3C C;  4PAB A;  2JA5 K;  3GTG C;  2JH3 A;  4WJ4 A;  1WSR A;  2VUM A;  1I50 K;  3GTM C;  5C44 K;  4A3I K;  4GTD A;  4A3B C;  4RMF A;  4AYB D;  5JFE A;  3HOY K;  4Y52 K;  3GTP K;  1IW7 A;  3S0X A;  4A3J C;  1X31 C;  1F93 A;  3GTO C;  2V6T A;  3S2D C;  1O27 A;  3GTP A;  4YFK A;  3SZY A;  4Y7N K;  2NVY K;  2XCO A;  3TTG A;  3I4M K;  1TWG K;  5TMC A;  5CHP A;  1I6H C;  3AQO A;  4P5B A;  4PAA A;  4KN4 A;  1R9T C;  3BP3 A;  1WQG A;  3H0G C;  3JST A;  1TWG C;  3S1Q K;  5C4J C;  2PA8 D;  2PA8 L;  1WCM K;  3S15 C;  2R92 K;  3S1Q C;  5HL8 A;  4OIO A;  1K83 A;  2YU9 K;  3GTQ A;  4BY7 C;  2WAQ L;  1DD5 A;  1SFO K;  1Y1V C;  5IOQ A;  3HOX C;  2NVX C;  5FLM C;  3GTQ K;  4J3N A;  4KDD A;  3FKI K;  1USO A;  3HOV C;  3I4M C;  4KAS A;  3RZD K;  3HOW C;  1JVI A;  2A69 A;  1VGX A;  3ADA C;  4MEX A;  3HOU C;  3L4J A;  1WIH A;  4P5A A;  5M5W K;  4P9S A;  5D4D A;  1Y1W C;  3AD8 C;  5M5X K;  1O2A A;  4A3K K;  3CQZ K;  5C4X K;  3S2H K;  1L0W A;  1EQR A;  1YCL A;  4Q4Z A;  4OIP A;  3S14 C;  2ZFZ A;  4XSZ A;  3AH5 A;  2NVX K;  1Y1W K;  1C0A A;  4WJ3 M;  4MQ9 A;  4YFN A;  1SFO C;  1WOS A;  3GTO K;  3G4A A;  4BLA A;  1O28 A;  2WB1 D;  4AH6 A;  4C2M K;  1TWF K;  4BBR C;  3K7A K;  4OIR A;  5IYD K;  4A3K C;  1R9T K;  1TWA C;  4QJV A;  3GDZ A;  4M1X A;  3GTG K;  2PMZ L;  2NVQ C;  4G7O A;  1O24 A;  1ZQ1 C;  3GTG A;  3S15 K;  1VLO A;  2A6E A;  4WIL A;  4QJV B;  5M3F K;  3GTJ K;  2A6H A;  1PJ5 A;  3N3Y A;  3FOF A;  2E2J C;  1WCM A;  2V6U A;  2B63 C;  1HI9 A;  3HKZ L;  3HOZ K;  4QIW D;  3RZD C;  5IOT A;  3S1R K;  1WOR A;  4NOI A;  2R7Z K;  1WQF A;  3GTK A;  2NVY C;  3MML B;  4KM8 A;  1J6X A;  4GT9 A;  2YU9 A;  1J98 A;  3S16 C;  3GTJ A;  4C3J C;  1PJ6 A;  3AD9 C;  2V6S A;  4BLB A;  4A3M C;  3BUE A;  1O2F B;  4GTB A;  2CW0 A;  1TWC K;  4A3I C;  1EFW A;  1YNJ A;  4G0U A;  2R93 A;  5FLM K;  1VH2 A;  2VUM C;  5IOR A;  2JA7 A;  4QIW L;  2NVT C;  3TFH A;  5IYB C;  1O26 A;  4KB2 A;  2JA6 C;  1EI6 A;  1TWG A;  1B4B A;  2JA8 C;  2R7Z C;  4KMA A;  4C3I C;  1DCO A;  1UV7 A;  1J6W A;  5CJ9 A;  4C3J K;  1USM A;  4LQY A;  4A3C K;  3S16 K;  4KMD A;  3FHZ A;  3GTL K;  5FJ8 K;  1XZP A;  4A3B K;  1I6V A;  3CQZ C;  5C4X C;  4G0V A;  1I50 C;  1WCM C;  3T01 A;  1INN A;  1Y1V K;  2R92 A;  2B63 K;  4A93 C;  4C3H C;  4YFX A;  4Y52 C;  3OPF A;  3HOY C;  3OEP A;  1BGW A;  3GTK C;  3I4N C;  4BKW A;  2XCQ A;  4OIQ A;  2ZUE A;  2JA5 C;  1I50 A;  4KMH A;  4KM9 A;  4A3G C;  1SFO A;  3T02 A;  3HOW K;  4KAT A;  1K83 C;  1O2B A;  2E2I A;  1XZQ A;  1GE9 A;  3PO2 K;  1ZBS A;  4XLP A;  3FKI A;  1WOP A;  3S1N K;  2NVX A;  2E2I K;  4LR2 A;  1PJ7 A;  4A3J K;  2E2H C;  1B4A A;  2BE5 A;  1F7U A;  3PO3 K;  2NVT K;  2D6F C;  3S14 K;  2GAH C;  3HXA A;  2RH6 A;  4A3F C;  3V4G A;  4DDQ A;  4LJZ A;  1RU0 A;  3HOU K;  4BXX C;  3Q3Q A;  1BDF A;  4G7Z A;  4ZH4 A;  4X6A C;  2WB1 L; 
#chains in the Genus database with same CATH homology
 4A3M K;  3S1M C;  3EQL A;  4Y7N K;  2NVY K;  3S2D K;  4A3E C;  3GTP C;  3HOX K;  3S16 C;  3I4M K;  1ZYR A;  2E2I C;  4C3H K;  1TWG K;  4GZY A;  2PPB A;  4MEY A;  5TMC A;  5IP7 K;  1I6H C;  4A3M C;  4KN4 A;  5TMF A;  1HQM A;  1R9T C;  3PO3 C;  5IYD C;  2CW0 A;  1TWC K;  3H0G C;  4A3I C;  2E2J K;  2JA7 C;  4OIN A;  1TWG C;  1YNJ A;  3S1Q K;  1I3Q C;  2PA8 D;  5IYC K;  5C4J C;  3H3V L;  2PA8 L;  3H3V D;  5FLM K;  4A3L C;  1WCM K;  2VUM C;  4Q5S A;  3S15 C;  2R92 K;  4LLG A;  4QIW L;  5M5Y K;  2NVT C;  3S1Q C;  4OIO A;  4A3F K;  2YU9 K;  4BY7 C;  5IYB C;  4XLN A;  2WAQ L;  1SMY A;  2JA7 K;  1SFO K;  1Y1V C;  2JA6 C;  5C44 C;  4BY1 C;  3HOX C;  1TWA K;  4X6A K;  2NVX C;  5FLM C;  2JA8 C;  3GTQ K;  3M3Y C;  2PMZ D;  2R7Z C;  2R93 C;  3FKI K;  3HOV C;  5IP7 C;  1TWC C;  3I4M C;  1TWH C;  2E2H K;  2O5J A;  4C3J K;  3GTL C;  3RZD K;  2NVQ K;  4A3C K;  4A3E K;  4AYB L;  3S16 K;  3S1N C;  4JK1 A;  3HOW C;  3RZO K;  5IYC C;  3GTL K;  2A69 A;  2Y0S L;  5FJ8 K;  4MEX A;  3GTM K;  3HOU C;  1YNN A;  4A3D K;  1TWF C;  2A68 A;  4A3B K;  4Y7N C;  1I6V A;  3CQZ C;  4YG2 A;  3RZO C;  5C4X C;  5M5W K;  1I50 C;  5D4D A;  5C3E C;  1Y1W C;  1WCM C;  4XSX A;  5IP9 C;  5M5X K;  4A3K K;  1Y1V K;  4LK1 A;  2JA6 K;  2B63 K;  3CQZ K;  5C4X K;  3S2H K;  4LK0 A;  2WAQ D;  4A93 C;  4BBR K;  4C3I K;  5M3M K;  5IYB K;  3GTK K;  3I4N K;  5IP9 K;  4OIP A;  4Q4Z A;  3S14 C;  4XSZ A;  4YFX A;  4Y52 C;  3HOY C;  4G7H A;  3M4O C;  2NVX K;  5C3E K;  1Y1W K;  2Y0S D;  3GTJ C;  3GTK C;  4MQ9 A;  1I3Q K;  5C4J K;  3I4N C;  3S17 K;  4YFN A;  4KN7 A;  1SFO C;  3GTO K;  3S2H C;  4OIQ A;  2WB1 D;  4BBS K;  3S1M K;  3HKZ D;  4KMU A;  3PO2 C;  2VUM K;  3HOZ C;  2JA5 C;  4C2M K;  1TWF K;  1TWH K;  1K83 K;  4BBR C;  1XPP A;  3K7A K;  4OIR A;  5IYD K;  4A3G C;  3DXJ A;  4A3K C;  4A3D C;  3HOW K;  3FKI C;  1K83 C;  1R9T K;  3HOV K;  1TWA C;  4A93 K;  4QJV A;  3K7A C;  3GTG K;  2JA8 K;  3WOD A;  3GTQ C;  3PO2 K;  4A3L K;  4XLP A;  2PMZ L;  2NVQ C;  3S1N K;  3M4O K;  4G7O A;  2E2I K;  4A3J K;  3S1R C;  2E2H C;  3S15 K;  3S17 C;  2BE5 A;  3PO3 K;  2NVT K;  2A6E A;  4A3C C;  2JA5 K;  3GTG C;  4QJV B;  5M3F K;  3GTJ K;  4BBS C;  3S14 K;  1I50 K;  3GTM C;  5C44 K;  2A6H A;  4BY1 K;  4BXX K;  4A3G K;  3H0G K;  4A3I K;  2E2J C;  4A3B C;  3M3Y K;  2B63 C;  4A3F C;  2YU9 C;  4BY7 K;  4AYB D;  3HKZ L;  3HOZ K;  1I6H K;  3HOY K;  4Y52 K;  3GTP K;  4LJZ A;  4QIW D;  1IW7 A;  3RZD C;  4A3J C;  3S1R K;  2O5I A;  3HOU K;  4BXX C;  4NOI A;  2R7Z K;  2R93 K;  2R92 C;  1BDF A;  4G7Z A;  2NVY C;  4ZH4 A;  3GTO C;  3S2D C;  4X6A C;  2WB1 L;  4YFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...