3S14K

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s14K00
4C3JK 2E2HK 3S1QC 2Y0SD 2A69A 4OIRA 5TMFA 5C44K 3S16K 1I3QK 2A6HA 1SFOC 3GTOC 3HOXC 4C3HK 3GTJK 2B63C 4BY1K 3PO2C 1I6HK 2R93C 4XSXA 4A3KC 5IP9K 4A3IK 3GTPC 5FLMK 3S2DK 1K83K 4A3EK 4A3FC 3S2HC 4MQ9A 3HOZK 2CW0A 4MEXA 3S1QK 4BBSK 4LLGA 4XSZA 4LK0A 4A3MK 2E2IC 1SFOK 4OINA 3HOXK 3GTOK 4QIWD 3S1NC 3PO2K 1TWHC 4AYBL 5M3MK 1Y1VC 3HOVC 2O5JA 1HQMA 3RZDC 3S2HK 4A3FK 4JK1A 3I4NK 4G7OA 3HOWC 2NVQC 4Y7NK 2R7ZK 1TWFK 5IP7C 4Q5SA 3S1MC 3S1NK 2WAQL 3K7AC 3CQZC 1IW7A 1TWAC 5C4XK 1Y1VK 2JA7C 3HOVK 4A93C 3I4MC 3HKZL 3S14C 4QJVA 4C3IK 4X6AC 4A3LK 2NVQK 2JA8K 3H0GC 5M5YK 4YG2A 1YNNA 5IP7K 3S1RC 2YU9C 2JA6C 4MEYA 4XLPA 3K7AK 4A3JC 2NVTK 1TWAK 3H3VL 3S14K 3S17C 4A93K 4BBRC 3I4MK 2O5IA 3GTLC 1YNJA 2WB1L 2B63K 2E2JC 3S15C 4X6AK 2PMZL 3DXJA 3FKIC 2NVYC 2R93K 1I50C 4A3KK 3GTPK 4A3BC 3H0GK 3WODA 3S1RK 2YU9K 3RZOK 2JA6K 4A3JK 4AYBD 4G7ZA 3EQLA 1TWGC 4BY7C 4BBRK 2BE5A 4QJVB 5IYDC 2A68A 5M5WK 2E2IK 2R92K 3S15K 1TWCC 1TWHK 1I50K 4A3BK 5IYBC 3RZDK 5C4JC 4OIQA 4G7HA 3HOWK 4A3CC 4BY7K 3HKZD 5D4DA 2VUMC 5M3FK 2R92C 5IYDK 4OIPA 3S1MK 1R9TC 1TWCK 3HOUC 4KN7A 3CQZK 2JA7K 4BBSC 4BXXC 1SMYA 3M3YC 3GTGC 1WCMC 4OIOA 5C4JK 5C44C 2NVXC 4Q4ZA 3H3VD 3S16C 4A3CK 3GTJC 3RZOC 2PA8L 4KMUA 1I6HC 2VUMK 5IP9C 4C2MK 4A3IC 1ZYRA 2WB1D 4LJZA 2Y0SL 4A3EC 1R9TK 2PMZD 4ZH4A 3GTKC 3HOUK 2PPBA 3HOZC 3S17K 4YFKA 4BXXK 3M3YK 2A6EA 1WCMK 3GTGK 2NVXK 3GTLK 3PO3C 4A3MC 3M4OK 4A3DC 2E2JK 3GTQC 3FKIK 2NVYK 5FJ8K 2JA5C 4KN4A 5M5XK 4Y52C 3GTKK 3GTMC 3HOYC 4A3GC 2WAQD 5C3EC 1TWGK 3I4NC 5TMCA 4QIWL 3PO3K 4Y7NC 2R7ZC 1TWFC 4A3DK 3GTQK 4XLNA 5IYCC 1Y1WC 2JA5K 3HOYK 3M4OC 5C4XC 4Y52K 2E2HC 3GTMK 5IYBK 4A3GK 4LK1A 4YFNA 1I3QC 5C3EK 4YFXA 4BY1C 4NOIA 4A3LC 4GZYA 2JA8C 1XPPA 5FLMC 3S2DC 1K83C 2PA8D 1BDFA 2NVTC 1Y1WK 5IYCK 1I6VA
chains in the Genus database with same CATH superfamily
3G4CA 3OREA 2Y0SD 2A69A 4OIRA 5C44K 1I3QK 1SFOC 3AQOA 3GTJK 4BY1K 3FOFA 1I6HK 2R93C 4A3KC 4KC6A 3N3YA 2PHCB 4MQ9A 4LOWA 4AH6A 1SFOK 2GSNA 4KMHA 4QIWD 4AYBL 5M3MK 1VRQC 1HQMA 3HOWC 2NVQC 4P9SA 4Y7NK 5TJ3A 4G0UA 1EQRA 5IP7C 1TWAC 2GSUA 3AQPA 1VGXA 1O2AA 2JA7A 4QJVA 4C3IK 3BP3A 2NVQK 2JA8K 5JVOA 3H0GC 5M5YK 5IP7K 2JA6C 3H3VL 3S14K 1TWAK 3S17C 3FOEA 4KM9A 1YNJA 3S15C 2PMZL 2NVYC 3GTPK 2W7VA 3H0GK 2JA6K 4BY7C 1INNA 4KMDA 4QJVB 2E2IK 2A68A 3S15K 1TWHK 3T01A 4KAWX 5C4JC 3A8KA 4GFQA 1PJ6A 4BY7K 4C2MC 1F93A 4OIPA 1F7VA 1EI6A 1R9TA 1SMYA 4C3JC 4KDDA 5C4JK 4KARA 4P5AA 3BUEA 2PA8L 1WOOA 3GTJA 4C2MK 1ZYRA 4A3EC 3GTKA 1ZXOA 3HOZC 1WOSA 3GTLK 1O2BA 4A3DC 3GTQC 2JA5C 4Y52C 1IL2A 4GTCA 3GTMC 4A3GC 2WAQD 5C3EC 4G0VA 1O2FB 1WORA 4KMAA 4A3DK 3GTQK 4DDQA 2JA5K 5C4XC 4Y52K 3GTMK 4A3GK 4O2DA 2E2HA 4YFNA 5C3EK 4YFXA 1WSRA 4GTFA 1WQGA 4P5BA 2V6SA 5EGHA 3GTOC 1WQFA 4C3HK 1KQ4A 1AB4A 2B63C 1IBAA 4FM9A 3GTPA 3BP8C 4C45A 2CW0A 1L0WA 3GTOK 4KB4A 2E2IA 4J3NA 3HOVC 2O5JA 1TWHA 1Y1VA 3I4NK 4G7OA 3GIRA 1USMA 3S1MC 1V5VA 3T00A 1YCLA 2WAQL 3CQZC 1IW7A 3HOVK 4GT9A 1ZQ1C 5IOQA 1XXBA 4WILA 3L4JA 3IPJA 2XCRB 4A3LK 1PJ5A 3ADAC 2GAHC 3GDZA 4YG2A 1YNNA 3TFIA 1J6WA 2NVTK 2YU9A 3S0XA 4KM8A 1YX2A 2O5IA 2WB1L 2R93K 3FKIC 4A3KK 1XZPB 1I50A 1TWGC 5M5WK 3N0BA 1TWCC 2V6TA 4WJ4A 5IYBC 4OIQA 4G7HA 1XXAA 1O26A 2CFAB 3HOWK 5CJ9A 2ZFZA 3HKZD 2VUMC 1XXCA 4KASA 1TWCK 2R92A 4BXXC 4WJ3M 4GTBA 1F9NA 1O27A 3JSTA 3S16C 3GTGA 1WCMA 3TTGA 2NVXA 1ZVUA 1DCPA 1G51A 2VUMK 5IP9C 4A3IC 2ZUEA 2Y0SL 4ZH4A 3T02A 3S17K 4BXXK 2XCOA 2A6EA 4A3MC 1EH1A 1HI9A 1B4AA 1O24A 2NVYK 3HOYC 5HL8A 2KWAA 2FQOA 4QIWL 1IS1A 2R7ZC 1TWFC 4G0WA 1Y1WC 3M4OC 3HOYK 1WQHA 3AH5A 1I3QA 5IOSA 1BJTA 4GZYA 1DCHA 2JH3A 5JFEA 3S2DC 1K83C 1BDFA 1Y1WK 3M4OK 4C3JK 3S1QC 5TMFA 3AD9C 3HOXC 3HXAA 1SFOA 1USOA 2R93A 3S2DK 1ZBSA 1K83K 4A3EK 4LQYA 1DD5A 3HOZK 1WOPA 3S1QK 1RU0A 2V6UA 3HOXK 2EBBA 3VA7A 3RZDC 3NUHA 3TFHA 4GTDA 1JVIA 4Q5SA 3K7AC 5C4XK 2JA7C 4GTEA 1TWAA 5L46A 5CHPA 3GEHA 3S1RC 3RZOC 3H0GA 4A3JC 4XLPA 3K7AK 2JA6A 1X31C 1WSVA 2B63K 2E2JC 3DXJA 4A3BC 3WODA 3S1RK 3RZOK 4A3JK 4AYBD 1EK8A 2P5MA 4G7ZA 4RMFA 2BE5A 3LAPA 2ZUFA 1XZPA 3ERED 4PAAA 4A3BK 2D6FC 3G4AA 4BLAA 2FQTA 5D4DA 5M3FK 3S1MK 1R9TC 4KB2A 3HOUC 3CQZK 4BBSC 3AD8C 2CFAA 3M3YC 3CAGA 4OIOA 3H3VD 5C44C 4Q4ZA 5IOTA 4ILDA 3GEIA 3GTLA 3GTJC 2RGRA 2GSOA 1I6HC 3GTKC 1R9TK 2PMZD 3HOUK 3M3YK 3GEEA 1VH2A 1WIHA 3L4KA 2XCQA 3FKIK 3GTQA 1J6VA 3GTKK 2JA5A 3GTMA 1TWGK 3OEPA 2P8TA 4Y7NC 4XLNA 5IYCC 5IORA 2E2HC 5IYBK 4LK1A 3AD7C 3GSIA 4C3IC 4NOIA 3V4GA 2JA8C 1VLOA 1XPPA 1O28A 5FLMC 2PA8D 3S14C 5IYCK 1I6VA 2E2HK 3S16K 4KATA 2A6HA 1ISEA 3GTOA 3A8JA 4GTAA 3PO2C 2B63A 4XSXA 3GTPC 5IP9K 4A3IK 5FLMK 3S2HC 4A3FC 1UV7A 1F7UA 1B4BA 1C0AA 4MEXA 2GAGC 4LLGA 4XSZA 4LK0A 4A3MK 2E2IC 4OINA 1VJEA 3S1NC 3PO2K 1TWHC 1XZQA 1Y1VC 3MMLB 3S2HK 4A3FK 4JK1A 3LPXA 3TFJA 2R7ZK 1TWFK 1BGWA 3S1NK 1Y1VK 4A93C 3CQZA 4PABA 3I4MC 3HKZL 4X6AC 1GE9A 1PJ7A 2YU9C 3LAJA 1XZQB 3N0CA 4MEYA 1IE0A 4A93K 4BBRC 3I4MK 3GTLC 2RH6A 1DCOA 4X6AK 1I50C 1BS2A 3SZZA 3FKIA 3Q3QA 2YU9K 3EQLA 1JOEA 1J6XA 4BBRK 4FZBA 1TWGA 5IYDC 4GTLA 1I50K 1TWCA 3QX3A 3RZDK 3FHZA 4LR2A 4A3CC 5IYDK 2R92C 2VUMA 5EGEA 4KN7A 2JA7K 3GTGC 1WCMC 2NVXC 4C3HC 4A3CK 1O29A 4KMUA 2R92K 2NVYA 2WB1D 4LJZA 1IQ0A 2PPBA 4YFKA 3PO3C 3GTGK 1WCMK 2NVXK 4XCHA 4BKWA 2E2JK 5FJ8K 4KN4A 5M5XK 5E68A 1J98A 3A8IA 3SZYA 3I4NC 5TMCA 3PO3K 1EFWA 1JQWA 2R7ZA 1TWFA 1O25A 1Y1WA 4M1XA 1I3QC 2Y3PA 4BLBA 4BY1C 4A3LC 3OPFA 2NVTC 1K83A 4BBSK
chains in the Genus database with same CATH topology
4C3JK 2E2HK 3S1QC 2Y0SD 2A69A 4OIRA 5TMFA 5C44K 3S16K 1I3QK 2A6HA 1SFOC 3GTOC 3HOXC 4C3HK 3GTJK 2B63C 4BY1K 3PO2C 1I6HK 2R93C 4XSXA 4A3KC 5IP9K 4A3IK 3GTPC 5FLMK 3S2DK 1K83K 4A3EK 4A3FC 3S2HC 4MQ9A 3HOZK 2CW0A 4MEXA 3S1QK 4BBSK 4LLGA 4XSZA 4LK0A 4A3MK 2E2IC 1SFOK 4OINA 3HOXK 3GTOK 4QIWD 3S1NC 3PO2K 1TWHC 4AYBL 5M3MK 1Y1VC 3HOVC 2O5JA 1HQMA 3RZDC 3S2HK 4A3FK 4JK1A 3I4NK 4G7OA 3HOWC 2NVQC 4Y7NK 2R7ZK 1TWFK 5IP7C 4Q5SA 3S1MC 3S1NK 2WAQL 3K7AC 3CQZC 1IW7A 1TWAC 5C4XK 1Y1VK 2JA7C 3HOVK 4A93C 3I4MC 3HKZL 3S14C 4QJVA 4C3IK 4X6AC 4A3LK 2NVQK 2JA8K 3H0GC 5M5YK 4YG2A 1YNNA 5IP7K 3S1RC 2YU9C 2JA6C 4MEYA 4XLPA 3K7AK 4A3JC 2NVTK 1TWAK 3H3VL 3S14K 3S17C 4A93K 4BBRC 3I4MK 2O5IA 3GTLC 1YNJA 2WB1L 2B63K 2E2JC 3S15C 4X6AK 2PMZL 3DXJA 3FKIC 2NVYC 2R93K 1I50C 4A3KK 3GTPK 4A3BC 3H0GK 3WODA 3S1RK 2YU9K 3RZOK 2JA6K 4A3JK 4AYBD 4G7ZA 3EQLA 1TWGC 4BY7C 4BBRK 2BE5A 4QJVB 5IYDC 2A68A 5M5WK 2E2IK 2R92K 3S15K 1TWCC 1TWHK 1I50K 4A3BK 5IYBC 3RZDK 5C4JC 4OIQA 4G7HA 3HOWK 4A3CC 4BY7K 3HKZD 5D4DA 2VUMC 5M3FK 2R92C 5IYDK 4OIPA 3S1MK 1R9TC 1TWCK 3HOUC 4KN7A 3CQZK 2JA7K 4BBSC 4BXXC 1SMYA 3M3YC 3GTGC 1WCMC 4OIOA 5C4JK 5C44C 2NVXC 4Q4ZA 3H3VD 3S16C 4A3CK 3GTJC 3RZOC 2PA8L 4KMUA 1I6HC 2VUMK 5IP9C 4C2MK 4A3IC 1ZYRA 2WB1D 4LJZA 2Y0SL 4A3EC 1R9TK 2PMZD 4ZH4A 3GTKC 3HOUK 2PPBA 3HOZC 3S17K 4YFKA 4BXXK 3M3YK 2A6EA 1WCMK 3GTGK 2NVXK 3GTLK 3PO3C 4A3MC 3M4OK 4A3DC 2E2JK 3GTQC 3FKIK 2NVYK 5FJ8K 2JA5C 4KN4A 5M5XK 4Y52C 3GTKK 3GTMC 3HOYC 4A3GC 2WAQD 5C3EC 1TWGK 3I4NC 5TMCA 4QIWL 3PO3K 4Y7NC 2R7ZC 1TWFC 4A3DK 3GTQK 4XLNA 5IYCC 1Y1WC 2JA5K 3HOYK 3M4OC 5C4XC 4Y52K 2E2HC 3GTMK 5IYBK 4A3GK 4LK1A 4YFNA 1I3QC 5C3EK 4YFXA 4BY1C 4NOIA 4A3LC 4GZYA 2JA8C 1XPPA 5FLMC 3S2DC 1K83C 2PA8D 1BDFA 2NVTC 1Y1WK 5IYCK 1I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J K;  2E2H K;  3S1Q C;  2Y0S D;  2A69 A;  4OIR A;  5TMF A;  5C44 K;  3S16 K;  1I3Q K;  2A6H A;  1SFO C;  3GTO C;  3HOX C;  4C3H K;  3GTJ K;  2B63 C;  4BY1 K;  3PO2 C;  1I6H K;  2R93 C;  4XSX A;  4A3K C;  5IP9 K;  4A3I K;  3GTP C;  5FLM K;  3S2D K;  1K83 K;  4A3E K;  4A3F C;  3S2H C;  4MQ9 A;  3HOZ K;  2CW0 A;  4MEX A;  3S1Q K;  4BBS K;  4LLG A;  4XSZ A;  4LK0 A;  4A3M K;  2E2I C;  1SFO K;  4OIN A;  3HOX K;  3GTO K;  4QIW D;  3S1N C;  3PO2 K;  1TWH C;  4AYB L;  5M3M K;  1Y1V C;  3HOV C;  2O5J A;  1HQM A;  3RZD C;  3S2H K;  4A3F K;  4JK1 A;  3I4N K;  4G7O A;  3HOW C;  2NVQ C;  4Y7N K;  2R7Z K;  1TWF K;  5IP7 C;  4Q5S A;  3S1M C;  3S1N K;  2WAQ L;  3K7A C;  3CQZ C;  1IW7 A;  1TWA C;  5C4X K;  1Y1V K;  2JA7 C;  3HOV K;  4A93 C;  3I4M C;  3HKZ L;  3S14 C;  4QJV A;  4C3I K;  4X6A C;  4A3L K;  2NVQ K;  2JA8 K;  3H0G C;  5M5Y K;  4YG2 A;  1YNN A;  5IP7 K;  3S1R C;  2YU9 C;  2JA6 C;  4MEY A;  4XLP A;  3K7A K;  4A3J C;  2NVT K;  1TWA K;  3H3V L;  3S14 K;  3S17 C;  4A93 K;  4BBR C;  3I4M K;  2O5I A;  3GTL C;  1YNJ A;  2WB1 L;  2B63 K;  2E2J C;  3S15 C;  4X6A K;  2PMZ L;  3DXJ A;  3FKI C;  2NVY C;  2R93 K;  1I50 C;  4A3K K;  3GTP K;  4A3B C;  3H0G K;  3WOD A;  3S1R K;  2YU9 K;  3RZO K;  2JA6 K;  4A3J K;  4AYB D;  4G7Z A;  3EQL A;  1TWG C;  4BY7 C;  4BBR K;  2BE5 A;  4QJV B;  5IYD C;  2A68 A;  5M5W K;  2E2I K;  2R92 K;  3S15 K;  1TWC C;  1TWH K;  1I50 K;  4A3B K;  5IYB C;  3RZD K;  5C4J C;  4OIQ A;  4G7H A;  3HOW K;  4A3C C;  4BY7 K;  3HKZ D;  5D4D A;  2VUM C;  5M3F K;  2R92 C;  5IYD K;  4OIP A;  3S1M K;  1R9T C;  1TWC K;  3HOU C;  4KN7 A;  3CQZ K;  2JA7 K;  4BBS C;  4BXX C;  1SMY A;  3M3Y C;  3GTG C;  1WCM C;  4OIO A;  5C4J K;  5C44 C;  2NVX C;  4Q4Z A;  3H3V D;  3S16 C;  4A3C K;  3GTJ C;  3RZO C;  2PA8 L;  4KMU A;  1I6H C;  2VUM K;  5IP9 C;  4C2M K;  4A3I C;  1ZYR A;  2WB1 D;  4LJZ A;  2Y0S L;  4A3E C;  1R9T K;  2PMZ D;  4ZH4 A;  3GTK C;  3HOU K;  2PPB A;  3HOZ C;  3S17 K;  4YFK A;  4BXX K;  3M3Y K;  2A6E A;  1WCM K;  3GTG K;  2NVX K;  3GTL K;  3PO3 C;  4A3M C;  3M4O K;  4A3D C;  2E2J K;  3GTQ C;  3FKI K;  2NVY K;  5FJ8 K;  2JA5 C;  4KN4 A;  5M5X K;  4Y52 C;  3GTK K;  3GTM C;  3HOY C;  4A3G C;  2WAQ D;  5C3E C;  1TWG K;  3I4N C;  5TMC A;  4QIW L;  3PO3 K;  4Y7N C;  2R7Z C;  1TWF C;  4A3D K;  3GTQ K;  4XLN A;  5IYC C;  1Y1W C;  2JA5 K;  3HOY K;  3M4O C;  5C4X C;  4Y52 K;  2E2H C;  3GTM K;  5IYB K;  4A3G K;  4LK1 A;  4YFN A;  1I3Q C;  5C3E K;  4YFX A;  4BY1 C;  4NOI A;  4A3L C;  4GZY A;  2JA8 C;  1XPP A;  5FLM C;  3S2D C;  1K83 C;  2PA8 D;  1BDF A;  2NVT C;  1Y1W K;  5IYC K;  1I6V A; 
#chains in the Genus database with same CATH topology
 3G4C A;  3ORE A;  2Y0S D;  2A69 A;  4OIR A;  5C44 K;  1I3Q K;  1SFO C;  3AQO A;  3GTJ K;  4BY1 K;  3FOF A;  1I6H K;  2R93 C;  4A3K C;  4KC6 A;  3N3Y A;  2PHC B;  4MQ9 A;  4LOW A;  4AH6 A;  1SFO K;  2GSN A;  4KMH A;  4QIW D;  4AYB L;  5M3M K;  1VRQ C;  1HQM A;  3HOW C;  2NVQ C;  4P9S A;  4Y7N K;  5TJ3 A;  4G0U A;  1EQR A;  5IP7 C;  1TWA C;  2GSU A;  3AQP A;  1VGX A;  1O2A A;  2JA7 A;  4QJV A;  4C3I K;  3BP3 A;  2NVQ K;  2JA8 K;  5JVO A;  3H0G C;  5M5Y K;  5IP7 K;  2JA6 C;  3H3V L;  3S14 K;  1TWA K;  3S17 C;  3FOE A;  4KM9 A;  1YNJ A;  3S15 C;  2PMZ L;  2NVY C;  3GTP K;  2W7V A;  3H0G K;  2JA6 K;  4BY7 C;  1INN A;  4KMD A;  4QJV B;  2E2I K;  2A68 A;  3S15 K;  1TWH K;  3T01 A;  4KAW X;  5C4J C;  3A8K A;  4GFQ A;  1PJ6 A;  4BY7 K;  4C2M C;  1F93 A;  4OIP A;  1F7V A;  1EI6 A;  1R9T A;  1SMY A;  4C3J C;  4KDD A;  5C4J K;  4KAR A;  4P5A A;  3BUE A;  2PA8 L;  1WOO A;  3GTJ A;  4C2M K;  1ZYR A;  4A3E C;  3GTK A;  1ZXO A;  3HOZ C;  1WOS A;  3GTL K;  1O2B A;  4A3D C;  3GTQ C;  2JA5 C;  4Y52 C;  1IL2 A;  4GTC A;  3GTM C;  4A3G C;  2WAQ D;  5C3E C;  4G0V A;  1O2F B;  1WOR A;  4KMA A;  4A3D K;  3GTQ K;  4DDQ A;  2JA5 K;  5C4X C;  4Y52 K;  3GTM K;  4A3G K;  4O2D A;  2E2H A;  4YFN A;  5C3E K;  4YFX A;  1WSR A;  4GTF A;  1WQG A;  4P5B A;  2V6S A;  5EGH A;  3GTO C;  1WQF A;  4C3H K;  1KQ4 A;  1AB4 A;  2B63 C;  1IBA A;  4FM9 A;  3GTP A;  3BP8 C;  4C45 A;  2CW0 A;  1L0W A;  3GTO K;  4KB4 A;  2E2I A;  4J3N A;  3HOV C;  2O5J A;  1TWH A;  1Y1V A;  3I4N K;  4G7O A;  3GIR A;  1USM A;  3S1M C;  1V5V A;  3T00 A;  1YCL A;  2WAQ L;  3CQZ C;  1IW7 A;  3HOV K;  4GT9 A;  1ZQ1 C;  5IOQ A;  1XXB A;  4WIL A;  3L4J A;  3IPJ A;  2XCR B;  4A3L K;  1PJ5 A;  3ADA C;  2GAH C;  3GDZ A;  4YG2 A;  1YNN A;  3TFI A;  1J6W A;  2NVT K;  2YU9 A;  3S0X A;  4KM8 A;  1YX2 A;  2O5I A;  2WB1 L;  2R93 K;  3FKI C;  4A3K K;  1XZP B;  1I50 A;  1TWG C;  5M5W K;  3N0B A;  1TWC C;  2V6T A;  4WJ4 A;  5IYB C;  4OIQ A;  4G7H A;  1XXA A;  1O26 A;  2CFA B;  3HOW K;  5CJ9 A;  2ZFZ A;  3HKZ D;  2VUM C;  1XXC A;  4KAS A;  1TWC K;  2R92 A;  4BXX C;  4WJ3 M;  4GTB A;  1F9N A;  1O27 A;  3JST A;  3S16 C;  3GTG A;  1WCM A;  3TTG A;  2NVX A;  1ZVU A;  1DCP A;  1G51 A;  2VUM K;  5IP9 C;  4A3I C;  2ZUE A;  2Y0S L;  4ZH4 A;  3T02 A;  3S17 K;  4BXX K;  2XCO A;  2A6E A;  4A3M C;  1EH1 A;  1HI9 A;  1B4A A;  1O24 A;  2NVY K;  3HOY C;  5HL8 A;  2KWA A;  2FQO A;  4QIW L;  1IS1 A;  2R7Z C;  1TWF C;  4G0W A;  1Y1W C;  3M4O C;  3HOY K;  1WQH A;  3AH5 A;  1I3Q A;  5IOS A;  1BJT A;  4GZY A;  1DCH A;  2JH3 A;  5JFE A;  3S2D C;  1K83 C;  1BDF A;  1Y1W K;  3M4O K;  4C3J K;  3S1Q C;  5TMF A;  3AD9 C;  3HOX C;  3HXA A;  1SFO A;  1USO A;  2R93 A;  3S2D K;  1ZBS A;  1K83 K;  4A3E K;  4LQY A;  1DD5 A;  3HOZ K;  1WOP A;  3S1Q K;  1RU0 A;  2V6U A;  3HOX K;  2EBB A;  3VA7 A;  3RZD C;  3NUH A;  3TFH A;  4GTD A;  1JVI A;  4Q5S A;  3K7A C;  5C4X K;  2JA7 C;  4GTE A;  1TWA A;  5L46 A;  5CHP A;  3GEH A;  3S1R C;  3RZO C;  3H0G A;  4A3J C;  4XLP A;  3K7A K;  2JA6 A;  1X31 C;  1WSV A;  2B63 K;  2E2J C;  3DXJ A;  4A3B C;  3WOD A;  3S1R K;  3RZO K;  4A3J K;  4AYB D;  1EK8 A;  2P5M A;  4G7Z A;  4RMF A;  2BE5 A;  3LAP A;  2ZUF A;  1XZP A;  3ERE D;  4PAA A;  4A3B K;  2D6F C;  3G4A A;  4BLA A;  2FQT A;  5D4D A;  5M3F K;  3S1M K;  1R9T C;  4KB2 A;  3HOU C;  3CQZ K;  4BBS C;  3AD8 C;  2CFA A;  3M3Y C;  3CAG A;  4OIO A;  3H3V D;  5C44 C;  4Q4Z A;  5IOT A;  4ILD A;  3GEI A;  3GTL A;  3GTJ C;  2RGR A;  2GSO A;  1I6H C;  3GTK C;  1R9T K;  2PMZ D;  3HOU K;  3M3Y K;  3GEE A;  1VH2 A;  1WIH A;  3L4K A;  2XCQ A;  3FKI K;  3GTQ A;  1J6V A;  3GTK K;  2JA5 A;  3GTM A;  1TWG K;  3OEP A;  2P8T A;  4Y7N C;  4XLN A;  5IYC C;  5IOR A;  2E2H C;  5IYB K;  4LK1 A;  3AD7 C;  3GSI A;  4C3I C;  4NOI A;  3V4G A;  2JA8 C;  1VLO A;  1XPP A;  1O28 A;  5FLM C;  2PA8 D;  3S14 C;  5IYC K;  1I6V A;  2E2H K;  3S16 K;  4KAT A;  2A6H A;  1ISE A;  3GTO A;  3A8J A;  4GTA A;  3PO2 C;  2B63 A;  4XSX A;  3GTP C;  5IP9 K;  4A3I K;  5FLM K;  3S2H C;  4A3F C;  1UV7 A;  1F7U A;  1B4B A;  1C0A A;  4MEX A;  2GAG C;  4LLG A;  4XSZ A;  4LK0 A;  4A3M K;  2E2I C;  4OIN A;  1VJE A;  3S1N C;  3PO2 K;  1TWH C;  1XZQ A;  1Y1V C;  3MML B;  3S2H K;  4A3F K;  4JK1 A;  3LPX A;  3TFJ A;  2R7Z K;  1TWF K;  1BGW A;  3S1N K;  1Y1V K;  4A93 C;  3CQZ A;  4PAB A;  3I4M C;  3HKZ L;  4X6A C;  1GE9 A;  1PJ7 A;  2YU9 C;  3LAJ A;  1XZQ B;  3N0C A;  4MEY A;  1IE0 A;  4A93 K;  4BBR C;  3I4M K;  3GTL C;  2RH6 A;  1DCO A;  4X6A K;  1I50 C;  1BS2 A;  3SZZ A;  3FKI A;  3Q3Q A;  2YU9 K;  3EQL A;  1JOE A;  1J6X A;  4BBR K;  4FZB A;  1TWG A;  5IYD C;  4GTL A;  1I50 K;  1TWC A;  3QX3 A;  3RZD K;  3FHZ A;  4LR2 A;  4A3C C;  5IYD K;  2R92 C;  2VUM A;  5EGE A;  4KN7 A;  2JA7 K;  3GTG C;  1WCM C;  2NVX C;  4C3H C;  4A3C K;  1O29 A;  4KMU A;  2R92 K;  2NVY A;  2WB1 D;  4LJZ A;  1IQ0 A;  2PPB A;  4YFK A;  3PO3 C;  3GTG K;  1WCM K;  2NVX K;  4XCH A;  4BKW A;  2E2J K;  5FJ8 K;  4KN4 A;  5M5X K;  5E68 A;  1J98 A;  3A8I A;  3SZY A;  3I4N C;  5TMC A;  3PO3 K;  1EFW A;  1JQW A;  2R7Z A;  1TWF A;  1O25 A;  1Y1W A;  4M1X A;  1I3Q C;  2Y3P A;  4BLB A;  4BY1 C;  4A3L C;  3OPF A;  2NVT C;  1K83 A;  4BBS K; 
#chains in the Genus database with same CATH homology
 4C3J K;  2E2H K;  3S1Q C;  2Y0S D;  2A69 A;  4OIR A;  5TMF A;  5C44 K;  3S16 K;  1I3Q K;  2A6H A;  1SFO C;  3GTO C;  3HOX C;  4C3H K;  3GTJ K;  2B63 C;  4BY1 K;  3PO2 C;  1I6H K;  2R93 C;  4XSX A;  4A3K C;  5IP9 K;  4A3I K;  3GTP C;  5FLM K;  3S2D K;  1K83 K;  4A3E K;  4A3F C;  3S2H C;  4MQ9 A;  3HOZ K;  2CW0 A;  4MEX A;  3S1Q K;  4BBS K;  4LLG A;  4XSZ A;  4LK0 A;  4A3M K;  2E2I C;  1SFO K;  4OIN A;  3HOX K;  3GTO K;  4QIW D;  3S1N C;  3PO2 K;  1TWH C;  4AYB L;  5M3M K;  1Y1V C;  3HOV C;  2O5J A;  1HQM A;  3RZD C;  3S2H K;  4A3F K;  4JK1 A;  3I4N K;  4G7O A;  3HOW C;  2NVQ C;  4Y7N K;  2R7Z K;  1TWF K;  5IP7 C;  4Q5S A;  3S1M C;  3S1N K;  2WAQ L;  3K7A C;  3CQZ C;  1IW7 A;  1TWA C;  5C4X K;  1Y1V K;  2JA7 C;  3HOV K;  4A93 C;  3I4M C;  3HKZ L;  3S14 C;  4QJV A;  4C3I K;  4X6A C;  4A3L K;  2NVQ K;  2JA8 K;  3H0G C;  5M5Y K;  4YG2 A;  1YNN A;  5IP7 K;  3S1R C;  2YU9 C;  2JA6 C;  4MEY A;  4XLP A;  3K7A K;  4A3J C;  2NVT K;  1TWA K;  3H3V L;  3S14 K;  3S17 C;  4A93 K;  4BBR C;  3I4M K;  2O5I A;  3GTL C;  1YNJ A;  2WB1 L;  2B63 K;  2E2J C;  3S15 C;  4X6A K;  2PMZ L;  3DXJ A;  3FKI C;  2NVY C;  2R93 K;  1I50 C;  4A3K K;  3GTP K;  4A3B C;  3H0G K;  3WOD A;  3S1R K;  2YU9 K;  3RZO K;  2JA6 K;  4A3J K;  4AYB D;  4G7Z A;  3EQL A;  1TWG C;  4BY7 C;  4BBR K;  2BE5 A;  4QJV B;  5IYD C;  2A68 A;  5M5W K;  2E2I K;  2R92 K;  3S15 K;  1TWC C;  1TWH K;  1I50 K;  4A3B K;  5IYB C;  3RZD K;  5C4J C;  4OIQ A;  4G7H A;  3HOW K;  4A3C C;  4BY7 K;  3HKZ D;  5D4D A;  2VUM C;  5M3F K;  2R92 C;  5IYD K;  4OIP A;  3S1M K;  1R9T C;  1TWC K;  3HOU C;  4KN7 A;  3CQZ K;  2JA7 K;  4BBS C;  4BXX C;  1SMY A;  3M3Y C;  3GTG C;  1WCM C;  4OIO A;  5C4J K;  5C44 C;  2NVX C;  4Q4Z A;  3H3V D;  3S16 C;  4A3C K;  3GTJ C;  3RZO C;  2PA8 L;  4KMU A;  1I6H C;  2VUM K;  5IP9 C;  4C2M K;  4A3I C;  1ZYR A;  2WB1 D;  4LJZ A;  2Y0S L;  4A3E C;  1R9T K;  2PMZ D;  4ZH4 A;  3GTK C;  3HOU K;  2PPB A;  3HOZ C;  3S17 K;  4YFK A;  4BXX K;  3M3Y K;  2A6E A;  1WCM K;  3GTG K;  2NVX K;  3GTL K;  3PO3 C;  4A3M C;  3M4O K;  4A3D C;  2E2J K;  3GTQ C;  3FKI K;  2NVY K;  5FJ8 K;  2JA5 C;  4KN4 A;  5M5X K;  4Y52 C;  3GTK K;  3GTM C;  3HOY C;  4A3G C;  2WAQ D;  5C3E C;  1TWG K;  3I4N C;  5TMC A;  4QIW L;  3PO3 K;  4Y7N C;  2R7Z C;  1TWF C;  4A3D K;  3GTQ K;  4XLN A;  5IYC C;  1Y1W C;  2JA5 K;  3HOY K;  3M4O C;  5C4X C;  4Y52 K;  2E2H C;  3GTM K;  5IYB K;  4A3G K;  4LK1 A;  4YFN A;  1I3Q C;  5C3E K;  4YFX A;  4BY1 C;  4NOI A;  4A3L C;  4GZY A;  2JA8 C;  1XPP A;  5FLM C;  3S2D C;  1K83 C;  2PA8 D;  1BDF A;  2NVT C;  1Y1W K;  5IYC K;  1I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...