3S14K

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s14K00
5IYBK 1XPPA 5IYBC 1R9TK 3HOWK 1R9TC 4BBRC 3HOWC 3S1MK 3S1MC 1HQMA 5TMFA 4BBSK 1YNJA 4LJZA 3GTLC 4A3CK 4A3CC 2R92C 5M3FK 2CW0A 2PA8L 4OIOA 4KMUA 1WCMC 1YNNA 5C44K 1WCMK 5C4JK 5C4JC 4A3IK 3PO2C 3PO3K 2PMZD 3HOVC 3H0GC 5IP7K 1TWFC 3HOXC 3FKIK 4XLNA 3GTKK 3FKIC 3WODA 4G7HA 3GTKC 3RZOC 4AYBL 4C3JK 3S1NC 3HOUK 4LK1A 4LLGA 3HOUC 1I6HK 4OIQA 1I6HC 2A69A 5M5YK 4QIWD 1Y1VK 1ZYRA 3K7AC 3K7AK 3DXJA 5M5WK 2E2IK 2R7ZK 4A3EC 5D4DA 4BY1C 4A3EK 3I4NK 4A3GC 4A3GK 3GTPC 2E2HC 1SMYA 4A3JC 3GTJK 3GTPK 4A3JK 3GTOC 3GTOK 2R93C 2WAQL 2R93K 2E2JC 3RZDC 3GTMK 3RZDK 3M3YK 1I3QK 3M3YC 4BXXC 3CQZK 1TWHK 2A6EA 4OIRA 1TWCK 4A3BC 3M4OC 5C4XK 2YU9K 1Y1WC 5M5XK 3S2HK 3S2HC 3HKZL 4XSZA 3GTQC 2Y0SD 4G7ZA 1K83K 2WB1L 1SFOC 3HOYC 4BBRK 2NVYK 3HOYK 2NVYC 4BBSC 3S14C 3S14K 4A3FC 2O5IA 3GTLK 4A3FK 3I4MK 4G7OA 2R92K 4XSXA 3EQLA 2A68A 4Q4ZA 2JA8C 3HOZK 5C44C 3PO3C 4OINA 3S1QC 3HOVK 3S1QK 3H0GK 4QJVB 4Y52K 2PA8D 1TWFK 2NVXC 2NVXK 1TWAK 4XLPA 4A3MC 3H3VD 4YG2A 4A3MK 5IYCK 4Y7NK 5IYCC 1I50C 5FLMC 4MEYA 1I6VA 4A3DC 2E2IC 1TWGK 2R7ZC 1TWGC 4BY1K 3I4NC 5IP9C 5IP9K 2BE5A 2PMZL 4JK1A 4C3IK 4LK0A 4GZYA 3GTGK 4X6AK 3GTGC 4X6AC 3GTMC 5C3EK 5C3EC 4BXXK 2NVTK 3CQZC 3S16K 2NVTC 4AYBD 1TWCC 4A3IC 3PO2K 3S16C 3M4OK 4A3BK 3S15C 5C4XC 3S15K 1Y1WK 2WAQD 4QIWL 4MQ9A 3S1RK 5IP7C 3S1RC 2PPBA 4NOIA 3HOXK 3RZOK 1K83C 4KN7A 2B63C 1SFOK 2JA6C 2B63K 2JA6K 4C3HK 3S1NK 3S2DK 3S2DC 3I4MC 1Y1VC 4QJVA 3HKZD 2JA8K 2Y0SL 1IW7A 4YFNA 3HOZC 4ZH4A 2JA5K 2JA7K 2A6HA 2JA5C 2JA7C 2E2HK 4BY7C 4YFXA 3GTJC 4BY7K 4A3LK 4YFKA 4C2MK 5IYDC 4A93K 4A93C 2NVQK 4Y52C 3S17C 2NVQC 4A3LC 3S17K 4Q5SA 1TWAC 5M3MK 1BDFA 2E2JK 1I3QC 5TMCA 2WB1D 4Y7NC 1TWHC 2VUMK 2VUMC 4A3KK 1I50K 4OIPA 4A3KC 5IYDK 4KN4A 5FLMK 2YU9C 3H3VL 4A3DK 5FJ8K 2O5JA 3GTQK 4MEXA
chains in the Genus database with same CATH superfamily
1R9TK 3BUEA 2R93A 2JA6A 4LJZA 3GTLC 3T02A 2CW0A 4OIOA 4GFQA 1YNNA 4A3IK 4GZYA 4FZBA 2RGRA 1F93A 2FQOA 1TWHA 3SZYA 1EFWA 1TWFC 1VRQC 2P5MA 4KB2A 1I3QA 3GTKC 4G7HA 4LOWA 3S1NC 2EBBA 1IQ0A 3HOUK 1UV7A 4LLGA 3S0XA 1Y1VK 1USMA 3K7AK 3G4AA 5D4DA 2E2HC 1ZQ1C 1SMYA 1O2AA 4A3JK 1EI6A 4GTAA 1DCOA 2R93K 2E2JC 3M3YK 4A3BC 1TWHK 2A6EA 4OIRA 1TWCK 1WOOA 1IS1A 1L0WA 4XCHA 1AB4A 3M4OC 1V5VA 3N3YA 4WJ3M 4GTDA 5L46A 1XZPA 4KDDA 1O24A 4GT9A 1J6VA 2NVYC 4M1XA 3CAGA 4KARA 3GTLK 1WSRA 4G7OA 2R92K 3HOZK 3NUHA 4Y52K 3A8KA 1XXCA 4GTEA 1K83A 1I6VA 1O2BA 3T01A 2R7ZC 4KB4A 3CQZA 1F7UA 4JK1A 3GTKA 1JOEA 1BGWA 1TWFA 3AD9C 3S16K 4A3IC 1O26A 2ZFZA 2WAQD 4MQ9A 1K83C 4KATA 3VA7A 5JFEA 2JA6C 4KM8A 4C3HC 3S1NK 1O28A 1Y1VC 3HKZD 4PABA 4ZH4A 1YX2A 3AD8C 2E2HK 4BY7C 4WILA 3LAPA 4A3LC 3S17K 1WOPA 1WQGA 2VUMC 5IOSA 4A3KK 1DCPA 2YU9C 3AQPA 5FJ8K 2RH6A 3GEIA 2O5JA 3GTQK 2Y3PA 5IYBK 5IYBC 3HOWK 4PAAA 1HQMA 1R9TA 1EK8A 1O27A 1WCMC 3PO2C 3T00A 1WCMK 5C44K 2YU9A 5E68A 3H0GC 2CFAB 5IP7K 3RZOC 3FKIK 3FKIC 4AYBL 1SFOA 3L4JA 2GSNA 1WOSA 4LK1A 1B4AA 1I6HC 4OIQA 1EH1A 4LR2A 1TWGA 4A3EC 3I4NK 4A3EK 1I50A 1GE9A 1IL2A 1WSVA 2WAQL 3GTOA 1I3QK 4G0VA 1IBAA 1TWCA 1ZBSA 1XZQA 3S2HC 3HKZL 3N0CA 4XSZA 2Y0SD 4BBRK 3S14C 3BP3A 1HI9A 3I4MK 1KQ4A 3IPJA 2JA5A 2JA7A 5C44C 3PO3C 1WCMA 3FHZA 5TJ3A 4G0WA 2FQTA 3TFJA 2NVXC 1TWFK 2NVXK 4A3MC 5IYCK 5EGHA 2CFAA 1USOA 1XZQB 5FLMC 1TWGK 1TWGC 1C0AA 4BY1K 5IP9C 1EQRA 5IP9K 4KMAA 4RMFA 5EGEA 3GTGA 3FOEA 2PMZL 1PJ5A 4LK0A 3FKIA 1O29A 5HL8A 1XZPB 5C3EC 4BXXK 2NVTK 4A3BK 2NVTC 4AYBD 1RU0A 2PHCB 3LAJA 1YCLA 5IP7C 2PPBA 4NOIA 4DDQA 2V6TA 3HOXK 2JA6K 4GTBA 1WQHA 1X31C 3I4MC 3HOZC 4YFNA 2JA5C 2JA7C 4A3LK 4ILDA 2V6UA 3BP8C 1TWAC 5M3MK 2WB1D 2VUMK 2GAHC 3AQOA 2R7ZA 4LQYA 3H3VL 3A8IA 1Y1VA 2GAGC 3HOWC 3S1MC 3S1MK 2B63A 4FM9A 4A3CK 4KAWX 4A3CC 2R92C 5M3FK 4P5AA 4KMUA 1J6WA 3PO3K 2V6SA 3HXAA 3QX3A 1WIHA 4XLNA 3GTKK 1VGXA 2NVYA 1IE0A 4C3JK 1I6HK 4KC6A 3GTJA 1ZYRA 2D6FC 3DXJA 4P9SA 5M5WK 2E2IK 2R7ZK 4GTLA 4BY1C 4A3GC 3N0BA 4A3GK 1ISEA 3OEPA 3MMLB 3GTJK 3GTOK 3AH5A 3GTMK 3RZDK 3M3YC 1PJ7A 3ERED 5IOTA 5C4XK 4MEXA 3S2HK 1DD5A 4G7ZA 2NVYK 3HOYK 3S14K 4A3FC 2O5IA 2JH3A 4XSXA 4C45A 2A68A 2JA8C 3G4CA 4GTCA 2E2IA 5IORA 4OINA 4GTFA 1XXBA 3HOVK 2ZUEA 3S1QC 2R92A 4QJVB 4J3NA 2PA8D 3H3VD 1TWAK 2NVXA 4Y7NK 3L4KA 2ZUFA 1PJ6A 1VH2A 3I4NC 1ZXOA 2BE5A 3GTGK 2XCOA 4X6AC 5C3EK 3CQZC 3S16C 1J98A 1J6XA 1TWCC 3GEEA 3S15C 3A8JA 5C4XC 1B4BA 3S1RK 3TFHA 1INNA 2B63C 1SFOK 5CHPA 4C3HK 3S2DK 2JA8K 2W7VA 2Y0SL 2XCRB 1VJEA 4YFXA 5IYDK 2GSOA 4C2MK 4YFKA 4A93C 4Y52C 3GSIA 1TWAA 4KM9A 2E2JK 5TMCA 2KWAA 4OIPA 3TTGA 3V4GA 1XPPA 1R9TC 4BBRC 5TMFA 4BBSK 1YNJA 2PA8L 2E2HA 5IOQA 5C4JC 5C4JK 2PMZD 3HOVC 3GDZA 4KMHA 3JSTA 5CJ9A 3Q3QA 3GTMA 3HOXC 4KMDA 3WODA 1XXAA 4C3JC 3LPXA 3HOUC 1O25A 2A69A 3GTQA 5M5YK 4QIWD 3K7AC 1BS2A 1Y1WA 4BLAA 3ADAC 3GTPC 3GTPK 4A3JC 3FOFA 3OPFA 3GTOC 3GTLA 1F7VA 3SZZA 4C3IC 2R93C 3TFIA 3RZDC 4BXXC 3GTPA 3CQZK 4O2DA 2YU9K 1Y1WC 5M5XK 3GIRA 3GTQC 2P8TA 1K83K 2WB1L 4AH6A 1SFOC 3HOYC 2GSUA 1WORA 4BBSC 4A3FK 3H0GA 3EQLA 4Q4ZA 4WJ4A 1O2FB 3S1QK 3AD7C 3H0GK 1G51A 4KASA 4XLPA 4YG2A 4A3MK 4G0UA 5IYCC 1I50C 4MEYA 1JVIA 4BLBA 4A3DC 2E2IC 1BJTA 4C3IK 1ZVUA 4X6AK 3GTGC 1DCHA 3GTMC 3PO2K 1VLOA 3M4OK 3S15K 1Y1WK 2XCQA 1JQWA 4QIWL 3S1RC 3RZOK 1WQFA 4KN7A 2B63K 4BKWA 3S2DC 4QJVA 1IW7A 2JA5K 2JA7K 2A6HA 3GTJC 4BY7K 2VUMA 4A93K 5IYDC 4C2MC 2NVQK 1F9NA 2NVQC 3S17C 4Q5SA 4P5BA 1BDFA 1I3QC 4Y7NC 1TWHC 1I50K 3OREA 4A3KC 4KN4A 5FLMK 4A3DK 5JVOA 3GEHA
chains in the Genus database with same CATH topology
5IYBK 1XPPA 5IYBC 1R9TK 3HOWK 1R9TC 4BBRC 3HOWC 3S1MK 3S1MC 1HQMA 5TMFA 4BBSK 1YNJA 4LJZA 3GTLC 4A3CK 4A3CC 2R92C 5M3FK 2CW0A 2PA8L 4OIOA 4KMUA 1WCMC 1YNNA 5C44K 1WCMK 5C4JK 5C4JC 4A3IK 3PO2C 3PO3K 2PMZD 3HOVC 3H0GC 5IP7K 1TWFC 3HOXC 3FKIK 4XLNA 3GTKK 3FKIC 3WODA 4G7HA 3GTKC 3RZOC 4AYBL 4C3JK 3S1NC 3HOUK 4LK1A 4LLGA 3HOUC 1I6HK 4OIQA 1I6HC 2A69A 5M5YK 4QIWD 1Y1VK 1ZYRA 3K7AC 3K7AK 3DXJA 5M5WK 2E2IK 2R7ZK 4A3EC 5D4DA 4BY1C 4A3EK 3I4NK 4A3GC 4A3GK 3GTPC 2E2HC 1SMYA 4A3JC 3GTJK 3GTPK 4A3JK 3GTOC 3GTOK 2R93C 2WAQL 2R93K 2E2JC 3RZDC 3GTMK 3RZDK 3M3YK 1I3QK 3M3YC 4BXXC 3CQZK 1TWHK 2A6EA 4OIRA 1TWCK 4A3BC 3M4OC 5C4XK 2YU9K 1Y1WC 5M5XK 3S2HK 3S2HC 3HKZL 4XSZA 3GTQC 2Y0SD 4G7ZA 1K83K 2WB1L 1SFOC 3HOYC 4BBRK 2NVYK 3HOYK 2NVYC 4BBSC 3S14C 3S14K 4A3FC 2O5IA 3GTLK 4A3FK 3I4MK 4G7OA 2R92K 4XSXA 3EQLA 2A68A 4Q4ZA 2JA8C 3HOZK 5C44C 3PO3C 4OINA 3S1QC 3HOVK 3S1QK 3H0GK 4QJVB 4Y52K 2PA8D 1TWFK 2NVXC 2NVXK 1TWAK 4XLPA 4A3MC 3H3VD 4YG2A 4A3MK 5IYCK 4Y7NK 5IYCC 1I50C 5FLMC 4MEYA 1I6VA 4A3DC 2E2IC 1TWGK 2R7ZC 1TWGC 4BY1K 3I4NC 5IP9C 5IP9K 2BE5A 2PMZL 4JK1A 4C3IK 4LK0A 4GZYA 3GTGK 4X6AK 3GTGC 4X6AC 3GTMC 5C3EK 5C3EC 4BXXK 2NVTK 3CQZC 3S16K 2NVTC 4AYBD 1TWCC 4A3IC 3PO2K 3S16C 3M4OK 4A3BK 3S15C 5C4XC 3S15K 1Y1WK 2WAQD 4QIWL 4MQ9A 3S1RK 5IP7C 3S1RC 2PPBA 4NOIA 3HOXK 3RZOK 1K83C 4KN7A 2B63C 1SFOK 2JA6C 2B63K 2JA6K 4C3HK 3S1NK 3S2DK 3S2DC 3I4MC 1Y1VC 4QJVA 3HKZD 2JA8K 2Y0SL 1IW7A 4YFNA 3HOZC 4ZH4A 2JA5K 2JA7K 2A6HA 2JA5C 2JA7C 2E2HK 4BY7C 4YFXA 3GTJC 4BY7K 4A3LK 4YFKA 4C2MK 5IYDC 4A93K 4A93C 2NVQK 4Y52C 3S17C 2NVQC 4A3LC 3S17K 4Q5SA 1TWAC 5M3MK 1BDFA 2E2JK 1I3QC 5TMCA 2WB1D 4Y7NC 1TWHC 2VUMK 2VUMC 4A3KK 1I50K 4OIPA 4A3KC 5IYDK 4KN4A 5FLMK 2YU9C 3H3VL 4A3DK 5FJ8K 2O5JA 3GTQK 4MEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB K;  1XPP A;  5IYB C;  1R9T K;  3HOW K;  1R9T C;  4BBR C;  3HOW C;  3S1M K;  3S1M C;  1HQM A;  5TMF A;  4BBS K;  1YNJ A;  4LJZ A;  3GTL C;  4A3C K;  4A3C C;  2R92 C;  5M3F K;  2CW0 A;  2PA8 L;  4OIO A;  4KMU A;  1WCM C;  1YNN A;  5C44 K;  1WCM K;  5C4J K;  5C4J C;  4A3I K;  3PO2 C;  3PO3 K;  2PMZ D;  3HOV C;  3H0G C;  5IP7 K;  1TWF C;  3HOX C;  3FKI K;  4XLN A;  3GTK K;  3FKI C;  3WOD A;  4G7H A;  3GTK C;  3RZO C;  4AYB L;  4C3J K;  3S1N C;  3HOU K;  4LK1 A;  4LLG A;  3HOU C;  1I6H K;  4OIQ A;  1I6H C;  2A69 A;  5M5Y K;  4QIW D;  1Y1V K;  1ZYR A;  3K7A C;  3K7A K;  3DXJ A;  5M5W K;  2E2I K;  2R7Z K;  4A3E C;  5D4D A;  4BY1 C;  4A3E K;  3I4N K;  4A3G C;  4A3G K;  3GTP C;  2E2H C;  1SMY A;  4A3J C;  3GTJ K;  3GTP K;  4A3J K;  3GTO C;  3GTO K;  2R93 C;  2WAQ L;  2R93 K;  2E2J C;  3RZD C;  3GTM K;  3RZD K;  3M3Y K;  1I3Q K;  3M3Y C;  4BXX C;  3CQZ K;  1TWH K;  2A6E A;  4OIR A;  1TWC K;  4A3B C;  3M4O C;  5C4X K;  2YU9 K;  1Y1W C;  5M5X K;  3S2H K;  3S2H C;  3HKZ L;  4XSZ A;  3GTQ C;  2Y0S D;  4G7Z A;  1K83 K;  2WB1 L;  1SFO C;  3HOY C;  4BBR K;  2NVY K;  3HOY K;  2NVY C;  4BBS C;  3S14 C;  3S14 K;  4A3F C;  2O5I A;  3GTL K;  4A3F K;  3I4M K;  4G7O A;  2R92 K;  4XSX A;  3EQL A;  2A68 A;  4Q4Z A;  2JA8 C;  3HOZ K;  5C44 C;  3PO3 C;  4OIN A;  3S1Q C;  3HOV K;  3S1Q K;  3H0G K;  4QJV B;  4Y52 K;  2PA8 D;  1TWF K;  2NVX C;  2NVX K;  1TWA K;  4XLP A;  4A3M C;  3H3V D;  4YG2 A;  4A3M K;  5IYC K;  4Y7N K;  5IYC C;  1I50 C;  5FLM C;  4MEY A;  1I6V A;  4A3D C;  2E2I C;  1TWG K;  2R7Z C;  1TWG C;  4BY1 K;  3I4N C;  5IP9 C;  5IP9 K;  2BE5 A;  2PMZ L;  4JK1 A;  4C3I K;  4LK0 A;  4GZY A;  3GTG K;  4X6A K;  3GTG C;  4X6A C;  3GTM C;  5C3E K;  5C3E C;  4BXX K;  2NVT K;  3CQZ C;  3S16 K;  2NVT C;  4AYB D;  1TWC C;  4A3I C;  3PO2 K;  3S16 C;  3M4O K;  4A3B K;  3S15 C;  5C4X C;  3S15 K;  1Y1W K;  2WAQ D;  4QIW L;  4MQ9 A;  3S1R K;  5IP7 C;  3S1R C;  2PPB A;  4NOI A;  3HOX K;  3RZO K;  1K83 C;  4KN7 A;  2B63 C;  1SFO K;  2JA6 C;  2B63 K;  2JA6 K;  4C3H K;  3S1N K;  3S2D K;  3S2D C;  3I4M C;  1Y1V C;  4QJV A;  3HKZ D;  2JA8 K;  2Y0S L;  1IW7 A;  4YFN A;  3HOZ C;  4ZH4 A;  2JA5 K;  2JA7 K;  2A6H A;  2JA5 C;  2JA7 C;  2E2H K;  4BY7 C;  4YFX A;  3GTJ C;  4BY7 K;  4A3L K;  4YFK A;  4C2M K;  5IYD C;  4A93 K;  4A93 C;  2NVQ K;  4Y52 C;  3S17 C;  2NVQ C;  4A3L C;  3S17 K;  4Q5S A;  1TWA C;  5M3M K;  1BDF A;  2E2J K;  1I3Q C;  5TMC A;  2WB1 D;  4Y7N C;  1TWH C;  2VUM K;  2VUM C;  4A3K K;  1I50 K;  4OIP A;  4A3K C;  5IYD K;  4KN4 A;  5FLM K;  2YU9 C;  3H3V L;  4A3D K;  5FJ8 K;  2O5J A;  3GTQ K;  4MEX A; 
#chains in the Genus database with same CATH topology
 1R9T K;  3BUE A;  2R93 A;  2JA6 A;  4LJZ A;  3GTL C;  3T02 A;  2CW0 A;  4OIO A;  4GFQ A;  1YNN A;  4A3I K;  4GZY A;  4FZB A;  2RGR A;  1F93 A;  2FQO A;  1TWH A;  3SZY A;  1EFW A;  1TWF C;  1VRQ C;  2P5M A;  4KB2 A;  1I3Q A;  3GTK C;  4G7H A;  4LOW A;  3S1N C;  2EBB A;  1IQ0 A;  3HOU K;  1UV7 A;  4LLG A;  3S0X A;  1Y1V K;  1USM A;  3K7A K;  3G4A A;  5D4D A;  2E2H C;  1ZQ1 C;  1SMY A;  1O2A A;  4A3J K;  1EI6 A;  4GTA A;  1DCO A;  2R93 K;  2E2J C;  3M3Y K;  4A3B C;  1TWH K;  2A6E A;  4OIR A;  1TWC K;  1WOO A;  1IS1 A;  1L0W A;  4XCH A;  1AB4 A;  3M4O C;  1V5V A;  3N3Y A;  4WJ3 M;  4GTD A;  5L46 A;  1XZP A;  4KDD A;  1O24 A;  4GT9 A;  1J6V A;  2NVY C;  4M1X A;  3CAG A;  4KAR A;  3GTL K;  1WSR A;  4G7O A;  2R92 K;  3HOZ K;  3NUH A;  4Y52 K;  3A8K A;  1XXC A;  4GTE A;  1K83 A;  1I6V A;  1O2B A;  3T01 A;  2R7Z C;  4KB4 A;  3CQZ A;  1F7U A;  4JK1 A;  3GTK A;  1JOE A;  1BGW A;  1TWF A;  3AD9 C;  3S16 K;  4A3I C;  1O26 A;  2ZFZ A;  2WAQ D;  4MQ9 A;  1K83 C;  4KAT A;  3VA7 A;  5JFE A;  2JA6 C;  4KM8 A;  4C3H C;  3S1N K;  1O28 A;  1Y1V C;  3HKZ D;  4PAB A;  4ZH4 A;  1YX2 A;  3AD8 C;  2E2H K;  4BY7 C;  4WIL A;  3LAP A;  4A3L C;  3S17 K;  1WOP A;  1WQG A;  2VUM C;  5IOS A;  4A3K K;  1DCP A;  2YU9 C;  3AQP A;  5FJ8 K;  2RH6 A;  3GEI A;  2O5J A;  3GTQ K;  2Y3P A;  5IYB K;  5IYB C;  3HOW K;  4PAA A;  1HQM A;  1R9T A;  1EK8 A;  1O27 A;  1WCM C;  3PO2 C;  3T00 A;  1WCM K;  5C44 K;  2YU9 A;  5E68 A;  3H0G C;  2CFA B;  5IP7 K;  3RZO C;  3FKI K;  3FKI C;  4AYB L;  1SFO A;  3L4J A;  2GSN A;  1WOS A;  4LK1 A;  1B4A A;  1I6H C;  4OIQ A;  1EH1 A;  4LR2 A;  1TWG A;  4A3E C;  3I4N K;  4A3E K;  1I50 A;  1GE9 A;  1IL2 A;  1WSV A;  2WAQ L;  3GTO A;  1I3Q K;  4G0V A;  1IBA A;  1TWC A;  1ZBS A;  1XZQ A;  3S2H C;  3HKZ L;  3N0C A;  4XSZ A;  2Y0S D;  4BBR K;  3S14 C;  3BP3 A;  1HI9 A;  3I4M K;  1KQ4 A;  3IPJ A;  2JA5 A;  2JA7 A;  5C44 C;  3PO3 C;  1WCM A;  3FHZ A;  5TJ3 A;  4G0W A;  2FQT A;  3TFJ A;  2NVX C;  1TWF K;  2NVX K;  4A3M C;  5IYC K;  5EGH A;  2CFA A;  1USO A;  1XZQ B;  5FLM C;  1TWG K;  1TWG C;  1C0A A;  4BY1 K;  5IP9 C;  1EQR A;  5IP9 K;  4KMA A;  4RMF A;  5EGE A;  3GTG A;  3FOE A;  2PMZ L;  1PJ5 A;  4LK0 A;  3FKI A;  1O29 A;  5HL8 A;  1XZP B;  5C3E C;  4BXX K;  2NVT K;  4A3B K;  2NVT C;  4AYB D;  1RU0 A;  2PHC B;  3LAJ A;  1YCL A;  5IP7 C;  2PPB A;  4NOI A;  4DDQ A;  2V6T A;  3HOX K;  2JA6 K;  4GTB A;  1WQH A;  1X31 C;  3I4M C;  3HOZ C;  4YFN A;  2JA5 C;  2JA7 C;  4A3L K;  4ILD A;  2V6U A;  3BP8 C;  1TWA C;  5M3M K;  2WB1 D;  2VUM K;  2GAH C;  3AQO A;  2R7Z A;  4LQY A;  3H3V L;  3A8I A;  1Y1V A;  2GAG C;  3HOW C;  3S1M C;  3S1M K;  2B63 A;  4FM9 A;  4A3C K;  4KAW X;  4A3C C;  2R92 C;  5M3F K;  4P5A A;  4KMU A;  1J6W A;  3PO3 K;  2V6S A;  3HXA A;  3QX3 A;  1WIH A;  4XLN A;  3GTK K;  1VGX A;  2NVY A;  1IE0 A;  4C3J K;  1I6H K;  4KC6 A;  3GTJ A;  1ZYR A;  2D6F C;  3DXJ A;  4P9S A;  5M5W K;  2E2I K;  2R7Z K;  4GTL A;  4BY1 C;  4A3G C;  3N0B A;  4A3G K;  1ISE A;  3OEP A;  3MML B;  3GTJ K;  3GTO K;  3AH5 A;  3GTM K;  3RZD K;  3M3Y C;  1PJ7 A;  3ERE D;  5IOT A;  5C4X K;  4MEX A;  3S2H K;  1DD5 A;  4G7Z A;  2NVY K;  3HOY K;  3S14 K;  4A3F C;  2O5I A;  2JH3 A;  4XSX A;  4C45 A;  2A68 A;  2JA8 C;  3G4C A;  4GTC A;  2E2I A;  5IOR A;  4OIN A;  4GTF A;  1XXB A;  3HOV K;  2ZUE A;  3S1Q C;  2R92 A;  4QJV B;  4J3N A;  2PA8 D;  3H3V D;  1TWA K;  2NVX A;  4Y7N K;  3L4K A;  2ZUF A;  1PJ6 A;  1VH2 A;  3I4N C;  1ZXO A;  2BE5 A;  3GTG K;  2XCO A;  4X6A C;  5C3E K;  3CQZ C;  3S16 C;  1J98 A;  1J6X A;  1TWC C;  3GEE A;  3S15 C;  3A8J A;  5C4X C;  1B4B A;  3S1R K;  3TFH A;  1INN A;  2B63 C;  1SFO K;  5CHP A;  4C3H K;  3S2D K;  2JA8 K;  2W7V A;  2Y0S L;  2XCR B;  1VJE A;  4YFX A;  5IYD K;  2GSO A;  4C2M K;  4YFK A;  4A93 C;  4Y52 C;  3GSI A;  1TWA A;  4KM9 A;  2E2J K;  5TMC A;  2KWA A;  4OIP A;  3TTG A;  3V4G A;  1XPP A;  1R9T C;  4BBR C;  5TMF A;  4BBS K;  1YNJ A;  2PA8 L;  2E2H A;  5IOQ A;  5C4J C;  5C4J K;  2PMZ D;  3HOV C;  3GDZ A;  4KMH A;  3JST A;  5CJ9 A;  3Q3Q A;  3GTM A;  3HOX C;  4KMD A;  3WOD A;  1XXA A;  4C3J C;  3LPX A;  3HOU C;  1O25 A;  2A69 A;  3GTQ A;  5M5Y K;  4QIW D;  3K7A C;  1BS2 A;  1Y1W A;  4BLA A;  3ADA C;  3GTP C;  3GTP K;  4A3J C;  3FOF A;  3OPF A;  3GTO C;  3GTL A;  1F7V A;  3SZZ A;  4C3I C;  2R93 C;  3TFI A;  3RZD C;  4BXX C;  3GTP A;  3CQZ K;  4O2D A;  2YU9 K;  1Y1W C;  5M5X K;  3GIR A;  3GTQ C;  2P8T A;  1K83 K;  2WB1 L;  4AH6 A;  1SFO C;  3HOY C;  2GSU A;  1WOR A;  4BBS C;  4A3F K;  3H0G A;  3EQL A;  4Q4Z A;  4WJ4 A;  1O2F B;  3S1Q K;  3AD7 C;  3H0G K;  1G51 A;  4KAS A;  4XLP A;  4YG2 A;  4A3M K;  4G0U A;  5IYC C;  1I50 C;  4MEY A;  1JVI A;  4BLB A;  4A3D C;  2E2I C;  1BJT A;  4C3I K;  1ZVU A;  4X6A K;  3GTG C;  1DCH A;  3GTM C;  3PO2 K;  1VLO A;  3M4O K;  3S15 K;  1Y1W K;  2XCQ A;  1JQW A;  4QIW L;  3S1R C;  3RZO K;  1WQF A;  4KN7 A;  2B63 K;  4BKW A;  3S2D C;  4QJV A;  1IW7 A;  2JA5 K;  2JA7 K;  2A6H A;  3GTJ C;  4BY7 K;  2VUM A;  4A93 K;  5IYD C;  4C2M C;  2NVQ K;  1F9N A;  2NVQ C;  3S17 C;  4Q5S A;  4P5B A;  1BDF A;  1I3Q C;  4Y7N C;  1TWH C;  1I50 K;  3ORE A;  4A3K C;  4KN4 A;  5FLM K;  4A3D K;  5JVO A;  3GEH A; 
#chains in the Genus database with same CATH homology
 5IYB K;  1XPP A;  5IYB C;  1R9T K;  3HOW K;  1R9T C;  4BBR C;  3HOW C;  3S1M K;  3S1M C;  1HQM A;  5TMF A;  4BBS K;  1YNJ A;  4LJZ A;  3GTL C;  4A3C K;  4A3C C;  2R92 C;  5M3F K;  2CW0 A;  2PA8 L;  4OIO A;  4KMU A;  1WCM C;  1YNN A;  5C44 K;  1WCM K;  5C4J K;  5C4J C;  4A3I K;  3PO2 C;  3PO3 K;  2PMZ D;  3HOV C;  3H0G C;  5IP7 K;  1TWF C;  3HOX C;  3FKI K;  4XLN A;  3GTK K;  3FKI C;  3WOD A;  4G7H A;  3GTK C;  3RZO C;  4AYB L;  4C3J K;  3S1N C;  3HOU K;  4LK1 A;  4LLG A;  3HOU C;  1I6H K;  4OIQ A;  1I6H C;  2A69 A;  5M5Y K;  4QIW D;  1Y1V K;  1ZYR A;  3K7A C;  3K7A K;  3DXJ A;  5M5W K;  2E2I K;  2R7Z K;  4A3E C;  5D4D A;  4BY1 C;  4A3E K;  3I4N K;  4A3G C;  4A3G K;  3GTP C;  2E2H C;  1SMY A;  4A3J C;  3GTJ K;  3GTP K;  4A3J K;  3GTO C;  3GTO K;  2R93 C;  2WAQ L;  2R93 K;  2E2J C;  3RZD C;  3GTM K;  3RZD K;  3M3Y K;  1I3Q K;  3M3Y C;  4BXX C;  3CQZ K;  1TWH K;  2A6E A;  4OIR A;  1TWC K;  4A3B C;  3M4O C;  5C4X K;  2YU9 K;  1Y1W C;  5M5X K;  3S2H K;  3S2H C;  3HKZ L;  4XSZ A;  3GTQ C;  2Y0S D;  4G7Z A;  1K83 K;  2WB1 L;  1SFO C;  3HOY C;  4BBR K;  2NVY K;  3HOY K;  2NVY C;  4BBS C;  3S14 C;  3S14 K;  4A3F C;  2O5I A;  3GTL K;  4A3F K;  3I4M K;  4G7O A;  2R92 K;  4XSX A;  3EQL A;  2A68 A;  4Q4Z A;  2JA8 C;  3HOZ K;  5C44 C;  3PO3 C;  4OIN A;  3S1Q C;  3HOV K;  3S1Q K;  3H0G K;  4QJV B;  4Y52 K;  2PA8 D;  1TWF K;  2NVX C;  2NVX K;  1TWA K;  4XLP A;  4A3M C;  3H3V D;  4YG2 A;  4A3M K;  5IYC K;  4Y7N K;  5IYC C;  1I50 C;  5FLM C;  4MEY A;  1I6V A;  4A3D C;  2E2I C;  1TWG K;  2R7Z C;  1TWG C;  4BY1 K;  3I4N C;  5IP9 C;  5IP9 K;  2BE5 A;  2PMZ L;  4JK1 A;  4C3I K;  4LK0 A;  4GZY A;  3GTG K;  4X6A K;  3GTG C;  4X6A C;  3GTM C;  5C3E K;  5C3E C;  4BXX K;  2NVT K;  3CQZ C;  3S16 K;  2NVT C;  4AYB D;  1TWC C;  4A3I C;  3PO2 K;  3S16 C;  3M4O K;  4A3B K;  3S15 C;  5C4X C;  3S15 K;  1Y1W K;  2WAQ D;  4QIW L;  4MQ9 A;  3S1R K;  5IP7 C;  3S1R C;  2PPB A;  4NOI A;  3HOX K;  3RZO K;  1K83 C;  4KN7 A;  2B63 C;  1SFO K;  2JA6 C;  2B63 K;  2JA6 K;  4C3H K;  3S1N K;  3S2D K;  3S2D C;  3I4M C;  1Y1V C;  4QJV A;  3HKZ D;  2JA8 K;  2Y0S L;  1IW7 A;  4YFN A;  3HOZ C;  4ZH4 A;  2JA5 K;  2JA7 K;  2A6H A;  2JA5 C;  2JA7 C;  2E2H K;  4BY7 C;  4YFX A;  3GTJ C;  4BY7 K;  4A3L K;  4YFK A;  4C2M K;  5IYD C;  4A93 K;  4A93 C;  2NVQ K;  4Y52 C;  3S17 C;  2NVQ C;  4A3L C;  3S17 K;  4Q5S A;  1TWA C;  5M3M K;  1BDF A;  2E2J K;  1I3Q C;  5TMC A;  2WB1 D;  4Y7N C;  1TWH C;  2VUM K;  2VUM C;  4A3K K;  1I50 K;  4OIP A;  4A3K C;  5IYD K;  4KN4 A;  5FLM K;  2YU9 C;  3H3V L;  4A3D K;  5FJ8 K;  2O5J A;  3GTQ K;  4MEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...