3S14K

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s14K00
2A68A 1TWFC 3S1MC 2JA5K 3HOVK 3S2DC 4A3FC 2VUMC 2E2JK 3M4OK 3FKIC 4A3JK 3S1NC 5M3FK 4LK0A 5IP7C 1Y1VK 2R93K 2BE5A 1TWAC 5M5XK 4A3LK 4A93C 4QJVB 3HOWK 4OIRA 5FLMC 1YNNA 4BXXC 4XSXA 5IYCK 2WB1D 2NVQK 4AYBD 2PA8D 4ZH4A 4BBRK 5IYBK 4Y7NC 4BBSK 3CQZK 2A69A 5C4XC 2JA8K 1I3QK 4LJZA 3S17K 1K83K 3S1QC 2PMZL 4MEXA 2E2IC 1Y1WC 2R92C 5IP9K 4KN4A 3S1RK 3S2HK 4OINA 2R7ZC 3S16K 3RZDC 3PO3C 2JA7K 3S14K 2NVYC 3GTKK 1ZYRA 4G7HA 3GTOC 1WCMK 4A3GK 4MQ9A 5C3EC 5C4JC 4OIPA 3RZOK 2JA5C 5M5YK 3HOVC 1BDFA 3M4OC 4A3EK 2E2JC 4NOIA 4A3JC 3HKZL 3HOZK 4Y52K 1TWHK 3HOUK 4XLPA 2NVTC 1Y1VC 2R93C 4A3LC 3EQLA 4BY1K 1I6VA 3M3YK 4A3DC 5M5WK 2YU9K 5TMCA 3HOWC 1I50C 3WODA 4A3MK 2NVXK 5IYCC 3DXJA 2O5IA 5FJ8K 4YFKA 2NVQC 3I4NK 3HOXK 3PO2K 3I4MC 1TWCK 2JA6K 5IYBC 4BBSC 3CQZC 5C44C 4QIWL 3H0GC 3HKZD 4A3KK 3GTJK 1I3QC 2JA8C 4BY7K 4Q5SA 3FKIK 1K83C 4A3IK 1SFOK 3S17C 4OIOA 2E2HK 1HQMA 3GTQK 4X6AK 4MEYA 3S1RC 3S2HC 2A6EA 4LK1A 4G7ZA 5IYDC 3S16C 2WAQL 2JA7C 5TMFA 5D4DA 4JK1A 2B63K 3GTKC 4YFXA 2PPBA 3GTPK 3GTMK 1WCMC 4A3GC 4KMUA 1TWGK 3K7AK 2PMZD 4XLNA 1IW7A 3H3VL 4C3JK 4A3CK 4Y52C 3HOZC 2O5JA 4A3BK 3HOUC 3HOYK 4LLGA 1I6HK 3GTLK 3GTGK 3S15K 4BY1C 3M3YC 3PO3K 1R9TK 2NVXC 4QJVA 4BBRC 4A3MC 4GZYA 3I4NC 3HOXC 3PO2C 1TWFK 1TWCC 2JA6C 3GTOK 4AYBL 3S1MK 3S2DK 4A3FK 2VUMK 2PA8L 3H3VD 3S1NK 4A3KC 3GTJC 4BY7C 2Y0SL 5IP9C 4Q4ZA 1SFOC 4A3IC 5IP7K 4OIQA 2E2HC 4X6AC 3GTQC 1TWAK 2NVTK 4A93K 3S14C 4BXXK 5FLMK 2CW0A 4A3DK 1I50K 2B63C 4QIWD 4C2MK 3RZOC 4Y7NK 3GTMC 3GTPC 1TWGC 5C4XK 4XSZA 3K7AC 4YG2A 4A3EC 2A6HA 1TWHC 3I4MK 5C44K 1XPPA 2Y0SD 3S1QK 4G7OA 4A3CC 3H0GK 5M3MK 1YNJA 1Y1WK 2E2IK 2R92K 4A3BC 1SMYA 2WAQD 4C3IK 4C3HK 3HOYC 3GTLC 2R7ZK 1I6HC 4YFNA 2YU9C 3GTGC 3RZDK 3S15C 4KN7A 2NVYK 5IYDK 1R9TC 2WB1L 5C3EK 5C4JK
chains in the Genus database with same CATH superfamily
2A68A 1TWFC 4P5BA 5CJ9A 2VUMC 2E2JK 4LK0A 2D6FC 1K83A 5M5XK 4QJVB 4DDQA 4OIRA 1IL2A 5IYCK 4AYBD 2V6UA 3GTKA 4C2MC 4BBSK 1WCMA 1I3QK 3S1QC 2PMZL 1Y1WC 4C3IC 5HL8A 4XCHA 1KQ4A 1F7VA 3RZDC 2JA7K 1DCPA 1ZQ1C 5TJ3A 4G7HA 3GTOC 4OIPA 3RZOK 3GEHA 5M5YK 1B4BA 4A3EK 4NOIA 4A3JC 3HKZL 1SFOA 4GTFA 1RU0A 3EQLA 1USOA 2YU9K 5TMCA 4GTDA 3L4KA 3DXJA 3I4NK 4YFKA 1UV7A 3GTPA 3GTMA 3FOFA 1JOEA 3S17C 3HXAA 1HQMA 3S0XA 4BKWA 3S1RC 3S2HC 4G7ZA 5IYDC 2YU9A 4M1XA 3TFIA 2ZUFA 4JK1A 5E68A 2B63K 2PPBA 1XXBA 3K7AK 4XLNA 1IW7A 3H3VL 4Y52C 3HOYK 3AD8C 2XCQA 2XCOA 3GEIA 3PO3K 2NVXC 2V6TA 4BBRC 2B63A 3S1MK 1TWCC 2JA6C 4AYBL 5JVOA 3S1NK 1O26A 3GTJC 5IP9C 4A3IC 5IP7K 1TWAK 3FOEA 4A93K 1ZXOA 1WOSA 4BXXK 5JFEA 4A3DK 4KMHA 5IOSA 1I50K 3T00A 4LR2A 1EFWA 4G7OA 3H0GK 2RGRA 2E2IK 4A3BC 1EQRA 2FQTA 1TWAA 2WAQD 5L46A 1I6HC 2R7ZK 4YFNA 1IS1A 2R93A 5IOTA 5CHPA 1WQHA 1I50A 1X31C 4Q4ZA 4KC6A 2JH3A 2JA5K 3HOVK 4A3FC 3M4OK 1XZPA 1EI6A 3H0GA 3JSTA 1XZQB 2E2IA 2R7ZA 3Q3QA 2BE5A 4GTLA 5FLMC 4XSXA 2WB1D 3VA7A 3LPXA 5IYBK 2JA5A 3CQZK 4C3JC 5C4XC 1EK8A 4P5AA 4LJZA 1K83K 1VGXA 4G0VA 1O29A 4G0WA 3GTKK 1WCMK 1WQGA 4MQ9A 3CQZA 5C4JC 3G4CA 2E2JC 3HOZK 1F7UA 3HOUK 2NVTC 4J3NA 4KASA 5IORA 3GTQA 2RH6A 4BY1K 3M3YK 5M5WK 1WSRA 4A3MK 1O2AA 3LAPA 5IYCC 2O5IA 1O25A 3ADAC 4LQYA 3PO2K 3I4MC 4BBSC 3AD9C 5C44C 2P8TA 1TWGA 3NUHA 3T02A 4BY7K 1I3QC 4Q5SA 5EGEA 1SFOK 4OIOA 3TTGA 1V5VA 4MEYA 4LK1A 2WAQL 1XXCA 2JA7C 4GFQA 4KB4A 3TFJA 5D4DA 1R9TA 3GTPK 3GTMK 4GTAA 1G51A 4KAWX 4KMUA 1TWFA 1C0AA 1YX2A 2P5MA 4LLGA 3GTLK 1WQFA 3GTGK 4GTBA 3S15K 1YCLA 3IPJA 4QJVA 3I4NC 1J6XA 4LOWA 3S2DK 3AD7C 3GTOK 1J98A 4GTCA 1DCOA 4PAAA 4OIQA 3GTLA 3GTGA 1F9NA 3S14C 1ISEA 1ZBSA 3V4GA 2CW0A 2B63C 4Y7NK 3GTOA 4KB2A 4WJ3M 4XSZA 3K7AC 4YG2A 3AH5A 1TWHC 1XPPA 2Y0SD 3GIRA 2R92K 4C3HK 3HOYC 1ZVUA 3BP3A 3OPFA 3QX3A 2GSUA 2NVYK 5IYDK 5IOQA 1VJEA 5C3EK 2ZUEA 3S1MC 1BGWA 3FKIC 3S1NC 2R92A 1INNA 1J6VA 4GTEA 1Y1VK 5IP7C 2R93K 4A3LK 1TWAC 3A8JA 4A93C 3HOWK 2NVYA 3SZYA 4BXXC 3T01A 2XCRB 2NVQK 1IBAA 2PA8D 4BBRK 1IQ0A 4PABA 2JA8K 1XZPB 2V6SA 5EGHA 4MEXA 2E2IC 1Y1VA 1DCHA 2W7VA 5IP9K 4KN4A 4OINA 2R7ZC 3S16K 2NVXA 1WOPA 4GT9A 4A3GK 1O2BA 4O2DA 2JA6A 2JA5C 3HOVC 3M4OC 4KARA 4BLBA 4XLPA 3GSIA 1PJ6A 3LAJA 1I6VA 3WODA 3N0CA 3L4JA 1VH2A 4FZBA 3HOXK 5IYBC 2CFAA 3A8IA 2FQOA 3CQZC 3HKZD 4A3KK 1K83C 2KWAA 2E2HK 4X6AK 3GTQK 2A6EA 2GAHC 3ERED 3GTKC 4KM9A 1WCMC 3AQOA 1TWGK 3AQPA 4WILA 4C3JK 4A3CK 3HOZC 3SZZA 2E2HA 1VLOA 3HOUC 1WOOA 1DD5A 3GEEA 4BY1C 3M3YC 3G4AA 1R9TK 4BLAA 4A3MC 4KMAA 1JVIA 4GZYA 2PHCB 3PO2C 1TWFK 4KMDA 2GSNA 2VUMK 2PA8L 1O24A 3H3VD 3BP8C 4BY7C 1SFOC 4P9SA 1BS2A 1WSVA 2Y3PA 2NVTK 1EH1A 1J6WA 4AH6A 4QIWD 4C2MK 3RZOC 3GTPC 3GTMC 2VUMA 4A3EC 4KDDA 3I4MK 2A6HA 5C44K 3S1QK 4KATA 5M3MK 1Y1WK 4C3IK 3GTLC 2YU9C 3GTGC 3RZDK 3S15C 1PJ7A 2WB1L 1HI9A 3S2DC 1O27A 4A3JK 5M3FK 1I3QA 1Y1WA 4G0UA 1USMA 1L0WA 4C45A 4WJ4A 1YNNA 3N0BA 2JA7A 3N3YA 4ZH4A 1IE0A 4Y7NC 3MMLB 2A69A 3FHZA 3S17K 4RMFA 2R92C 4C3HC 3S1RK 3S2HK 3PO3C 3S14K 2NVYC 1ZYRA 1WIHA 5C3EC 2GAGC 1AB4A 1BDFA 4Y52K 1TWHK 1Y1VC 2R93C 4A3LC 4A3DC 3HOWC 1I50C 2NVXK 5FJ8K 2NVQC 1TWCK 2JA6K 1XXAA 4QIWL 3H0GC 2JA8C 3GTJK 1TWHA 3FKIK 4A3IK 2GSOA 3S16C 3CAGA 5TMFA 1VRQC 4YFXA 1TWCA 4A3GC 3OEPA 2CFAB 2PMZD 3GTJA 3FKIA 2O5JA 1F93A 4A3BK 1PJ5A 1I6HK 1B4AA 1BJTA 3GDZA 3HOXC 4A3FK 1GE9A 1O2FB 4A3KC 3TFHA 2Y0SL 2E2HC 4X6AC 3GTQC 1WORA 4KM8A 5FLMK 2EBBA 4ILDA 1TWGC 5C4XK 3BUEA 1XZQA 4A3CC 1YNJA 3A8KA 1SMYA 4FM9A 3OREA 4KN7A 2ZFZA 1R9TC 1JQWA 1O28A 5C4JK
chains in the Genus database with same CATH topology
2A68A 1TWFC 3S1MC 2JA5K 3HOVK 3S2DC 4A3FC 2VUMC 2E2JK 3M4OK 3FKIC 4A3JK 3S1NC 5M3FK 4LK0A 5IP7C 1Y1VK 2R93K 2BE5A 1TWAC 5M5XK 4A3LK 4A93C 4QJVB 3HOWK 4OIRA 5FLMC 1YNNA 4BXXC 4XSXA 5IYCK 2WB1D 2NVQK 4AYBD 2PA8D 4ZH4A 4BBRK 5IYBK 4Y7NC 4BBSK 3CQZK 2A69A 5C4XC 2JA8K 1I3QK 4LJZA 3S17K 1K83K 3S1QC 2PMZL 4MEXA 2E2IC 1Y1WC 2R92C 5IP9K 4KN4A 3S1RK 3S2HK 4OINA 2R7ZC 3S16K 3RZDC 3PO3C 2JA7K 3S14K 2NVYC 3GTKK 1ZYRA 4G7HA 3GTOC 1WCMK 4A3GK 4MQ9A 5C3EC 5C4JC 4OIPA 3RZOK 2JA5C 5M5YK 3HOVC 1BDFA 3M4OC 4A3EK 2E2JC 4NOIA 4A3JC 3HKZL 3HOZK 4Y52K 1TWHK 3HOUK 4XLPA 2NVTC 1Y1VC 2R93C 4A3LC 3EQLA 4BY1K 1I6VA 3M3YK 4A3DC 5M5WK 2YU9K 5TMCA 3HOWC 1I50C 3WODA 4A3MK 2NVXK 5IYCC 3DXJA 2O5IA 5FJ8K 4YFKA 2NVQC 3I4NK 3HOXK 3PO2K 3I4MC 1TWCK 2JA6K 5IYBC 4BBSC 3CQZC 5C44C 4QIWL 3H0GC 3HKZD 4A3KK 3GTJK 1I3QC 2JA8C 4BY7K 4Q5SA 3FKIK 1K83C 4A3IK 1SFOK 3S17C 4OIOA 2E2HK 1HQMA 3GTQK 4X6AK 4MEYA 3S1RC 3S2HC 2A6EA 4LK1A 4G7ZA 5IYDC 3S16C 2WAQL 2JA7C 5TMFA 5D4DA 4JK1A 2B63K 3GTKC 4YFXA 2PPBA 3GTPK 3GTMK 1WCMC 4A3GC 4KMUA 1TWGK 3K7AK 2PMZD 4XLNA 1IW7A 3H3VL 4C3JK 4A3CK 4Y52C 3HOZC 2O5JA 4A3BK 3HOUC 3HOYK 4LLGA 1I6HK 3GTLK 3GTGK 3S15K 4BY1C 3M3YC 3PO3K 1R9TK 2NVXC 4QJVA 4BBRC 4A3MC 4GZYA 3I4NC 3HOXC 3PO2C 1TWFK 1TWCC 2JA6C 3GTOK 4AYBL 3S1MK 3S2DK 4A3FK 2VUMK 2PA8L 3H3VD 3S1NK 4A3KC 3GTJC 4BY7C 2Y0SL 5IP9C 4Q4ZA 1SFOC 4A3IC 5IP7K 4OIQA 2E2HC 4X6AC 3GTQC 1TWAK 2NVTK 4A93K 3S14C 4BXXK 5FLMK 2CW0A 4A3DK 1I50K 2B63C 4QIWD 4C2MK 3RZOC 4Y7NK 3GTMC 3GTPC 1TWGC 5C4XK 4XSZA 3K7AC 4YG2A 4A3EC 2A6HA 1TWHC 3I4MK 5C44K 1XPPA 2Y0SD 3S1QK 4G7OA 4A3CC 3H0GK 5M3MK 1YNJA 1Y1WK 2E2IK 2R92K 4A3BC 1SMYA 2WAQD 4C3IK 4C3HK 3HOYC 3GTLC 2R7ZK 1I6HC 4YFNA 2YU9C 3GTGC 3RZDK 3S15C 4KN7A 2NVYK 5IYDK 1R9TC 2WB1L 5C3EK 5C4JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 A;  1TWF C;  3S1M C;  2JA5 K;  3HOV K;  3S2D C;  4A3F C;  2VUM C;  2E2J K;  3M4O K;  3FKI C;  4A3J K;  3S1N C;  5M3F K;  4LK0 A;  5IP7 C;  1Y1V K;  2R93 K;  2BE5 A;  1TWA C;  5M5X K;  4A3L K;  4A93 C;  4QJV B;  3HOW K;  4OIR A;  5FLM C;  1YNN A;  4BXX C;  4XSX A;  5IYC K;  2WB1 D;  2NVQ K;  4AYB D;  2PA8 D;  4ZH4 A;  4BBR K;  5IYB K;  4Y7N C;  4BBS K;  3CQZ K;  2A69 A;  5C4X C;  2JA8 K;  1I3Q K;  4LJZ A;  3S17 K;  1K83 K;  3S1Q C;  2PMZ L;  4MEX A;  2E2I C;  1Y1W C;  2R92 C;  5IP9 K;  4KN4 A;  3S1R K;  3S2H K;  4OIN A;  2R7Z C;  3S16 K;  3RZD C;  3PO3 C;  2JA7 K;  3S14 K;  2NVY C;  3GTK K;  1ZYR A;  4G7H A;  3GTO C;  1WCM K;  4A3G K;  4MQ9 A;  5C3E C;  5C4J C;  4OIP A;  3RZO K;  2JA5 C;  5M5Y K;  3HOV C;  1BDF A;  3M4O C;  4A3E K;  2E2J C;  4NOI A;  4A3J C;  3HKZ L;  3HOZ K;  4Y52 K;  1TWH K;  3HOU K;  4XLP A;  2NVT C;  1Y1V C;  2R93 C;  4A3L C;  3EQL A;  4BY1 K;  1I6V A;  3M3Y K;  4A3D C;  5M5W K;  2YU9 K;  5TMC A;  3HOW C;  1I50 C;  3WOD A;  4A3M K;  2NVX K;  5IYC C;  3DXJ A;  2O5I A;  5FJ8 K;  4YFK A;  2NVQ C;  3I4N K;  3HOX K;  3PO2 K;  3I4M C;  1TWC K;  2JA6 K;  5IYB C;  4BBS C;  3CQZ C;  5C44 C;  4QIW L;  3H0G C;  3HKZ D;  4A3K K;  3GTJ K;  1I3Q C;  2JA8 C;  4BY7 K;  4Q5S A;  3FKI K;  1K83 C;  4A3I K;  1SFO K;  3S17 C;  4OIO A;  2E2H K;  1HQM A;  3GTQ K;  4X6A K;  4MEY A;  3S1R C;  3S2H C;  2A6E A;  4LK1 A;  4G7Z A;  5IYD C;  3S16 C;  2WAQ L;  2JA7 C;  5TMF A;  5D4D A;  4JK1 A;  2B63 K;  3GTK C;  4YFX A;  2PPB A;  3GTP K;  3GTM K;  1WCM C;  4A3G C;  4KMU A;  1TWG K;  3K7A K;  2PMZ D;  4XLN A;  1IW7 A;  3H3V L;  4C3J K;  4A3C K;  4Y52 C;  3HOZ C;  2O5J A;  4A3B K;  3HOU C;  3HOY K;  4LLG A;  1I6H K;  3GTL K;  3GTG K;  3S15 K;  4BY1 C;  3M3Y C;  3PO3 K;  1R9T K;  2NVX C;  4QJV A;  4BBR C;  4A3M C;  4GZY A;  3I4N C;  3HOX C;  3PO2 C;  1TWF K;  1TWC C;  2JA6 C;  3GTO K;  4AYB L;  3S1M K;  3S2D K;  4A3F K;  2VUM K;  2PA8 L;  3H3V D;  3S1N K;  4A3K C;  3GTJ C;  4BY7 C;  2Y0S L;  5IP9 C;  4Q4Z A;  1SFO C;  4A3I C;  5IP7 K;  4OIQ A;  2E2H C;  4X6A C;  3GTQ C;  1TWA K;  2NVT K;  4A93 K;  3S14 C;  4BXX K;  5FLM K;  2CW0 A;  4A3D K;  1I50 K;  2B63 C;  4QIW D;  4C2M K;  3RZO C;  4Y7N K;  3GTM C;  3GTP C;  1TWG C;  5C4X K;  4XSZ A;  3K7A C;  4YG2 A;  4A3E C;  2A6H A;  1TWH C;  3I4M K;  5C44 K;  1XPP A;  2Y0S D;  3S1Q K;  4G7O A;  4A3C C;  3H0G K;  5M3M K;  1YNJ A;  1Y1W K;  2E2I K;  2R92 K;  4A3B C;  1SMY A;  2WAQ D;  4C3I K;  4C3H K;  3HOY C;  3GTL C;  2R7Z K;  1I6H C;  4YFN A;  2YU9 C;  3GTG C;  3RZD K;  3S15 C;  4KN7 A;  2NVY K;  5IYD K;  1R9T C;  2WB1 L;  5C3E K;  5C4J K; 
#chains in the Genus database with same CATH topology
 2A68 A;  1TWF C;  4P5B A;  5CJ9 A;  2VUM C;  2E2J K;  4LK0 A;  2D6F C;  1K83 A;  5M5X K;  4QJV B;  4DDQ A;  4OIR A;  1IL2 A;  5IYC K;  4AYB D;  2V6U A;  3GTK A;  4C2M C;  4BBS K;  1WCM A;  1I3Q K;  3S1Q C;  2PMZ L;  1Y1W C;  4C3I C;  5HL8 A;  4XCH A;  1KQ4 A;  1F7V A;  3RZD C;  2JA7 K;  1DCP A;  1ZQ1 C;  5TJ3 A;  4G7H A;  3GTO C;  4OIP A;  3RZO K;  3GEH A;  5M5Y K;  1B4B A;  4A3E K;  4NOI A;  4A3J C;  3HKZ L;  1SFO A;  4GTF A;  1RU0 A;  3EQL A;  1USO A;  2YU9 K;  5TMC A;  4GTD A;  3L4K A;  3DXJ A;  3I4N K;  4YFK A;  1UV7 A;  3GTP A;  3GTM A;  3FOF A;  1JOE A;  3S17 C;  3HXA A;  1HQM A;  3S0X A;  4BKW A;  3S1R C;  3S2H C;  4G7Z A;  5IYD C;  2YU9 A;  4M1X A;  3TFI A;  2ZUF A;  4JK1 A;  5E68 A;  2B63 K;  2PPB A;  1XXB A;  3K7A K;  4XLN A;  1IW7 A;  3H3V L;  4Y52 C;  3HOY K;  3AD8 C;  2XCQ A;  2XCO A;  3GEI A;  3PO3 K;  2NVX C;  2V6T A;  4BBR C;  2B63 A;  3S1M K;  1TWC C;  2JA6 C;  4AYB L;  5JVO A;  3S1N K;  1O26 A;  3GTJ C;  5IP9 C;  4A3I C;  5IP7 K;  1TWA K;  3FOE A;  4A93 K;  1ZXO A;  1WOS A;  4BXX K;  5JFE A;  4A3D K;  4KMH A;  5IOS A;  1I50 K;  3T00 A;  4LR2 A;  1EFW A;  4G7O A;  3H0G K;  2RGR A;  2E2I K;  4A3B C;  1EQR A;  2FQT A;  1TWA A;  2WAQ D;  5L46 A;  1I6H C;  2R7Z K;  4YFN A;  1IS1 A;  2R93 A;  5IOT A;  5CHP A;  1WQH A;  1I50 A;  1X31 C;  4Q4Z A;  4KC6 A;  2JH3 A;  2JA5 K;  3HOV K;  4A3F C;  3M4O K;  1XZP A;  1EI6 A;  3H0G A;  3JST A;  1XZQ B;  2E2I A;  2R7Z A;  3Q3Q A;  2BE5 A;  4GTL A;  5FLM C;  4XSX A;  2WB1 D;  3VA7 A;  3LPX A;  5IYB K;  2JA5 A;  3CQZ K;  4C3J C;  5C4X C;  1EK8 A;  4P5A A;  4LJZ A;  1K83 K;  1VGX A;  4G0V A;  1O29 A;  4G0W A;  3GTK K;  1WCM K;  1WQG A;  4MQ9 A;  3CQZ A;  5C4J C;  3G4C A;  2E2J C;  3HOZ K;  1F7U A;  3HOU K;  2NVT C;  4J3N A;  4KAS A;  5IOR A;  3GTQ A;  2RH6 A;  4BY1 K;  3M3Y K;  5M5W K;  1WSR A;  4A3M K;  1O2A A;  3LAP A;  5IYC C;  2O5I A;  1O25 A;  3ADA C;  4LQY A;  3PO2 K;  3I4M C;  4BBS C;  3AD9 C;  5C44 C;  2P8T A;  1TWG A;  3NUH A;  3T02 A;  4BY7 K;  1I3Q C;  4Q5S A;  5EGE A;  1SFO K;  4OIO A;  3TTG A;  1V5V A;  4MEY A;  4LK1 A;  2WAQ L;  1XXC A;  2JA7 C;  4GFQ A;  4KB4 A;  3TFJ A;  5D4D A;  1R9T A;  3GTP K;  3GTM K;  4GTA A;  1G51 A;  4KAW X;  4KMU A;  1TWF A;  1C0A A;  1YX2 A;  2P5M A;  4LLG A;  3GTL K;  1WQF A;  3GTG K;  4GTB A;  3S15 K;  1YCL A;  3IPJ A;  4QJV A;  3I4N C;  1J6X A;  4LOW A;  3S2D K;  3AD7 C;  3GTO K;  1J98 A;  4GTC A;  1DCO A;  4PAA A;  4OIQ A;  3GTL A;  3GTG A;  1F9N A;  3S14 C;  1ISE A;  1ZBS A;  3V4G A;  2CW0 A;  2B63 C;  4Y7N K;  3GTO A;  4KB2 A;  4WJ3 M;  4XSZ A;  3K7A C;  4YG2 A;  3AH5 A;  1TWH C;  1XPP A;  2Y0S D;  3GIR A;  2R92 K;  4C3H K;  3HOY C;  1ZVU A;  3BP3 A;  3OPF A;  3QX3 A;  2GSU A;  2NVY K;  5IYD K;  5IOQ A;  1VJE A;  5C3E K;  2ZUE A;  3S1M C;  1BGW A;  3FKI C;  3S1N C;  2R92 A;  1INN A;  1J6V A;  4GTE A;  1Y1V K;  5IP7 C;  2R93 K;  4A3L K;  1TWA C;  3A8J A;  4A93 C;  3HOW K;  2NVY A;  3SZY A;  4BXX C;  3T01 A;  2XCR B;  2NVQ K;  1IBA A;  2PA8 D;  4BBR K;  1IQ0 A;  4PAB A;  2JA8 K;  1XZP B;  2V6S A;  5EGH A;  4MEX A;  2E2I C;  1Y1V A;  1DCH A;  2W7V A;  5IP9 K;  4KN4 A;  4OIN A;  2R7Z C;  3S16 K;  2NVX A;  1WOP A;  4GT9 A;  4A3G K;  1O2B A;  4O2D A;  2JA6 A;  2JA5 C;  3HOV C;  3M4O C;  4KAR A;  4BLB A;  4XLP A;  3GSI A;  1PJ6 A;  3LAJ A;  1I6V A;  3WOD A;  3N0C A;  3L4J A;  1VH2 A;  4FZB A;  3HOX K;  5IYB C;  2CFA A;  3A8I A;  2FQO A;  3CQZ C;  3HKZ D;  4A3K K;  1K83 C;  2KWA A;  2E2H K;  4X6A K;  3GTQ K;  2A6E A;  2GAH C;  3ERE D;  3GTK C;  4KM9 A;  1WCM C;  3AQO A;  1TWG K;  3AQP A;  4WIL A;  4C3J K;  4A3C K;  3HOZ C;  3SZZ A;  2E2H A;  1VLO A;  3HOU C;  1WOO A;  1DD5 A;  3GEE A;  4BY1 C;  3M3Y C;  3G4A A;  1R9T K;  4BLA A;  4A3M C;  4KMA A;  1JVI A;  4GZY A;  2PHC B;  3PO2 C;  1TWF K;  4KMD A;  2GSN A;  2VUM K;  2PA8 L;  1O24 A;  3H3V D;  3BP8 C;  4BY7 C;  1SFO C;  4P9S A;  1BS2 A;  1WSV A;  2Y3P A;  2NVT K;  1EH1 A;  1J6W A;  4AH6 A;  4QIW D;  4C2M K;  3RZO C;  3GTP C;  3GTM C;  2VUM A;  4A3E C;  4KDD A;  3I4M K;  2A6H A;  5C44 K;  3S1Q K;  4KAT A;  5M3M K;  1Y1W K;  4C3I K;  3GTL C;  2YU9 C;  3GTG C;  3RZD K;  3S15 C;  1PJ7 A;  2WB1 L;  1HI9 A;  3S2D C;  1O27 A;  4A3J K;  5M3F K;  1I3Q A;  1Y1W A;  4G0U A;  1USM A;  1L0W A;  4C45 A;  4WJ4 A;  1YNN A;  3N0B A;  2JA7 A;  3N3Y A;  4ZH4 A;  1IE0 A;  4Y7N C;  3MML B;  2A69 A;  3FHZ A;  3S17 K;  4RMF A;  2R92 C;  4C3H C;  3S1R K;  3S2H K;  3PO3 C;  3S14 K;  2NVY C;  1ZYR A;  1WIH A;  5C3E C;  2GAG C;  1AB4 A;  1BDF A;  4Y52 K;  1TWH K;  1Y1V C;  2R93 C;  4A3L C;  4A3D C;  3HOW C;  1I50 C;  2NVX K;  5FJ8 K;  2NVQ C;  1TWC K;  2JA6 K;  1XXA A;  4QIW L;  3H0G C;  2JA8 C;  3GTJ K;  1TWH A;  3FKI K;  4A3I K;  2GSO A;  3S16 C;  3CAG A;  5TMF A;  1VRQ C;  4YFX A;  1TWC A;  4A3G C;  3OEP A;  2CFA B;  2PMZ D;  3GTJ A;  3FKI A;  2O5J A;  1F93 A;  4A3B K;  1PJ5 A;  1I6H K;  1B4A A;  1BJT A;  3GDZ A;  3HOX C;  4A3F K;  1GE9 A;  1O2F B;  4A3K C;  3TFH A;  2Y0S L;  2E2H C;  4X6A C;  3GTQ C;  1WOR A;  4KM8 A;  5FLM K;  2EBB A;  4ILD A;  1TWG C;  5C4X K;  3BUE A;  1XZQ A;  4A3C C;  1YNJ A;  3A8K A;  1SMY A;  4FM9 A;  3ORE A;  4KN7 A;  2ZFZ A;  1R9T C;  1JQW A;  1O28 A;  5C4J K; 
#chains in the Genus database with same CATH homology
 2A68 A;  1TWF C;  3S1M C;  2JA5 K;  3HOV K;  3S2D C;  4A3F C;  2VUM C;  2E2J K;  3M4O K;  3FKI C;  4A3J K;  3S1N C;  5M3F K;  4LK0 A;  5IP7 C;  1Y1V K;  2R93 K;  2BE5 A;  1TWA C;  5M5X K;  4A3L K;  4A93 C;  4QJV B;  3HOW K;  4OIR A;  5FLM C;  1YNN A;  4BXX C;  4XSX A;  5IYC K;  2WB1 D;  2NVQ K;  4AYB D;  2PA8 D;  4ZH4 A;  4BBR K;  5IYB K;  4Y7N C;  4BBS K;  3CQZ K;  2A69 A;  5C4X C;  2JA8 K;  1I3Q K;  4LJZ A;  3S17 K;  1K83 K;  3S1Q C;  2PMZ L;  4MEX A;  2E2I C;  1Y1W C;  2R92 C;  5IP9 K;  4KN4 A;  3S1R K;  3S2H K;  4OIN A;  2R7Z C;  3S16 K;  3RZD C;  3PO3 C;  2JA7 K;  3S14 K;  2NVY C;  3GTK K;  1ZYR A;  4G7H A;  3GTO C;  1WCM K;  4A3G K;  4MQ9 A;  5C3E C;  5C4J C;  4OIP A;  3RZO K;  2JA5 C;  5M5Y K;  3HOV C;  1BDF A;  3M4O C;  4A3E K;  2E2J C;  4NOI A;  4A3J C;  3HKZ L;  3HOZ K;  4Y52 K;  1TWH K;  3HOU K;  4XLP A;  2NVT C;  1Y1V C;  2R93 C;  4A3L C;  3EQL A;  4BY1 K;  1I6V A;  3M3Y K;  4A3D C;  5M5W K;  2YU9 K;  5TMC A;  3HOW C;  1I50 C;  3WOD A;  4A3M K;  2NVX K;  5IYC C;  3DXJ A;  2O5I A;  5FJ8 K;  4YFK A;  2NVQ C;  3I4N K;  3HOX K;  3PO2 K;  3I4M C;  1TWC K;  2JA6 K;  5IYB C;  4BBS C;  3CQZ C;  5C44 C;  4QIW L;  3H0G C;  3HKZ D;  4A3K K;  3GTJ K;  1I3Q C;  2JA8 C;  4BY7 K;  4Q5S A;  3FKI K;  1K83 C;  4A3I K;  1SFO K;  3S17 C;  4OIO A;  2E2H K;  1HQM A;  3GTQ K;  4X6A K;  4MEY A;  3S1R C;  3S2H C;  2A6E A;  4LK1 A;  4G7Z A;  5IYD C;  3S16 C;  2WAQ L;  2JA7 C;  5TMF A;  5D4D A;  4JK1 A;  2B63 K;  3GTK C;  4YFX A;  2PPB A;  3GTP K;  3GTM K;  1WCM C;  4A3G C;  4KMU A;  1TWG K;  3K7A K;  2PMZ D;  4XLN A;  1IW7 A;  3H3V L;  4C3J K;  4A3C K;  4Y52 C;  3HOZ C;  2O5J A;  4A3B K;  3HOU C;  3HOY K;  4LLG A;  1I6H K;  3GTL K;  3GTG K;  3S15 K;  4BY1 C;  3M3Y C;  3PO3 K;  1R9T K;  2NVX C;  4QJV A;  4BBR C;  4A3M C;  4GZY A;  3I4N C;  3HOX C;  3PO2 C;  1TWF K;  1TWC C;  2JA6 C;  3GTO K;  4AYB L;  3S1M K;  3S2D K;  4A3F K;  2VUM K;  2PA8 L;  3H3V D;  3S1N K;  4A3K C;  3GTJ C;  4BY7 C;  2Y0S L;  5IP9 C;  4Q4Z A;  1SFO C;  4A3I C;  5IP7 K;  4OIQ A;  2E2H C;  4X6A C;  3GTQ C;  1TWA K;  2NVT K;  4A93 K;  3S14 C;  4BXX K;  5FLM K;  2CW0 A;  4A3D K;  1I50 K;  2B63 C;  4QIW D;  4C2M K;  3RZO C;  4Y7N K;  3GTM C;  3GTP C;  1TWG C;  5C4X K;  4XSZ A;  3K7A C;  4YG2 A;  4A3E C;  2A6H A;  1TWH C;  3I4M K;  5C44 K;  1XPP A;  2Y0S D;  3S1Q K;  4G7O A;  4A3C C;  3H0G K;  5M3M K;  1YNJ A;  1Y1W K;  2E2I K;  2R92 K;  4A3B C;  1SMY A;  2WAQ D;  4C3I K;  4C3H K;  3HOY C;  3GTL C;  2R7Z K;  1I6H C;  4YFN A;  2YU9 C;  3GTG C;  3RZD K;  3S15 C;  4KN7 A;  2NVY K;  5IYD K;  1R9T C;  2WB1 L;  5C3E K;  5C4J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...