3S14K

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s14K00
3HOWC 3S14K 1I6VA 2NVXC 3HOVC 4MEYA 3HOUK 3M3YK 2Y0SD 4XSZA 1WCMC 2JA6K 2CW0A 5IYCC 4QIWD 1SFOC 4A3CC 1R9TK 2A69A 2JA5C 5C4JC 4A3GK 4BBSK 5C44C 4A3MC 3H0GC 2E2JC 2NVQK 2R93K 4LJZA 3HOXC 4A3FK 2A6EA 3S1QC 1I50K 3HKZL 4KN4A 4LK1A 3K7AC 3S17K 3S1MK 4XLNA 4A3DK 2NVYC 3HOZK 1Y1WK 3S15C 1TWCC 3S1NK 5D4DA 5IYBC 4G7HA 2R92K 3M4OC 4A3JK 4Q5SA 2VUMC 4KMUA 2WAQL 4YG2A 4YFXA 4XSXA 3FKIK 3PO3K 3GTLK 4C3JK 5M5YK 4A93C 2E2HC 1SMYA 1R9TC 3CQZC 2NVTK 1TWHK 4A3KK 4BBSC 4X6AC 1TWGC 4LLGA 3GTKC 1K83C 1IW7A 5FLMC 2WB1D 2Y0SL 3GTPK 2O5JA 5C3EK 4JK1A 2PMZD 4XLPA 2PPBA 4A3DC 1Y1VC 4MQ9A 3I4MK 5IP9C 4OIRA 4BY7C 2B63K 3S1NC 4A3BK 2R92C 3HOYC 4BXXK 5IP7C 3GTJK 2JA8C 1HQMA 2R7ZK 5FJ8K 2A68A 5M5WK 4BY1K 1YNJA 1I6HK 3FKIC 1TWFK 5M3FK 3RZOC 3S16K 3RZDC 5M5XK 3I4NK 3S2DK 4GZYA 4Y7NC 3GTGK 3H3VD 4QJVB 3S14C 4Y52C 2PA8D 3HOUC 4YFKA 4A3EK 4A3KC 3M3YC 1YNNA 4A3LK 4Y52K 3S1RK 2JA6C 2BE5A 4LK0A 3GTPC 5IYDK 1TWAK 4MEXA 4A3GC 4NOIA 4QJVA 4BBRK 2NVQC 2R93C 5IYCK 1SFOK 5TMCA 4A3FC 2WB1L 1I50C 4QIWL 2JA5K 5C4JK 3GTMK 3S17C 3GTQK 2A6HA 5C44K 4A3MK 3H0GK 2E2JK 3HOZC 2PMZL 2JA7K 1Y1WC 3S1QK 3PO2K 2NVYK 2YU9K 3S2HK 4A3JC 3S2DC 1TWCK 5C4XK 2E2IK 3PO3C 3GTLC 4Y7NK 3GTOK 3S1MC 4AYBD 3DXJA 4C3HK 4YFNA 2O5IA 4C3IK 3H3VL 2NVTC 5IYDC 1TWAC 1TWHC 1XPPA 2PA8L 4KN7A 1I3QK 4ZH4A 4BBRC 4A3IK 4A93K 3HOWK 2E2HK 4OINA 2NVXK 3CQZK 3HOVK 3GTMC 4C2MK 5C3EC 4G7OA 3GTQC 4X6AK 1TWGK 3GTKK 1K83K 1WCMK 4OIOA 5FLMK 3I4MC 3HKZD 2JA7C 4A3CK 2B63C 4A3BC 3WODA 3PO2C 3EQLA 4BXXC 3S2HC 4Q4ZA 1Y1VK 2YU9C 3GTJC 1BDFA 5IP9K 3HOXK 2R7ZC 4A3LC 4BY7K 5C4XC 2E2IC 4BY1C 4OIQA 3K7AK 1I6HC 3HOYK 1TWFC 3GTOC 5IP7K 3S16C 3I4NC 2WAQD 2JA8K 4G7ZA 4OIPA 3S15K 3GTGC 5IYBK 3M4OK 5M3MK 1ZYRA 3RZOK 3RZDK 5TMFA 4A3EC 2VUMK 4A3IC 4AYBL 1I3QC 3S1RC
chains in the Genus database with same CATH superfamily
3HOVC 1WORA 4C2MC 3HOUK 1J6VA 2Y0SD 3GEEA 1WCMC 1SFOC 1WIHA 5C44C 2R93K 4LJZA 4BKWA 3ADAC 1XXAA 4A3FK 4KM9A 1I50K 3HKZL 4KN4A 1O24A 3K7AC 3S17K 3S1QC 4KAWX 4GTBA 1IS1A 1SFOA 5IYBC 4G7HA 1J98A 3GTQA 4C3HC 4KMUA 2WAQL 1IL2A 1O27A 4YG2A 1WSVA 3FKIK 3SZYA 3FOEA 3LAPA 2FQOA 1TWHK 4A3KK 4X6AC 2O5JA 4XLPA 1Y1VC 4DDQA 3I4MK 2P8TA 2XCOA 1O26A 5M5WK 1PJ6A 3FKIC 1WSRA 2V6UA 3S16K 3I4NK 1Y1VA 3GTGK 3N0CA 4QJVB 4PABA 1O2BA 4GTDA 4YFKA 4A3KC 2NVYA 2D6FC 3M3YC 4A3LK 1KQ4A 3S1RK 1IE0A 2BE5A 4G0WA 2JA6C 1WQGA 3MMLB 5CHPA 5IYDK 1TWAK 3IPJA 4QIWL 2JA5K 3GTMK 3G4CA 4A3MK 3H0GK 4XCHA 3HOZC 1V5VA 1Y1WC 2JA6A 1EH1A 5IOQA 2YU9K 1K83A 1TWCK 4KMHA 2E2IK 3NUHA 4Y7NK 2P5MA 4C3IK 1Y1WA 2NVTC 4P5AA 1TWAC 2CFAB 5IYDC 3N0BA 4WJ4A 1I3QK 1VH2A 2E2HK 4OINA 1X31C 3GTMC 2PHCB 3GTKK 1WOSA 5FLMK 2B63C 4A3BC 3WODA 2YU9C 3TFJA 2R7ZC 2E2IC 4BY1C 1I6HC 5IP7K 1O25A 4G7ZA 4GFQA 3S15K 3BP8C 2RH6A 1YCLA 4M1XA 3RZDK 4Y52C 1I3QC 2R7ZA 3AD8C 4QIWD 4KC6A 1JQWA 3T01A 5C4JC 4A3GK 3AH5A 1WQFA 1GE9A 4KB4A 2A6EA 4KDDA 5TJ3A 3S1MK 4XLNA 3CAGA 3AD9C 3S15C 3S1NK 1BJTA 1J6WA 2JA7A 1IBAA 1ZBSA 4KATA 5M5YK 4A93C 3CQZC 3OPFA 2ZUFA 3GTOA 4LLGA 1IW7A 2WB1D 5C3EK 5IP9C 3S1NC 1XZQA 4BXXK 3GTJK 3L4KA 1HQMA 1WCMA 3T00A 2A68A 1RU0A 1TWFK 2RGRA 1DCPA 5M5XK 3S2DK 4GZYA 4Y7NC 4GTAA 3H3VD 3HOUC 4A3EK 5IORA 3N3YA 1O2AA 4QJVA 4BBRK 1XZQB 2R93C 5IYCK 3L4JA 4A3FC 1I50C 3S17C 2GAHC 2E2JK 3OREA 2PMZL 4G0VA 4O2DA 2NVYK 3S2DC 2R93A 4KASA 4C45A 5C4XK 5EGHA 1I50A 3SZZA 5HL8A 1EK8A 4AYBD 3LPXA 3QX3A 1TWHC 1XPPA 2PA8L 4ZH4A 4BBRC 1O29A 3GSIA 2NVXK 3FKIA 4G7OA 1TWGK 1K83K 3I4MC 3HKZD 2CFAA 1TWHA 4G0UA 4KM8A 2Y3PA 3HOXK 4BY7K 5C4XC 2JH3A 3TTGA 1O2FB 4OIQA 3HOYK 3S16C 1USMA 3I4NC 2WAQD 2JA8K 3GTGC 5M3MK 1ZYRA 3RZOK 1VJEA 2GSNA 5TMFA 2VUMK 4A3LC 3S1RC 5JVOA 1ISEA 3S14K 2NVXC 1EI6A 5CJ9A 4XSZA 1YX2A 3GDZA 3GIRA 3GTGA 1R9TK 3G4AA 4KB2A 4LQYA 1VRQC 3JSTA 2JA5C 4A3MC 3H0GC 2NVQK 3HOXC 2GSUA 3A8KA 4LK1A 1TWAA 1TWCC 2R92K 2XCRB 3GTMA 4A3JK 2VUMC 2ZUEA 1VGXA 4C3IC 4YFXA 2B63A 1EQRA 3PO3K 1IQ0A 3GTLK 4C3JK 4WILA 2YU9A 2XCQA 3LAJA 1F7VA 4PAAA 1TWCA 2E2HC 1R9TC 2E2IA 3GTKC 1XXCA 1PJ5A 5FLMC 2Y0SL 2FQTA 1BS2A 3GTPK 3AQOA 2PPBA 4MQ9A 1I3QA 4OIRA 2E2HA 4GT9A 3Q3QA 2R92C 4J3NA 4GTLA 5JFEA 1ZVUA 5IP7C 3A8IA 1YNJA 5M3FK 3RZDC 2GAGC 1ZQ1C 3T02A 1PJ7A 4LK0A 1XXBA 3GTPC 1EFWA 4A3GC 3A8JA 1SFOK 2GSOA 3S1MC 3GTQK 5C44K 1B4AA 4ILDA 1BGWA 3BUEA 3S1QK 3CQZA 1WQHA 3S2HK 3VA7A 4C3HK 2ZFZA 2O5IA 1VLOA 3AQPA 4A3IK 4KN7A 1AB4A 3BP3A 4AH6A 3HOWK 1JOEA 3ERED 5C3EC 3GTQC 4X6AK 3S0XA 4A3CK 4BXXC 3S2HC 1Y1VK 2W7VA 4GTCA 3GTJC 1BDFA 1DD5A 3HXAA 1TWFC 3M4OK 4KMAA 4A3EC 4A3IC 3GTJA 4GTEA 3HOWC 1I6VA 3GEIA 4MEYA 1TWFA 4FZBA 3M3YK 3FHZA 2CW0A 5IYCC 2JA6K 4A3CC 2A69A 2V6SA 4BBSK 2E2JC 1INNA 4LR2A 4KMDA 3TFIA 1UV7A 4A3DK 2NVYC 3HOZK 1DCOA 1Y1WK 4RMFA 5D4DA 5IOSA 3M4OC 4P5BA 1O28A 3TFHA 1J6XA 4Q5SA 4XSXA 4LOWA 1F93A 3GEHA 1XZPA 2V6TA 1SMYA 2NVTK 4BBSC 1TWGC 1K83C 3OEPA 4JK1A 2PMZD 4A3DC 2EBBA 4BY7C 2B63K 4A3BK 2NVXA 3HOYC 1TWGA 2JA8C 2R7ZK 5FJ8K 4BY1K 1XZPB 1I6HK 4BLAA 4GTFA 3RZOC 2JA5A 3H0GA 3S14C 2PA8D 1YNNA 4Y52K 4MEXA 1JVIA 4NOIA 1ZXOA 2NVQC 2VUMA 5TMCA 2WB1L 4KARA 5L46A 5C4JK 4FM9A 2A6HA 1F7UA 2JA7K 1L0WA 1R9TA 3PO2K 1C0AA 4A3JC 4BLBA 1DCHA 3GTKA 5IOTA 1HI9A 1WOPA 3PO3C 3GTLC 1USOA 3GTOK 4C3JC 3FOFA 1F9NA 3DXJA 4YFNA 3H3VL 2R92A 4P9SA 3V4GA 4A93K 3AD7C 5EGEA 3CQZK 3HOVK 4C2MK 3GTLA 2KWAA 1WCMK 4OIOA 2JA7C 1G51A 5E68A 1B4BA 3PO2C 3EQLA 4Q4ZA 5IP9K 3K7AK 3GTPA 3GTOC 4OIPA 5IYBK 4WJ3M 4AYBL 1WOOA
chains in the Genus database with same CATH topology
3HOWC 3S14K 1I6VA 2NVXC 3HOVC 4MEYA 3HOUK 3M3YK 2Y0SD 4XSZA 1WCMC 2JA6K 2CW0A 5IYCC 4QIWD 1SFOC 4A3CC 1R9TK 2A69A 2JA5C 5C4JC 4A3GK 4BBSK 5C44C 4A3MC 3H0GC 2E2JC 2NVQK 2R93K 4LJZA 3HOXC 4A3FK 2A6EA 3S1QC 1I50K 3HKZL 4KN4A 4LK1A 3K7AC 3S17K 3S1MK 4XLNA 4A3DK 2NVYC 3HOZK 1Y1WK 3S15C 1TWCC 3S1NK 5D4DA 5IYBC 4G7HA 2R92K 3M4OC 4A3JK 4Q5SA 2VUMC 4KMUA 2WAQL 4YG2A 4YFXA 4XSXA 3FKIK 3PO3K 3GTLK 4C3JK 5M5YK 4A93C 2E2HC 1SMYA 1R9TC 3CQZC 2NVTK 1TWHK 4A3KK 4BBSC 4X6AC 1TWGC 4LLGA 3GTKC 1K83C 1IW7A 5FLMC 2WB1D 2Y0SL 3GTPK 2O5JA 5C3EK 4JK1A 2PMZD 4XLPA 2PPBA 4A3DC 1Y1VC 4MQ9A 3I4MK 5IP9C 4OIRA 4BY7C 2B63K 3S1NC 4A3BK 2R92C 3HOYC 4BXXK 5IP7C 3GTJK 2JA8C 1HQMA 2R7ZK 5FJ8K 2A68A 5M5WK 4BY1K 1YNJA 1I6HK 3FKIC 1TWFK 5M3FK 3RZOC 3S16K 3RZDC 5M5XK 3I4NK 3S2DK 4GZYA 4Y7NC 3GTGK 3H3VD 4QJVB 3S14C 4Y52C 2PA8D 3HOUC 4YFKA 4A3EK 4A3KC 3M3YC 1YNNA 4A3LK 4Y52K 3S1RK 2JA6C 2BE5A 4LK0A 3GTPC 5IYDK 1TWAK 4MEXA 4A3GC 4NOIA 4QJVA 4BBRK 2NVQC 2R93C 5IYCK 1SFOK 5TMCA 4A3FC 2WB1L 1I50C 4QIWL 2JA5K 5C4JK 3GTMK 3S17C 3GTQK 2A6HA 5C44K 4A3MK 3H0GK 2E2JK 3HOZC 2PMZL 2JA7K 1Y1WC 3S1QK 3PO2K 2NVYK 2YU9K 3S2HK 4A3JC 3S2DC 1TWCK 5C4XK 2E2IK 3PO3C 3GTLC 4Y7NK 3GTOK 3S1MC 4AYBD 3DXJA 4C3HK 4YFNA 2O5IA 4C3IK 3H3VL 2NVTC 5IYDC 1TWAC 1TWHC 1XPPA 2PA8L 4KN7A 1I3QK 4ZH4A 4BBRC 4A3IK 4A93K 3HOWK 2E2HK 4OINA 2NVXK 3CQZK 3HOVK 3GTMC 4C2MK 5C3EC 4G7OA 3GTQC 4X6AK 1TWGK 3GTKK 1K83K 1WCMK 4OIOA 5FLMK 3I4MC 3HKZD 2JA7C 4A3CK 2B63C 4A3BC 3WODA 3PO2C 3EQLA 4BXXC 3S2HC 4Q4ZA 1Y1VK 2YU9C 3GTJC 1BDFA 5IP9K 3HOXK 2R7ZC 4A3LC 4BY7K 5C4XC 2E2IC 4BY1C 4OIQA 3K7AK 1I6HC 3HOYK 1TWFC 3GTOC 5IP7K 3S16C 3I4NC 2WAQD 2JA8K 4G7ZA 4OIPA 3S15K 3GTGC 5IYBK 3M4OK 5M3MK 1ZYRA 3RZOK 3RZDK 5TMFA 4A3EC 2VUMK 4A3IC 4AYBL 1I3QC 3S1RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW C;  3S14 K;  1I6V A;  2NVX C;  3HOV C;  4MEY A;  3HOU K;  3M3Y K;  2Y0S D;  4XSZ A;  1WCM C;  2JA6 K;  2CW0 A;  5IYC C;  4QIW D;  1SFO C;  4A3C C;  1R9T K;  2A69 A;  2JA5 C;  5C4J C;  4A3G K;  4BBS K;  5C44 C;  4A3M C;  3H0G C;  2E2J C;  2NVQ K;  2R93 K;  4LJZ A;  3HOX C;  4A3F K;  2A6E A;  3S1Q C;  1I50 K;  3HKZ L;  4KN4 A;  4LK1 A;  3K7A C;  3S17 K;  3S1M K;  4XLN A;  4A3D K;  2NVY C;  3HOZ K;  1Y1W K;  3S15 C;  1TWC C;  3S1N K;  5D4D A;  5IYB C;  4G7H A;  2R92 K;  3M4O C;  4A3J K;  4Q5S A;  2VUM C;  4KMU A;  2WAQ L;  4YG2 A;  4YFX A;  4XSX A;  3FKI K;  3PO3 K;  3GTL K;  4C3J K;  5M5Y K;  4A93 C;  2E2H C;  1SMY A;  1R9T C;  3CQZ C;  2NVT K;  1TWH K;  4A3K K;  4BBS C;  4X6A C;  1TWG C;  4LLG A;  3GTK C;  1K83 C;  1IW7 A;  5FLM C;  2WB1 D;  2Y0S L;  3GTP K;  2O5J A;  5C3E K;  4JK1 A;  2PMZ D;  4XLP A;  2PPB A;  4A3D C;  1Y1V C;  4MQ9 A;  3I4M K;  5IP9 C;  4OIR A;  4BY7 C;  2B63 K;  3S1N C;  4A3B K;  2R92 C;  3HOY C;  4BXX K;  5IP7 C;  3GTJ K;  2JA8 C;  1HQM A;  2R7Z K;  5FJ8 K;  2A68 A;  5M5W K;  4BY1 K;  1YNJ A;  1I6H K;  3FKI C;  1TWF K;  5M3F K;  3RZO C;  3S16 K;  3RZD C;  5M5X K;  3I4N K;  3S2D K;  4GZY A;  4Y7N C;  3GTG K;  3H3V D;  4QJV B;  3S14 C;  4Y52 C;  2PA8 D;  3HOU C;  4YFK A;  4A3E K;  4A3K C;  3M3Y C;  1YNN A;  4A3L K;  4Y52 K;  3S1R K;  2JA6 C;  2BE5 A;  4LK0 A;  3GTP C;  5IYD K;  1TWA K;  4MEX A;  4A3G C;  4NOI A;  4QJV A;  4BBR K;  2NVQ C;  2R93 C;  5IYC K;  1SFO K;  5TMC A;  4A3F C;  2WB1 L;  1I50 C;  4QIW L;  2JA5 K;  5C4J K;  3GTM K;  3S17 C;  3GTQ K;  2A6H A;  5C44 K;  4A3M K;  3H0G K;  2E2J K;  3HOZ C;  2PMZ L;  2JA7 K;  1Y1W C;  3S1Q K;  3PO2 K;  2NVY K;  2YU9 K;  3S2H K;  4A3J C;  3S2D C;  1TWC K;  5C4X K;  2E2I K;  3PO3 C;  3GTL C;  4Y7N K;  3GTO K;  3S1M C;  4AYB D;  3DXJ A;  4C3H K;  4YFN A;  2O5I A;  4C3I K;  3H3V L;  2NVT C;  5IYD C;  1TWA C;  1TWH C;  1XPP A;  2PA8 L;  4KN7 A;  1I3Q K;  4ZH4 A;  4BBR C;  4A3I K;  4A93 K;  3HOW K;  2E2H K;  4OIN A;  2NVX K;  3CQZ K;  3HOV K;  3GTM C;  4C2M K;  5C3E C;  4G7O A;  3GTQ C;  4X6A K;  1TWG K;  3GTK K;  1K83 K;  1WCM K;  4OIO A;  5FLM K;  3I4M C;  3HKZ D;  2JA7 C;  4A3C K;  2B63 C;  4A3B C;  3WOD A;  3PO2 C;  3EQL A;  4BXX C;  3S2H C;  4Q4Z A;  1Y1V K;  2YU9 C;  3GTJ C;  1BDF A;  5IP9 K;  3HOX K;  2R7Z C;  4A3L C;  4BY7 K;  5C4X C;  2E2I C;  4BY1 C;  4OIQ A;  3K7A K;  1I6H C;  3HOY K;  1TWF C;  3GTO C;  5IP7 K;  3S16 C;  3I4N C;  2WAQ D;  2JA8 K;  4G7Z A;  4OIP A;  3S15 K;  3GTG C;  5IYB K;  3M4O K;  5M3M K;  1ZYR A;  3RZO K;  3RZD K;  5TMF A;  4A3E C;  2VUM K;  4A3I C;  4AYB L;  1I3Q C;  3S1R C; 
#chains in the Genus database with same CATH topology
 3HOV C;  1WOR A;  4C2M C;  3HOU K;  1J6V A;  2Y0S D;  3GEE A;  1WCM C;  1SFO C;  1WIH A;  5C44 C;  2R93 K;  4LJZ A;  4BKW A;  3ADA C;  1XXA A;  4A3F K;  4KM9 A;  1I50 K;  3HKZ L;  4KN4 A;  1O24 A;  3K7A C;  3S17 K;  3S1Q C;  4KAW X;  4GTB A;  1IS1 A;  1SFO A;  5IYB C;  4G7H A;  1J98 A;  3GTQ A;  4C3H C;  4KMU A;  2WAQ L;  1IL2 A;  1O27 A;  4YG2 A;  1WSV A;  3FKI K;  3SZY A;  3FOE A;  3LAP A;  2FQO A;  1TWH K;  4A3K K;  4X6A C;  2O5J A;  4XLP A;  1Y1V C;  4DDQ A;  3I4M K;  2P8T A;  2XCO A;  1O26 A;  5M5W K;  1PJ6 A;  3FKI C;  1WSR A;  2V6U A;  3S16 K;  3I4N K;  1Y1V A;  3GTG K;  3N0C A;  4QJV B;  4PAB A;  1O2B A;  4GTD A;  4YFK A;  4A3K C;  2NVY A;  2D6F C;  3M3Y C;  4A3L K;  1KQ4 A;  3S1R K;  1IE0 A;  2BE5 A;  4G0W A;  2JA6 C;  1WQG A;  3MML B;  5CHP A;  5IYD K;  1TWA K;  3IPJ A;  4QIW L;  2JA5 K;  3GTM K;  3G4C A;  4A3M K;  3H0G K;  4XCH A;  3HOZ C;  1V5V A;  1Y1W C;  2JA6 A;  1EH1 A;  5IOQ A;  2YU9 K;  1K83 A;  1TWC K;  4KMH A;  2E2I K;  3NUH A;  4Y7N K;  2P5M A;  4C3I K;  1Y1W A;  2NVT C;  4P5A A;  1TWA C;  2CFA B;  5IYD C;  3N0B A;  4WJ4 A;  1I3Q K;  1VH2 A;  2E2H K;  4OIN A;  1X31 C;  3GTM C;  2PHC B;  3GTK K;  1WOS A;  5FLM K;  2B63 C;  4A3B C;  3WOD A;  2YU9 C;  3TFJ A;  2R7Z C;  2E2I C;  4BY1 C;  1I6H C;  5IP7 K;  1O25 A;  4G7Z A;  4GFQ A;  3S15 K;  3BP8 C;  2RH6 A;  1YCL A;  4M1X A;  3RZD K;  4Y52 C;  1I3Q C;  2R7Z A;  3AD8 C;  4QIW D;  4KC6 A;  1JQW A;  3T01 A;  5C4J C;  4A3G K;  3AH5 A;  1WQF A;  1GE9 A;  4KB4 A;  2A6E A;  4KDD A;  5TJ3 A;  3S1M K;  4XLN A;  3CAG A;  3AD9 C;  3S15 C;  3S1N K;  1BJT A;  1J6W A;  2JA7 A;  1IBA A;  1ZBS A;  4KAT A;  5M5Y K;  4A93 C;  3CQZ C;  3OPF A;  2ZUF A;  3GTO A;  4LLG A;  1IW7 A;  2WB1 D;  5C3E K;  5IP9 C;  3S1N C;  1XZQ A;  4BXX K;  3GTJ K;  3L4K A;  1HQM A;  1WCM A;  3T00 A;  2A68 A;  1RU0 A;  1TWF K;  2RGR A;  1DCP A;  5M5X K;  3S2D K;  4GZY A;  4Y7N C;  4GTA A;  3H3V D;  3HOU C;  4A3E K;  5IOR A;  3N3Y A;  1O2A A;  4QJV A;  4BBR K;  1XZQ B;  2R93 C;  5IYC K;  3L4J A;  4A3F C;  1I50 C;  3S17 C;  2GAH C;  2E2J K;  3ORE A;  2PMZ L;  4G0V A;  4O2D A;  2NVY K;  3S2D C;  2R93 A;  4KAS A;  4C45 A;  5C4X K;  5EGH A;  1I50 A;  3SZZ A;  5HL8 A;  1EK8 A;  4AYB D;  3LPX A;  3QX3 A;  1TWH C;  1XPP A;  2PA8 L;  4ZH4 A;  4BBR C;  1O29 A;  3GSI A;  2NVX K;  3FKI A;  4G7O A;  1TWG K;  1K83 K;  3I4M C;  3HKZ D;  2CFA A;  1TWH A;  4G0U A;  4KM8 A;  2Y3P A;  3HOX K;  4BY7 K;  5C4X C;  2JH3 A;  3TTG A;  1O2F B;  4OIQ A;  3HOY K;  3S16 C;  1USM A;  3I4N C;  2WAQ D;  2JA8 K;  3GTG C;  5M3M K;  1ZYR A;  3RZO K;  1VJE A;  2GSN A;  5TMF A;  2VUM K;  4A3L C;  3S1R C;  5JVO A;  1ISE A;  3S14 K;  2NVX C;  1EI6 A;  5CJ9 A;  4XSZ A;  1YX2 A;  3GDZ A;  3GIR A;  3GTG A;  1R9T K;  3G4A A;  4KB2 A;  4LQY A;  1VRQ C;  3JST A;  2JA5 C;  4A3M C;  3H0G C;  2NVQ K;  3HOX C;  2GSU A;  3A8K A;  4LK1 A;  1TWA A;  1TWC C;  2R92 K;  2XCR B;  3GTM A;  4A3J K;  2VUM C;  2ZUE A;  1VGX A;  4C3I C;  4YFX A;  2B63 A;  1EQR A;  3PO3 K;  1IQ0 A;  3GTL K;  4C3J K;  4WIL A;  2YU9 A;  2XCQ A;  3LAJ A;  1F7V A;  4PAA A;  1TWC A;  2E2H C;  1R9T C;  2E2I A;  3GTK C;  1XXC A;  1PJ5 A;  5FLM C;  2Y0S L;  2FQT A;  1BS2 A;  3GTP K;  3AQO A;  2PPB A;  4MQ9 A;  1I3Q A;  4OIR A;  2E2H A;  4GT9 A;  3Q3Q A;  2R92 C;  4J3N A;  4GTL A;  5JFE A;  1ZVU A;  5IP7 C;  3A8I A;  1YNJ A;  5M3F K;  3RZD C;  2GAG C;  1ZQ1 C;  3T02 A;  1PJ7 A;  4LK0 A;  1XXB A;  3GTP C;  1EFW A;  4A3G C;  3A8J A;  1SFO K;  2GSO A;  3S1M C;  3GTQ K;  5C44 K;  1B4A A;  4ILD A;  1BGW A;  3BUE A;  3S1Q K;  3CQZ A;  1WQH A;  3S2H K;  3VA7 A;  4C3H K;  2ZFZ A;  2O5I A;  1VLO A;  3AQP A;  4A3I K;  4KN7 A;  1AB4 A;  3BP3 A;  4AH6 A;  3HOW K;  1JOE A;  3ERE D;  5C3E C;  3GTQ C;  4X6A K;  3S0X A;  4A3C K;  4BXX C;  3S2H C;  1Y1V K;  2W7V A;  4GTC A;  3GTJ C;  1BDF A;  1DD5 A;  3HXA A;  1TWF C;  3M4O K;  4KMA A;  4A3E C;  4A3I C;  3GTJ A;  4GTE A;  3HOW C;  1I6V A;  3GEI A;  4MEY A;  1TWF A;  4FZB A;  3M3Y K;  3FHZ A;  2CW0 A;  5IYC C;  2JA6 K;  4A3C C;  2A69 A;  2V6S A;  4BBS K;  2E2J C;  1INN A;  4LR2 A;  4KMD A;  3TFI A;  1UV7 A;  4A3D K;  2NVY C;  3HOZ K;  1DCO A;  1Y1W K;  4RMF A;  5D4D A;  5IOS A;  3M4O C;  4P5B A;  1O28 A;  3TFH A;  1J6X A;  4Q5S A;  4XSX A;  4LOW A;  1F93 A;  3GEH A;  1XZP A;  2V6T A;  1SMY A;  2NVT K;  4BBS C;  1TWG C;  1K83 C;  3OEP A;  4JK1 A;  2PMZ D;  4A3D C;  2EBB A;  4BY7 C;  2B63 K;  4A3B K;  2NVX A;  3HOY C;  1TWG A;  2JA8 C;  2R7Z K;  5FJ8 K;  4BY1 K;  1XZP B;  1I6H K;  4BLA A;  4GTF A;  3RZO C;  2JA5 A;  3H0G A;  3S14 C;  2PA8 D;  1YNN A;  4Y52 K;  4MEX A;  1JVI A;  4NOI A;  1ZXO A;  2NVQ C;  2VUM A;  5TMC A;  2WB1 L;  4KAR A;  5L46 A;  5C4J K;  4FM9 A;  2A6H A;  1F7U A;  2JA7 K;  1L0W A;  1R9T A;  3PO2 K;  1C0A A;  4A3J C;  4BLB A;  1DCH A;  3GTK A;  5IOT A;  1HI9 A;  1WOP A;  3PO3 C;  3GTL C;  1USO A;  3GTO K;  4C3J C;  3FOF A;  1F9N A;  3DXJ A;  4YFN A;  3H3V L;  2R92 A;  4P9S A;  3V4G A;  4A93 K;  3AD7 C;  5EGE A;  3CQZ K;  3HOV K;  4C2M K;  3GTL A;  2KWA A;  1WCM K;  4OIO A;  2JA7 C;  1G51 A;  5E68 A;  1B4B A;  3PO2 C;  3EQL A;  4Q4Z A;  5IP9 K;  3K7A K;  3GTP A;  3GTO C;  4OIP A;  5IYB K;  4WJ3 M;  4AYB L;  1WOO A; 
#chains in the Genus database with same CATH homology
 3HOW C;  3S14 K;  1I6V A;  2NVX C;  3HOV C;  4MEY A;  3HOU K;  3M3Y K;  2Y0S D;  4XSZ A;  1WCM C;  2JA6 K;  2CW0 A;  5IYC C;  4QIW D;  1SFO C;  4A3C C;  1R9T K;  2A69 A;  2JA5 C;  5C4J C;  4A3G K;  4BBS K;  5C44 C;  4A3M C;  3H0G C;  2E2J C;  2NVQ K;  2R93 K;  4LJZ A;  3HOX C;  4A3F K;  2A6E A;  3S1Q C;  1I50 K;  3HKZ L;  4KN4 A;  4LK1 A;  3K7A C;  3S17 K;  3S1M K;  4XLN A;  4A3D K;  2NVY C;  3HOZ K;  1Y1W K;  3S15 C;  1TWC C;  3S1N K;  5D4D A;  5IYB C;  4G7H A;  2R92 K;  3M4O C;  4A3J K;  4Q5S A;  2VUM C;  4KMU A;  2WAQ L;  4YG2 A;  4YFX A;  4XSX A;  3FKI K;  3PO3 K;  3GTL K;  4C3J K;  5M5Y K;  4A93 C;  2E2H C;  1SMY A;  1R9T C;  3CQZ C;  2NVT K;  1TWH K;  4A3K K;  4BBS C;  4X6A C;  1TWG C;  4LLG A;  3GTK C;  1K83 C;  1IW7 A;  5FLM C;  2WB1 D;  2Y0S L;  3GTP K;  2O5J A;  5C3E K;  4JK1 A;  2PMZ D;  4XLP A;  2PPB A;  4A3D C;  1Y1V C;  4MQ9 A;  3I4M K;  5IP9 C;  4OIR A;  4BY7 C;  2B63 K;  3S1N C;  4A3B K;  2R92 C;  3HOY C;  4BXX K;  5IP7 C;  3GTJ K;  2JA8 C;  1HQM A;  2R7Z K;  5FJ8 K;  2A68 A;  5M5W K;  4BY1 K;  1YNJ A;  1I6H K;  3FKI C;  1TWF K;  5M3F K;  3RZO C;  3S16 K;  3RZD C;  5M5X K;  3I4N K;  3S2D K;  4GZY A;  4Y7N C;  3GTG K;  3H3V D;  4QJV B;  3S14 C;  4Y52 C;  2PA8 D;  3HOU C;  4YFK A;  4A3E K;  4A3K C;  3M3Y C;  1YNN A;  4A3L K;  4Y52 K;  3S1R K;  2JA6 C;  2BE5 A;  4LK0 A;  3GTP C;  5IYD K;  1TWA K;  4MEX A;  4A3G C;  4NOI A;  4QJV A;  4BBR K;  2NVQ C;  2R93 C;  5IYC K;  1SFO K;  5TMC A;  4A3F C;  2WB1 L;  1I50 C;  4QIW L;  2JA5 K;  5C4J K;  3GTM K;  3S17 C;  3GTQ K;  2A6H A;  5C44 K;  4A3M K;  3H0G K;  2E2J K;  3HOZ C;  2PMZ L;  2JA7 K;  1Y1W C;  3S1Q K;  3PO2 K;  2NVY K;  2YU9 K;  3S2H K;  4A3J C;  3S2D C;  1TWC K;  5C4X K;  2E2I K;  3PO3 C;  3GTL C;  4Y7N K;  3GTO K;  3S1M C;  4AYB D;  3DXJ A;  4C3H K;  4YFN A;  2O5I A;  4C3I K;  3H3V L;  2NVT C;  5IYD C;  1TWA C;  1TWH C;  1XPP A;  2PA8 L;  4KN7 A;  1I3Q K;  4ZH4 A;  4BBR C;  4A3I K;  4A93 K;  3HOW K;  2E2H K;  4OIN A;  2NVX K;  3CQZ K;  3HOV K;  3GTM C;  4C2M K;  5C3E C;  4G7O A;  3GTQ C;  4X6A K;  1TWG K;  3GTK K;  1K83 K;  1WCM K;  4OIO A;  5FLM K;  3I4M C;  3HKZ D;  2JA7 C;  4A3C K;  2B63 C;  4A3B C;  3WOD A;  3PO2 C;  3EQL A;  4BXX C;  3S2H C;  4Q4Z A;  1Y1V K;  2YU9 C;  3GTJ C;  1BDF A;  5IP9 K;  3HOX K;  2R7Z C;  4A3L C;  4BY7 K;  5C4X C;  2E2I C;  4BY1 C;  4OIQ A;  3K7A K;  1I6H C;  3HOY K;  1TWF C;  3GTO C;  5IP7 K;  3S16 C;  3I4N C;  2WAQ D;  2JA8 K;  4G7Z A;  4OIP A;  3S15 K;  3GTG C;  5IYB K;  3M4O K;  5M3M K;  1ZYR A;  3RZO K;  3RZD K;  5TMF A;  4A3E C;  2VUM K;  4A3I C;  4AYB L;  1I3Q C;  3S1R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...