3OEPA

Crystal structure of ttha0988 in space group p43212
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
485
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 129
structure length 485
sequence length 492
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oepA01
4YUIA 4N1SA 2ZP2A 2XCOA 1CLHA 2X2CK 1M63C 5KV2A 5KURA 1LOPA 4YUHA 2ALFA 1M9CA 3QX3A 4FM9A 2P0OA 2POYA 5F66A 1CWAA 5CYHA 3K0NA 1W8LA 4N1NA 1M9XA 3K0PA 2N0TA 4G0UA 2POEA 3CAGA 2X7KA 3L4JA 1ZKCA 2R99A 1QNHA 3NUHA 4N1RA 5KV3A 1A33A 5KV0A 2KWAA 3L4KA 1ISEA 4N1OA 1EH1A 2HE9A 4YUNA 1W8MA 3CYSA 1WQGA 2MS4A 1XXAA 1CWKA 1VBSA 4J58A 3R57A 3RFYA 5KULA 3LAJA 5KV7A 1B4AA 4KB2A 3BT8A 4R3FA 1AWTA 3VA7A 2MVZA 2K7NA 1M9FA 4DGCA 1CWLA 3V4GA 1X7FA 1DYWA 3R49A 3RD9X 5CBTA 4J3NA 3OEPA 2RS4A 2B71A 1IIPA 2IGWA 1XQ7A 3RCIX 1AWQA 4XNCA 2XCRB 5KV4A 2RMAA 1XXCA 4N1QA 1H0PA 2HAQA 3BO7A 2BITX 3UCHA 3BKPA 4JJMA 1AWRA 5CJ9A 1CWJA 3ICHA 1VDNA 4YUGA 4G0VA 3R56A 4N1MA 2CPLA 1Z81A 1BCKA 2NULA 3K0RA 3R59A 5CCQA 1W74A 1IHGA 2A2NA 2XCQA 2XGYB 2BIUX 2Z6WA 3RDAX 2MZUA 1AWSA 1ZVUA 4R3EA 5KUUA 5KUOA 2HQ6A 1AWUA 3RCLA 4KC6A 1FGLA 2WFIA 1B4BA 3FOFA 4DGAA 3CYHA 1MF8C 4E1QA 5JHEA 3RDCA 1CYNA 5CBWA 3O7TA 3BUEA 1AK4A 3RDDA 2ZFZA 1GE9A 3FHZA 5DUDA 3FOEA 5A0EA 1XO7A 1XWNA 4O8HA 3OREA 2RMBA 3ICIA 1CWMA 2WLWA 2RGRA 5KV5A 1CWOA 2PHCB 1E3BA 4DGDA 4CYHA 4J5DX 1RMHA 5KUWA 3ODIA 3OPFA 2C3BA 4TOTA 3QYUA 5LUDA 1YNDA 4IPZA 4HY7A 2Y3PA 1CWHA 4I9YA 1CWFA 1BJTA 4FRUA 3RDBA 1M9EA 2P5MA 4JCPA 3LAPA 4LQWA 3JB9d 3R54A 5KV6A 5JVOA 3K2CA 2RMCA 1QOIA 1NMKA 1ZMFA 4J5EX 2OK3A 1AWVA 1BGWA 1A58A 2CYHA 1XYHA 4KB4A 4KAWX 1VBTA 1F9NA 3ERED 2CFEA 1AB4A 5KUVA 2X25B 4YUPA 3T1UA 3S6MA 3MMLB 3R4GA 4O8IA 1OCAA 1WIHA 4J59A 1QNGA 3ODLA 5KUNA 5KUSA 2MC9A 1MZWA 4YUKA 3EOVA 4GFQA 1CWCA 3RCKX 5CCSX 2OJUA 2X2DB 5KV1A 4J5BA 1CWIA 3K0QA 1ZKFA 4G0WA 4DGBA 2OSEA 2FU0A 1ISTA 1MIKA 1DD5A 2HQJA 5KUQA 4ZSDA 1IS1A 4S1EA 3LPXA 1C5FA 4EYVA 1E8KA 4J5AX 1WQHA 2X83B 3K0MA 2WFJA 3RCFA 4YUJA 4J5CX 1WQFA 2QERA 5CCNA 5CCRA 5CBVA 5CBUA 2IGVA 1V9TA 4DDQA 3MMLA 4FRVA 2PLUA 1J2AA 1M9DA 1EK8A 5KUZA 4DGEA 2X2AA 2GW2A 4S1JA 4N1PA 3K0OA 1CWBA 2ESLA 1M9YA 1W8VA 4ZSCA 4YULA 4KDDA 2CK1A 1VAIA 4YUMA 4YUOA 2CMTA 1XXBA 3PMPA 3RCGA
chains in the Genus database with same CATH superfamily
3JSTA 4Y7NK 1XPPA 1F7UA 4YUIA 4GTDA 3AH5A 2O5JA 4KM8A 4N1SA 2ZP2A 2Y0SL 3GTMK 2XCOA 1CLHA 2X2CK 3GTKC 2NVTC 4Q5SA 2R93K 5M5XK 1SMYA 2NVYA 1M63C 5KV2A 5KURA 4GTEA 1LOPA 4YUHA 2ALFA 1J6VA 3GIRA 5FLMC 5IYBC 1M9CA 4GTAA 1SFOA 3HOZC 2VUMC 3QX3A 5C4JC 3S0XA 4OIOA 4ZH4A 4FM9A 2P0OA 1PJ5A 1JVIA 2POYA 5F66A 1YNNA 1CWAA 5CYHA 3K0NA 1W8LA 4N1NA 4A3EC 1M9XA 3S1MC 2W7VA 3RZDC 3M3YC 4A93C 1I6HK 3K0PA 4XLNA 5C44K 2N0TA 4GTCA 4G0UA 2POEA 4A3JK 5TJ3A 4GTFA 5EGHA 2ZUFA 1Y1VK 3CAGA 2X7KA 5IOSA 3HOUC 3S15C 1WCMK 3I4NC 1TWHA 4BY1C 4GT9A 4XCHA 4C3HC 3L4JA 4OIPA 1ZKCA 4A3GK 2R99A 2GSOA 1QNHA 3AD9C 1TWCC 3NUHA 3T00A 2NVXA 4N1RA 3G4CA 4LJZA 2V6SA 3SZZA 5KV3A 1A33A 5KV0A 2KWAA 4GTLA 4PAAA 1O27A 3L4KA 3AD8C 4P5BA 1ISEA 3GTMA 4KATA 4N1OA 3IPJA 2R93A 1EH1A 1YNJA 1Y1WK 2JA7K 2PMZD 1PJ6A 3M4OC 5IORA 3GDZA 1O29A 2GSNA 2HE9A 4BY7C 4YUNA 1I6VA 3A8KA 3GTLC 3PO2C 1W8MA 1O2BA 5TMCA 3CYSA 5EGEA 1ZBSA 3HOYK 1WQGA 2MS4A 1XXAA 2R7ZC 4Q4ZA 3S1RC 5IYDK 1CWKA 4Y52C 1VBSA 4J58A 3R57A 2JH3A 5HL8A 4A3MC 1DCPA 5IOQA 1WORA 3A8JA 1VH2A 3GEEA 4AYBD 2E2JK 3RFYA 5KULA 3LAJA 5KV7A 2JA8C 1B4AA 4KB2A 1VGXA 3BT8A 4R3FA 1AWTA 1EQRA 3VA7A 2MVZA 3N3YA 2K7NA 1Y1VA 1M9FA 4DGCA 1CWLA 3V4GA 4LQYA 3GTJK 1WCMA 1I3QC 1SFOK 4A3CC 1X7FA 4G7OA 1DYWA 3R49A 2B63C 3GTMC 4PABA 3RD9X 3FKIK 3AD7C 5IP7C 4A3FC 5CBTA 4J3NA 3BP3A 3OEPA 2PA8D 3GTQK 3S2HK 3GTPC 2BE5A 4ILDA 1HQMA 1O28A 1TWAK 2RS4A 2B71A 1IIPA 2IGWA 4YFKA 4BXXC 1XQ7A 3RCIX 2WAQL 1AWQA 3CQZC 3TFHA 2PMZL 4XNCA 1TWFC 2XCRB 1I6HC 2JA7A 3S17K 5KV4A 2RMAA 4LOWA 1XXCA 4N1QA 1H0PA 2HAQA 3GSIA 4A3IK 3BO7A 5C4XC 2YU9C 2A68A 2BITX 3UCHA 4BBRK 3H0GC 3X27A 3BKPA 4JJMA 2NVXK 4A3KK 2E2HA 1AWRA 2O5IA 4AYBL 5CJ9A 1CWJA 3ICHA 1VDNA 3N0BA 1VJEA 4YUGA 3WODA 1XZPB 4G0VA 4A3LC 4A3BK 4X6AK 4XSZA 3R56A 1EFWA 5M5WK 1IBAA 4C2MK 3RZOC 4N1MA 2CPLA 3GTGK 3GTJA 2NVQC 1Z81A 1ZYRA 1BCKA 2EBBA 2NULA 3K0RA 3R59A 5CCQA 4C3JC 1V5VA 1W74A 3FKIA 1IHGA 4OINA 2PA8L 3N0CA 2A2NA 2XCQA 4C3IC 3S16K 1Y1WC 3S1QC 5IYCC 3GTQA 2XGYB 1JOEA 5C3EK 1J98A 1TWAA 2BIUX 2Z6WA 3RDAX 2R92K 3S2DK 4A3DC 4QJVB 4G7HA 3HOWC 2MZUA 1AWSA 1INNA 2E2IK 2FQOA 1ZVUA 1TWGK 3PO3C 4R3EA 5KUUA 4BBSK 3GTOC 5KUOA 4MEXA 2HQ6A 1AWUA 3RCLA 4KC6A 1O24A 1FGLA 2WFIA 1B4BA 1O2AA 1K83K 1DCOA 2JA5K 3FOFA 4LK1A 4DGAA 2KA0A 3CYHA 1MF8C 4E1QA 5JHEA 2NVYC 3RDCA 4BKWA 1CYNA 2JA6K 5CBWA 3HOXK 3O7TA 3BUEA 1SFOC 4NOIA 1AK4A 3RDDA 1DCHA 2ZFZA 1GE9A 3FHZA 5DUDA 3FOEA 4P9SA 2WAQD 5A0EA 1XO7A 3K7AC 1XWNA 4O8HA 3OREA 4M1XA 2RMBA 3ICIA 1CWMA 4JK1A 1I50A 3GTKK 3S2HC 2NVTK 2WLWA 3GTGA 4FZBA 4KN4A 2RGRA 1ZXOA 1O26A 5KV5A 3S1NK 3AQPA 4QIWL 2WB1D 1CWOA 2PHCB 5IYBK 2V6UA 1BDFA 1PJ7A 2VUMK 1E3BA 3KOPA 1C0AA 4DGDA 4CYHA 5C4JK 2E2HK 4J5DX 1RMHA 5KUWA 5M3MK 2R92A 1TWHC 3ODIA 3OPFA 3EQLA 5M5YK 2C3BA 4A3IC 1X31C 2E2IA 4TOTA 1TWGA 3RZDK 3M3YK 4A93K 3QYUA 4BBRC 5LUDA 1IQ0A 1YNDA 3S14K 4Y7NC 4IPZA 4HY7A 2Y3PA 1CWHA 3TFIA 1XZPA 4A3KC 2NVXC 4OIQA 4WJ4A 1JQWA 4I9YA 4KMHA 1K83A 2JA5A 1CWFA 4LLGA 1XZQB 2V6TA 4MQ9A 1BJTA 4GZYA 1HI9A 3S15K 2R93C 4FRUA 3RDBA 1EI6A 1M9EA 2P5MA 3GEHA 1L0WA 4JCPA 3LAPA 4LQWA 4C2MC 2JA6A 3JB9d 3R54A 4KM9A 5KV6A 5FJ8K 1TWCK 5JVOA 4WJ3M 1F7VA 3K2CA 4QJVA 3S16C 2RMCA 5L46A 3GTKA 5C3EC 3ADAC 3S2DC 1YX2A 1QOIA 2A6HA 1NMKA 2WB1L 4GTBA 4YFNA 4YFXA 2NNZA 5C44C 1ZMFA 4KMDA 4J5EX 4A3JC 2ZUEA 4G7ZA 3SZYA 4BLBA 5IP9K 3GTLK 2VUMA 2A6EA 2OK3A 4BBSC 1AWVA 1BGWA 1A58A 1IL2A 1WSRA 1Y1VC 5D4DA 1YCLA 2CYHA 5M3FK 1WCMC 3S1RK 2R7ZK 1XYHA 4Y52K 4KB4A 3H3VD 1UV7A 3HXAA 4A3MK 3I4MK 4KAWX 4A3GC 1VBTA 1F9NA 3ERED 2CFEA 1I50K 3TTGA 1AB4A 5KUVA 2X25B 4YUPA 3T1UA 3Q3QA 3S6MA 4LK0A 3MMLB 2GAHC 2D6FC 2FQTA 2RH6A 3R4GA 4A3CK 1I3QK 4O8IA 4BLAA 1OCAA 4QIWD 4XLPA 1WIHA 2JA7C 4J59A 4RMFA 5E68A 2B63K 5JFEA 5IP7K 4A3FK 1IE0A 3S1NC 1TWCA 1IW7A 3GTPK 3HOYC 1QNGA 3ODLA 5KUNA 5KUSA 1WSVA 2MC9A 4BXXK 5IYDC 3HOVK 2A69A 1MZWA 4YUKA 4KMAA 3CQZK 3EOVA 2E2HC 4GFQA 1CWCA 1TWFK 3RCKX 5CCSX 5IOTA 5CHPA 2E2JC 3T01A 2OJUA 2X2DB 5KV1A 4J5BA 3GTLA 2CFAB 1CWIA 3K0QA 5C4XK 3S14C 1ZKFA 3HKZL 1R9TK 1O2FB 2YU9K 1XZQA 3H3VL 3GTJC 2R7ZA 3H0GK 4G0WA 4DGBA 1J6WA 1RU0A 2OSEA 1VLOA 1ZQ1C 3FKIC 2FU0A 3GEIA 3G4AA 1G51A 1ISTA 1MIKA 1BS2A 4AH6A 1DD5A 3GTQC 2HQJA 5KUQA 4A3LK 2PPBA 4ZSDA 1IS1A 1TWAC 4S1EA 3LPXA 1C5FA 4EYVA 1J6XA 4KMUA 4OIRA 1KQ4A 3RZOK 5FLMK 1I3QA 3HOZK 1E8KA 2NVQK 4WILA 4J5AX 1WQHA 2B63A 4C3JK 2X83B 3K0MA 3S17C 3A8IA 2WFJA 5TMFA 4C3IK 3S1QK 5IYCK 3RCFA 4YUJA 4A3EK 4J5CX 3GTPA 3S1MK 4A3DK 5IP9C 3HOWK 1WQFA 3CQZA 2QERA 5CCNA 2P8TA 5CCRA 1USOA 1TWFA 3PO3K 3GTOK 4C45A 3TFJA 3T02A 5CBVA 1WOOA 3HOUK 3I4MC 5CBUA 3I4NK 4A3BC 4X6AC 2IGVA 4LR2A 1WOSA 4KARA 1V9TA 4BY1K 4C3HK 4DDQA 3MMLA 1R9TA 1I50C 2YU9A 4FRVA 3GTGC 2Y0SD 2PLUA 1J2AA 1M9DA 1EK8A 2CW0A 5KUZA 3H0GA 4KN7A 2NVYK 3DXJA 4KASA 4DGEA 2X2AA 2GW2A 4S1JA 4N1PA 3K0OA 1VRQC 4XSXA 1F93A 2R92C 3K7AK 4P5AA 1WOPA 3M4OK 2E2IC 1CWBA 2ESLA 4O2DA 1M9YA 4BY7K 1TWGC 1W8VA 3PO2K 3BP8C 1O25A 3HOVC 4ZSCA 4MEYA 4YULA 4YG2A 3HKZD 4KDDA 2CK1A 1Y1WA 2GSUA 1K83C 2CFAA 2JA5C 1VAIA 4YUMA 4YUOA 2CMTA 2GAGC 1XXBA 1ZX8A 1TWHK 3PMPA 3RCGA 3AQOA 2JA8K 1R9TC 3HOXC 2JA6C 1USMA 3GTOA
chains in the Genus database with same CATH topology
4YUIA 4GTDA 3AH5A 4KM8A 4N1SA 2ZP2A 2XCOA 1CLHA 2X2CK 2NVYA 1M63C 5KV2A 5KURA 4GTEA 1LOPA 4YUHA 2ALFA 1M9CA 4GTAA 1SFOA 3QX3A 3S0XA 4FM9A 2P0OA 2POYA 5F66A 1CWAA 5CYHA 3K0NA 1W8LA 4N1NA 1M9XA 3K0PA 2N0TA 4GTCA 4G0UA 2POEA 5TJ3A 4GTFA 5EGHA 3CAGA 2X7KA 5IOSA 1TWHA 4GT9A 4C3HC 3L4JA 1ZKCA 2R99A 2GSOA 1QNHA 3NUHA 2NVXA 4N1RA 3G4CA 5KV3A 1A33A 5KV0A 2KWAA 4GTLA 1O27A 3L4KA 3GTMA 4P5BA 1ISEA 4KATA 4N1OA 2R93A 1EH1A 5IORA 1O29A 2GSNA 2HE9A 4YUNA 1W8MA 1O2BA 3CYSA 5EGEA 1ZBSA 1WQGA 2MS4A 1XXAA 1CWKA 1VBSA 4J58A 2JH3A 3R57A 5IOQA 3RFYA 5KULA 3LAJA 5KV7A 1B4AA 4KB2A 3BT8A 4R3FA 1AWTA 3VA7A 2MVZA 3N3YA 1Y1VA 2K7NA 1M9FA 4DGCA 1CWLA 3V4GA 4LQYA 1WCMA 1X7FA 1DYWA 3R49A 3RD9X 5CBTA 4J3NA 3OEPA 4ILDA 1O28A 2RS4A 2B71A 1IIPA 2IGWA 1XQ7A 3RCIX 1AWQA 4XNCA 2XCRB 2JA7A 5KV4A 2RMAA 1XXCA 4N1QA 1H0PA 2HAQA 3BO7A 2BITX 3UCHA 3BKPA 4JJMA 2E2HA 1AWRA 5CJ9A 1CWJA 3ICHA 1VDNA 3N0BA 4YUGA 4G0VA 3R56A 4N1MA 2CPLA 3GTJA 1Z81A 1BCKA 2NULA 3K0RA 3R59A 5CCQA 4C3JC 3FKIA 1W74A 1IHGA 3N0CA 2A2NA 2XCQA 4C3IC 3GTQA 2XGYB 1TWAA 2BIUX 2Z6WA 3RDAX 2MZUA 1AWSA 1ZVUA 4R3EA 5KUUA 5KUOA 2HQ6A 1AWUA 3RCLA 4KC6A 1O24A 1FGLA 2WFIA 1B4BA 1O2AA 3FOFA 4DGAA 3CYHA 1MF8C 4E1QA 5JHEA 3RDCA 4BKWA 1CYNA 5CBWA 3O7TA 3BUEA 1AK4A 3RDDA 2ZFZA 1GE9A 3FHZA 5DUDA 3FOEA 5A0EA 1XO7A 1XWNA 4O8HA 3OREA 4M1XA 2RMBA 3ICIA 1CWMA 1I50A 3GTGA 2WLWA 4FZBA 2RGRA 1ZXOA 1O26A 5KV5A 3AQPA 1CWOA 2PHCB 1E3BA 4DGDA 4CYHA 4J5DX 1RMHA 5KUWA 2R92A 3ODIA 3OPFA 2C3BA 2E2IA 4TOTA 1TWGA 3QYUA 5LUDA 1YNDA 4IPZA 4HY7A 2Y3PA 1CWHA 4I9YA 4KMHA 1K83A 2JA5A 1CWFA 1BJTA 4FRUA 3RDBA 1M9EA 2P5MA 4JCPA 3LAPA 4LQWA 4C2MC 2JA6A 3JB9d 3R54A 4KM9A 5KV6A 5JVOA 3K2CA 2RMCA 3GTKA 1QOIA 4GTBA 1NMKA 1ZMFA 4KMDA 4J5EX 4BLBA 2VUMA 2OK3A 1AWVA 1BGWA 1A58A 2CYHA 1XYHA 4KB4A 4KAWX 1VBTA 1F9NA 3ERED 2CFEA 1AB4A 5KUVA 2X25B 4YUPA 3T1UA 3Q3QA 3S6MA 3MMLB 2RH6A 3R4GA 4O8IA 4BLAA 1OCAA 1WIHA 4J59A 5JFEA 1TWCA 1QNGA 3ODLA 5KUNA 5KUSA 2MC9A 1MZWA 4YUKA 4KMAA 3EOVA 4GFQA 1CWCA 3RCKX 5CCSX 5IOTA 5CHPA 2OJUA 2X2DB 5KV1A 4J5BA 3GTLA 2CFAB 1CWIA 3K0QA 1ZKFA 2R7ZA 4G0WA 4DGBA 2OSEA 2FU0A 3G4AA 1ISTA 1MIKA 1DD5A 2HQJA 5KUQA 4ZSDA 1IS1A 4S1EA 3LPXA 1C5FA 4EYVA 1KQ4A 1I3QA 1E8KA 4J5AX 1WQHA 2B63A 2X83B 3K0MA 2WFJA 3RCFA 4YUJA 4J5CX 3GTPA 1WQFA 3CQZA 2QERA 5CCNA 5CCRA 1TWFA 5CBVA 5CBUA 2IGVA 4LR2A 4KARA 1V9TA 4DDQA 3MMLA 1R9TA 2YU9A 4FRVA 2PLUA 1J2AA 1M9DA 1EK8A 3H0GA 5KUZA 4KASA 4DGEA 2X2AA 2GW2A 4S1JA 4N1PA 3K0OA 4P5AA 1CWBA 2ESLA 1M9YA 1W8VA 1O25A 4ZSCA 4YULA 4KDDA 2CK1A 1Y1WA 2GSUA 2CFAA 1VAIA 4YUMA 4YUOA 2CMTA 1XXBA 3PMPA 3RCGA 3AQOA 3GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YUI A;  4N1S A;  2ZP2 A;  2XCO A;  1CLH A;  2X2C K;  1M63 C;  5KV2 A;  5KUR A;  1LOP A;  4YUH A;  2ALF A;  1M9C A;  3QX3 A;  4FM9 A;  2P0O A;  2POY A;  5F66 A;  1CWA A;  5CYH A;  3K0N A;  1W8L A;  4N1N A;  1M9X A;  3K0P A;  2N0T A;  4G0U A;  2POE A;  3CAG A;  2X7K A;  3L4J A;  1ZKC A;  2R99 A;  1QNH A;  3NUH A;  4N1R A;  5KV3 A;  1A33 A;  5KV0 A;  2KWA A;  3L4K A;  1ISE A;  4N1O A;  1EH1 A;  2HE9 A;  4YUN A;  1W8M A;  3CYS A;  1WQG A;  2MS4 A;  1XXA A;  1CWK A;  1VBS A;  4J58 A;  3R57 A;  3RFY A;  5KUL A;  3LAJ A;  5KV7 A;  1B4A A;  4KB2 A;  3BT8 A;  4R3F A;  1AWT A;  3VA7 A;  2MVZ A;  2K7N A;  1M9F A;  4DGC A;  1CWL A;  3V4G A;  1X7F A;  1DYW A;  3R49 A;  3RD9 X;  5CBT A;  4J3N A;  3OEP A;  2RS4 A;  2B71 A;  1IIP A;  2IGW A;  1XQ7 A;  3RCI X;  1AWQ A;  4XNC A;  2XCR B;  5KV4 A;  2RMA A;  1XXC A;  4N1Q A;  1H0P A;  2HAQ A;  3BO7 A;  2BIT X;  3UCH A;  3BKP A;  4JJM A;  1AWR A;  5CJ9 A;  1CWJ A;  3ICH A;  1VDN A;  4YUG A;  4G0V A;  3R56 A;  4N1M A;  2CPL A;  1Z81 A;  1BCK A;  2NUL A;  3K0R A;  3R59 A;  5CCQ A;  1W74 A;  1IHG A;  2A2N A;  2XCQ A;  2XGY B;  2BIU X;  2Z6W A;  3RDA X;  2MZU A;  1AWS A;  1ZVU A;  4R3E A;  5KUU A;  5KUO A;  2HQ6 A;  1AWU A;  3RCL A;  4KC6 A;  1FGL A;  2WFI A;  1B4B A;  3FOF A;  4DGA A;  3CYH A;  1MF8 C;  4E1Q A;  5JHE A;  3RDC A;  1CYN A;  5CBW A;  3O7T A;  3BUE A;  1AK4 A;  3RDD A;  2ZFZ A;  1GE9 A;  3FHZ A;  5DUD A;  3FOE A;  5A0E A;  1XO7 A;  1XWN A;  4O8H A;  3ORE A;  2RMB A;  3ICI A;  1CWM A;  2WLW A;  2RGR A;  5KV5 A;  1CWO A;  2PHC B;  1E3B A;  4DGD A;  4CYH A;  4J5D X;  1RMH A;  5KUW A;  3ODI A;  3OPF A;  2C3B A;  4TOT A;  3QYU A;  5LUD A;  1YND A;  4IPZ A;  4HY7 A;  2Y3P A;  1CWH A;  4I9Y A;  1CWF A;  1BJT A;  4FRU A;  3RDB A;  1M9E A;  2P5M A;  4JCP A;  3LAP A;  4LQW A;  3JB9 d;  3R54 A;  5KV6 A;  5JVO A;  3K2C A;  2RMC A;  1QOI A;  1NMK A;  1ZMF A;  4J5E X;  2OK3 A;  1AWV A;  1BGW A;  1A58 A;  2CYH A;  1XYH A;  4KB4 A;  4KAW X;  1VBT A;  1F9N A;  3ERE D;  2CFE A;  1AB4 A;  5KUV A;  2X25 B;  4YUP A;  3T1U A;  3S6M A;  3MML B;  3R4G A;  4O8I A;  1OCA A;  1WIH A;  4J59 A;  1QNG A;  3ODL A;  5KUN A;  5KUS A;  2MC9 A;  1MZW A;  4YUK A;  3EOV A;  4GFQ A;  1CWC A;  3RCK X;  5CCS X;  2OJU A;  2X2D B;  5KV1 A;  4J5B A;  1CWI A;  3K0Q A;  1ZKF A;  4G0W A;  4DGB A;  2OSE A;  2FU0 A;  1IST A;  1MIK A;  1DD5 A;  2HQJ A;  5KUQ A;  4ZSD A;  1IS1 A;  4S1E A;  3LPX A;  1C5F A;  4EYV A;  1E8K A;  4J5A X;  1WQH A;  2X83 B;  3K0M A;  2WFJ A;  3RCF A;  4YUJ A;  4J5C X;  1WQF A;  2QER A;  5CCN A;  5CCR A;  5CBV A;  5CBU A;  2IGV A;  1V9T A;  4DDQ A;  3MML A;  4FRV A;  2PLU A;  1J2A A;  1M9D A;  1EK8 A;  5KUZ A;  4DGE A;  2X2A A;  2GW2 A;  4S1J A;  4N1P A;  3K0O A;  1CWB A;  2ESL A;  1M9Y A;  1W8V A;  4ZSC A;  4YUL A;  4KDD A;  2CK1 A;  1VAI A;  4YUM A;  4YUO A;  2CMT A;  1XXB A;  3PMP A;  3RCG A; 
#chains in the Genus database with same CATH topology
 3JST A;  4Y7N K;  1XPP A;  1F7U A;  4YUI A;  4GTD A;  3AH5 A;  2O5J A;  4KM8 A;  4N1S A;  2ZP2 A;  2Y0S L;  3GTM K;  2XCO A;  1CLH A;  2X2C K;  3GTK C;  2NVT C;  4Q5S A;  2R93 K;  5M5X K;  1SMY A;  2NVY A;  1M63 C;  5KV2 A;  5KUR A;  4GTE A;  1LOP A;  4YUH A;  2ALF A;  1J6V A;  3GIR A;  5FLM C;  5IYB C;  1M9C A;  4GTA A;  1SFO A;  3HOZ C;  2VUM C;  3QX3 A;  5C4J C;  3S0X A;  4OIO A;  4ZH4 A;  4FM9 A;  2P0O A;  1PJ5 A;  1JVI A;  2POY A;  5F66 A;  1YNN A;  1CWA A;  5CYH A;  3K0N A;  1W8L A;  4N1N A;  4A3E C;  1M9X A;  3S1M C;  2W7V A;  3RZD C;  3M3Y C;  4A93 C;  1I6H K;  3K0P A;  4XLN A;  5C44 K;  2N0T A;  4GTC A;  4G0U A;  2POE A;  4A3J K;  5TJ3 A;  4GTF A;  5EGH A;  2ZUF A;  1Y1V K;  3CAG A;  2X7K A;  5IOS A;  3HOU C;  3S15 C;  1WCM K;  3I4N C;  1TWH A;  4BY1 C;  4GT9 A;  4XCH A;  4C3H C;  3L4J A;  4OIP A;  1ZKC A;  4A3G K;  2R99 A;  2GSO A;  1QNH A;  3AD9 C;  1TWC C;  3NUH A;  3T00 A;  2NVX A;  4N1R A;  3G4C A;  4LJZ A;  2V6S A;  3SZZ A;  5KV3 A;  1A33 A;  5KV0 A;  2KWA A;  4GTL A;  4PAA A;  1O27 A;  3L4K A;  3AD8 C;  4P5B A;  1ISE A;  3GTM A;  4KAT A;  4N1O A;  3IPJ A;  2R93 A;  1EH1 A;  1YNJ A;  1Y1W K;  2JA7 K;  2PMZ D;  1PJ6 A;  3M4O C;  5IOR A;  3GDZ A;  1O29 A;  2GSN A;  2HE9 A;  4BY7 C;  4YUN A;  1I6V A;  3A8K A;  3GTL C;  3PO2 C;  1W8M A;  1O2B A;  5TMC A;  3CYS A;  5EGE A;  1ZBS A;  3HOY K;  1WQG A;  2MS4 A;  1XXA A;  2R7Z C;  4Q4Z A;  3S1R C;  5IYD K;  1CWK A;  4Y52 C;  1VBS A;  4J58 A;  3R57 A;  2JH3 A;  5HL8 A;  4A3M C;  1DCP A;  5IOQ A;  1WOR A;  3A8J A;  1VH2 A;  3GEE A;  4AYB D;  2E2J K;  3RFY A;  5KUL A;  3LAJ A;  5KV7 A;  2JA8 C;  1B4A A;  4KB2 A;  1VGX A;  3BT8 A;  4R3F A;  1AWT A;  1EQR A;  3VA7 A;  2MVZ A;  3N3Y A;  2K7N A;  1Y1V A;  1M9F A;  4DGC A;  1CWL A;  3V4G A;  4LQY A;  3GTJ K;  1WCM A;  1I3Q C;  1SFO K;  4A3C C;  1X7F A;  4G7O A;  1DYW A;  3R49 A;  2B63 C;  3GTM C;  4PAB A;  3RD9 X;  3FKI K;  3AD7 C;  5IP7 C;  4A3F C;  5CBT A;  4J3N A;  3BP3 A;  3OEP A;  2PA8 D;  3GTQ K;  3S2H K;  3GTP C;  2BE5 A;  4ILD A;  1HQM A;  1O28 A;  1TWA K;  2RS4 A;  2B71 A;  1IIP A;  2IGW A;  4YFK A;  4BXX C;  1XQ7 A;  3RCI X;  2WAQ L;  1AWQ A;  3CQZ C;  3TFH A;  2PMZ L;  4XNC A;  1TWF C;  2XCR B;  1I6H C;  2JA7 A;  3S17 K;  5KV4 A;  2RMA A;  4LOW A;  1XXC A;  4N1Q A;  1H0P A;  2HAQ A;  3GSI A;  4A3I K;  3BO7 A;  5C4X C;  2YU9 C;  2A68 A;  2BIT X;  3UCH A;  4BBR K;  3H0G C;  3X27 A;  3BKP A;  4JJM A;  2NVX K;  4A3K K;  2E2H A;  1AWR A;  2O5I A;  4AYB L;  5CJ9 A;  1CWJ A;  3ICH A;  1VDN A;  3N0B A;  1VJE A;  4YUG A;  3WOD A;  1XZP B;  4G0V A;  4A3L C;  4A3B K;  4X6A K;  4XSZ A;  3R56 A;  1EFW A;  5M5W K;  1IBA A;  4C2M K;  3RZO C;  4N1M A;  2CPL A;  3GTG K;  3GTJ A;  2NVQ C;  1Z81 A;  1ZYR A;  1BCK A;  2EBB A;  2NUL A;  3K0R A;  3R59 A;  5CCQ A;  4C3J C;  1V5V A;  1W74 A;  3FKI A;  1IHG A;  4OIN A;  2PA8 L;  3N0C A;  2A2N A;  2XCQ A;  4C3I C;  3S16 K;  1Y1W C;  3S1Q C;  5IYC C;  3GTQ A;  2XGY B;  1JOE A;  5C3E K;  1J98 A;  1TWA A;  2BIU X;  2Z6W A;  3RDA X;  2R92 K;  3S2D K;  4A3D C;  4QJV B;  4G7H A;  3HOW C;  2MZU A;  1AWS A;  1INN A;  2E2I K;  2FQO A;  1ZVU A;  1TWG K;  3PO3 C;  4R3E A;  5KUU A;  4BBS K;  3GTO C;  5KUO A;  4MEX A;  2HQ6 A;  1AWU A;  3RCL A;  4KC6 A;  1O24 A;  1FGL A;  2WFI A;  1B4B A;  1O2A A;  1K83 K;  1DCO A;  2JA5 K;  3FOF A;  4LK1 A;  4DGA A;  2KA0 A;  3CYH A;  1MF8 C;  4E1Q A;  5JHE A;  2NVY C;  3RDC A;  4BKW A;  1CYN A;  2JA6 K;  5CBW A;  3HOX K;  3O7T A;  3BUE A;  1SFO C;  4NOI A;  1AK4 A;  3RDD A;  1DCH A;  2ZFZ A;  1GE9 A;  3FHZ A;  5DUD A;  3FOE A;  4P9S A;  2WAQ D;  5A0E A;  1XO7 A;  3K7A C;  1XWN A;  4O8H A;  3ORE A;  4M1X A;  2RMB A;  3ICI A;  1CWM A;  4JK1 A;  1I50 A;  3GTK K;  3S2H C;  2NVT K;  2WLW A;  3GTG A;  4FZB A;  4KN4 A;  2RGR A;  1ZXO A;  1O26 A;  5KV5 A;  3S1N K;  3AQP A;  4QIW L;  2WB1 D;  1CWO A;  2PHC B;  5IYB K;  2V6U A;  1BDF A;  1PJ7 A;  2VUM K;  1E3B A;  3KOP A;  1C0A A;  4DGD A;  4CYH A;  5C4J K;  2E2H K;  4J5D X;  1RMH A;  5KUW A;  5M3M K;  2R92 A;  1TWH C;  3ODI A;  3OPF A;  3EQL A;  5M5Y K;  2C3B A;  4A3I C;  1X31 C;  2E2I A;  4TOT A;  1TWG A;  3RZD K;  3M3Y K;  4A93 K;  3QYU A;  4BBR C;  5LUD A;  1IQ0 A;  1YND A;  3S14 K;  4Y7N C;  4IPZ A;  4HY7 A;  2Y3P A;  1CWH A;  3TFI A;  1XZP A;  4A3K C;  2NVX C;  4OIQ A;  4WJ4 A;  1JQW A;  4I9Y A;  4KMH A;  1K83 A;  2JA5 A;  1CWF A;  4LLG A;  1XZQ B;  2V6T A;  4MQ9 A;  1BJT A;  4GZY A;  1HI9 A;  3S15 K;  2R93 C;  4FRU A;  3RDB A;  1EI6 A;  1M9E A;  2P5M A;  3GEH A;  1L0W A;  4JCP A;  3LAP A;  4LQW A;  4C2M C;  2JA6 A;  3JB9 d;  3R54 A;  4KM9 A;  5KV6 A;  5FJ8 K;  1TWC K;  5JVO A;  4WJ3 M;  1F7V A;  3K2C A;  4QJV A;  3S16 C;  2RMC A;  5L46 A;  3GTK A;  5C3E C;  3ADA C;  3S2D C;  1YX2 A;  1QOI A;  2A6H A;  1NMK A;  2WB1 L;  4GTB A;  4YFN A;  4YFX A;  2NNZ A;  5C44 C;  1ZMF A;  4KMD A;  4J5E X;  4A3J C;  2ZUE A;  4G7Z A;  3SZY A;  4BLB A;  5IP9 K;  3GTL K;  2VUM A;  2A6E A;  2OK3 A;  4BBS C;  1AWV A;  1BGW A;  1A58 A;  1IL2 A;  1WSR A;  1Y1V C;  5D4D A;  1YCL A;  2CYH A;  5M3F K;  1WCM C;  3S1R K;  2R7Z K;  1XYH A;  4Y52 K;  4KB4 A;  3H3V D;  1UV7 A;  3HXA A;  4A3M K;  3I4M K;  4KAW X;  4A3G C;  1VBT A;  1F9N A;  3ERE D;  2CFE A;  1I50 K;  3TTG A;  1AB4 A;  5KUV A;  2X25 B;  4YUP A;  3T1U A;  3Q3Q A;  3S6M A;  4LK0 A;  3MML B;  2GAH C;  2D6F C;  2FQT A;  2RH6 A;  3R4G A;  4A3C K;  1I3Q K;  4O8I A;  4BLA A;  1OCA A;  4QIW D;  4XLP A;  1WIH A;  2JA7 C;  4J59 A;  4RMF A;  5E68 A;  2B63 K;  5JFE A;  5IP7 K;  4A3F K;  1IE0 A;  3S1N C;  1TWC A;  1IW7 A;  3GTP K;  3HOY C;  1QNG A;  3ODL A;  5KUN A;  5KUS A;  1WSV A;  2MC9 A;  4BXX K;  5IYD C;  3HOV K;  2A69 A;  1MZW A;  4YUK A;  4KMA A;  3CQZ K;  3EOV A;  2E2H C;  4GFQ A;  1CWC A;  1TWF K;  3RCK X;  5CCS X;  5IOT A;  5CHP A;  2E2J C;  3T01 A;  2OJU A;  2X2D B;  5KV1 A;  4J5B A;  3GTL A;  2CFA B;  1CWI A;  3K0Q A;  5C4X K;  3S14 C;  1ZKF A;  3HKZ L;  1R9T K;  1O2F B;  2YU9 K;  1XZQ A;  3H3V L;  3GTJ C;  2R7Z A;  3H0G K;  4G0W A;  4DGB A;  1J6W A;  1RU0 A;  2OSE A;  1VLO A;  1ZQ1 C;  3FKI C;  2FU0 A;  3GEI A;  3G4A A;  1G51 A;  1IST A;  1MIK A;  1BS2 A;  4AH6 A;  1DD5 A;  3GTQ C;  2HQJ A;  5KUQ A;  4A3L K;  2PPB A;  4ZSD A;  1IS1 A;  1TWA C;  4S1E A;  3LPX A;  1C5F A;  4EYV A;  1J6X A;  4KMU A;  4OIR A;  1KQ4 A;  3RZO K;  5FLM K;  1I3Q A;  3HOZ K;  1E8K A;  2NVQ K;  4WIL A;  4J5A X;  1WQH A;  2B63 A;  4C3J K;  2X83 B;  3K0M A;  3S17 C;  3A8I A;  2WFJ A;  5TMF A;  4C3I K;  3S1Q K;  5IYC K;  3RCF A;  4YUJ A;  4A3E K;  4J5C X;  3GTP A;  3S1M K;  4A3D K;  5IP9 C;  3HOW K;  1WQF A;  3CQZ A;  2QER A;  5CCN A;  2P8T A;  5CCR A;  1USO A;  1TWF A;  3PO3 K;  3GTO K;  4C45 A;  3TFJ A;  3T02 A;  5CBV A;  1WOO A;  3HOU K;  3I4M C;  5CBU A;  3I4N K;  4A3B C;  4X6A C;  2IGV A;  4LR2 A;  1WOS A;  4KAR A;  1V9T A;  4BY1 K;  4C3H K;  4DDQ A;  3MML A;  1R9T A;  1I50 C;  2YU9 A;  4FRV A;  3GTG C;  2Y0S D;  2PLU A;  1J2A A;  1M9D A;  1EK8 A;  2CW0 A;  5KUZ A;  3H0G A;  4KN7 A;  2NVY K;  3DXJ A;  4KAS A;  4DGE A;  2X2A A;  2GW2 A;  4S1J A;  4N1P A;  3K0O A;  1VRQ C;  4XSX A;  1F93 A;  2R92 C;  3K7A K;  4P5A A;  1WOP A;  3M4O K;  2E2I C;  1CWB A;  2ESL A;  4O2D A;  1M9Y A;  4BY7 K;  1TWG C;  1W8V A;  3PO2 K;  3BP8 C;  1O25 A;  3HOV C;  4ZSC A;  4MEY A;  4YUL A;  4YG2 A;  3HKZ D;  4KDD A;  2CK1 A;  1Y1W A;  2GSU A;  1K83 C;  2CFA A;  2JA5 C;  1VAI A;  4YUM A;  4YUO A;  2CMT A;  2GAG C;  1XXB A;  1ZX8 A;  1TWH K;  3PMP A;  3RCG A;  3AQO A;  2JA8 K;  1R9T C;  3HOX C;  2JA6 C;  1USM A;  3GTO A; 
#chains in the Genus database with same CATH homology
 4YUI A;  4GTD A;  3AH5 A;  4KM8 A;  4N1S A;  2ZP2 A;  2XCO A;  1CLH A;  2X2C K;  2NVY A;  1M63 C;  5KV2 A;  5KUR A;  4GTE A;  1LOP A;  4YUH A;  2ALF A;  1M9C A;  4GTA A;  1SFO A;  3QX3 A;  3S0X A;  4FM9 A;  2P0O A;  2POY A;  5F66 A;  1CWA A;  5CYH A;  3K0N A;  1W8L A;  4N1N A;  1M9X A;  3K0P A;  2N0T A;  4GTC A;  4G0U A;  2POE A;  5TJ3 A;  4GTF A;  5EGH A;  3CAG A;  2X7K A;  5IOS A;  1TWH A;  4GT9 A;  4C3H C;  3L4J A;  1ZKC A;  2R99 A;  2GSO A;  1QNH A;  3NUH A;  2NVX A;  4N1R A;  3G4C A;  5KV3 A;  1A33 A;  5KV0 A;  2KWA A;  4GTL A;  1O27 A;  3L4K A;  3GTM A;  4P5B A;  1ISE A;  4KAT A;  4N1O A;  2R93 A;  1EH1 A;  5IOR A;  1O29 A;  2GSN A;  2HE9 A;  4YUN A;  1W8M A;  1O2B A;  3CYS A;  5EGE A;  1ZBS A;  1WQG A;  2MS4 A;  1XXA A;  1CWK A;  1VBS A;  4J58 A;  2JH3 A;  3R57 A;  5IOQ A;  3RFY A;  5KUL A;  3LAJ A;  5KV7 A;  1B4A A;  4KB2 A;  3BT8 A;  4R3F A;  1AWT A;  3VA7 A;  2MVZ A;  3N3Y A;  1Y1V A;  2K7N A;  1M9F A;  4DGC A;  1CWL A;  3V4G A;  4LQY A;  1WCM A;  1X7F A;  1DYW A;  3R49 A;  3RD9 X;  5CBT A;  4J3N A;  3OEP A;  4ILD A;  1O28 A;  2RS4 A;  2B71 A;  1IIP A;  2IGW A;  1XQ7 A;  3RCI X;  1AWQ A;  4XNC A;  2XCR B;  2JA7 A;  5KV4 A;  2RMA A;  1XXC A;  4N1Q A;  1H0P A;  2HAQ A;  3BO7 A;  2BIT X;  3UCH A;  3BKP A;  4JJM A;  2E2H A;  1AWR A;  5CJ9 A;  1CWJ A;  3ICH A;  1VDN A;  3N0B A;  4YUG A;  4G0V A;  3R56 A;  4N1M A;  2CPL A;  3GTJ A;  1Z81 A;  1BCK A;  2NUL A;  3K0R A;  3R59 A;  5CCQ A;  4C3J C;  3FKI A;  1W74 A;  1IHG A;  3N0C A;  2A2N A;  2XCQ A;  4C3I C;  3GTQ A;  2XGY B;  1TWA A;  2BIU X;  2Z6W A;  3RDA X;  2MZU A;  1AWS A;  1ZVU A;  4R3E A;  5KUU A;  5KUO A;  2HQ6 A;  1AWU A;  3RCL A;  4KC6 A;  1O24 A;  1FGL A;  2WFI A;  1B4B A;  1O2A A;  3FOF A;  4DGA A;  3CYH A;  1MF8 C;  4E1Q A;  5JHE A;  3RDC A;  4BKW A;  1CYN A;  5CBW A;  3O7T A;  3BUE A;  1AK4 A;  3RDD A;  2ZFZ A;  1GE9 A;  3FHZ A;  5DUD A;  3FOE A;  5A0E A;  1XO7 A;  1XWN A;  4O8H A;  3ORE A;  4M1X A;  2RMB A;  3ICI A;  1CWM A;  1I50 A;  3GTG A;  2WLW A;  4FZB A;  2RGR A;  1ZXO A;  1O26 A;  5KV5 A;  3AQP A;  1CWO A;  2PHC B;  1E3B A;  4DGD A;  4CYH A;  4J5D X;  1RMH A;  5KUW A;  2R92 A;  3ODI A;  3OPF A;  2C3B A;  2E2I A;  4TOT A;  1TWG A;  3QYU A;  5LUD A;  1YND A;  4IPZ A;  4HY7 A;  2Y3P A;  1CWH A;  4I9Y A;  4KMH A;  1K83 A;  2JA5 A;  1CWF A;  1BJT A;  4FRU A;  3RDB A;  1M9E A;  2P5M A;  4JCP A;  3LAP A;  4LQW A;  4C2M C;  2JA6 A;  3JB9 d;  3R54 A;  4KM9 A;  5KV6 A;  5JVO A;  3K2C A;  2RMC A;  3GTK A;  1QOI A;  4GTB A;  1NMK A;  1ZMF A;  4KMD A;  4J5E X;  4BLB A;  2VUM A;  2OK3 A;  1AWV A;  1BGW A;  1A58 A;  2CYH A;  1XYH A;  4KB4 A;  4KAW X;  1VBT A;  1F9N A;  3ERE D;  2CFE A;  1AB4 A;  5KUV A;  2X25 B;  4YUP A;  3T1U A;  3Q3Q A;  3S6M A;  3MML B;  2RH6 A;  3R4G A;  4O8I A;  4BLA A;  1OCA A;  1WIH A;  4J59 A;  5JFE A;  1TWC A;  1QNG A;  3ODL A;  5KUN A;  5KUS A;  2MC9 A;  1MZW A;  4YUK A;  4KMA A;  3EOV A;  4GFQ A;  1CWC A;  3RCK X;  5CCS X;  5IOT A;  5CHP A;  2OJU A;  2X2D B;  5KV1 A;  4J5B A;  3GTL A;  2CFA B;  1CWI A;  3K0Q A;  1ZKF A;  2R7Z A;  4G0W A;  4DGB A;  2OSE A;  2FU0 A;  3G4A A;  1IST A;  1MIK A;  1DD5 A;  2HQJ A;  5KUQ A;  4ZSD A;  1IS1 A;  4S1E A;  3LPX A;  1C5F A;  4EYV A;  1KQ4 A;  1I3Q A;  1E8K A;  4J5A X;  1WQH A;  2B63 A;  2X83 B;  3K0M A;  2WFJ A;  3RCF A;  4YUJ A;  4J5C X;  3GTP A;  1WQF A;  3CQZ A;  2QER A;  5CCN A;  5CCR A;  1TWF A;  5CBV A;  5CBU A;  2IGV A;  4LR2 A;  4KAR A;  1V9T A;  4DDQ A;  3MML A;  1R9T A;  2YU9 A;  4FRV A;  2PLU A;  1J2A A;  1M9D A;  1EK8 A;  3H0G A;  5KUZ A;  4KAS A;  4DGE A;  2X2A A;  2GW2 A;  4S1J A;  4N1P A;  3K0O A;  4P5A A;  1CWB A;  2ESL A;  1M9Y A;  1W8V A;  1O25 A;  4ZSC A;  4YUL A;  4KDD A;  2CK1 A;  1Y1W A;  2GSU A;  2CFA A;  1VAI A;  4YUM A;  4YUO A;  2CMT A;  1XXB A;  3PMP A;  3RCG A;  3AQO A;  3GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...