3OEPA

Crystal structure of ttha0988 in space group p43212
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
485
Chain Sequence
b'VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 129
structure length 485
sequence length 492
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oepA01
3R49A 1AWUA 5JHEA 1CWJA 3PMPA 4J58A 4IPZA 3K0NA 5KUVA 1EK8A 1ZKCA 1CWHA 1W8MA 3RD9X 1BCKA 1GE9A 2X2AA 5KV2A 1FGLA 2CPLA 1M9FA 2P5MA 2X25B 2NULA 4YUNA 5CBWA 3R4GA 3LAPA 3OREA 1CWIA 1CWOA 5KV7A 1MZWA 4KC6A 3ODLA 4G0UA 2ZP2A 4J5AX 4G0VA 1WQGA 3RDCA 5KV3A 2IGWA 4FM9A 4R3FA 3RCLA 1ZVUA 4G0WA 3K0RA 3L4KA 5DUDA 1IS1A 1CWBA 5KURA 2WLWA 3BO7A 4GFQA 1ISTA 4KB2A 3UCHA 1Z81A 2KWAA 4FRVA 1AWVA 1V9TA 1J2AA 5CCQA 4O8HA 3FHZA 2CMTA 1XYHA 5CYHA 1IIPA 1WQHA 1QNGA 3RCKX 1ZMFA 1CLHA 4KAWX 1DD5A 2MZUA 2K7NA 5CCSX 2X2CK 3R56A 5KUQA 2POYA 1M9DA 1LOPA 1CWCA 5JVOA 3L4JA 3RDAX 2FU0A 5KULA 3OPFA 4ZSDA 2N0TA 4N1MA 5CBTA 5KUWA 1M63C 2PHCB 1VBSA 4ZSCA 2X2DB 3RFYA 1EH1A 2XCQA 1M9EA 1ZKFA 2RMAA 1XO7A 3K0QA 2Y3PA 4EYVA 1QOIA 3MMLA 5KV4A 4YUIA 4DDQA 5KUNA 2GW2A 1CWLA 1CWMA 4I9YA 2RMBA 4KB4A 5CBVA 4O8IA 2XCOA 1XXBA 3RCIX 3V4GA 1RMHA 1CWKA 1M9CA 1E3BA 2B71A 1X7FA 2OSEA 4S1JA 2HQJA 3LAJA 3R57A 3RDBA 1B4AA 3RDDA 1IHGA 1F9NA 2HAQA 4YUGA 1M9XA 2CYHA 3ICIA 4N1QA 4YULA 1VDNA 5KUUA 1XQ7A 1XWNA 3CYSA 2QERA 3BKPA 3ICHA 3K0PA 5F66A 4DGEA 3K0MA 2XCRB 4N1PA 5LUDA 3LPXA 2OJUA 2CFEA 2R99A 3K2CA 5CCRA 2PLUA 5KUSA 5CBUA 1BJTA 2A2NA 3VA7A 2ESLA 4YUJA 4DGBA 4DGDA 1CYNA 3R59A 2POEA 4FRUA 1AWQA 2WFJA 2WFIA 2XGYB 4JCPA 4R3EA 3T1UA 5KV1A 2CK1A 1A58A 1QNHA 1C5FA 2Z6WA 4YUPA 4DGCA 1E8KA 4CYHA 4XNCA 3FOFA 3K0OA 1CWFA 4J5BA 1AK4A 5KV5A 2MVZA 3ODIA 4YUOA 3ERED 1W8VA 1XXAA 2MC9A 3BUEA 4TOTA 5KUZA 1XXCA 1NMKA 5CJ9A 4N1SA 4DGAA 2RS4A 1W8LA 2HQ6A 3S6MA 2MS4A 1AWRA 2IGVA 4N1RA 1VAIA 1W74A 2ALFA 4J5CX 2C3BA 3JB9d 2X83B 2ZFZA 1H0PA 1B4BA 4J5EX 3CAGA 4YUKA 4HY7A 5KUOA 1MIKA 2OK3A 4E1QA 1WIHA 4N1OA 4KDDA 2BITX 3CYHA 5KV6A 1DYWA 2X7KA 4N1NA 1M9YA 3BT8A 1CWAA 5CCNA 5KV0A 4YUHA 1WQFA 4LQWA 5A0EA 3EOVA 3RCFA 4J3NA 2P0OA 4S1EA 3O7TA 2HE9A 2RMCA 3QX3A 1VBTA 3RCGA 4JJMA 3FOEA 1AWSA 1OCAA 3MMLB 3QYUA 1ISEA 3OEPA 3NUHA 1YNDA 4J59A 1A33A 4YUMA 2BIUX 1AB4A 3R54A 2RGRA 1MF8C 1AWTA 1BGWA 4J5DX
chains in the Genus database with same CATH superfamily
5IYCK 4LK1A 1USOA 4KARA 2GAHC 3R49A 1AWUA 5JHEA 4XLNA 1CWJA 3GTKC 3PO2C 3PO3C 3PMPA 1K83A 4J58A 4IPZA 2NVTK 3K0NA 5KUVA 2CFAA 1EK8A 3S1NC 1ZKCA 1CWHA 3N0CA 2O5IA 2CW0A 1W8MA 3AQOA 4AYBL 3RZOK 3M4OK 5C44C 4C3HK 3M3YK 4A3FK 4GTFA 3RD9X 1DCOA 1BCKA 1GE9A 1J6VA 2A69A 1YX2A 1XPPA 2PPBA 4AH6A 4A3DC 2X2AA 4BY1C 5KV2A 1FGLA 4A3KC 2A68A 2RH6A 2R7ZA 3GEHA 2CPLA 3HOVK 4A3LK 2NVYK 1M9FA 2P5MA 2X25B 4KM8A 4BLBA 4KN4A 3S1MK 3HOXK 1VLOA 2NULA 3HKZL 4YFNA 1YNJA 2E2JK 5C3EC 4YUNA 5CBWA 3T00A 3R4GA 3LAPA 3OREA 5TMCA 4YFXA 3CQZK 3GTKA 1CWIA 1CWOA 5KV7A 4BKWA 1MZWA 4KC6A 3ODLA 5IORA 3GDZA 2ZP2A 4J5AX 1I3QC 1WQGA 4G0VA 3WODA 3RDCA 3BP8C 4G0UA 5KV3A 3KOPA 2R93C 2IGWA 1VRQC 4AYBD 3GTJC 4C45A 1VGXA 3AQPA 3FKIA 1F93A 5IOTA 4FM9A 5D4DA 1SFOA 4R3FA 2JA7K 3GTLA 3RCLA 4A3CK 3X27A 1TWFK 3GTOA 4KMDA 2JA5K 4LQYA 2D6FC 2NVXC 1IE0A 1ZVUA 4G7HA 4G0WA 3K0RA 3L4KA 5DUDA 1ZXOA 1IS1A 2ZUFA 1X31C 2E2HC 2WB1D 3AD7C 1TWHC 3GTKK 1CWBA 3PO2K 4C3JK 3GSIA 3PO3K 5KURA 3GTQA 4GTEA 2E2IC 2WLWA 1UV7A 3BO7A 3I4MC 3HKZD 4XCHA 3HOUC 1EI6A 4A3JC 2PA8D 3AH5A 4GFQA 5IOSA 5FLMK 1ISTA 4KB2A 3UCHA 3S1NK 4LOWA 4RMFA 1BDFA 3GEIA 1Z81A 2KWAA 3HOWC 4YG2A 5M5XK 4FRVA 1AWVA 3GTPK 3G4CA 1V9TA 4A3BK 1J2AA 4GTLA 5CCQA 1O24A 5IP9K 3S2DC 3S1RK 4O8HA 3FHZA 2CMTA 1TWGC 5M3MK 3T01A 1XYHA 1O26A 4QIWL 5CYHA 1JVIA 5C4JC 1IIPA 1IBAA 4PAAA 1WQHA 2V6TA 1QNGA 3RCKX 1ZMFA 1CLHA 1TWCA 4KAWX 4BY1K 3GTJA 1DD5A 3S16C 4A3KK 2MZUA 4WJ4A 1R9TC 5IYDK 2K7NA 5CCSX 1JQWA 3A8IA 3EQLA 4ZH4A 2X2CK 3R56A 5KUQA 4X6AC 4WILA 2POYA 2W7VA 1O2FB 1M9DA 1LOPA 1CWCA 5JVOA 3L4JA 3RDAX 2A6EA 5C3EK 2FU0A 5KULA 3G4AA 4YFKA 3OPFA 4ZSDA 3HOYK 2E2HA 1TWHA 2GSUA 2N0TA 2E2IA 5C4XC 4N1MA 1ZBSA 4GT9A 5CBTA 5KUWA 1M63C 1I3QK 3S17C 2PHCB 1VBSA 1Y1WK 3HOZC 2R93K 4ZSCA 2YU9C 2X2DB 3RFYA 1EH1A 3FKIC 2XCQA 4GTAA 1SFOC 1M9EA 1ZKFA 2RMAA 3GTLC 4BXXK 3TFHA 2ZUEA 3GTOC 1O27A 1XO7A 3K0QA 2Y3PA 2NVXK 1I6HC 2FQTA 1HI9A 1TWGA 2VUMK 4EYVA 1QOIA 3S2HK 4A3IK 3MMLA 5IOQA 5KV4A 3I4NC 1TWAC 5IYBC 3GTQC 1VJEA 2Y0SD 4YUIA 4KN7A 4MEYA 4NOIA 1L0WA 4DDQA 5KUNA 1K83K 2GW2A 1R9TA 4MQ9A 3I4MK 1CWLA 3HOUK 1KQ4A 4A3JK 1CWMA 4I9YA 4XSXA 4XSZA 2JA6A 2RMBA 4C2MC 3TFJA 4KB4A 3H3VL 4A3MK 4BY7C 3S14C 1IQ0A 3HOWK 5CBVA 4O8IA 2XCOA 4A93K 4LK0A 1RU0A 1XXBA 4BBSC 5M5WK 2R92C 3RCIX 1WCMA 1YCLA 4KMUA 5E68A 3V4GA 2NVQC 3S2DK 1RMHA 1CWKA 4KATA 3TTGA 1ZX8A 1Y1VC 1M9CA 4Q5SA 1E3BA 3A8JA 4A3EC 3K7AK 2B71A 1X7FA 2OSEA 4S1JA 5C4JK 4QJVB 3S15K 2HQJA 1TWCC 3LAJA 2YU9A 3R57A 3AD9C 3RDBA 2GAGC 3S1QC 1B4AA 2R7ZK 1WORA 4ILDA 5IYCC 4OIRA 3RDDA 5EGHA 2EBBA 1IHGA 1EFWA 1F9NA 2HAQA 4YUGA 1M9XA 2CYHA 1YNNA 4GZYA 3ICIA 4N1QA 4YULA 1VDNA 1IW7A 5KUUA 2GSNA 4GTDA 1XQ7A 1TWAA 3H0GA 4P9SA 1XWNA 3H3VD 5C4XK 3CYSA 1JOEA 2QERA 3DXJA 4FZBA 3GTMA 3BKPA 3ICHA 3K0PA 1J6WA 5F66A 4DGEA 3HOZK 4A3GC 2B63A 3K0MA 2XCRB 3M4OC 4C3HC 4N1PA 5LUDA 2CFAB 3LPXA 4A3FC 2JA8C 3FKIK 3M3YC 1SFOK 1I50A 4KMHA 2OJUA 3SZYA 2R92A 3GTLK 2CFEA 3GTOK 3GTGA 5C44K 4O2DA 2R99A 3K2CA 1Y1VA 4OIQA 4GTCA 5CCRA 2NVYC 2PLUA 5KUSA 1XZQB 5CBUA 1BJTA 4A3DK 3I4NK 1ZQ1C 2A2NA 3VA7A 1PJ6A 3S1MC 2ESLA 3HOXC 3GTQK 4OINA 4YUJA 2V6UA 5IP7C 2JH3A 4C3IC 4BLAA 2E2JC 4DGBA 1J6XA 2V6SA 5EGEA 4DGDA 2JA6C 4C2MK 3IPJA 1CYNA 3R59A 2POEA 4FRUA 1ZYRA 3GEEA 2WAQL 1AWQA 2WFJA 2WFIA 2XGYB 1HQMA 4JCPA 4QJVA 4R3EA 3RZDC 3T1UA 1WSVA 5KV1A 2CK1A 1WCMC 1XZPB 4P5BA 5TMFA 1A58A 1QNHA 1O2AA 1C5FA 2Z6WA 3Q3QA 4A3EK 1F7UA 4BBRC 4YUPA 4DGCA 4A3CC 1E8KA 2BE5A 2JA5C 1TWCK 3GTJK 5M3FK 4CYHA 3S1QK 4XNCA 4XLPA 3FOFA 3K0OA 1CWFA 4QIWD 1F7VA 4J5BA 1AK4A 5KV5A 3N0BA 2MVZA 3ODIA 4YUOA 4C3JC 1W8VA 3ERED 1XXAA 2MC9A 2NVYA 3BUEA 1PJ5A 1USMA 5FLMC 3H0GC 2E2HK 1TWHK 1BS2A 4Y7NC 2E2IK 1SMYA 4TOTA 5KUZA 4KM9A 1XXCA 1NMKA 2WAQD 5CJ9A 3GTMC 3GTPC 4N1SA 4A3GK 2B63C 4A3BC 3CQZA 5IP9C 4DGAA 3S1RC 2RS4A 1W8LA 2HQ6A 2JA8K 1EQRA 3S6MA 1C0AA 2MS4A 1AWRA 1XZQA 1I50C 2IGVA 4N1RA 1J98A 4Y52C 1VAIA 3GTGC 1W74A 2ALFA 2O5JA 4J5CX 2C3BA 3JB9d 2X83B 3JSTA 1TWGK 1H0PA 2ZFZA 1I6VA 1B4BA 4OIPA 5IYDC 4J5EX 1IL2A 3CAGA 2JA7A 4YUKA 4HY7A 5KUOA 1MIKA 2OK3A 1TWFA 4KASA 2WB1L 2JA5A 2NNZA 4E1QA 5FJ8K 2PMZL 3S16K 2A6HA 1O29A 1O28A 1WIHA 5IP7K 1R9TK 3GIRA 4C3IK 4N1OA 1XZPA 2PA8L 4KDDA 1V5VA 2BITX 2JA6K 1WOSA 3CYHA 3N3YA 3HOYC 5KV6A 4X6AK 1DYWA 2X7KA 4N1NA 1G51A 1M9YA 5HL8A 2NVTC 3BT8A 1CWAA 5CCNA 5KV0A 1WOOA 3RZDK 3A8KA 1Y1WC 4YUHA 1WCMK 1WQFA 4LQWA 5CHPA 4G7ZA 3S0XA 4LR2A 1O25A 4BBRK 3S17K 3GTPA 5A0EA 4BXXC 3EOVA 3RZOC 3RCFA 4J3NA 2YU9K 2P0OA 2VUMC 4WJ3M 4S1EA 3O7TA 2HE9A 1WOPA 5M5YK 1DCHA 3S2HC 3BP3A 4A3IC 3AD8C 4G7OA 2RMCA 1I6HK 3HXAA 3QX3A 3T02A 4M1XA 2PMZD 4GTBA 1VBTA 1K83C 3RCGA 3TFIA 3HOVC 4A3LC 4Q4ZA 4JJMA 3FOEA 1AWSA 1TWAK 3H0GK 5IYBK 1OCAA 3MMLB 3QYUA 1ISEA 2GSOA 4Y7NK 4A3MC 3OEPA 3NUHA 2FQOA 4A93C 3SZZA 1INNA 3GTMK 4JK1A 2B63K 3CQZC 1YNDA 4BY7K 4PABA 3S14K 3ADAC 4J59A 2VUMA 1I50K 3K7AC 1A33A 1I3QA 1PJ7A 4BBSK 5JFEA 4YUMA 1O2BA 2P8TA 2R92K 1Y1WA 4OIOA 4Y52K 4KMAA 4LJZA 2R93A 3S15C 2NVQK 3GTGK 1VH2A 1Y1VK 2BIUX 1WSRA 2R7ZC 2KA0A 4LLGA 1AB4A 1DCPA 3R54A 4P5AA 2JA7C 2RGRA 5L46A 1TWFC 5TJ3A 4MEXA 1MF8C 1AWTA 2NVXA 2Y0SL 1BGWA 4J5DX
chains in the Genus database with same CATH topology
4KARA 3R49A 1AWUA 5JHEA 1CWJA 3PMPA 1K83A 4J58A 4IPZA 3K0NA 5KUVA 2CFAA 1EK8A 1ZKCA 1CWHA 3N0CA 1W8MA 3AQOA 4GTFA 3RD9X 1BCKA 1GE9A 2X2AA 5KV2A 1FGLA 2RH6A 2R7ZA 2CPLA 1M9FA 2P5MA 2X25B 4KM8A 4BLBA 2NULA 4YUNA 5CBWA 3R4GA 3LAPA 3OREA 3GTKA 1CWIA 1CWOA 5KV7A 4BKWA 1MZWA 4KC6A 3ODLA 5IORA 4G0UA 2ZP2A 4J5AX 4G0VA 1WQGA 3RDCA 5KV3A 2IGWA 3AQPA 3FKIA 4FM9A 5IOTA 1SFOA 4R3FA 3GTLA 3RCLA 3GTOA 4KMDA 4LQYA 1ZVUA 4G0WA 3K0RA 3L4KA 5DUDA 1ZXOA 1IS1A 1CWBA 3GTQA 5KURA 4GTEA 2WLWA 3BO7A 3AH5A 4GFQA 5IOSA 1ISTA 4KB2A 3UCHA 1Z81A 2KWAA 4FRVA 1AWVA 3G4CA 1V9TA 1J2AA 4GTLA 5CCQA 1O24A 4O8HA 3FHZA 2CMTA 1XYHA 1O26A 5CYHA 1IIPA 1WQHA 1QNGA 3RCKX 1ZMFA 1CLHA 1TWCA 4KAWX 3GTJA 1DD5A 2MZUA 2K7NA 5CCSX 2X2CK 3R56A 5KUQA 2POYA 1M9DA 1LOPA 1CWCA 5JVOA 3L4JA 3RDAX 2FU0A 5KULA 3G4AA 3OPFA 4ZSDA 2E2HA 1TWHA 2GSUA 2N0TA 2E2IA 4N1MA 1ZBSA 4GT9A 5CBTA 5KUWA 1M63C 2PHCB 1VBSA 4ZSCA 2X2DB 3RFYA 1EH1A 2XCQA 4GTAA 1M9EA 1ZKFA 2RMAA 1O27A 1XO7A 3K0QA 2Y3PA 1TWGA 4EYVA 1QOIA 3MMLA 5IOQA 5KV4A 4YUIA 4DDQA 1R9TA 5KUNA 2GW2A 1CWLA 1KQ4A 1CWMA 4I9YA 2JA6A 2RMBA 4C2MC 4KB4A 5CBVA 4O8IA 2XCOA 1XXBA 3RCIX 1WCMA 3V4GA 1RMHA 1CWKA 4KATA 1M9CA 1E3BA 2B71A 1X7FA 2OSEA 4S1JA 2HQJA 2YU9A 3LAJA 3R57A 3RDBA 1B4AA 4ILDA 3RDDA 5EGHA 1IHGA 1F9NA 2HAQA 4YUGA 1M9XA 2CYHA 3ICIA 4N1QA 4YULA 1VDNA 5KUUA 2GSNA 4GTDA 1XQ7A 1TWAA 3H0GA 1XWNA 3CYSA 2QERA 4FZBA 3GTMA 3BKPA 3ICHA 3K0PA 5F66A 4DGEA 2B63A 3K0MA 2XCRB 4C3HC 4N1PA 5LUDA 2CFAB 3LPXA 1I50A 4KMHA 2OJUA 2R92A 2CFEA 3GTGA 2R99A 3K2CA 1Y1VA 4GTCA 5CCRA 2PLUA 5KUSA 5CBUA 1BJTA 2A2NA 3VA7A 2ESLA 4YUJA 2JH3A 4C3IC 4BLAA 4DGBA 5EGEA 4DGDA 1CYNA 3R59A 2POEA 4FRUA 1AWQA 2WFJA 2WFIA 2XGYB 4JCPA 4R3EA 3T1UA 5KV1A 2CK1A 4P5BA 1A58A 1QNHA 1O2AA 1C5FA 2Z6WA 3Q3QA 4YUPA 4DGCA 1E8KA 4CYHA 4XNCA 3FOFA 3K0OA 1CWFA 4J5BA 1AK4A 5KV5A 3N0BA 2MVZA 3ODIA 4YUOA 4C3JC 1W8VA 3ERED 1XXAA 2MC9A 2NVYA 3BUEA 4TOTA 5KUZA 4KM9A 1XXCA 1NMKA 5CJ9A 4N1SA 3CQZA 4DGAA 2RS4A 1W8LA 2HQ6A 3S6MA 2MS4A 1AWRA 2IGVA 4N1RA 1VAIA 1W74A 2ALFA 4J5CX 2C3BA 3JB9d 2X83B 2ZFZA 1H0PA 1B4BA 4J5EX 3CAGA 2JA7A 4YUKA 4HY7A 5KUOA 1MIKA 2OK3A 1TWFA 4KASA 2JA5A 4E1QA 1O29A 1O28A 1WIHA 4N1OA 4KDDA 2BITX 3CYHA 3N3YA 5KV6A 1DYWA 2X7KA 4N1NA 1M9YA 3BT8A 1CWAA 5CCNA 5KV0A 4YUHA 1WQFA 4LQWA 5CHPA 3S0XA 4LR2A 1O25A 3GTPA 5A0EA 3EOVA 3RCFA 4J3NA 2P0OA 4S1EA 3O7TA 2HE9A 2RMCA 3QX3A 4M1XA 4GTBA 1VBTA 3RCGA 4JJMA 3FOEA 1AWSA 1OCAA 3MMLB 3QYUA 1ISEA 2GSOA 3OEPA 3NUHA 1YNDA 4J59A 2VUMA 1I3QA 1A33A 5JFEA 4YUMA 1O2BA 1Y1WA 4KMAA 2R93A 2BIUX 1AB4A 3R54A 4P5AA 2RGRA 5TJ3A 1MF8C 1AWTA 2NVXA 1BGWA 4J5DX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R49 A;  1AWU A;  5JHE A;  1CWJ A;  3PMP A;  4J58 A;  4IPZ A;  3K0N A;  5KUV A;  1EK8 A;  1ZKC A;  1CWH A;  1W8M A;  3RD9 X;  1BCK A;  1GE9 A;  2X2A A;  5KV2 A;  1FGL A;  2CPL A;  1M9F A;  2P5M A;  2X25 B;  2NUL A;  4YUN A;  5CBW A;  3R4G A;  3LAP A;  3ORE A;  1CWI A;  1CWO A;  5KV7 A;  1MZW A;  4KC6 A;  3ODL A;  4G0U A;  2ZP2 A;  4J5A X;  4G0V A;  1WQG A;  3RDC A;  5KV3 A;  2IGW A;  4FM9 A;  4R3F A;  3RCL A;  1ZVU A;  4G0W A;  3K0R A;  3L4K A;  5DUD A;  1IS1 A;  1CWB A;  5KUR A;  2WLW A;  3BO7 A;  4GFQ A;  1IST A;  4KB2 A;  3UCH A;  1Z81 A;  2KWA A;  4FRV A;  1AWV A;  1V9T A;  1J2A A;  5CCQ A;  4O8H A;  3FHZ A;  2CMT A;  1XYH A;  5CYH A;  1IIP A;  1WQH A;  1QNG A;  3RCK X;  1ZMF A;  1CLH A;  4KAW X;  1DD5 A;  2MZU A;  2K7N A;  5CCS X;  2X2C K;  3R56 A;  5KUQ A;  2POY A;  1M9D A;  1LOP A;  1CWC A;  5JVO A;  3L4J A;  3RDA X;  2FU0 A;  5KUL A;  3OPF A;  4ZSD A;  2N0T A;  4N1M A;  5CBT A;  5KUW A;  1M63 C;  2PHC B;  1VBS A;  4ZSC A;  2X2D B;  3RFY A;  1EH1 A;  2XCQ A;  1M9E A;  1ZKF A;  2RMA A;  1XO7 A;  3K0Q A;  2Y3P A;  4EYV A;  1QOI A;  3MML A;  5KV4 A;  4YUI A;  4DDQ A;  5KUN A;  2GW2 A;  1CWL A;  1CWM A;  4I9Y A;  2RMB A;  4KB4 A;  5CBV A;  4O8I A;  2XCO A;  1XXB A;  3RCI X;  3V4G A;  1RMH A;  1CWK A;  1M9C A;  1E3B A;  2B71 A;  1X7F A;  2OSE A;  4S1J A;  2HQJ A;  3LAJ A;  3R57 A;  3RDB A;  1B4A A;  3RDD A;  1IHG A;  1F9N A;  2HAQ A;  4YUG A;  1M9X A;  2CYH A;  3ICI A;  4N1Q A;  4YUL A;  1VDN A;  5KUU A;  1XQ7 A;  1XWN A;  3CYS A;  2QER A;  3BKP A;  3ICH A;  3K0P A;  5F66 A;  4DGE A;  3K0M A;  2XCR B;  4N1P A;  5LUD A;  3LPX A;  2OJU A;  2CFE A;  2R99 A;  3K2C A;  5CCR A;  2PLU A;  5KUS A;  5CBU A;  1BJT A;  2A2N A;  3VA7 A;  2ESL A;  4YUJ A;  4DGB A;  4DGD A;  1CYN A;  3R59 A;  2POE A;  4FRU A;  1AWQ A;  2WFJ A;  2WFI A;  2XGY B;  4JCP A;  4R3E A;  3T1U A;  5KV1 A;  2CK1 A;  1A58 A;  1QNH A;  1C5F A;  2Z6W A;  4YUP A;  4DGC A;  1E8K A;  4CYH A;  4XNC A;  3FOF A;  3K0O A;  1CWF A;  4J5B A;  1AK4 A;  5KV5 A;  2MVZ A;  3ODI A;  4YUO A;  3ERE D;  1W8V A;  1XXA A;  2MC9 A;  3BUE A;  4TOT A;  5KUZ A;  1XXC A;  1NMK A;  5CJ9 A;  4N1S A;  4DGA A;  2RS4 A;  1W8L A;  2HQ6 A;  3S6M A;  2MS4 A;  1AWR A;  2IGV A;  4N1R A;  1VAI A;  1W74 A;  2ALF A;  4J5C X;  2C3B A;  3JB9 d;  2X83 B;  2ZFZ A;  1H0P A;  1B4B A;  4J5E X;  3CAG A;  4YUK A;  4HY7 A;  5KUO A;  1MIK A;  2OK3 A;  4E1Q A;  1WIH A;  4N1O A;  4KDD A;  2BIT X;  3CYH A;  5KV6 A;  1DYW A;  2X7K A;  4N1N A;  1M9Y A;  3BT8 A;  1CWA A;  5CCN A;  5KV0 A;  4YUH A;  1WQF A;  4LQW A;  5A0E A;  3EOV A;  3RCF A;  4J3N A;  2P0O A;  4S1E A;  3O7T A;  2HE9 A;  2RMC A;  3QX3 A;  1VBT A;  3RCG A;  4JJM A;  3FOE A;  1AWS A;  1OCA A;  3MML B;  3QYU A;  1ISE A;  3OEP A;  3NUH A;  1YND A;  4J59 A;  1A33 A;  4YUM A;  2BIU X;  1AB4 A;  3R54 A;  2RGR A;  1MF8 C;  1AWT A;  1BGW A;  4J5D X; 
#chains in the Genus database with same CATH topology
 5IYC K;  4LK1 A;  1USO A;  4KAR A;  2GAH C;  3R49 A;  1AWU A;  5JHE A;  4XLN A;  1CWJ A;  3GTK C;  3PO2 C;  3PO3 C;  3PMP A;  1K83 A;  4J58 A;  4IPZ A;  2NVT K;  3K0N A;  5KUV A;  2CFA A;  1EK8 A;  3S1N C;  1ZKC A;  1CWH A;  3N0C A;  2O5I A;  2CW0 A;  1W8M A;  3AQO A;  4AYB L;  3RZO K;  3M4O K;  5C44 C;  4C3H K;  3M3Y K;  4A3F K;  4GTF A;  3RD9 X;  1DCO A;  1BCK A;  1GE9 A;  1J6V A;  2A69 A;  1YX2 A;  1XPP A;  2PPB A;  4AH6 A;  4A3D C;  2X2A A;  4BY1 C;  5KV2 A;  1FGL A;  4A3K C;  2A68 A;  2RH6 A;  2R7Z A;  3GEH A;  2CPL A;  3HOV K;  4A3L K;  2NVY K;  1M9F A;  2P5M A;  2X25 B;  4KM8 A;  4BLB A;  4KN4 A;  3S1M K;  3HOX K;  1VLO A;  2NUL A;  3HKZ L;  4YFN A;  1YNJ A;  2E2J K;  5C3E C;  4YUN A;  5CBW A;  3T00 A;  3R4G A;  3LAP A;  3ORE A;  5TMC A;  4YFX A;  3CQZ K;  3GTK A;  1CWI A;  1CWO A;  5KV7 A;  4BKW A;  1MZW A;  4KC6 A;  3ODL A;  5IOR A;  3GDZ A;  2ZP2 A;  4J5A X;  1I3Q C;  1WQG A;  4G0V A;  3WOD A;  3RDC A;  3BP8 C;  4G0U A;  5KV3 A;  3KOP A;  2R93 C;  2IGW A;  1VRQ C;  4AYB D;  3GTJ C;  4C45 A;  1VGX A;  3AQP A;  3FKI A;  1F93 A;  5IOT A;  4FM9 A;  5D4D A;  1SFO A;  4R3F A;  2JA7 K;  3GTL A;  3RCL A;  4A3C K;  3X27 A;  1TWF K;  3GTO A;  4KMD A;  2JA5 K;  4LQY A;  2D6F C;  2NVX C;  1IE0 A;  1ZVU A;  4G7H A;  4G0W A;  3K0R A;  3L4K A;  5DUD A;  1ZXO A;  1IS1 A;  2ZUF A;  1X31 C;  2E2H C;  2WB1 D;  3AD7 C;  1TWH C;  3GTK K;  1CWB A;  3PO2 K;  4C3J K;  3GSI A;  3PO3 K;  5KUR A;  3GTQ A;  4GTE A;  2E2I C;  2WLW A;  1UV7 A;  3BO7 A;  3I4M C;  3HKZ D;  4XCH A;  3HOU C;  1EI6 A;  4A3J C;  2PA8 D;  3AH5 A;  4GFQ A;  5IOS A;  5FLM K;  1IST A;  4KB2 A;  3UCH A;  3S1N K;  4LOW A;  4RMF A;  1BDF A;  3GEI A;  1Z81 A;  2KWA A;  3HOW C;  4YG2 A;  5M5X K;  4FRV A;  1AWV A;  3GTP K;  3G4C A;  1V9T A;  4A3B K;  1J2A A;  4GTL A;  5CCQ A;  1O24 A;  5IP9 K;  3S2D C;  3S1R K;  4O8H A;  3FHZ A;  2CMT A;  1TWG C;  5M3M K;  3T01 A;  1XYH A;  1O26 A;  4QIW L;  5CYH A;  1JVI A;  5C4J C;  1IIP A;  1IBA A;  4PAA A;  1WQH A;  2V6T A;  1QNG A;  3RCK X;  1ZMF A;  1CLH A;  1TWC A;  4KAW X;  4BY1 K;  3GTJ A;  1DD5 A;  3S16 C;  4A3K K;  2MZU A;  4WJ4 A;  1R9T C;  5IYD K;  2K7N A;  5CCS X;  1JQW A;  3A8I A;  3EQL A;  4ZH4 A;  2X2C K;  3R56 A;  5KUQ A;  4X6A C;  4WIL A;  2POY A;  2W7V A;  1O2F B;  1M9D A;  1LOP A;  1CWC A;  5JVO A;  3L4J A;  3RDA X;  2A6E A;  5C3E K;  2FU0 A;  5KUL A;  3G4A A;  4YFK A;  3OPF A;  4ZSD A;  3HOY K;  2E2H A;  1TWH A;  2GSU A;  2N0T A;  2E2I A;  5C4X C;  4N1M A;  1ZBS A;  4GT9 A;  5CBT A;  5KUW A;  1M63 C;  1I3Q K;  3S17 C;  2PHC B;  1VBS A;  1Y1W K;  3HOZ C;  2R93 K;  4ZSC A;  2YU9 C;  2X2D B;  3RFY A;  1EH1 A;  3FKI C;  2XCQ A;  4GTA A;  1SFO C;  1M9E A;  1ZKF A;  2RMA A;  3GTL C;  4BXX K;  3TFH A;  2ZUE A;  3GTO C;  1O27 A;  1XO7 A;  3K0Q A;  2Y3P A;  2NVX K;  1I6H C;  2FQT A;  1HI9 A;  1TWG A;  2VUM K;  4EYV A;  1QOI A;  3S2H K;  4A3I K;  3MML A;  5IOQ A;  5KV4 A;  3I4N C;  1TWA C;  5IYB C;  3GTQ C;  1VJE A;  2Y0S D;  4YUI A;  4KN7 A;  4MEY A;  4NOI A;  1L0W A;  4DDQ A;  5KUN A;  1K83 K;  2GW2 A;  1R9T A;  4MQ9 A;  3I4M K;  1CWL A;  3HOU K;  1KQ4 A;  4A3J K;  1CWM A;  4I9Y A;  4XSX A;  4XSZ A;  2JA6 A;  2RMB A;  4C2M C;  3TFJ A;  4KB4 A;  3H3V L;  4A3M K;  4BY7 C;  3S14 C;  1IQ0 A;  3HOW K;  5CBV A;  4O8I A;  2XCO A;  4A93 K;  4LK0 A;  1RU0 A;  1XXB A;  4BBS C;  5M5W K;  2R92 C;  3RCI X;  1WCM A;  1YCL A;  4KMU A;  5E68 A;  3V4G A;  2NVQ C;  3S2D K;  1RMH A;  1CWK A;  4KAT A;  3TTG A;  1ZX8 A;  1Y1V C;  1M9C A;  4Q5S A;  1E3B A;  3A8J A;  4A3E C;  3K7A K;  2B71 A;  1X7F A;  2OSE A;  4S1J A;  5C4J K;  4QJV B;  3S15 K;  2HQJ A;  1TWC C;  3LAJ A;  2YU9 A;  3R57 A;  3AD9 C;  3RDB A;  2GAG C;  3S1Q C;  1B4A A;  2R7Z K;  1WOR A;  4ILD A;  5IYC C;  4OIR A;  3RDD A;  5EGH A;  2EBB A;  1IHG A;  1EFW A;  1F9N A;  2HAQ A;  4YUG A;  1M9X A;  2CYH A;  1YNN A;  4GZY A;  3ICI A;  4N1Q A;  4YUL A;  1VDN A;  1IW7 A;  5KUU A;  2GSN A;  4GTD A;  1XQ7 A;  1TWA A;  3H0G A;  4P9S A;  1XWN A;  3H3V D;  5C4X K;  3CYS A;  1JOE A;  2QER A;  3DXJ A;  4FZB A;  3GTM A;  3BKP A;  3ICH A;  3K0P A;  1J6W A;  5F66 A;  4DGE A;  3HOZ K;  4A3G C;  2B63 A;  3K0M A;  2XCR B;  3M4O C;  4C3H C;  4N1P A;  5LUD A;  2CFA B;  3LPX A;  4A3F C;  2JA8 C;  3FKI K;  3M3Y C;  1SFO K;  1I50 A;  4KMH A;  2OJU A;  3SZY A;  2R92 A;  3GTL K;  2CFE A;  3GTO K;  3GTG A;  5C44 K;  4O2D A;  2R99 A;  3K2C A;  1Y1V A;  4OIQ A;  4GTC A;  5CCR A;  2NVY C;  2PLU A;  5KUS A;  1XZQ B;  5CBU A;  1BJT A;  4A3D K;  3I4N K;  1ZQ1 C;  2A2N A;  3VA7 A;  1PJ6 A;  3S1M C;  2ESL A;  3HOX C;  3GTQ K;  4OIN A;  4YUJ A;  2V6U A;  5IP7 C;  2JH3 A;  4C3I C;  4BLA A;  2E2J C;  4DGB A;  1J6X A;  2V6S A;  5EGE A;  4DGD A;  2JA6 C;  4C2M K;  3IPJ A;  1CYN A;  3R59 A;  2POE A;  4FRU A;  1ZYR A;  3GEE A;  2WAQ L;  1AWQ A;  2WFJ A;  2WFI A;  2XGY B;  1HQM A;  4JCP A;  4QJV A;  4R3E A;  3RZD C;  3T1U A;  1WSV A;  5KV1 A;  2CK1 A;  1WCM C;  1XZP B;  4P5B A;  5TMF A;  1A58 A;  1QNH A;  1O2A A;  1C5F A;  2Z6W A;  3Q3Q A;  4A3E K;  1F7U A;  4BBR C;  4YUP A;  4DGC A;  4A3C C;  1E8K A;  2BE5 A;  2JA5 C;  1TWC K;  3GTJ K;  5M3F K;  4CYH A;  3S1Q K;  4XNC A;  4XLP A;  3FOF A;  3K0O A;  1CWF A;  4QIW D;  1F7V A;  4J5B A;  1AK4 A;  5KV5 A;  3N0B A;  2MVZ A;  3ODI A;  4YUO A;  4C3J C;  1W8V A;  3ERE D;  1XXA A;  2MC9 A;  2NVY A;  3BUE A;  1PJ5 A;  1USM A;  5FLM C;  3H0G C;  2E2H K;  1TWH K;  1BS2 A;  4Y7N C;  2E2I K;  1SMY A;  4TOT A;  5KUZ A;  4KM9 A;  1XXC A;  1NMK A;  2WAQ D;  5CJ9 A;  3GTM C;  3GTP C;  4N1S A;  4A3G K;  2B63 C;  4A3B C;  3CQZ A;  5IP9 C;  4DGA A;  3S1R C;  2RS4 A;  1W8L A;  2HQ6 A;  2JA8 K;  1EQR A;  3S6M A;  1C0A A;  2MS4 A;  1AWR A;  1XZQ A;  1I50 C;  2IGV A;  4N1R A;  1J98 A;  4Y52 C;  1VAI A;  3GTG C;  1W74 A;  2ALF A;  2O5J A;  4J5C X;  2C3B A;  3JB9 d;  2X83 B;  3JST A;  1TWG K;  1H0P A;  2ZFZ A;  1I6V A;  1B4B A;  4OIP A;  5IYD C;  4J5E X;  1IL2 A;  3CAG A;  2JA7 A;  4YUK A;  4HY7 A;  5KUO A;  1MIK A;  2OK3 A;  1TWF A;  4KAS A;  2WB1 L;  2JA5 A;  2NNZ A;  4E1Q A;  5FJ8 K;  2PMZ L;  3S16 K;  2A6H A;  1O29 A;  1O28 A;  1WIH A;  5IP7 K;  1R9T K;  3GIR A;  4C3I K;  4N1O A;  1XZP A;  2PA8 L;  4KDD A;  1V5V A;  2BIT X;  2JA6 K;  1WOS A;  3CYH A;  3N3Y A;  3HOY C;  5KV6 A;  4X6A K;  1DYW A;  2X7K A;  4N1N A;  1G51 A;  1M9Y A;  5HL8 A;  2NVT C;  3BT8 A;  1CWA A;  5CCN A;  5KV0 A;  1WOO A;  3RZD K;  3A8K A;  1Y1W C;  4YUH A;  1WCM K;  1WQF A;  4LQW A;  5CHP A;  4G7Z A;  3S0X A;  4LR2 A;  1O25 A;  4BBR K;  3S17 K;  3GTP A;  5A0E A;  4BXX C;  3EOV A;  3RZO C;  3RCF A;  4J3N A;  2YU9 K;  2P0O A;  2VUM C;  4WJ3 M;  4S1E A;  3O7T A;  2HE9 A;  1WOP A;  5M5Y K;  1DCH A;  3S2H C;  3BP3 A;  4A3I C;  3AD8 C;  4G7O A;  2RMC A;  1I6H K;  3HXA A;  3QX3 A;  3T02 A;  4M1X A;  2PMZ D;  4GTB A;  1VBT A;  1K83 C;  3RCG A;  3TFI A;  3HOV C;  4A3L C;  4Q4Z A;  4JJM A;  3FOE A;  1AWS A;  1TWA K;  3H0G K;  5IYB K;  1OCA A;  3MML B;  3QYU A;  1ISE A;  2GSO A;  4Y7N K;  4A3M C;  3OEP A;  3NUH A;  2FQO A;  4A93 C;  3SZZ A;  1INN A;  3GTM K;  4JK1 A;  2B63 K;  3CQZ C;  1YND A;  4BY7 K;  4PAB A;  3S14 K;  3ADA C;  4J59 A;  2VUM A;  1I50 K;  3K7A C;  1A33 A;  1I3Q A;  1PJ7 A;  4BBS K;  5JFE A;  4YUM A;  1O2B A;  2P8T A;  2R92 K;  1Y1W A;  4OIO A;  4Y52 K;  4KMA A;  4LJZ A;  2R93 A;  3S15 C;  2NVQ K;  3GTG K;  1VH2 A;  1Y1V K;  2BIU X;  1WSR A;  2R7Z C;  2KA0 A;  4LLG A;  1AB4 A;  1DCP A;  3R54 A;  4P5A A;  2JA7 C;  2RGR A;  5L46 A;  1TWF C;  5TJ3 A;  4MEX A;  1MF8 C;  1AWT A;  2NVX A;  2Y0S L;  1BGW A;  4J5D X; 
#chains in the Genus database with same CATH homology
 4KAR A;  3R49 A;  1AWU A;  5JHE A;  1CWJ A;  3PMP A;  1K83 A;  4J58 A;  4IPZ A;  3K0N A;  5KUV A;  2CFA A;  1EK8 A;  1ZKC A;  1CWH A;  3N0C A;  1W8M A;  3AQO A;  4GTF A;  3RD9 X;  1BCK A;  1GE9 A;  2X2A A;  5KV2 A;  1FGL A;  2RH6 A;  2R7Z A;  2CPL A;  1M9F A;  2P5M A;  2X25 B;  4KM8 A;  4BLB A;  2NUL A;  4YUN A;  5CBW A;  3R4G A;  3LAP A;  3ORE A;  3GTK A;  1CWI A;  1CWO A;  5KV7 A;  4BKW A;  1MZW A;  4KC6 A;  3ODL A;  5IOR A;  4G0U A;  2ZP2 A;  4J5A X;  4G0V A;  1WQG A;  3RDC A;  5KV3 A;  2IGW A;  3AQP A;  3FKI A;  4FM9 A;  5IOT A;  1SFO A;  4R3F A;  3GTL A;  3RCL A;  3GTO A;  4KMD A;  4LQY A;  1ZVU A;  4G0W A;  3K0R A;  3L4K A;  5DUD A;  1ZXO A;  1IS1 A;  1CWB A;  3GTQ A;  5KUR A;  4GTE A;  2WLW A;  3BO7 A;  3AH5 A;  4GFQ A;  5IOS A;  1IST A;  4KB2 A;  3UCH A;  1Z81 A;  2KWA A;  4FRV A;  1AWV A;  3G4C A;  1V9T A;  1J2A A;  4GTL A;  5CCQ A;  1O24 A;  4O8H A;  3FHZ A;  2CMT A;  1XYH A;  1O26 A;  5CYH A;  1IIP A;  1WQH A;  1QNG A;  3RCK X;  1ZMF A;  1CLH A;  1TWC A;  4KAW X;  3GTJ A;  1DD5 A;  2MZU A;  2K7N A;  5CCS X;  2X2C K;  3R56 A;  5KUQ A;  2POY A;  1M9D A;  1LOP A;  1CWC A;  5JVO A;  3L4J A;  3RDA X;  2FU0 A;  5KUL A;  3G4A A;  3OPF A;  4ZSD A;  2E2H A;  1TWH A;  2GSU A;  2N0T A;  2E2I A;  4N1M A;  1ZBS A;  4GT9 A;  5CBT A;  5KUW A;  1M63 C;  2PHC B;  1VBS A;  4ZSC A;  2X2D B;  3RFY A;  1EH1 A;  2XCQ A;  4GTA A;  1M9E A;  1ZKF A;  2RMA A;  1O27 A;  1XO7 A;  3K0Q A;  2Y3P A;  1TWG A;  4EYV A;  1QOI A;  3MML A;  5IOQ A;  5KV4 A;  4YUI A;  4DDQ A;  1R9T A;  5KUN A;  2GW2 A;  1CWL A;  1KQ4 A;  1CWM A;  4I9Y A;  2JA6 A;  2RMB A;  4C2M C;  4KB4 A;  5CBV A;  4O8I A;  2XCO A;  1XXB A;  3RCI X;  1WCM A;  3V4G A;  1RMH A;  1CWK A;  4KAT A;  1M9C A;  1E3B A;  2B71 A;  1X7F A;  2OSE A;  4S1J A;  2HQJ A;  2YU9 A;  3LAJ A;  3R57 A;  3RDB A;  1B4A A;  4ILD A;  3RDD A;  5EGH A;  1IHG A;  1F9N A;  2HAQ A;  4YUG A;  1M9X A;  2CYH A;  3ICI A;  4N1Q A;  4YUL A;  1VDN A;  5KUU A;  2GSN A;  4GTD A;  1XQ7 A;  1TWA A;  3H0G A;  1XWN A;  3CYS A;  2QER A;  4FZB A;  3GTM A;  3BKP A;  3ICH A;  3K0P A;  5F66 A;  4DGE A;  2B63 A;  3K0M A;  2XCR B;  4C3H C;  4N1P A;  5LUD A;  2CFA B;  3LPX A;  1I50 A;  4KMH A;  2OJU A;  2R92 A;  2CFE A;  3GTG A;  2R99 A;  3K2C A;  1Y1V A;  4GTC A;  5CCR A;  2PLU A;  5KUS A;  5CBU A;  1BJT A;  2A2N A;  3VA7 A;  2ESL A;  4YUJ A;  2JH3 A;  4C3I C;  4BLA A;  4DGB A;  5EGE A;  4DGD A;  1CYN A;  3R59 A;  2POE A;  4FRU A;  1AWQ A;  2WFJ A;  2WFI A;  2XGY B;  4JCP A;  4R3E A;  3T1U A;  5KV1 A;  2CK1 A;  4P5B A;  1A58 A;  1QNH A;  1O2A A;  1C5F A;  2Z6W A;  3Q3Q A;  4YUP A;  4DGC A;  1E8K A;  4CYH A;  4XNC A;  3FOF A;  3K0O A;  1CWF A;  4J5B A;  1AK4 A;  5KV5 A;  3N0B A;  2MVZ A;  3ODI A;  4YUO A;  4C3J C;  1W8V A;  3ERE D;  1XXA A;  2MC9 A;  2NVY A;  3BUE A;  4TOT A;  5KUZ A;  4KM9 A;  1XXC A;  1NMK A;  5CJ9 A;  4N1S A;  3CQZ A;  4DGA A;  2RS4 A;  1W8L A;  2HQ6 A;  3S6M A;  2MS4 A;  1AWR A;  2IGV A;  4N1R A;  1VAI A;  1W74 A;  2ALF A;  4J5C X;  2C3B A;  3JB9 d;  2X83 B;  2ZFZ A;  1H0P A;  1B4B A;  4J5E X;  3CAG A;  2JA7 A;  4YUK A;  4HY7 A;  5KUO A;  1MIK A;  2OK3 A;  1TWF A;  4KAS A;  2JA5 A;  4E1Q A;  1O29 A;  1O28 A;  1WIH A;  4N1O A;  4KDD A;  2BIT X;  3CYH A;  3N3Y A;  5KV6 A;  1DYW A;  2X7K A;  4N1N A;  1M9Y A;  3BT8 A;  1CWA A;  5CCN A;  5KV0 A;  4YUH A;  1WQF A;  4LQW A;  5CHP A;  3S0X A;  4LR2 A;  1O25 A;  3GTP A;  5A0E A;  3EOV A;  3RCF A;  4J3N A;  2P0O A;  4S1E A;  3O7T A;  2HE9 A;  2RMC A;  3QX3 A;  4M1X A;  4GTB A;  1VBT A;  3RCG A;  4JJM A;  3FOE A;  1AWS A;  1OCA A;  3MML B;  3QYU A;  1ISE A;  2GSO A;  3OEP A;  3NUH A;  1YND A;  4J59 A;  2VUM A;  1I3Q A;  1A33 A;  5JFE A;  4YUM A;  1O2B A;  1Y1W A;  4KMA A;  2R93 A;  2BIU X;  1AB4 A;  3R54 A;  4P5A A;  2RGR A;  5TJ3 A;  1MF8 C;  1AWT A;  2NVX A;  1BGW A;  4J5D X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...