3OEPA

Crystal structure of ttha0988 in space group p43212
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
485
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 129
structure length 485
sequence length 492
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oepA01
2OJUA 2PHCB 5KUSA 3RCKX 3VA7A 2X83B 1AWRA 2ZFZA 2WLWA 4TOTA 3JB9d 1BCKA 1CWKA 3RD9X 4KDDA 1W8MA 1CWLA 3R49A 1YNDA 3RCFA 1AWTA 1XO7A 3RDBA 4EYVA 2A2NA 2X2DB 2N0TA 3K0OA 1LOPA 4DGEA 3BT8A 4N1QA 1AWUA 1M9EA 1VBSA 4DGDA 1B4AA 1XXBA 4J3NA 1E8KA 2XCRB 4YUHA 1CWOA 5CCRA 3R4GA 1XXAA 1OCAA 2CPLA 1F9NA 4GFQA 5KV7A 3OPFA 5KULA 3QYUA 4JJMA 5KV6A 1CWHA 1A58A 4J58A 4N1MA 3CYSA 1M63C 3ICHA 3R54A 4N1NA 4YULA 3BUEA 3V4GA 4G0UA 1EH1A 4DGBA 2RS4A 5KV1A 1XXCA 4YUJA 1ZMFA 5LUDA 4ZSCA 1ZVUA 2BITX 1DYWA 4J5AX 4XNCA 1VDNA 2ESLA 1M9XA 4HY7A 3K0NA 4G0VA 1CWBA 1XYHA 5KV0A 2C3BA 3RDDA 1WQHA 3FOFA 5DUDA 4KC6A 1GE9A 1Z81A 4FRUA 2B71A 1QOIA 5CYHA 5JVOA 2HQJA 2MVZA 5KUWA 1MIKA 2POEA 1CWIA 2P5MA 1V9TA 3LAJA 1BJTA 2X25B 1QNGA 1MZWA 5JHEA 3MMLB 2PLUA 3RFYA 2ZP2A 4IPZA 1CWCA 3RDCA 5CBWA 4R3EA 2X2CK 2R99A 3ODLA 1VAIA 2MS4A 4J59A 4YUMA 1ISEA 4KB4A 4N1RA 5KV4A 1WQFA 4O8HA 4YUNA 2OSEA 1EK8A 2NULA 1IS1A 1XWNA 5CJ9A 4N1SA 1W8LA 4YUIA 4YUGA 2MZUA 2CYHA 5CCQA 3FOEA 1W8VA 1FGLA 3K2CA 3R56A 4KAWX 1CLHA 5KUVA 2RMBA 3CYHA 5F66A 2POYA 3RCLA 1B4BA 1AWVA 3LAPA 2OK3A 5KUZA 1QNHA 3EOVA 1CWJA 4DDQA 1CWFA 5KV3A 3QX3A 4G0WA 2CK1A 2HAQA 2X2AA 2XGYB 2MC9A 3OEPA 1M9DA 1IHGA 2BIUX 3K0QA 1WQGA 2KWAA 3NUHA 4S1EA 5KUQA 1C5FA 5CCNA 3FHZA 4FRVA 5KV5A 3RDAX 3RCGA 4CYHA 4J5DX 1BGWA 5CCSX 4DGAA 2XCOA 2K7NA 1M9YA 1ISTA 3ERED 1E3BA 4J5EX 5KUOA 3T1UA 1NMKA 2X7KA 2QERA 3BO7A 1XQ7A 4N1OA 4S1JA 2IGVA 1X7FA 4E1QA 2RGRA 3RCIX 2FU0A 1MF8C 4I9YA 4FM9A 1DD5A 3R59A 2Z6WA 1AB4A 3L4JA 2RMCA 4J5BA 4YUKA 2RMAA 1CWMA 1H0PA 1ZKCA 4R3FA 2Y3PA 4O8IA 1CYNA 1M9FA 3BKPA 4YUOA 5CBTA 2XCQA 3LPXA 1CWAA 4N1PA 2ALFA 3L4KA 1AWQA 1ZKFA 3MMLA 3CAGA 2HE9A 1VBTA 2IGWA 3K0PA 3ODIA 1M9CA 1AK4A 1RMHA 1A33A 2GW2A 2P0OA 3K0MA 5CBVA 5KURA 5KUNA 2CMTA 1IIPA 5CBUA 3K0RA 5A0EA 2WFJA 4J5CX 4KB2A 2WFIA 2CFEA 3OREA 1AWSA 5KUUA 4JCPA 1WIHA 3PMPA 1W74A 2HQ6A 3O7TA 3S6MA 1J2AA 3R57A 5KV2A 3UCHA 4ZSDA 4DGCA 3ICIA 4YUPA 4LQWA
chains in the Genus database with same CATH superfamily
2OJUA 3RCKX 1TWAK 3GTQK 3GEEA 1BCKA 4XSZA 3RD9X 1Y1WK 2D6FC 1YNDA 3RDBA 1K83C 3KOPA 4A93C 3S17K 4KMAA 1I3QC 2XCRB 1YX2A 5CCRA 3R4GA 1TWCK 3AQOA 2Y0SL 1F9NA 4QJVA 5E68A 2JA7A 4GFQA 2JA5K 4KMHA 1YNNA 2A68A 5KV6A 1A58A 4J58A 4ILDA 5FJ8K 3PO2K 3BUEA 4G0UA 5IYCK 2V6TA 3CQZK 1ZMFA 1JVIA 3DXJA 3AQPA 1R9TC 1I6HC 4KN7A 2JH3A 4A3MC 3GDZA 4J5AX 3GTKC 5EGHA 3GTPA 3Q3QA 3HOWK 3A8KA 2PMZL 1CWBA 5IORA 3AD7C 2R7ZC 2E2HA 2E2HK 1WCMC 1QOIA 2PPBA 4Q4ZA 5KUWA 4P9SA 4MQ9A 2P5MA 3A8IA 1PJ5A 2E2IA 4NOIA 3GTMC 3GTGK 3GTLC 3MMLB 1VJEA 2PLUA 1DCPA 3HOZC 2ZP2A 3HOUC 4P5AA 4XCHA 1WSVA 2FQTA 3AD9C 2GSNA 4O8HA 2OSEA 2PA8D 1XWNA 2VUMK 1W8LA 4YUIA 2R92C 3K7AC 1I50A 3AD8C 1W8VA 3K2CA 3GTJK 2NVXA 3R56A 5KUVA 3LAPA 2NNZA 1V5VA 2OK3A 3GTPC 5KUZA 1QNHA 3EOVA 1O24A 1CWJA 4G0WA 2HAQA 2X2AA 2XGYB 2MC9A 3OEPA 1TWGA 3S1QK 1IHGA 2BIUX 1O2AA 2PA8L 4JK1A 2GSUA 4S1EA 5KUQA 2JA6K 3S1MC 3FHZA 4KMDA 2NVYK 4A3KC 5KV5A 1WOPA 4CYHA 5TMFA 4C2MC 3IPJA 1BGWA 3JSTA 4GTFA 4A3BC 3S16C 4KASA 4GTDA 4A3CK 3T1UA 1XZPB 2X7KA 1SFOC 1XQ7A 1J6XA 3GEIA 2FU0A 2B63A 4YFNA 4BY1K 3H0GA 4J5BA 1I50K 1VRQC 4AYBD 2YU9C 3N0BA 1M9FA 5CBTA 1R9TA 4N1PA 1ZKFA 5C3EC 4LQYA 1VBTA 5KURA 2P0OA 1WOOA 2V6SA 4J5CX 4Y7NK 4BBSK 3SZZA 3UCHA 3RDCA 3R57A 1ISEA 5M5YK 4WILA 5TMCA 5C44C 3VA7A 4ZH4A 3HOVK 3N0CA 1K83A 2X83B 1O26A 4M1XA 3JB9d 4TOTA 4BY7C 1CWKA 1ZXOA 4KDDA 3RZOC 3R49A 4A3EK 3RCFA 1AWTA 4A3IC 4DGEA 2N0TA 3I4MC 1RU0A 3S1RK 3PO3K 4N1QA 4LR2A 1XXBA 4J3NA 3BP3A 3S15K 1XXAA 3TFHA 4KARA 4GTLA 2CPLA 2NVTK 5IYBC 2R92A 5FLMC 3OPFA 4A3GC 3I4NK 3BP8C 2A69A 4P5BA 2JA5C 3V4GA 4N1NA 1XXCA 1VH2A 4YUJA 1X31C 5LUDA 3S0XA 1DYWA 5IYCC 3CQZC 1M9XA 1R9TK 2E2IK 5IP9K 3RDDA 3T02A 1WQHA 2WB1D 2A6EA 5DUDA 3FOFA 3S2HC 1Z81A 3GTLA 1GE9A 4FRUA 2R93A 5CYHA 5L46A 3GTMA 3S14K 1EQRA 2POEA 1CWIA 3HKZL 3LAJA 1BJTA 5D4DA 1TWFC 1F7UA 2WAQL 3S1NK 5CBWA 4LJZA 3GEHA 4KB4A 4C3JK 3GTGC 2P8TA 4YG2A 4GTBA 5CJ9A 1DCOA 1K83K 4LK1A 5C4JC 1IL2A 3M4OC 1I3QK 1C0AA 2MZUA 1KQ4A 1XZQB 1XZPA 1FGLA 2RMBA 2POYA 1WOSA 1AWVA 4OINA 3TFIA 1CWFA 4A3FK 4AH6A 1SMYA 1TWHC 2KWAA 3K0QA 4C3IK 3NUHA 4A3DK 4BBRK 5JFEA 5HL8A 2K7NA 1USMA 4LK0A 1WCMA 1E3BA 4Y52K 1IQ0A 3X27A 1NMKA 3GSIA 3GTOC 4G7HA 3S17C 1J6WA 4LOWA 4GZYA 1X7FA 3FKIC 2NVQK 1ZQ1C 2E2JK 4PABA 5IOSA 1MF8C 4I9YA 4A3CC 1SFOK 2EBBA 5IP7C 4YUKA 1ZKCA 4A3LC 3GTMK 1CYNA 3HOZK 3CAGA 4AYBL 2HE9A 3HOUK 2IGWA 2JA6A 1ZX8A 1AK4A 2GW2A 3S2DC 4G7OA 2CMTA 1IIPA 3K0RA 3GTOA 2GSOA 4BXXC 2CFEA 3OREA 1AWSA 5KUUA 4QJVB 4OIRA 2JA7C 1J6VA 5IYDK 1Y1VK 3GTJC 1TWGC 1L0WA 4DGCA 3O7TA 3HOWC 4KM8A 4ZSDA 1Y1WC 3HXAA 2PHCB 5KUSA 2R93C 3M3YK 4X6AC 1AWRA 2ZFZA 2WLWA 3G4CA 4G7ZA 1W8MA 1CWLA 5C44K 2O5IA 4BY7K 2X2DB 3K0OA 3RZDC 3GTKA 1O27A 3BT8A 1TWCC 1AWUA 1VBSA 1IE0A 4C2MK 3GTGA 3HOYC 4YUHA 1CWOA 3G4AA 1OCAA 3S15C 1Y1WA 5KULA 4GTCA 2B63C 4C3HC 4JJMA 4N1MA 4YULA 3ICHA 3R54A 4BY1C 1I50C 3GTKK 1WSRA 4ZSCA 4MEYA 3HOXC 3CQZA 1YNJA 4XNCA 1VDNA 2ESLA 4HY7A 5C4XC 4G0VA 1DCHA 1XPPA 3H0GK 1O25A 2B71A 4RMFA 4Y7NC 4BLBA 2R7ZK 1IW7A 5M3MK 4KN4A 1QNGA 1MZWA 2V6UA 5CHPA 4OIOA 2A6HA 2WB1L 3RFYA 4MEXA 2X2CK 2R99A 1VAIA 4YUMA 5IOTA 5EGEA 1WQFA 4KMUA 3H3VD 2WAQD 4YUNA 4A3EC 1IS1A 4A3IK 4GT9A 2CW0A 5M5XK 5CCQA 3FOEA 1SFOA 3T00A 2VUMC 3CYHA 3RCLA 1XZQA 1B4BA 3ADAC 3M4OK 2NVTC 1TWAC 5KV3A 2CK1A 4BBSC 1ZYRA 2W7VA 1TWHA 1C5FA 5CCNA 4A3BK 4WJ4A 2KA0A 3RCGA 1TWHK 1JQWA 2RH6A 2ZUFA 4J5DX 4C3IC 4Q5SA 3S1MK 2NVYC 3ERED 4J5EX 4FZBA 1USOA 1TWAA 1JOEA 2NVXC 1Y1VA 4OIPA 2QERA 3BO7A 4E1QA 2IGVA 2BE5A 2JA8C 3RCIX 3WODA 4FM9A 3R59A 4XLNA 3GTQA 2RMCA 1CWMA 1H0PA 4R3FA 2Y3PA 2E2JC 1I6HK 1TWFA 1CWAA 2R92K 4A3JC 3MMLA 3SZYA 3I4NC 3K0PA 1TWFK 1M9CA 1RMHA 3K0MA 1A33A 1UV7A 4C3JC 5CBUA 3GTPK 5A0EA 2ZUEA 2WFJA 4KB2A 1O29A 2E2HC 1HQMA 2WFIA 1WCMK 1PJ6A 4BLAA 4KATA 1BDFA 4JCPA 1YCLA 2PMZD 3PMPA 1W74A 2E2IC 3GTQC 3S6MA 1J2AA 5KV2A 4YUPA 2NVYA 4C45A 3RZOK 4EYVA 1Y1VC 5M5WK 4A93K 3AH5A 1J98A 4KM9A 3S16K 1IBAA 1I6VA 3TFJA 4GTEA 1XO7A 1TWCA 3M3YC 4X6AK 2A2NA 1LOPA 1HI9A 5M3FK 1VGXA 3S1NC 1M9EA 3FKIA 4DGDA 1B4AA 1G51A 4O2DA 1E8KA 5IYBK 1PJ7A 3PO3C 5FLMK 4YFKA 4A3GK 2CFAA 4Y52C 2VUMA 3PO2C 5KV7A 3HOYK 4QIWD 3S1QC 5C3EK 3QYUA 1CWHA 2RGRA 3CYSA 1M63C 2JA6C 1VLOA 4A3MK 4LLGA 1EH1A 4DGBA 2RS4A 5KV1A 5IP7K 1WORA 2GAGC 1ZVUA 3TTGA 2BITX 3K0NA 2R7ZA 3HOXK 2GAHC 1XYHA 3A8JA 4QIWL 5KV0A 2C3BA 4KC6A 3GTLK 5JVOA 2HQJA 2MVZA 2JA7K 1MIKA 4XSXA 1ZBSA 1V9TA 1TWGK 2X25B 5JHEA 3S14C 4IPZA 3HKZD 1CWCA 4R3EA 4J59A 3ODLA 2MS4A 2FQOA 3K7AK 4N1RA 5KV4A 1EK8A 2NULA 1I3QA 4N1SA 4YUGA 3RZDK 4XLPA 1F93A 2CYHA 4BKWA 5C4JK 4KAWX 3L4KA 1CLHA 1F7VA 5F66A 1O2FB 1EI6A 3HOVC 4DDQA 4BXXK 3QX3A 5IYDC 4A3KK 4WJ3M 4A3DC 1EFWA 4BBRC 1M9DA 1WQGA 3I4MK 3S1RC 4FRVA 3RDAX 3S2HK 2O5JA 4YFXA 5CCSX 4DGAA 4PAAA 2XCOA 1M9YA 1ISTA 1O2BA 3FKIK 5KUOA 3GIRA 1O28A 2NVQC 5TJ3A 4N1OA 4S1JA 3H0GC 2YU9K 2YU9A 1DD5A 2Y0SD 2Z6WA 1AB4A 2NVXK 3GTJA 3GTOK 4A3LK 3L4JA 2RMAA 1BS2A 5IOQA 2JA8K 4O8IA 3BKPA 2XCQA 4YUOA 3LPXA 4GTAA 2ALFA 1AWQA 2B63K 4C3HK 2JA5A 3ODIA 3EQLA 5CBVA 5KUNA 3N3YA 3H3VL 5IP9C 4A3JK 3S2DK 4A3FC 2CFAB 1INNA 1WIHA 2R93K 2HQ6A 5C4XK 4OIQA 3T01A 3ICIA 4LQWA
chains in the Genus database with same CATH topology
2OJUA 3RCKX 1BCKA 3RD9X 1YNDA 3RDBA 4KMAA 2XCRB 5CCRA 3R4GA 3AQOA 1F9NA 2JA7A 4GFQA 4KMHA 5KV6A 1A58A 4J58A 4ILDA 3BUEA 4G0UA 1ZMFA 3AQPA 2JH3A 4J5AX 5EGHA 3GTPA 3Q3QA 1CWBA 5IORA 2E2HA 1QOIA 5KUWA 2P5MA 2E2IA 3MMLB 2PLUA 2ZP2A 4P5AA 2GSNA 4O8HA 2OSEA 1XWNA 1W8LA 4YUIA 1I50A 1W8VA 3K2CA 2NVXA 3R56A 5KUVA 3LAPA 2OK3A 5KUZA 1QNHA 3EOVA 1O24A 1CWJA 4G0WA 2HAQA 2X2AA 2XGYB 2MC9A 3OEPA 1TWGA 1IHGA 2BIUX 1O2AA 2GSUA 4S1EA 5KUQA 3FHZA 4KMDA 5KV5A 4CYHA 4C2MC 1BGWA 4GTFA 4KASA 4GTDA 3T1UA 2X7KA 1XQ7A 2FU0A 2B63A 3H0GA 4J5BA 3N0BA 1M9FA 5CBTA 1R9TA 4N1PA 1ZKFA 4LQYA 1VBTA 5KURA 2P0OA 4J5CX 3UCHA 4LQWA 3RDCA 3R57A 1ISEA 3VA7A 3N0CA 1K83A 2X83B 1O26A 4M1XA 3JB9d 4TOTA 1CWKA 1ZXOA 4KDDA 3R49A 3RCFA 1AWTA 4DGEA 2N0TA 4N1QA 4LR2A 1XXBA 4J3NA 1XXAA 4KARA 4GTLA 2CPLA 2R92A 3OPFA 4P5BA 3V4GA 4N1NA 1XXCA 4YUJA 5LUDA 3S0XA 1DYWA 1M9XA 3RDDA 1WQHA 3FOFA 5DUDA 1GE9A 1Z81A 3GTLA 4FRUA 2R93A 5CYHA 3GTMA 2POEA 1CWIA 3LAJA 1BJTA 5CBWA 4KB4A 4GTBA 5CJ9A 2MZUA 1KQ4A 1FGLA 2RMBA 2POYA 1AWVA 1CWFA 2KWAA 3K0QA 3NUHA 5JFEA 2K7NA 1WCMA 1E3BA 1NMKA 1X7FA 5IOSA 1MF8C 4I9YA 4YUKA 1ZKCA 1CYNA 3CAGA 2HE9A 2IGWA 2JA6A 1AK4A 2GW2A 2CMTA 1IIPA 3K0RA 3GTOA 2GSOA 2CFEA 3OREA 1AWSA 5KUUA 4DGCA 3O7TA 4KM8A 4ZSDA 2PHCB 5KUSA 1AWRA 2ZFZA 2WLWA 3G4CA 1W8MA 1CWLA 2X2DB 3K0OA 3GTKA 1O27A 3BT8A 1AWUA 1VBSA 3GTGA 4YUHA 1CWOA 3G4AA 1OCAA 1Y1WA 5KULA 4GTCA 4C3HC 4JJMA 4N1MA 4YULA 3ICHA 3R54A 4ZSCA 3CQZA 4XNCA 1VDNA 2ESLA 4HY7A 4G0VA 1O25A 2B71A 4BLBA 1QNGA 1MZWA 5CHPA 3RFYA 2X2CK 2R99A 1VAIA 4YUMA 5IOTA 5EGEA 1WQFA 4YUNA 1IS1A 4GT9A 5CCQA 3FOEA 1SFOA 3CYHA 3RCLA 1B4BA 5KV3A 2CK1A 1TWHA 1C5FA 5CCNA 3RCGA 2RH6A 4J5DX 4C3IC 3ERED 4J5EX 4FZBA 1Y1VA 2QERA 3BO7A 4E1QA 2IGVA 3RCIX 4FM9A 3R59A 3GTQA 2RMCA 1CWMA 1H0PA 4R3FA 2Y3PA 1TWFA 1CWAA 3MMLA 3K0PA 1M9CA 1RMHA 3K0MA 1A33A 4C3JC 5CBUA 5A0EA 2WFJA 4KB2A 1O29A 2WFIA 4BLAA 4KATA 4JCPA 3PMPA 1W74A 3S6MA 1J2AA 5KV2A 4YUPA 2NVYA 4EYVA 3AH5A 4KM9A 4GTEA 1XO7A 1TWCA 2A2NA 1LOPA 1M9EA 3FKIA 4DGDA 1B4AA 1E8KA 2VUMA 2CFAA 5KV7A 3QYUA 1CWHA 2RGRA 3CYSA 1M63C 1EH1A 4DGBA 2RS4A 5KV1A 1ZVUA 2BITX 3K0NA 2R7ZA 1XYHA 5KV0A 2C3BA 4KC6A 5JVOA 2HQJA 2MVZA 1MIKA 1ZBSA 1V9TA 2X25B 5JHEA 4IPZA 1CWCA 4R3EA 4J59A 3ODLA 2MS4A 4N1RA 5KV4A 1EK8A 2NULA 1I3QA 4N1SA 4YUGA 2CYHA 4BKWA 4KAWX 3L4KA 1CLHA 5F66A 4DDQA 3QX3A 1M9DA 1WQGA 4FRVA 3RDAX 5CCSX 4DGAA 2XCOA 1M9YA 1ISTA 1O2BA 5KUOA 1O28A 5TJ3A 4N1OA 4S1JA 2YU9A 1DD5A 2Z6WA 1AB4A 3GTJA 3L4JA 2RMAA 5IOQA 4O8IA 3BKPA 2XCQA 4YUOA 3LPXA 4GTAA 2ALFA 1AWQA 2JA5A 3ODIA 5CBVA 5KUNA 3N3YA 2CFAB 1WIHA 2HQ6A 3ICIA 1TWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJU A;  2PHC B;  5KUS A;  3RCK X;  3VA7 A;  2X83 B;  1AWR A;  2ZFZ A;  2WLW A;  4TOT A;  3JB9 d;  1BCK A;  1CWK A;  3RD9 X;  4KDD A;  1W8M A;  1CWL A;  3R49 A;  1YND A;  3RCF A;  1AWT A;  1XO7 A;  3RDB A;  4EYV A;  2A2N A;  2X2D B;  2N0T A;  3K0O A;  1LOP A;  4DGE A;  3BT8 A;  4N1Q A;  1AWU A;  1M9E A;  1VBS A;  4DGD A;  1B4A A;  1XXB A;  4J3N A;  1E8K A;  2XCR B;  4YUH A;  1CWO A;  5CCR A;  3R4G A;  1XXA A;  1OCA A;  2CPL A;  1F9N A;  4GFQ A;  5KV7 A;  3OPF A;  5KUL A;  3QYU A;  4JJM A;  5KV6 A;  1CWH A;  1A58 A;  4J58 A;  4N1M A;  3CYS A;  1M63 C;  3ICH A;  3R54 A;  4N1N A;  4YUL A;  3BUE A;  3V4G A;  4G0U A;  1EH1 A;  4DGB A;  2RS4 A;  5KV1 A;  1XXC A;  4YUJ A;  1ZMF A;  5LUD A;  4ZSC A;  1ZVU A;  2BIT X;  1DYW A;  4J5A X;  4XNC A;  1VDN A;  2ESL A;  1M9X A;  4HY7 A;  3K0N A;  4G0V A;  1CWB A;  1XYH A;  5KV0 A;  2C3B A;  3RDD A;  1WQH A;  3FOF A;  5DUD A;  4KC6 A;  1GE9 A;  1Z81 A;  4FRU A;  2B71 A;  1QOI A;  5CYH A;  5JVO A;  2HQJ A;  2MVZ A;  5KUW A;  1MIK A;  2POE A;  1CWI A;  2P5M A;  1V9T A;  3LAJ A;  1BJT A;  2X25 B;  1QNG A;  1MZW A;  5JHE A;  3MML B;  2PLU A;  3RFY A;  2ZP2 A;  4IPZ A;  1CWC A;  3RDC A;  5CBW A;  4R3E A;  2X2C K;  2R99 A;  3ODL A;  1VAI A;  2MS4 A;  4J59 A;  4YUM A;  1ISE A;  4KB4 A;  4N1R A;  5KV4 A;  1WQF A;  4O8H A;  4YUN A;  2OSE A;  1EK8 A;  2NUL A;  1IS1 A;  1XWN A;  5CJ9 A;  4N1S A;  1W8L A;  4YUI A;  4YUG A;  2MZU A;  2CYH A;  5CCQ A;  3FOE A;  1W8V A;  1FGL A;  3K2C A;  3R56 A;  4KAW X;  1CLH A;  5KUV A;  2RMB A;  3CYH A;  5F66 A;  2POY A;  3RCL A;  1B4B A;  1AWV A;  3LAP A;  2OK3 A;  5KUZ A;  1QNH A;  3EOV A;  1CWJ A;  4DDQ A;  1CWF A;  5KV3 A;  3QX3 A;  4G0W A;  2CK1 A;  2HAQ A;  2X2A A;  2XGY B;  2MC9 A;  3OEP A;  1M9D A;  1IHG A;  2BIU X;  3K0Q A;  1WQG A;  2KWA A;  3NUH A;  4S1E A;  5KUQ A;  1C5F A;  5CCN A;  3FHZ A;  4FRV A;  5KV5 A;  3RDA X;  3RCG A;  4CYH A;  4J5D X;  1BGW A;  5CCS X;  4DGA A;  2XCO A;  2K7N A;  1M9Y A;  1IST A;  3ERE D;  1E3B A;  4J5E X;  5KUO A;  3T1U A;  1NMK A;  2X7K A;  2QER A;  3BO7 A;  1XQ7 A;  4N1O A;  4S1J A;  2IGV A;  1X7F A;  4E1Q A;  2RGR A;  3RCI X;  2FU0 A;  1MF8 C;  4I9Y A;  4FM9 A;  1DD5 A;  3R59 A;  2Z6W A;  1AB4 A;  3L4J A;  2RMC A;  4J5B A;  4YUK A;  2RMA A;  1CWM A;  1H0P A;  1ZKC A;  4R3F A;  2Y3P A;  4O8I A;  1CYN A;  1M9F A;  3BKP A;  4YUO A;  5CBT A;  2XCQ A;  3LPX A;  1CWA A;  4N1P A;  2ALF A;  3L4K A;  1AWQ A;  1ZKF A;  3MML A;  3CAG A;  2HE9 A;  1VBT A;  2IGW A;  3K0P A;  3ODI A;  1M9C A;  1AK4 A;  1RMH A;  1A33 A;  2GW2 A;  2P0O A;  3K0M A;  5CBV A;  5KUR A;  5KUN A;  2CMT A;  1IIP A;  5CBU A;  3K0R A;  5A0E A;  2WFJ A;  4J5C X;  4KB2 A;  2WFI A;  2CFE A;  3ORE A;  1AWS A;  5KUU A;  4JCP A;  1WIH A;  3PMP A;  1W74 A;  2HQ6 A;  3O7T A;  3S6M A;  1J2A A;  3R57 A;  5KV2 A;  3UCH A;  4ZSD A;  4DGC A;  3ICI A;  4YUP A;  4LQW A; 
#chains in the Genus database with same CATH topology
 2OJU A;  3RCK X;  1TWA K;  3GTQ K;  3GEE A;  1BCK A;  4XSZ A;  3RD9 X;  1Y1W K;  2D6F C;  1YND A;  3RDB A;  1K83 C;  3KOP A;  4A93 C;  3S17 K;  4KMA A;  1I3Q C;  2XCR B;  1YX2 A;  5CCR A;  3R4G A;  1TWC K;  3AQO A;  2Y0S L;  1F9N A;  4QJV A;  5E68 A;  2JA7 A;  4GFQ A;  2JA5 K;  4KMH A;  1YNN A;  2A68 A;  5KV6 A;  1A58 A;  4J58 A;  4ILD A;  5FJ8 K;  3PO2 K;  3BUE A;  4G0U A;  5IYC K;  2V6T A;  3CQZ K;  1ZMF A;  1JVI A;  3DXJ A;  3AQP A;  1R9T C;  1I6H C;  4KN7 A;  2JH3 A;  4A3M C;  3GDZ A;  4J5A X;  3GTK C;  5EGH A;  3GTP A;  3Q3Q A;  3HOW K;  3A8K A;  2PMZ L;  1CWB A;  5IOR A;  3AD7 C;  2R7Z C;  2E2H A;  2E2H K;  1WCM C;  1QOI A;  2PPB A;  4Q4Z A;  5KUW A;  4P9S A;  4MQ9 A;  2P5M A;  3A8I A;  1PJ5 A;  2E2I A;  4NOI A;  3GTM C;  3GTG K;  3GTL C;  3MML B;  1VJE A;  2PLU A;  1DCP A;  3HOZ C;  2ZP2 A;  3HOU C;  4P5A A;  4XCH A;  1WSV A;  2FQT A;  3AD9 C;  2GSN A;  4O8H A;  2OSE A;  2PA8 D;  1XWN A;  2VUM K;  1W8L A;  4YUI A;  2R92 C;  3K7A C;  1I50 A;  3AD8 C;  1W8V A;  3K2C A;  3GTJ K;  2NVX A;  3R56 A;  5KUV A;  3LAP A;  2NNZ A;  1V5V A;  2OK3 A;  3GTP C;  5KUZ A;  1QNH A;  3EOV A;  1O24 A;  1CWJ A;  4G0W A;  2HAQ A;  2X2A A;  2XGY B;  2MC9 A;  3OEP A;  1TWG A;  3S1Q K;  1IHG A;  2BIU X;  1O2A A;  2PA8 L;  4JK1 A;  2GSU A;  4S1E A;  5KUQ A;  2JA6 K;  3S1M C;  3FHZ A;  4KMD A;  2NVY K;  4A3K C;  5KV5 A;  1WOP A;  4CYH A;  5TMF A;  4C2M C;  3IPJ A;  1BGW A;  3JST A;  4GTF A;  4A3B C;  3S16 C;  4KAS A;  4GTD A;  4A3C K;  3T1U A;  1XZP B;  2X7K A;  1SFO C;  1XQ7 A;  1J6X A;  3GEI A;  2FU0 A;  2B63 A;  4YFN A;  4BY1 K;  3H0G A;  4J5B A;  1I50 K;  1VRQ C;  4AYB D;  2YU9 C;  3N0B A;  1M9F A;  5CBT A;  1R9T A;  4N1P A;  1ZKF A;  5C3E C;  4LQY A;  1VBT A;  5KUR A;  2P0O A;  1WOO A;  2V6S A;  4J5C X;  4Y7N K;  4BBS K;  3SZZ A;  3UCH A;  3RDC A;  3R57 A;  1ISE A;  5M5Y K;  4WIL A;  5TMC A;  5C44 C;  3VA7 A;  4ZH4 A;  3HOV K;  3N0C A;  1K83 A;  2X83 B;  1O26 A;  4M1X A;  3JB9 d;  4TOT A;  4BY7 C;  1CWK A;  1ZXO A;  4KDD A;  3RZO C;  3R49 A;  4A3E K;  3RCF A;  1AWT A;  4A3I C;  4DGE A;  2N0T A;  3I4M C;  1RU0 A;  3S1R K;  3PO3 K;  4N1Q A;  4LR2 A;  1XXB A;  4J3N A;  3BP3 A;  3S15 K;  1XXA A;  3TFH A;  4KAR A;  4GTL A;  2CPL A;  2NVT K;  5IYB C;  2R92 A;  5FLM C;  3OPF A;  4A3G C;  3I4N K;  3BP8 C;  2A69 A;  4P5B A;  2JA5 C;  3V4G A;  4N1N A;  1XXC A;  1VH2 A;  4YUJ A;  1X31 C;  5LUD A;  3S0X A;  1DYW A;  5IYC C;  3CQZ C;  1M9X A;  1R9T K;  2E2I K;  5IP9 K;  3RDD A;  3T02 A;  1WQH A;  2WB1 D;  2A6E A;  5DUD A;  3FOF A;  3S2H C;  1Z81 A;  3GTL A;  1GE9 A;  4FRU A;  2R93 A;  5CYH A;  5L46 A;  3GTM A;  3S14 K;  1EQR A;  2POE A;  1CWI A;  3HKZ L;  3LAJ A;  1BJT A;  5D4D A;  1TWF C;  1F7U A;  2WAQ L;  3S1N K;  5CBW A;  4LJZ A;  3GEH A;  4KB4 A;  4C3J K;  3GTG C;  2P8T A;  4YG2 A;  4GTB A;  5CJ9 A;  1DCO A;  1K83 K;  4LK1 A;  5C4J C;  1IL2 A;  3M4O C;  1I3Q K;  1C0A A;  2MZU A;  1KQ4 A;  1XZQ B;  1XZP A;  1FGL A;  2RMB A;  2POY A;  1WOS A;  1AWV A;  4OIN A;  3TFI A;  1CWF A;  4A3F K;  4AH6 A;  1SMY A;  1TWH C;  2KWA A;  3K0Q A;  4C3I K;  3NUH A;  4A3D K;  4BBR K;  5JFE A;  5HL8 A;  2K7N A;  1USM A;  4LK0 A;  1WCM A;  1E3B A;  4Y52 K;  1IQ0 A;  3X27 A;  1NMK A;  3GSI A;  3GTO C;  4G7H A;  3S17 C;  1J6W A;  4LOW A;  4GZY A;  1X7F A;  3FKI C;  2NVQ K;  1ZQ1 C;  2E2J K;  4PAB A;  5IOS A;  1MF8 C;  4I9Y A;  4A3C C;  1SFO K;  2EBB A;  5IP7 C;  4YUK A;  1ZKC A;  4A3L C;  3GTM K;  1CYN A;  3HOZ K;  3CAG A;  4AYB L;  2HE9 A;  3HOU K;  2IGW A;  2JA6 A;  1ZX8 A;  1AK4 A;  2GW2 A;  3S2D C;  4G7O A;  2CMT A;  1IIP A;  3K0R A;  3GTO A;  2GSO A;  4BXX C;  2CFE A;  3ORE A;  1AWS A;  5KUU A;  4QJV B;  4OIR A;  2JA7 C;  1J6V A;  5IYD K;  1Y1V K;  3GTJ C;  1TWG C;  1L0W A;  4DGC A;  3O7T A;  3HOW C;  4KM8 A;  4ZSD A;  1Y1W C;  3HXA A;  2PHC B;  5KUS A;  2R93 C;  3M3Y K;  4X6A C;  1AWR A;  2ZFZ A;  2WLW A;  3G4C A;  4G7Z A;  1W8M A;  1CWL A;  5C44 K;  2O5I A;  4BY7 K;  2X2D B;  3K0O A;  3RZD C;  3GTK A;  1O27 A;  3BT8 A;  1TWC C;  1AWU A;  1VBS A;  1IE0 A;  4C2M K;  3GTG A;  3HOY C;  4YUH A;  1CWO A;  3G4A A;  1OCA A;  3S15 C;  1Y1W A;  5KUL A;  4GTC A;  2B63 C;  4C3H C;  4JJM A;  4N1M A;  4YUL A;  3ICH A;  3R54 A;  4BY1 C;  1I50 C;  3GTK K;  1WSR A;  4ZSC A;  4MEY A;  3HOX C;  3CQZ A;  1YNJ A;  4XNC A;  1VDN A;  2ESL A;  4HY7 A;  5C4X C;  4G0V A;  1DCH A;  1XPP A;  3H0G K;  1O25 A;  2B71 A;  4RMF A;  4Y7N C;  4BLB A;  2R7Z K;  1IW7 A;  5M3M K;  4KN4 A;  1QNG A;  1MZW A;  2V6U A;  5CHP A;  4OIO A;  2A6H A;  2WB1 L;  3RFY A;  4MEX A;  2X2C K;  2R99 A;  1VAI A;  4YUM A;  5IOT A;  5EGE A;  1WQF A;  4KMU A;  3H3V D;  2WAQ D;  4YUN A;  4A3E C;  1IS1 A;  4A3I K;  4GT9 A;  2CW0 A;  5M5X K;  5CCQ A;  3FOE A;  1SFO A;  3T00 A;  2VUM C;  3CYH A;  3RCL A;  1XZQ A;  1B4B A;  3ADA C;  3M4O K;  2NVT C;  1TWA C;  5KV3 A;  2CK1 A;  4BBS C;  1ZYR A;  2W7V A;  1TWH A;  1C5F A;  5CCN A;  4A3B K;  4WJ4 A;  2KA0 A;  3RCG A;  1TWH K;  1JQW A;  2RH6 A;  2ZUF A;  4J5D X;  4C3I C;  4Q5S A;  3S1M K;  2NVY C;  3ERE D;  4J5E X;  4FZB A;  1USO A;  1TWA A;  1JOE A;  2NVX C;  1Y1V A;  4OIP A;  2QER A;  3BO7 A;  4E1Q A;  2IGV A;  2BE5 A;  2JA8 C;  3RCI X;  3WOD A;  4FM9 A;  3R59 A;  4XLN A;  3GTQ A;  2RMC A;  1CWM A;  1H0P A;  4R3F A;  2Y3P A;  2E2J C;  1I6H K;  1TWF A;  1CWA A;  2R92 K;  4A3J C;  3MML A;  3SZY A;  3I4N C;  3K0P A;  1TWF K;  1M9C A;  1RMH A;  3K0M A;  1A33 A;  1UV7 A;  4C3J C;  5CBU A;  3GTP K;  5A0E A;  2ZUE A;  2WFJ A;  4KB2 A;  1O29 A;  2E2H C;  1HQM A;  2WFI A;  1WCM K;  1PJ6 A;  4BLA A;  4KAT A;  1BDF A;  4JCP A;  1YCL A;  2PMZ D;  3PMP A;  1W74 A;  2E2I C;  3GTQ C;  3S6M A;  1J2A A;  5KV2 A;  4YUP A;  2NVY A;  4C45 A;  3RZO K;  4EYV A;  1Y1V C;  5M5W K;  4A93 K;  3AH5 A;  1J98 A;  4KM9 A;  3S16 K;  1IBA A;  1I6V A;  3TFJ A;  4GTE A;  1XO7 A;  1TWC A;  3M3Y C;  4X6A K;  2A2N A;  1LOP A;  1HI9 A;  5M3F K;  1VGX A;  3S1N C;  1M9E A;  3FKI A;  4DGD A;  1B4A A;  1G51 A;  4O2D A;  1E8K A;  5IYB K;  1PJ7 A;  3PO3 C;  5FLM K;  4YFK A;  4A3G K;  2CFA A;  4Y52 C;  2VUM A;  3PO2 C;  5KV7 A;  3HOY K;  4QIW D;  3S1Q C;  5C3E K;  3QYU A;  1CWH A;  2RGR A;  3CYS A;  1M63 C;  2JA6 C;  1VLO A;  4A3M K;  4LLG A;  1EH1 A;  4DGB A;  2RS4 A;  5KV1 A;  5IP7 K;  1WOR A;  2GAG C;  1ZVU A;  3TTG A;  2BIT X;  3K0N A;  2R7Z A;  3HOX K;  2GAH C;  1XYH A;  3A8J A;  4QIW L;  5KV0 A;  2C3B A;  4KC6 A;  3GTL K;  5JVO A;  2HQJ A;  2MVZ A;  2JA7 K;  1MIK A;  4XSX A;  1ZBS A;  1V9T A;  1TWG K;  2X25 B;  5JHE A;  3S14 C;  4IPZ A;  3HKZ D;  1CWC A;  4R3E A;  4J59 A;  3ODL A;  2MS4 A;  2FQO A;  3K7A K;  4N1R A;  5KV4 A;  1EK8 A;  2NUL A;  1I3Q A;  4N1S A;  4YUG A;  3RZD K;  4XLP A;  1F93 A;  2CYH A;  4BKW A;  5C4J K;  4KAW X;  3L4K A;  1CLH A;  1F7V A;  5F66 A;  1O2F B;  1EI6 A;  3HOV C;  4DDQ A;  4BXX K;  3QX3 A;  5IYD C;  4A3K K;  4WJ3 M;  4A3D C;  1EFW A;  4BBR C;  1M9D A;  1WQG A;  3I4M K;  3S1R C;  4FRV A;  3RDA X;  3S2H K;  2O5J A;  4YFX A;  5CCS X;  4DGA A;  4PAA A;  2XCO A;  1M9Y A;  1IST A;  1O2B A;  3FKI K;  5KUO A;  3GIR A;  1O28 A;  2NVQ C;  5TJ3 A;  4N1O A;  4S1J A;  3H0G C;  2YU9 K;  2YU9 A;  1DD5 A;  2Y0S D;  2Z6W A;  1AB4 A;  2NVX K;  3GTJ A;  3GTO K;  4A3L K;  3L4J A;  2RMA A;  1BS2 A;  5IOQ A;  2JA8 K;  4O8I A;  3BKP A;  2XCQ A;  4YUO A;  3LPX A;  4GTA A;  2ALF A;  1AWQ A;  2B63 K;  4C3H K;  2JA5 A;  3ODI A;  3EQL A;  5CBV A;  5KUN A;  3N3Y A;  3H3V L;  5IP9 C;  4A3J K;  3S2D K;  4A3F C;  2CFA B;  1INN A;  1WIH A;  2R93 K;  2HQ6 A;  5C4X K;  4OIQ A;  3T01 A;  3ICI A;  4LQW A; 
#chains in the Genus database with same CATH homology
 2OJU A;  3RCK X;  1BCK A;  3RD9 X;  1YND A;  3RDB A;  4KMA A;  2XCR B;  5CCR A;  3R4G A;  3AQO A;  1F9N A;  2JA7 A;  4GFQ A;  4KMH A;  5KV6 A;  1A58 A;  4J58 A;  4ILD A;  3BUE A;  4G0U A;  1ZMF A;  3AQP A;  2JH3 A;  4J5A X;  5EGH A;  3GTP A;  3Q3Q A;  1CWB A;  5IOR A;  2E2H A;  1QOI A;  5KUW A;  2P5M A;  2E2I A;  3MML B;  2PLU A;  2ZP2 A;  4P5A A;  2GSN A;  4O8H A;  2OSE A;  1XWN A;  1W8L A;  4YUI A;  1I50 A;  1W8V A;  3K2C A;  2NVX A;  3R56 A;  5KUV A;  3LAP A;  2OK3 A;  5KUZ A;  1QNH A;  3EOV A;  1O24 A;  1CWJ A;  4G0W A;  2HAQ A;  2X2A A;  2XGY B;  2MC9 A;  3OEP A;  1TWG A;  1IHG A;  2BIU X;  1O2A A;  2GSU A;  4S1E A;  5KUQ A;  3FHZ A;  4KMD A;  5KV5 A;  4CYH A;  4C2M C;  1BGW A;  4GTF A;  4KAS A;  4GTD A;  3T1U A;  2X7K A;  1XQ7 A;  2FU0 A;  2B63 A;  3H0G A;  4J5B A;  3N0B A;  1M9F A;  5CBT A;  1R9T A;  4N1P A;  1ZKF A;  4LQY A;  1VBT A;  5KUR A;  2P0O A;  4J5C X;  3UCH A;  4LQW A;  3RDC A;  3R57 A;  1ISE A;  3VA7 A;  3N0C A;  1K83 A;  2X83 B;  1O26 A;  4M1X A;  3JB9 d;  4TOT A;  1CWK A;  1ZXO A;  4KDD A;  3R49 A;  3RCF A;  1AWT A;  4DGE A;  2N0T A;  4N1Q A;  4LR2 A;  1XXB A;  4J3N A;  1XXA A;  4KAR A;  4GTL A;  2CPL A;  2R92 A;  3OPF A;  4P5B A;  3V4G A;  4N1N A;  1XXC A;  4YUJ A;  5LUD A;  3S0X A;  1DYW A;  1M9X A;  3RDD A;  1WQH A;  3FOF A;  5DUD A;  1GE9 A;  1Z81 A;  3GTL A;  4FRU A;  2R93 A;  5CYH A;  3GTM A;  2POE A;  1CWI A;  3LAJ A;  1BJT A;  5CBW A;  4KB4 A;  4GTB A;  5CJ9 A;  2MZU A;  1KQ4 A;  1FGL A;  2RMB A;  2POY A;  1AWV A;  1CWF A;  2KWA A;  3K0Q A;  3NUH A;  5JFE A;  2K7N A;  1WCM A;  1E3B A;  1NMK A;  1X7F A;  5IOS A;  1MF8 C;  4I9Y A;  4YUK A;  1ZKC A;  1CYN A;  3CAG A;  2HE9 A;  2IGW A;  2JA6 A;  1AK4 A;  2GW2 A;  2CMT A;  1IIP A;  3K0R A;  3GTO A;  2GSO A;  2CFE A;  3ORE A;  1AWS A;  5KUU A;  4DGC A;  3O7T A;  4KM8 A;  4ZSD A;  2PHC B;  5KUS A;  1AWR A;  2ZFZ A;  2WLW A;  3G4C A;  1W8M A;  1CWL A;  2X2D B;  3K0O A;  3GTK A;  1O27 A;  3BT8 A;  1AWU A;  1VBS A;  3GTG A;  4YUH A;  1CWO A;  3G4A A;  1OCA A;  1Y1W A;  5KUL A;  4GTC A;  4C3H C;  4JJM A;  4N1M A;  4YUL A;  3ICH A;  3R54 A;  4ZSC A;  3CQZ A;  4XNC A;  1VDN A;  2ESL A;  4HY7 A;  4G0V A;  1O25 A;  2B71 A;  4BLB A;  1QNG A;  1MZW A;  5CHP A;  3RFY A;  2X2C K;  2R99 A;  1VAI A;  4YUM A;  5IOT A;  5EGE A;  1WQF A;  4YUN A;  1IS1 A;  4GT9 A;  5CCQ A;  3FOE A;  1SFO A;  3CYH A;  3RCL A;  1B4B A;  5KV3 A;  2CK1 A;  1TWH A;  1C5F A;  5CCN A;  3RCG A;  2RH6 A;  4J5D X;  4C3I C;  3ERE D;  4J5E X;  4FZB A;  1Y1V A;  2QER A;  3BO7 A;  4E1Q A;  2IGV A;  3RCI X;  4FM9 A;  3R59 A;  3GTQ A;  2RMC A;  1CWM A;  1H0P A;  4R3F A;  2Y3P A;  1TWF A;  1CWA A;  3MML A;  3K0P A;  1M9C A;  1RMH A;  3K0M A;  1A33 A;  4C3J C;  5CBU A;  5A0E A;  2WFJ A;  4KB2 A;  1O29 A;  2WFI A;  4BLA A;  4KAT A;  4JCP A;  3PMP A;  1W74 A;  3S6M A;  1J2A A;  5KV2 A;  4YUP A;  2NVY A;  4EYV A;  3AH5 A;  4KM9 A;  4GTE A;  1XO7 A;  1TWC A;  2A2N A;  1LOP A;  1M9E A;  3FKI A;  4DGD A;  1B4A A;  1E8K A;  2VUM A;  2CFA A;  5KV7 A;  3QYU A;  1CWH A;  2RGR A;  3CYS A;  1M63 C;  1EH1 A;  4DGB A;  2RS4 A;  5KV1 A;  1ZVU A;  2BIT X;  3K0N A;  2R7Z A;  1XYH A;  5KV0 A;  2C3B A;  4KC6 A;  5JVO A;  2HQJ A;  2MVZ A;  1MIK A;  1ZBS A;  1V9T A;  2X25 B;  5JHE A;  4IPZ A;  1CWC A;  4R3E A;  4J59 A;  3ODL A;  2MS4 A;  4N1R A;  5KV4 A;  1EK8 A;  2NUL A;  1I3Q A;  4N1S A;  4YUG A;  2CYH A;  4BKW A;  4KAW X;  3L4K A;  1CLH A;  5F66 A;  4DDQ A;  3QX3 A;  1M9D A;  1WQG A;  4FRV A;  3RDA X;  5CCS X;  4DGA A;  2XCO A;  1M9Y A;  1IST A;  1O2B A;  5KUO A;  1O28 A;  5TJ3 A;  4N1O A;  4S1J A;  2YU9 A;  1DD5 A;  2Z6W A;  1AB4 A;  3GTJ A;  3L4J A;  2RMA A;  5IOQ A;  4O8I A;  3BKP A;  2XCQ A;  4YUO A;  3LPX A;  4GTA A;  2ALF A;  1AWQ A;  2JA5 A;  3ODI A;  5CBV A;  5KUN A;  3N3Y A;  2CFA B;  1WIH A;  2HQ6 A;  3ICI A;  1TWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...