3OEPA

Crystal structure of ttha0988 in space group p43212
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
485
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
total genus 129
structure length 485
sequence length 492
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oepA01
1XO7A 2X83B 3LPXA 4KC6A 5CCNA 4CYHA 3O7TA 1ZKFA 2Z6WA 4DGBA 1EH1A 4S1EA 3RFYA 1ZVUA 3ICHA 5KV1A 4DGEA 1CWOA 3K0RA 3QYUA 5KV7A 5JVOA 3CAGA 2A2NA 2HE9A 3CYHA 2CYHA 1H0PA 5KV4A 3OREA 3K0MA 2CPLA 3NUHA 4YUMA 1E8KA 4TOTA 3S6MA 1M9YA 1BCKA 3T1UA 1NMKA 1YNDA 5CBTA 2R99A 1CYNA 2X2AA 2WLWA 1F9NA 2XCOA 1CWKA 3MMLA 1VBTA 3QX3A 3ODLA 2QERA 4YUIA 1CWAA 4JJMA 4YUPA 2C3BA 2X7KA 5KUUA 4KDDA 4N1RA 4KAWX 4J5CX 4J58A 1WQHA 1W8LA 5KV2A 4YUJA 3L4JA 1CWLA 1CWMA 3RDBA 1WQFA 3V4GA 5CCRA 2POEA 1WIHA 1C5FA 3RDCA 5CYHA 2RMBA 2MVZA 2IGWA 5KUQA 3ICIA 3R4GA 4R3FA 1M63C 3L4KA 3RDDA 2IGVA 1J2AA 1CWJA 1LOPA 4O8HA 4LQWA 1AWQA 2OSEA 3RDAX 4G0WA 3BKPA 1MF8C 5A0EA 3MMLB 4O8IA 5KULA 1XYHA 4YUNA 5LUDA 1V9TA 4YUGA 3K0OA 2HAQA 4DGCA 5KV5A 4N1PA 5JHEA 5KUOA 2XGYB 2WFJA 5KUZA 4ZSCA 4KB4A 2OK3A 2XCRB 5KV6A 2OJUA 4S1JA 2PLUA 4J59A 3VA7A 3OEPA 2K7NA 3RCKX 4FRVA 5CCQA 1AWUA 4XNCA 4DGDA 1AB4A 1XQ7A 4GFQA 4N1NA 2RGRA 2ALFA 1W8MA 1B4AA 3R56A 5CJ9A 4G0VA 3R49A 4IPZA 2Y3PA 1QNHA 2ZP2A 2RMCA 1ZMFA 1WQGA 1IIPA 1M9CA 3JB9d 5CBWA 4EYVA 1VAIA 2HQJA 2N0TA 1CWIA 1MZWA 3K0PA 2BIUX 5KV0A 4J5EX 5KUSA 2WFIA 4FRUA 1M9XA 3CYSA 2POYA 4FM9A 2XCQA 3RCIX 2P0OA 2MC9A 1IS1A 3R59A 1M9DA 1M9EA 2B71A 4JCPA 1DYWA 4J5AX 2HQ6A 4YULA 4DDQA 1OCAA 2MS4A 1ISEA 3RCFA 2KWAA 5DUDA 1MIKA 4G0UA 5KV3A 4N1OA 1DD5A 3R57A 1A58A 2RS4A 5CBUA 4E1QA 1W74A 1ZKCA 3UCHA 3K0NA 1CWFA 1Z81A 2P5MA 1XXBA 4ZSDA 2CFEA 1QOIA 1W8VA 1GE9A 1CWCA 3R54A 2ESLA 3BO7A 3BUEA 3ERED 1AWRA 4YUOA 3K2CA 4J5BA 2CK1A 1IHGA 1CLHA 2RMAA 1RMHA 3RCLA 5F66A 5KURA 3FOFA 2FU0A 5CCSX 4N1QA 2X25B 2CMTA 1X7FA 3FOEA 1XXCA 3BT8A 1ISTA 1XWNA 2PHCB 5CBVA 3OPFA 4HY7A 3PMPA 1E3BA 4YUHA 3ODIA 1A33A 1CWHA 3RCGA 4R3EA 2ZFZA 1AK4A 5KUNA 1FGLA 4KB2A 1VDNA 4N1MA 1EK8A 1CWBA 1XXAA 1AWTA 3K0QA 2X2DB 1VBSA 2BITX 5KUVA 1M9FA 4I9YA 3LAJA 4J3NA 4N1SA 1QNGA 3FHZA 3EOVA 1BJTA 2MZUA 3RD9X 2X2CK 4DGAA 2NULA 4YUKA 1B4BA 4J5DX 1AWSA 1BGWA 5KUWA 1AWVA 2GW2A 3LAPA
chains in the Genus database with same CATH superfamily
1XO7A 2PPBA 2X83B 3LPXA 1TWHA 4BKWA 4KC6A 1TWAA 4GTLA 3GTMK 5CCNA 3FKIA 1WCMK 4CYHA 5TMFA 3O7TA 1ZKFA 2Z6WA 4KN4A 5IYBK 4DGBA 5C4JK 3GTPC 3T01A 5IORA 2NVXC 2KA0A 1ZX8A 1EH1A 1R9TA 1WOSA 4S1EA 3RFYA 5TMCA 1ZVUA 4Y52C 3ICHA 5KV1A 2E2IA 4DGEA 3I4MC 1CWOA 3K0RA 3QYUA 4OIOA 4WJ3M 4G7HA 5KV7A 3Q3QA 2R93A 1YNJA 5JVOA 1O2AA 3CAGA 2A2NA 4A3IK 1TWHC 3TTGA 2NVYK 2HE9A 5IOQA 3CYHA 3HKZD 4C3IK 1TWAC 3A8JA 3FKIC 4XCHA 5IOTA 2CYHA 1H0PA 5KV4A 1R9TC 2CFAB 3S2HC 3S16C 2E2IC 3OREA 2R92A 4Q5SA 1TWFA 1I6HK 4MQ9A 2GAHC 4ZH4A 1VLOA 3K0MA 2CPLA 4KMUA 3NUHA 4X6AC 4YUMA 1E8KA 4TOTA 3S6MA 4GTDA 1M9YA 1BCKA 2VUMA 4Q4ZA 3T1UA 1NMKA 1TWCA 1YNDA 1WOPA 4QJVA 2B63K 4LJZA 3S1NK 1ZXOA 2NVTK 5CBTA 2R92C 2R99A 1CYNA 3S0XA 3S1QK 2X2AA 2WLWA 4KMHA 1F9NA 2XCOA 3SZZA 1CWKA 3MMLA 1VBTA 2R7ZA 3QX3A 3ODLA 2QERA 2WAQD 2VUMC 4YUIA 1CWAA 1IL2A 4A3BC 4JJMA 4YUPA 1TWCC 4XSXA 1Y1WA 4A3GC 1UV7A 2CW0A 2C3BA 5M5XK 2X7KA 4QIWL 5KUUA 4OIPA 5IYDC 4KDDA 3K7AK 4N1RA 4A3EK 4KAWX 2GSNA 5C3EC 4J5CX 1L0WA 2YU9A 5IYCC 3S2DC 2JA8C 4J58A 1WQHA 2PA8D 4KMAA 4PABA 1W8LA 3LAPA 1BS2A 5KV2A 4YUJA 4KM9A 3L4JA 1CWLA 1CWMA 3TFHA 1Y1WC 3A8IA 4GTAA 3HOUC 3RDBA 5M5YK 3PO2K 1WQFA 5IP7K 3JSTA 4C3HC 3V4GA 5EGHA 2E2HA 5CCRA 2POEA 4LR2A 2CFAA 1WIHA 1C5FA 5E68A 5FLMK 4BBRC 4A3DC 5FJ8K 3RDCA 3HKZL 4Y7NK 5HL8A 4WILA 5CYHA 1DCPA 2V6SA 3GEEA 1SFOA 4OINA 3HOYC 2RMBA 2E2JC 1JOEA 1I3QK 1BDFA 3AQPA 4LK0A 4A3KK 2MVZA 2IGWA 5KUQA 3ICIA 5M3MK 3AH5A 3EQLA 2JA6A 4A3CC 1JQWA 3R4GA 3HOWK 1O26A 3HOXC 4R3FA 4M1XA 1SFOC 1M63C 4BY7C 3L4KA 4QJVB 3RDDA 4BXXK 2IGVA 1K83C 1J2AA 3S14K 5L46A 4BBSK 2P8TA 1CWJA 1LOPA 4O8HA 4LQWA 1AWQA 2OSEA 3RDAX 3AQOA 1TWGK 1I50A 3BKPA 4G0WA 4A3FK 1MF8C 2JA6C 5JFEA 5A0EA 3MMLB 2WAQL 4O8IA 5KULA 1XYHA 4YUNA 5LUDA 1J6WA 4JK1A 3RZDK 4PAAA 3I4NC 3AD9C 3H3VD 1RU0A 1V9TA 4YUGA 3M3YC 1ZYRA 3K0OA 1C0AA 2NVQC 2HAQA 4DGCA 2NVXK 4BY1C 5KV5A 4N1PA 5JHEA 1JVIA 3GTMA 1I50C 3S1RK 3HOZK 4Y52K 5KUOA 2XGYB 2WFJA 5KUZA 1J6VA 3I4MK 5CHPA 5C44C 4ZSCA 3CQZA 4KB4A 2OK3A 3DXJA 5KV6A 3HXAA 2XCRB 1IE0A 2OJUA 4AH6A 4S1JA 2EBBA 2PLUA 2NVYA 1INNA 4J59A 3GTMC 3HOVC 3VA7A 2RH6A 3S2HK 4GT9A 5C4JC 3OEPA 2K7NA 4AYBD 3RCKX 1HI9A 4FRVA 5CCQA 1F93A 3CQZC 2PMZD 2R93C 1AWUA 4XNCA 3S17K 4DGDA 3GTGK 3RZOK 4A3IC 4KM8A 1ZBSA 1I6VA 2NVYC 3GTQK 2A69A 1AB4A 5D4DA 4P9SA 4KARA 4A3MK 1IQ0A 1XQ7A 4GFQA 2B63A 5EGEA 1TWFC 2A6HA 4N1NA 2JA7K 2RGRA 1DCHA 2ALFA 1W8MA 1B4AA 3R56A 5CJ9A 1I6HC 4G0VA 2VUMK 3WODA 3A8KA 3R49A 4IPZA 1TWCK 2Y3PA 1O24A 1QNHA 2ZP2A 2RMCA 1ZMFA 3GSIA 4C45A 1IW7A 4GZYA 4GTFA 1WQGA 3GTLA 2B63C 1IIPA 5IYDK 3S1NC 2NVTC 2WB1D 3S1MK 3H3VL 3PO3K 1O29A 2R7ZC 1M9CA 5M3FK 3S1QC 3JB9d 4C3JK 4BLBA 5CBWA 1XZPA 3H0GK 2A68A 4EYVA 1VAIA 4XSZA 2JA5K 2HQJA 2N0TA 3HOUK 1CWIA 4KMDA 1MZWA 1VRQC 2O5IA 3K0PA 5C4XK 2FQOA 3GTLC 4OIRA 4A3DK 2BIUX 5KV0A 4O2DA 1EI6A 2YU9C 4J5EX 3K7AC 4A3EC 1VGXA 4A3LK 3G4AA 1PJ6A 5KUSA 2WFIA 3GTOK 1PJ7A 4NOIA 4C2MK 1IBAA 4FRUA 2E2HC 1J6XA 4KATA 3SZYA 4YFXA 1M9XA 3CYSA 3PO2C 1I3QA 3ADAC 5IP7C 3GTJK 2POYA 4FM9A 2XCQA 1EQRA 4A93K 3RCIX 3X27A 2P0OA 2MC9A 5FLMC 3HOXK 1IS1A 3M4OC 3T02A 3AD8C 3R59A 1XZQA 1M9DA 4Y7NC 1SFOK 1M9EA 4A3JK 2GAGC 1WSRA 2B71A 1K83K 4JCPA 1Y1VK 1DYWA 4J5AX 5IP9K 2NVQK 2HQ6A 3AD7C 1I3QC 4YULA 4BLAA 4DDQA 4A3KC 4YG2A 3GTKK 1O25A 3T00A 1F7VA 1OCAA 2MS4A 1ISEA 1TWGA 4G7OA 3RCFA 3I4NK 2KWAA 3IPJA 4FZBA 5DUDA 1MIKA 3M3YK 4G0UA 5KV3A 3GTPK 4N1OA 3TFJA 4BXXC 1DD5A 4RMFA 3S14C 3R57A 1WCMA 4BBSC 4XLNA 3S15C 1A58A 2PA8L 1KQ4A 2RS4A 5CBUA 1TWGC 4E1QA 4A3FC 1W74A 2BE5A 1XZPB 1ZKCA 1O2BA 1TWHK 2ZUEA 3UCHA 4KN7A 1TWAK 3FKIK 3K0NA 3RZDC 1CWFA 3HOVK 1Z81A 1R9TK 2GSUA 2P5MA 3N3YA 1XXBA 1WCMC 4ZSDA 2CFEA 5IYBC 3S16K 1X31C 2E2IK 3S1RC 3HOZC 3CQZK 2R93K 1QOIA 1EFWA 4X6AK 4P5BA 4ILDA 1VH2A 1W8VA 2V6TA 2Y0SD 1GE9A 1CWCA 3R54A 4GTCA 4C3IC 4G7ZA 3GIRA 3GTGA 1DCOA 2ESLA 3BO7A 4YFNA 3GTQA 2R92K 1TWFK 3N0CA 2W7VA 3BUEA 1AWRA 4YUOA 3K2CA 4J5BA 2CK1A 1YX2A 3ERED 1IHGA 1CLHA 2RMAA 1XZQB 1RMHA 4A3BK 1V5VA 3KOPA 2JA7A 3S17C 3GTGC 3RZOC 4OIQA 4A3GK 2D6FC 3RCLA 5F66A 1VJEA 5KURA 3GTQC 4LOWA 1O2FB 3FOFA 2FU0A 1HQMA 4A3MC 4LLGA 5CCSX 5C3EK 2R7ZK 5IYCK 5M5WK 3S2DK 2V6UA 2JA8K 4N1QA 2JH3A 2JA7C 1WORA 1Y1WK 3H0GA 2X25B 1ZQ1C 3GEIA 4P5AA 1J98A 1PJ5A 2JA5A 4C3HK 2CMTA 3GTLK 1X7FA 2O5JA 3FOEA 1WSVA 1XXCA 4BBRK 3BT8A 1ISTA 2YU9K 1XWNA 2PHCB 1G51A 5CBVA 3OPFA 4HY7A 3PMPA 3BP3A 1E3BA 3S1MC 4YUHA 3ODIA 3PO3C 1A33A 1CWHA 3RCGA 3HOYK 4C3JC 3H0GC 2E2JK 3GDZA 2FQTA 4R3EA 5TJ3A 4AYBL 2ZFZA 2E2HK 2JA5C 1AK4A 5KUNA 4LQYA 1FGLA 1F7UA 4KB2A 3GTOA 1VDNA 4N1MA 2PMZL 1SMYA 5C4XC 1EK8A 1CWBA 4A3CK 1XXAA 2Y0SL 4LK1A 3M4OK 1AWTA 4KASA 2GSOA 3GTJA 3K0QA 2X2DB 2ZUFA 4MEXA 1VBSA 4BY7K 4A3LC 1YCLA 2BITX 4YFKA 3N0BA 5KUVA 3GTOC 1M9FA 4I9YA 1K83A 4C2MC 4WJ4A 2JA6K 1Y1VA 5IOSA 3LAJA 4J3NA 4N1SA 1O28A 4XLPA 1USMA 1XPPA 2NNZA 1O27A 4MEYA 3GTJC 4A93C 3GTKA 1QNGA 3HOWC 3FHZA 3EOVA 1BJTA 1WOOA 2MZUA 3RD9X 2X2CK 4DGAA 4A3JC 3G4CA 4BY1K 4GTBA 2NULA 4YUKA 1B4BA 1I50K 2WB1L 3GTPA 1Y1VC 3GEHA 3S15K 2NVXA 5IP9C 1USOA 2A6EA 4GTEA 3BP8C 3TFIA 5C44K 4J5DX 1AWSA 1BGWA 5KUWA 1AWVA 1YNNA 3GTKC 2GW2A 4QIWD
chains in the Genus database with same CATH topology
1XO7A 2X83B 3LPXA 1TWHA 4BKWA 4KC6A 1TWAA 4GTLA 5CCNA 3FKIA 4CYHA 3O7TA 1ZKFA 2Z6WA 4DGBA 5IORA 1EH1A 1R9TA 4S1EA 3RFYA 1ZVUA 3ICHA 5KV1A 2E2IA 4DGEA 1CWOA 3K0RA 3QYUA 5KV7A 3Q3QA 2R93A 5JVOA 1O2AA 3CAGA 2A2NA 5IOQA 2HE9A 3CYHA 5IOTA 2CYHA 1H0PA 5KV4A 2CFAB 3OREA 2R92A 1TWFA 3K0MA 2CPLA 3NUHA 4YUMA 1E8KA 4TOTA 3S6MA 4GTDA 1M9YA 1BCKA 2VUMA 3T1UA 1NMKA 1TWCA 1YNDA 1ZXOA 5CBTA 2R99A 1CYNA 3S0XA 2X2AA 2WLWA 4KMHA 1F9NA 2XCOA 1CWKA 3MMLA 1VBTA 2R7ZA 3QX3A 3ODLA 2QERA 4YUIA 1CWAA 4JJMA 4YUPA 1Y1WA 2C3BA 2X7KA 5KUUA 4KDDA 4N1RA 4KAWX 2GSNA 4J5CX 2YU9A 4J58A 1WQHA 4KMAA 1W8LA 5KV2A 4YUJA 4KM9A 3L4JA 1CWLA 1CWMA 4GTAA 3RDBA 1WQFA 2E2HA 4C3HC 3V4GA 5EGHA 5CCRA 2POEA 4LR2A 2CFAA 1WIHA 1C5FA 3RDCA 5CYHA 1SFOA 2RMBA 3AQPA 2MVZA 2IGWA 5KUQA 3ICIA 3AH5A 2JA6A 3R4GA 1O26A 4R3FA 4M1XA 1M63C 3L4KA 3RDDA 2IGVA 1J2AA 1CWJA 1LOPA 4O8HA 4LQWA 1AWQA 2OSEA 3RDAX 3AQOA 1I50A 4G0WA 3BKPA 1MF8C 5JFEA 5A0EA 3MMLB 4O8IA 5KULA 1XYHA 4YUNA 5LUDA 1V9TA 4YUGA 3K0OA 2HAQA 4DGCA 5KV5A 4N1PA 5JHEA 3GTMA 5KUOA 2XGYB 2WFJA 5KUZA 5CHPA 4ZSCA 3CQZA 4KB4A 2OK3A 2XCRB 5KV6A 2OJUA 4S1JA 2NVYA 2PLUA 4J59A 3VA7A 2RH6A 4GT9A 3OEPA 2K7NA 3RCKX 4FRVA 5CCQA 1AWUA 4XNCA 4DGDA 4KM8A 1ZBSA 1AB4A 4KARA 1XQ7A 4GFQA 2B63A 5EGEA 4N1NA 2RGRA 2ALFA 1W8MA 1B4AA 3R56A 5CJ9A 4G0VA 3R49A 4IPZA 2Y3PA 1O24A 1QNHA 2ZP2A 2RMCA 1ZMFA 4GTFA 1WQGA 3GTLA 1IIPA 1O29A 1M9CA 3JB9d 4BLBA 5CBWA 4EYVA 1VAIA 2HQJA 2N0TA 1CWIA 4KMDA 1MZWA 3K0PA 2BIUX 5KV0A 4J5EX 3G4AA 5KUSA 2WFIA 4FRUA 4KATA 1M9XA 3CYSA 1I3QA 2POYA 4FM9A 2XCQA 3RCIX 2P0OA 2MC9A 1IS1A 3R59A 1M9DA 1M9EA 2B71A 4JCPA 1DYWA 4J5AX 2HQ6A 4YULA 4BLAA 4DDQA 1O25A 1OCAA 2MS4A 1TWGA 1ISEA 3RCFA 2KWAA 4FZBA 5DUDA 1MIKA 4G0UA 5KV3A 4N1OA 1DD5A 3R57A 1WCMA 1A58A 1KQ4A 2RS4A 5CBUA 4E1QA 1W74A 1ZKCA 1O2BA 3UCHA 3K0NA 1CWFA 1Z81A 2GSUA 2P5MA 3N3YA 1XXBA 4ZSDA 2CFEA 1QOIA 4P5BA 4ILDA 1W8VA 1GE9A 1CWCA 3R54A 4GTCA 4C3IC 3GTGA 2ESLA 3BO7A 3GTQA 3N0CA 3BUEA 3ERED 1AWRA 4YUOA 3K2CA 4J5BA 2CK1A 1IHGA 1CLHA 2RMAA 1RMHA 2JA7A 3RCLA 5F66A 5KURA 3FOFA 2FU0A 5CCSX 4N1QA 2JH3A 3H0GA 2X25B 4P5AA 2JA5A 2CMTA 1X7FA 3FOEA 1XXCA 3BT8A 1ISTA 1XWNA 2PHCB 5CBVA 3OPFA 4HY7A 3PMPA 1E3BA 4YUHA 3ODIA 1A33A 1CWHA 3RCGA 4C3JC 4R3EA 5TJ3A 2ZFZA 1AK4A 5KUNA 4LQYA 1FGLA 4KB2A 3GTOA 1VDNA 4N1MA 1EK8A 1CWBA 1XXAA 1AWTA 4KASA 2GSOA 3GTJA 3K0QA 2X2DB 1VBSA 2BITX 3N0BA 5KUVA 1M9FA 4I9YA 1K83A 4C2MC 1Y1VA 5IOSA 3LAJA 4J3NA 4N1SA 1O28A 1O27A 3GTKA 1QNGA 3FHZA 3EOVA 1BJTA 2MZUA 3RD9X 2X2CK 4DGAA 3G4CA 4GTBA 2NULA 4YUKA 1B4BA 3GTPA 2NVXA 4GTEA 4J5DX 1AWSA 1BGWA 5KUWA 1AWVA 2GW2A 3LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO7 A;  2X83 B;  3LPX A;  4KC6 A;  5CCN A;  4CYH A;  3O7T A;  1ZKF A;  2Z6W A;  4DGB A;  1EH1 A;  4S1E A;  3RFY A;  1ZVU A;  3ICH A;  5KV1 A;  4DGE A;  1CWO A;  3K0R A;  3QYU A;  5KV7 A;  5JVO A;  3CAG A;  2A2N A;  2HE9 A;  3CYH A;  2CYH A;  1H0P A;  5KV4 A;  3ORE A;  3K0M A;  2CPL A;  3NUH A;  4YUM A;  1E8K A;  4TOT A;  3S6M A;  1M9Y A;  1BCK A;  3T1U A;  1NMK A;  1YND A;  5CBT A;  2R99 A;  1CYN A;  2X2A A;  2WLW A;  1F9N A;  2XCO A;  1CWK A;  3MML A;  1VBT A;  3QX3 A;  3ODL A;  2QER A;  4YUI A;  1CWA A;  4JJM A;  4YUP A;  2C3B A;  2X7K A;  5KUU A;  4KDD A;  4N1R A;  4KAW X;  4J5C X;  4J58 A;  1WQH A;  1W8L A;  5KV2 A;  4YUJ A;  3L4J A;  1CWL A;  1CWM A;  3RDB A;  1WQF A;  3V4G A;  5CCR A;  2POE A;  1WIH A;  1C5F A;  3RDC A;  5CYH A;  2RMB A;  2MVZ A;  2IGW A;  5KUQ A;  3ICI A;  3R4G A;  4R3F A;  1M63 C;  3L4K A;  3RDD A;  2IGV A;  1J2A A;  1CWJ A;  1LOP A;  4O8H A;  4LQW A;  1AWQ A;  2OSE A;  3RDA X;  4G0W A;  3BKP A;  1MF8 C;  5A0E A;  3MML B;  4O8I A;  5KUL A;  1XYH A;  4YUN A;  5LUD A;  1V9T A;  4YUG A;  3K0O A;  2HAQ A;  4DGC A;  5KV5 A;  4N1P A;  5JHE A;  5KUO A;  2XGY B;  2WFJ A;  5KUZ A;  4ZSC A;  4KB4 A;  2OK3 A;  2XCR B;  5KV6 A;  2OJU A;  4S1J A;  2PLU A;  4J59 A;  3VA7 A;  3OEP A;  2K7N A;  3RCK X;  4FRV A;  5CCQ A;  1AWU A;  4XNC A;  4DGD A;  1AB4 A;  1XQ7 A;  4GFQ A;  4N1N A;  2RGR A;  2ALF A;  1W8M A;  1B4A A;  3R56 A;  5CJ9 A;  4G0V A;  3R49 A;  4IPZ A;  2Y3P A;  1QNH A;  2ZP2 A;  2RMC A;  1ZMF A;  1WQG A;  1IIP A;  1M9C A;  3JB9 d;  5CBW A;  4EYV A;  1VAI A;  2HQJ A;  2N0T A;  1CWI A;  1MZW A;  3K0P A;  2BIU X;  5KV0 A;  4J5E X;  5KUS A;  2WFI A;  4FRU A;  1M9X A;  3CYS A;  2POY A;  4FM9 A;  2XCQ A;  3RCI X;  2P0O A;  2MC9 A;  1IS1 A;  3R59 A;  1M9D A;  1M9E A;  2B71 A;  4JCP A;  1DYW A;  4J5A X;  2HQ6 A;  4YUL A;  4DDQ A;  1OCA A;  2MS4 A;  1ISE A;  3RCF A;  2KWA A;  5DUD A;  1MIK A;  4G0U A;  5KV3 A;  4N1O A;  1DD5 A;  3R57 A;  1A58 A;  2RS4 A;  5CBU A;  4E1Q A;  1W74 A;  1ZKC A;  3UCH A;  3K0N A;  1CWF A;  1Z81 A;  2P5M A;  1XXB A;  4ZSD A;  2CFE A;  1QOI A;  1W8V A;  1GE9 A;  1CWC A;  3R54 A;  2ESL A;  3BO7 A;  3BUE A;  3ERE D;  1AWR A;  4YUO A;  3K2C A;  4J5B A;  2CK1 A;  1IHG A;  1CLH A;  2RMA A;  1RMH A;  3RCL A;  5F66 A;  5KUR A;  3FOF A;  2FU0 A;  5CCS X;  4N1Q A;  2X25 B;  2CMT A;  1X7F A;  3FOE A;  1XXC A;  3BT8 A;  1IST A;  1XWN A;  2PHC B;  5CBV A;  3OPF A;  4HY7 A;  3PMP A;  1E3B A;  4YUH A;  3ODI A;  1A33 A;  1CWH A;  3RCG A;  4R3E A;  2ZFZ A;  1AK4 A;  5KUN A;  1FGL A;  4KB2 A;  1VDN A;  4N1M A;  1EK8 A;  1CWB A;  1XXA A;  1AWT A;  3K0Q A;  2X2D B;  1VBS A;  2BIT X;  5KUV A;  1M9F A;  4I9Y A;  3LAJ A;  4J3N A;  4N1S A;  1QNG A;  3FHZ A;  3EOV A;  1BJT A;  2MZU A;  3RD9 X;  2X2C K;  4DGA A;  2NUL A;  4YUK A;  1B4B A;  4J5D X;  1AWS A;  1BGW A;  5KUW A;  1AWV A;  2GW2 A;  3LAP A; 
#chains in the Genus database with same CATH topology
 1XO7 A;  2PPB A;  2X83 B;  3LPX A;  1TWH A;  4BKW A;  4KC6 A;  1TWA A;  4GTL A;  3GTM K;  5CCN A;  3FKI A;  1WCM K;  4CYH A;  5TMF A;  3O7T A;  1ZKF A;  2Z6W A;  4KN4 A;  5IYB K;  4DGB A;  5C4J K;  3GTP C;  3T01 A;  5IOR A;  2NVX C;  2KA0 A;  1ZX8 A;  1EH1 A;  1R9T A;  1WOS A;  4S1E A;  3RFY A;  5TMC A;  1ZVU A;  4Y52 C;  3ICH A;  5KV1 A;  2E2I A;  4DGE A;  3I4M C;  1CWO A;  3K0R A;  3QYU A;  4OIO A;  4WJ3 M;  4G7H A;  5KV7 A;  3Q3Q A;  2R93 A;  1YNJ A;  5JVO A;  1O2A A;  3CAG A;  2A2N A;  4A3I K;  1TWH C;  3TTG A;  2NVY K;  2HE9 A;  5IOQ A;  3CYH A;  3HKZ D;  4C3I K;  1TWA C;  3A8J A;  3FKI C;  4XCH A;  5IOT A;  2CYH A;  1H0P A;  5KV4 A;  1R9T C;  2CFA B;  3S2H C;  3S16 C;  2E2I C;  3ORE A;  2R92 A;  4Q5S A;  1TWF A;  1I6H K;  4MQ9 A;  2GAH C;  4ZH4 A;  1VLO A;  3K0M A;  2CPL A;  4KMU A;  3NUH A;  4X6A C;  4YUM A;  1E8K A;  4TOT A;  3S6M A;  4GTD A;  1M9Y A;  1BCK A;  2VUM A;  4Q4Z A;  3T1U A;  1NMK A;  1TWC A;  1YND A;  1WOP A;  4QJV A;  2B63 K;  4LJZ A;  3S1N K;  1ZXO A;  2NVT K;  5CBT A;  2R92 C;  2R99 A;  1CYN A;  3S0X A;  3S1Q K;  2X2A A;  2WLW A;  4KMH A;  1F9N A;  2XCO A;  3SZZ A;  1CWK A;  3MML A;  1VBT A;  2R7Z A;  3QX3 A;  3ODL A;  2QER A;  2WAQ D;  2VUM C;  4YUI A;  1CWA A;  1IL2 A;  4A3B C;  4JJM A;  4YUP A;  1TWC C;  4XSX A;  1Y1W A;  4A3G C;  1UV7 A;  2CW0 A;  2C3B A;  5M5X K;  2X7K A;  4QIW L;  5KUU A;  4OIP A;  5IYD C;  4KDD A;  3K7A K;  4N1R A;  4A3E K;  4KAW X;  2GSN A;  5C3E C;  4J5C X;  1L0W A;  2YU9 A;  5IYC C;  3S2D C;  2JA8 C;  4J58 A;  1WQH A;  2PA8 D;  4KMA A;  4PAB A;  1W8L A;  3LAP A;  1BS2 A;  5KV2 A;  4YUJ A;  4KM9 A;  3L4J A;  1CWL A;  1CWM A;  3TFH A;  1Y1W C;  3A8I A;  4GTA A;  3HOU C;  3RDB A;  5M5Y K;  3PO2 K;  1WQF A;  5IP7 K;  3JST A;  4C3H C;  3V4G A;  5EGH A;  2E2H A;  5CCR A;  2POE A;  4LR2 A;  2CFA A;  1WIH A;  1C5F A;  5E68 A;  5FLM K;  4BBR C;  4A3D C;  5FJ8 K;  3RDC A;  3HKZ L;  4Y7N K;  5HL8 A;  4WIL A;  5CYH A;  1DCP A;  2V6S A;  3GEE A;  1SFO A;  4OIN A;  3HOY C;  2RMB A;  2E2J C;  1JOE A;  1I3Q K;  1BDF A;  3AQP A;  4LK0 A;  4A3K K;  2MVZ A;  2IGW A;  5KUQ A;  3ICI A;  5M3M K;  3AH5 A;  3EQL A;  2JA6 A;  4A3C C;  1JQW A;  3R4G A;  3HOW K;  1O26 A;  3HOX C;  4R3F A;  4M1X A;  1SFO C;  1M63 C;  4BY7 C;  3L4K A;  4QJV B;  3RDD A;  4BXX K;  2IGV A;  1K83 C;  1J2A A;  3S14 K;  5L46 A;  4BBS K;  2P8T A;  1CWJ A;  1LOP A;  4O8H A;  4LQW A;  1AWQ A;  2OSE A;  3RDA X;  3AQO A;  1TWG K;  1I50 A;  3BKP A;  4G0W A;  4A3F K;  1MF8 C;  2JA6 C;  5JFE A;  5A0E A;  3MML B;  2WAQ L;  4O8I A;  5KUL A;  1XYH A;  4YUN A;  5LUD A;  1J6W A;  4JK1 A;  3RZD K;  4PAA A;  3I4N C;  3AD9 C;  3H3V D;  1RU0 A;  1V9T A;  4YUG A;  3M3Y C;  1ZYR A;  3K0O A;  1C0A A;  2NVQ C;  2HAQ A;  4DGC A;  2NVX K;  4BY1 C;  5KV5 A;  4N1P A;  5JHE A;  1JVI A;  3GTM A;  1I50 C;  3S1R K;  3HOZ K;  4Y52 K;  5KUO A;  2XGY B;  2WFJ A;  5KUZ A;  1J6V A;  3I4M K;  5CHP A;  5C44 C;  4ZSC A;  3CQZ A;  4KB4 A;  2OK3 A;  3DXJ A;  5KV6 A;  3HXA A;  2XCR B;  1IE0 A;  2OJU A;  4AH6 A;  4S1J A;  2EBB A;  2PLU A;  2NVY A;  1INN A;  4J59 A;  3GTM C;  3HOV C;  3VA7 A;  2RH6 A;  3S2H K;  4GT9 A;  5C4J C;  3OEP A;  2K7N A;  4AYB D;  3RCK X;  1HI9 A;  4FRV A;  5CCQ A;  1F93 A;  3CQZ C;  2PMZ D;  2R93 C;  1AWU A;  4XNC A;  3S17 K;  4DGD A;  3GTG K;  3RZO K;  4A3I C;  4KM8 A;  1ZBS A;  1I6V A;  2NVY C;  3GTQ K;  2A69 A;  1AB4 A;  5D4D A;  4P9S A;  4KAR A;  4A3M K;  1IQ0 A;  1XQ7 A;  4GFQ A;  2B63 A;  5EGE A;  1TWF C;  2A6H A;  4N1N A;  2JA7 K;  2RGR A;  1DCH A;  2ALF A;  1W8M A;  1B4A A;  3R56 A;  5CJ9 A;  1I6H C;  4G0V A;  2VUM K;  3WOD A;  3A8K A;  3R49 A;  4IPZ A;  1TWC K;  2Y3P A;  1O24 A;  1QNH A;  2ZP2 A;  2RMC A;  1ZMF A;  3GSI A;  4C45 A;  1IW7 A;  4GZY A;  4GTF A;  1WQG A;  3GTL A;  2B63 C;  1IIP A;  5IYD K;  3S1N C;  2NVT C;  2WB1 D;  3S1M K;  3H3V L;  3PO3 K;  1O29 A;  2R7Z C;  1M9C A;  5M3F K;  3S1Q C;  3JB9 d;  4C3J K;  4BLB A;  5CBW A;  1XZP A;  3H0G K;  2A68 A;  4EYV A;  1VAI A;  4XSZ A;  2JA5 K;  2HQJ A;  2N0T A;  3HOU K;  1CWI A;  4KMD A;  1MZW A;  1VRQ C;  2O5I A;  3K0P A;  5C4X K;  2FQO A;  3GTL C;  4OIR A;  4A3D K;  2BIU X;  5KV0 A;  4O2D A;  1EI6 A;  2YU9 C;  4J5E X;  3K7A C;  4A3E C;  1VGX A;  4A3L K;  3G4A A;  1PJ6 A;  5KUS A;  2WFI A;  3GTO K;  1PJ7 A;  4NOI A;  4C2M K;  1IBA A;  4FRU A;  2E2H C;  1J6X A;  4KAT A;  3SZY A;  4YFX A;  1M9X A;  3CYS A;  3PO2 C;  1I3Q A;  3ADA C;  5IP7 C;  3GTJ K;  2POY A;  4FM9 A;  2XCQ A;  1EQR A;  4A93 K;  3RCI X;  3X27 A;  2P0O A;  2MC9 A;  5FLM C;  3HOX K;  1IS1 A;  3M4O C;  3T02 A;  3AD8 C;  3R59 A;  1XZQ A;  1M9D A;  4Y7N C;  1SFO K;  1M9E A;  4A3J K;  2GAG C;  1WSR A;  2B71 A;  1K83 K;  4JCP A;  1Y1V K;  1DYW A;  4J5A X;  5IP9 K;  2NVQ K;  2HQ6 A;  3AD7 C;  1I3Q C;  4YUL A;  4BLA A;  4DDQ A;  4A3K C;  4YG2 A;  3GTK K;  1O25 A;  3T00 A;  1F7V A;  1OCA A;  2MS4 A;  1ISE A;  1TWG A;  4G7O A;  3RCF A;  3I4N K;  2KWA A;  3IPJ A;  4FZB A;  5DUD A;  1MIK A;  3M3Y K;  4G0U A;  5KV3 A;  3GTP K;  4N1O A;  3TFJ A;  4BXX C;  1DD5 A;  4RMF A;  3S14 C;  3R57 A;  1WCM A;  4BBS C;  4XLN A;  3S15 C;  1A58 A;  2PA8 L;  1KQ4 A;  2RS4 A;  5CBU A;  1TWG C;  4E1Q A;  4A3F C;  1W74 A;  2BE5 A;  1XZP B;  1ZKC A;  1O2B A;  1TWH K;  2ZUE A;  3UCH A;  4KN7 A;  1TWA K;  3FKI K;  3K0N A;  3RZD C;  1CWF A;  3HOV K;  1Z81 A;  1R9T K;  2GSU A;  2P5M A;  3N3Y A;  1XXB A;  1WCM C;  4ZSD A;  2CFE A;  5IYB C;  3S16 K;  1X31 C;  2E2I K;  3S1R C;  3HOZ C;  3CQZ K;  2R93 K;  1QOI A;  1EFW A;  4X6A K;  4P5B A;  4ILD A;  1VH2 A;  1W8V A;  2V6T A;  2Y0S D;  1GE9 A;  1CWC A;  3R54 A;  4GTC A;  4C3I C;  4G7Z A;  3GIR A;  3GTG A;  1DCO A;  2ESL A;  3BO7 A;  4YFN A;  3GTQ A;  2R92 K;  1TWF K;  3N0C A;  2W7V A;  3BUE A;  1AWR A;  4YUO A;  3K2C A;  4J5B A;  2CK1 A;  1YX2 A;  3ERE D;  1IHG A;  1CLH A;  2RMA A;  1XZQ B;  1RMH A;  4A3B K;  1V5V A;  3KOP A;  2JA7 A;  3S17 C;  3GTG C;  3RZO C;  4OIQ A;  4A3G K;  2D6F C;  3RCL A;  5F66 A;  1VJE A;  5KUR A;  3GTQ C;  4LOW A;  1O2F B;  3FOF A;  2FU0 A;  1HQM A;  4A3M C;  4LLG A;  5CCS X;  5C3E K;  2R7Z K;  5IYC K;  5M5W K;  3S2D K;  2V6U A;  2JA8 K;  4N1Q A;  2JH3 A;  2JA7 C;  1WOR A;  1Y1W K;  3H0G A;  2X25 B;  1ZQ1 C;  3GEI A;  4P5A A;  1J98 A;  1PJ5 A;  2JA5 A;  4C3H K;  2CMT A;  3GTL K;  1X7F A;  2O5J A;  3FOE A;  1WSV A;  1XXC A;  4BBR K;  3BT8 A;  1IST A;  2YU9 K;  1XWN A;  2PHC B;  1G51 A;  5CBV A;  3OPF A;  4HY7 A;  3PMP A;  3BP3 A;  1E3B A;  3S1M C;  4YUH A;  3ODI A;  3PO3 C;  1A33 A;  1CWH A;  3RCG A;  3HOY K;  4C3J C;  3H0G C;  2E2J K;  3GDZ A;  2FQT A;  4R3E A;  5TJ3 A;  4AYB L;  2ZFZ A;  2E2H K;  2JA5 C;  1AK4 A;  5KUN A;  4LQY A;  1FGL A;  1F7U A;  4KB2 A;  3GTO A;  1VDN A;  4N1M A;  2PMZ L;  1SMY A;  5C4X C;  1EK8 A;  1CWB A;  4A3C K;  1XXA A;  2Y0S L;  4LK1 A;  3M4O K;  1AWT A;  4KAS A;  2GSO A;  3GTJ A;  3K0Q A;  2X2D B;  2ZUF A;  4MEX A;  1VBS A;  4BY7 K;  4A3L C;  1YCL A;  2BIT X;  4YFK A;  3N0B A;  5KUV A;  3GTO C;  1M9F A;  4I9Y A;  1K83 A;  4C2M C;  4WJ4 A;  2JA6 K;  1Y1V A;  5IOS A;  3LAJ A;  4J3N A;  4N1S A;  1O28 A;  4XLP A;  1USM A;  1XPP A;  2NNZ A;  1O27 A;  4MEY A;  3GTJ C;  4A93 C;  3GTK A;  1QNG A;  3HOW C;  3FHZ A;  3EOV A;  1BJT A;  1WOO A;  2MZU A;  3RD9 X;  2X2C K;  4DGA A;  4A3J C;  3G4C A;  4BY1 K;  4GTB A;  2NUL A;  4YUK A;  1B4B A;  1I50 K;  2WB1 L;  3GTP A;  1Y1V C;  3GEH A;  3S15 K;  2NVX A;  5IP9 C;  1USO A;  2A6E A;  4GTE A;  3BP8 C;  3TFI A;  5C44 K;  4J5D X;  1AWS A;  1BGW A;  5KUW A;  1AWV A;  1YNN A;  3GTK C;  2GW2 A;  4QIW D; 
#chains in the Genus database with same CATH homology
 1XO7 A;  2X83 B;  3LPX A;  1TWH A;  4BKW A;  4KC6 A;  1TWA A;  4GTL A;  5CCN A;  3FKI A;  4CYH A;  3O7T A;  1ZKF A;  2Z6W A;  4DGB A;  5IOR A;  1EH1 A;  1R9T A;  4S1E A;  3RFY A;  1ZVU A;  3ICH A;  5KV1 A;  2E2I A;  4DGE A;  1CWO A;  3K0R A;  3QYU A;  5KV7 A;  3Q3Q A;  2R93 A;  5JVO A;  1O2A A;  3CAG A;  2A2N A;  5IOQ A;  2HE9 A;  3CYH A;  5IOT A;  2CYH A;  1H0P A;  5KV4 A;  2CFA B;  3ORE A;  2R92 A;  1TWF A;  3K0M A;  2CPL A;  3NUH A;  4YUM A;  1E8K A;  4TOT A;  3S6M A;  4GTD A;  1M9Y A;  1BCK A;  2VUM A;  3T1U A;  1NMK A;  1TWC A;  1YND A;  1ZXO A;  5CBT A;  2R99 A;  1CYN A;  3S0X A;  2X2A A;  2WLW A;  4KMH A;  1F9N A;  2XCO A;  1CWK A;  3MML A;  1VBT A;  2R7Z A;  3QX3 A;  3ODL A;  2QER A;  4YUI A;  1CWA A;  4JJM A;  4YUP A;  1Y1W A;  2C3B A;  2X7K A;  5KUU A;  4KDD A;  4N1R A;  4KAW X;  2GSN A;  4J5C X;  2YU9 A;  4J58 A;  1WQH A;  4KMA A;  1W8L A;  5KV2 A;  4YUJ A;  4KM9 A;  3L4J A;  1CWL A;  1CWM A;  4GTA A;  3RDB A;  1WQF A;  2E2H A;  4C3H C;  3V4G A;  5EGH A;  5CCR A;  2POE A;  4LR2 A;  2CFA A;  1WIH A;  1C5F A;  3RDC A;  5CYH A;  1SFO A;  2RMB A;  3AQP A;  2MVZ A;  2IGW A;  5KUQ A;  3ICI A;  3AH5 A;  2JA6 A;  3R4G A;  1O26 A;  4R3F A;  4M1X A;  1M63 C;  3L4K A;  3RDD A;  2IGV A;  1J2A A;  1CWJ A;  1LOP A;  4O8H A;  4LQW A;  1AWQ A;  2OSE A;  3RDA X;  3AQO A;  1I50 A;  4G0W A;  3BKP A;  1MF8 C;  5JFE A;  5A0E A;  3MML B;  4O8I A;  5KUL A;  1XYH A;  4YUN A;  5LUD A;  1V9T A;  4YUG A;  3K0O A;  2HAQ A;  4DGC A;  5KV5 A;  4N1P A;  5JHE A;  3GTM A;  5KUO A;  2XGY B;  2WFJ A;  5KUZ A;  5CHP A;  4ZSC A;  3CQZ A;  4KB4 A;  2OK3 A;  2XCR B;  5KV6 A;  2OJU A;  4S1J A;  2NVY A;  2PLU A;  4J59 A;  3VA7 A;  2RH6 A;  4GT9 A;  3OEP A;  2K7N A;  3RCK X;  4FRV A;  5CCQ A;  1AWU A;  4XNC A;  4DGD A;  4KM8 A;  1ZBS A;  1AB4 A;  4KAR A;  1XQ7 A;  4GFQ A;  2B63 A;  5EGE A;  4N1N A;  2RGR A;  2ALF A;  1W8M A;  1B4A A;  3R56 A;  5CJ9 A;  4G0V A;  3R49 A;  4IPZ A;  2Y3P A;  1O24 A;  1QNH A;  2ZP2 A;  2RMC A;  1ZMF A;  4GTF A;  1WQG A;  3GTL A;  1IIP A;  1O29 A;  1M9C A;  3JB9 d;  4BLB A;  5CBW A;  4EYV A;  1VAI A;  2HQJ A;  2N0T A;  1CWI A;  4KMD A;  1MZW A;  3K0P A;  2BIU X;  5KV0 A;  4J5E X;  3G4A A;  5KUS A;  2WFI A;  4FRU A;  4KAT A;  1M9X A;  3CYS A;  1I3Q A;  2POY A;  4FM9 A;  2XCQ A;  3RCI X;  2P0O A;  2MC9 A;  1IS1 A;  3R59 A;  1M9D A;  1M9E A;  2B71 A;  4JCP A;  1DYW A;  4J5A X;  2HQ6 A;  4YUL A;  4BLA A;  4DDQ A;  1O25 A;  1OCA A;  2MS4 A;  1TWG A;  1ISE A;  3RCF A;  2KWA A;  4FZB A;  5DUD A;  1MIK A;  4G0U A;  5KV3 A;  4N1O A;  1DD5 A;  3R57 A;  1WCM A;  1A58 A;  1KQ4 A;  2RS4 A;  5CBU A;  4E1Q A;  1W74 A;  1ZKC A;  1O2B A;  3UCH A;  3K0N A;  1CWF A;  1Z81 A;  2GSU A;  2P5M A;  3N3Y A;  1XXB A;  4ZSD A;  2CFE A;  1QOI A;  4P5B A;  4ILD A;  1W8V A;  1GE9 A;  1CWC A;  3R54 A;  4GTC A;  4C3I C;  3GTG A;  2ESL A;  3BO7 A;  3GTQ A;  3N0C A;  3BUE A;  3ERE D;  1AWR A;  4YUO A;  3K2C A;  4J5B A;  2CK1 A;  1IHG A;  1CLH A;  2RMA A;  1RMH A;  2JA7 A;  3RCL A;  5F66 A;  5KUR A;  3FOF A;  2FU0 A;  5CCS X;  4N1Q A;  2JH3 A;  3H0G A;  2X25 B;  4P5A A;  2JA5 A;  2CMT A;  1X7F A;  3FOE A;  1XXC A;  3BT8 A;  1IST A;  1XWN A;  2PHC B;  5CBV A;  3OPF A;  4HY7 A;  3PMP A;  1E3B A;  4YUH A;  3ODI A;  1A33 A;  1CWH A;  3RCG A;  4C3J C;  4R3E A;  5TJ3 A;  2ZFZ A;  1AK4 A;  5KUN A;  4LQY A;  1FGL A;  4KB2 A;  3GTO A;  1VDN A;  4N1M A;  1EK8 A;  1CWB A;  1XXA A;  1AWT A;  4KAS A;  2GSO A;  3GTJ A;  3K0Q A;  2X2D B;  1VBS A;  2BIT X;  3N0B A;  5KUV A;  1M9F A;  4I9Y A;  1K83 A;  4C2M C;  1Y1V A;  5IOS A;  3LAJ A;  4J3N A;  4N1S A;  1O28 A;  1O27 A;  3GTK A;  1QNG A;  3FHZ A;  3EOV A;  1BJT A;  2MZU A;  3RD9 X;  2X2C K;  4DGA A;  3G4C A;  4GTB A;  2NUL A;  4YUK A;  1B4B A;  3GTP A;  2NVX A;  4GTE A;  4J5D X;  1AWS A;  1BGW A;  5KUW A;  1AWV A;  2GW2 A;  3LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...