3OEPA

Crystal structure of ttha0988 in space group p43212
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
485
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 129
structure length 485
sequence length 492
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oepA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oepA01
2HE9A 1A33A 4N1PA 3O7TA 4CYHA 2XCOA 2N0TA 1QNGA 1MZWA 2MS4A 1WQHA 1CWHA 4S1JA 4J59A 4J5AX 3EOVA 3BT8A 4J3NA 2GW2A 2OK3A 1XQ7A 4TOTA 1B4AA 4I9YA 4N1QA 4FM9A 4HY7A 3K0QA 3R54A 5F66A 3ICHA 3RDCA 4DGDA 5CBTA 3JB9d 2OSEA 1XXAA 3K0PA 3NUHA 2NULA 3RCGA 2CPLA 1E8KA 4YUPA 4J5EX 1AWRA 3ICIA 4J5CX 5KV2A 2ZFZA 1AWTA 1AWSA 1ZKCA 5CBVA 1AWUA 2ZP2A 3MMLB 5KV5A 1B4BA 3V4GA 5KUOA 3CYHA 3K0MA 1M9XA 3CYSA 1XYHA 1CWOA 3RCKX 2IGWA 2Z6WA 3L4JA 1W8VA 3FOFA 1CWIA 1M9EA 3OEPA 4J5BA 3RCIX 2R99A 4KDDA 2HQ6A 2POEA 1CWCA 4YUHA 1WQFA 5DUDA 1XXBA 1CWKA 3K0OA 1VBTA 4FRVA 1YNDA 3RCFA 2X2CK 1MF8C 1X7FA 3RD9X 2A2NA 1W8MA 5KUQA 5CCRA 5KUWA 1M9FA 1ZVUA 1M9YA 2FU0A 2HAQA 3ERED 1XXCA 3OREA 4J5DX 1CLHA 2CMTA 2RS4A 1AK4A 1ZKFA 1IS1A 1CWMA 1CWAA 1M63C 5JHEA 5CJ9A 4DDQA 1VDNA 5KUSA 1AWQA 2OJUA 2PLUA 4S1EA 1QOIA 3LPXA 4GFQA 4KC6A 2X83B 1IIPA 4ZSDA 4KB2A 2X2AA 5KV6A 1GE9A 2ALFA 1WIHA 2CFEA 1MIKA 2K7NA 5KV1A 3LAPA 3FOEA 1M9CA 5CCNA 4XNCA 3BO7A 4DGBA 3R4GA 2BIUX 5CCSX 2WFJA 1M9DA 1EH1A 3CAGA 2RGRA 3RDAX 4JCPA 1V9TA 4YULA 2MVZA 5CYHA 1VBSA 3RCLA 3UCHA 4N1SA 1LOPA 3S6MA 4YUIA 2XCQA 5JVOA 4ZSCA 1BCKA 2CK1A 2RMCA 4FRUA 2B71A 4R3FA 3RDDA 3VA7A 2X2DB 3ODIA 4N1OA 5KV3A 4DGCA 2P5MA 4E1QA 1F9NA 3RDBA 1WQGA 2POYA 2WFIA 1W74A 1A58A 3BKPA 4YUMA 1AWVA 2RMAA 1ISEA 3FHZA 2X25B 4G0WA 1H0PA 5CCQA 2IGVA 3R59A 1CWFA 1QNHA 4YUNA 5KUZA 1XO7A 4YUKA 1EK8A 3L4KA 1DYWA 1CWBA 4KAWX 1ZMFA 2XGYB 4DGAA 5KUVA 5CBUA 5KV4A 3R56A 3K0NA 4O8IA 3K0RA 1FGLA 2RMBA 4EYVA 4YUOA 2Y3PA 2XCRB 4YUGA 4R3EA 1OCAA 2CYHA 4J58A 1XWNA 2HQJA 2QERA 3BUEA 1C5FA 3PMPA 4N1MA 2KWAA 1BGWA 1DD5A 1Z81A 5KV0A 1J2AA 5KULA 1VAIA 1RMHA 5KV7A 2MZUA 3OPFA 1E3BA 2ESLA 3R49A 5KUNA 3LAJA 3QX3A 2PHCB 4G0VA 5KUUA 4YUJA 4LQWA 3R57A 1CWJA 4O8HA 4KB4A 4G0UA 1W8LA 2C3BA 4N1NA 5LUDA 4IPZA 3RFYA 5CBWA 2WLWA 4N1RA 5KURA 4DGEA 4JJMA 1NMKA 1CWLA 2X7KA 3MMLA 2MC9A 1BJTA 3QYUA 3K2CA 5A0EA 1ISTA 3T1UA 1AB4A 2BITX 3ODLA 2P0OA 1CYNA 1IHGA
chains in the Genus database with same CATH superfamily
3KOPA 1A33A 4N1PA 2N0TA 1MZWA 2MS4A 1Y1VA 4J59A 4GTDA 1SFOK 4A3LK 3BT8A 2GW2A 1XQ7A 1B4AA 3R54A 5CBTA 2OSEA 1XXAA 1KQ4A 5C44K 3BP8C 4J5EX 1AWRA 3ICIA 4J5CX 3S1NC 1O2AA 5CHPA 1AWSA 1WCMA 5KV5A 3V4GA 3S2DK 1TWGA 4A3BC 1J98A 3RCKX 1Y1WC 1Y1WA 3L4JA 1CWIA 1I3QK 2GSNA 4KM9A 1O24A 1TWFK 4BBSC 3A8KA 2V6UA 4KARA 1JOEA 3DXJA 4C3IK 1R9TA 4FRVA 3RCFA 1YNDA 1WCMK 1ZVUA 1X7FA 3BP3A 3FOFA 5KUQA 3HXAA 3S0XA 4QIWL 3FKIA 3GEEA 2RS4A 1M63C 1CWAA 4RMFA 4DDQA 2JA8K 1J6WA 2PPBA 4S1EA 4GTEA 3LPXA 4BLBA 1F7UA 1J6VA 3GIRA 4KMDA 3AQOA 3X27A 4BXXK 3S14K 1DCOA 3T00A 5CCSX 1K83K 2WFJA 1EH1A 1VH2A 3CAGA 2RGRA 3RDAX 4YULA 2JA5K 5M3MK 5CYHA 1VBSA 3UCHA 4N1SA 4GTBA 4P5BA 4XSXA 3GTQK 4XCHA 3RZOK 5FLMC 3GTQA 4FRUA 1HQMA 3S1QK 2X2DB 3ODIA 3AD7C 2CFAB 5KV3A 4A3KC 2A69A 4QJVB 3GTMC 4E1QA 1F9NA 3RDBA 3M4OK 4YUMA 1W74A 3BKPA 4A3EK 4G0WA 5CCQA 1I50K 3S1RK 2WB1L 1YNJA 1CWFA 1XO7A 3H0GA 2GSOA 4AH6A 2NVXC 1DYWA 4G7ZA 3H0GK 5KUVA 5KV4A 4O8IA 4EYVA 2CYHA 4J58A 4YFKA 2R7ZC 3BUEA 3GTKC 4QIWD 4N1MA 2KWAA 1DD5A 2JA6A 4P9SA 1RU0A 2MZUA 1L0WA 1E3BA 2ESLA 1IW7A 3PO2C 3GTGA 3R49A 5KUNA 3N0CA 3LAJA 1EQRA 4G7OA 2PMZD 3TFIA 1W8LA 4N1NA 5LUDA 1IBAA 1J6XA 1XPPA 4YFNA 1TWGK 1WOOA 4DGEA 1ZX8A 4JJMA 2V6TA 3HOZK 3QYUA 3ADAC 3K2CA 3S16C 3PO3K 3GTLC 1CYNA 2R7ZK 4LK0A 1IHGA 4JK1A 5HL8A 5C4XK 3H0GC 3O7TA 5M5YK 4A3FK 1WSVA 1ZQ1C 1QNGA 4MEYA 3CQZA 2GAGC 1CWHA 4J5AX 3RZDC 3HOWK 4I9YA 4N1QA 3RDCA 1TWGC 2NVTC 5TJ3A 4OIPA 2A6HA 3K0PA 3N3YA 3GTPK 2PA8D 2NVYK 4A3GC 2ZFZA 1I3QA 4YG2A 1VRQC 1BDFA 3SZYA 4WILA 1ZKCA 5CBVA 4BXXC 5M5XK 3GTGK 4A3GK 1XYHA 1K83C 5EGEA 4LR2A 4AYBL 2O5IA 4NOIA 1M9EA 5E68A 4A3BK 5M5WK 4J5BA 4A3JC 5IP9C 4KDDA 2W7VA 4A3IC 2HQ6A 2Y0SD 2E2IC 2POEA 4C2MC 1TWCC 1TWCA 4A3JK 4A3FC 3S15C 5TMFA 1I6VA 3FKIC 3RD9X 1MF8C 2CW0A 4LQYA 5CCRA 1M9FA 1M9YA 2FU0A 4QJVA 3S1MC 3OREA 1PJ6A 2CMTA 3GTGC 1O26A 2E2JC 4Y7NC 3G4AA 2VUMA 4KC6A 1O27A 1IIPA 4MQ9A 2ALFA 3FOEA 2CFEA 1MIKA 2K7NA 4GTFA 4A3DC 5CCNA 3GTQC 4WJ4A 3S2HK 2KA0A 4ZH4A 1VJEA 1Y1WK 4KMHA 4PABA 3K7AK 3TFHA 3HOVC 4YUIA 2JA5C 1WOPA 3A8JA 3RDDA 2CK1A 2RMCA 3VA7A 4Y52K 4N1OA 2NVXA 4DGCA 2P5MA 2WB1D 2POYA 2WFIA 3FHZA 1A58A 4G0UA 2X25B 3WODA 1H0PA 1UV7A 4FZBA 4M1XA 5IYBC 4YUNA 4MEXA 4C3JC 5KUZA 5IYCK 2JA8C 3L4KA 1CWBA 5C4XC 1R9TK 1YCLA 3GDZA 5CBUA 3K0NA 3K0RA 4PAAA 2XCRB 4YUGA 4R3EA 1TWHC 1XWNA 2R92C 1C5FA 3HOUK 1TWHK 4GTCA 1Z81A 1DCPA 2WAQD 5IOSA 1RMHA 5IP7K 2JA6K 4KB4A 3R57A 2JA7C 4O8HA 5IYCC 3GTLA 2P8TA 1BS2A 3HKZL 4N1RA 1R9TC 1NMKA 3N0BA 3T1UA 2P0OA 2PHCB 4C3HC 2ZUEA 1USMA 3PO3C 2O5JA 1I50A 1SFOC 3S16K 5D4DA 4GZYA 2XCOA 2JA6C 3EOVA 2NVYC 4TOTA 3K0QA 5F66A 1XZPA 4KATA 3RCGA 1E8KA 3RZDK 4Q5SA 2GAHC 3S2DC 5KV2A 2V6SA 2NVTK 2ZP2A 2EBBA 1Y1VC 5IYDK 3K0MA 3CYSA 3TFJA 1CWOA 1O2FB 2IGWA 2Z6WA 4C2MK 2E2IK 3FKIK 3RCIX 1HI9A 2R99A 1F93A 4LOWA 3S15K 1WQFA 4YUHA 4OIQA 5DUDA 1XXBA 1CWKA 3K0OA 5FJ8K 1CLHA 2X2CK 1W8MA 3HKZD 2HAQA 2ZUFA 1IE0A 1XXCA 4XSZA 3AD8C 1AK4A 1ZKFA 2A68A 1CWMA 3H3VD 2OJUA 1TWAA 4GT9A 3I4MK 4ILDA 1PJ7A 4Y7NK 3GTMA 5KV6A 3T02A 1WIHA 5KV1A 3LAPA 1YX2A 4Q4ZA 4XNCA 3BO7A 5IYBK 4DGBA 4BY1C 1IQ0A 1XZQA 3GEHA 3GTJC 3IPJA 4JCPA 4LLGA 4GTLA 3I4NK 2R93A 2R93C 3RCLA 1LOPA 3A8IA 4O2DA 5JVOA 4KM8A 5IP9K 2JA7A 1BCKA 4R3FA 2B71A 1TWCK 2D6FC 1SFOA 4C45A 1WORA 1WQGA 5FLMK 1ISEA 2VUMC 2RMAA 3CQZC 5IOTA 4Y52C 2IGVA 4BLAA 1O2BA 4BY1K 1WOSA 4YUKA 1TWAK 4KAWX 2JH3A 1ZMFA 3K7AC 1WSRA 3HOUC 4A3DK 2RMBA 3S2HC 2QERA 3AD9C 3PMPA 3GTJA 5KV0A 1J2AA 5KULA 1VAIA 5KV7A 3OPFA 3QX3A 4G0VA 5KUUA 4LQWA 1O28A 3GEIA 2E2HA 1Y1VK 2B63A 1EI6A 3RFYA 5CBWA 5KURA 2NVQC 1X31C 4YFXA 3GTLK 3M4OC 5TMCA 4A3EC 1CWLA 2X7KA 2MC9A 1SMYA 3S1RC 1O29A 3HOZC 2BITX 3ODLA 4S1JA 4A3IK 3T01A 1F7VA 2HE9A 2YU9C 4CYHA 1ZBSA 2YU9A 3PO2K 3GTPA 1WQHA 2JA5A 3HOWC 2R92A 5C44C 4J3NA 2OK3A 4FM9A 4HY7A 4DGDA 3NUHA 3ICHA 3JB9d 3JSTA 1JQWA 2NULA 4A3LC 2CPLA 4YUPA 5C3EK 3Q3QA 5C4JK 1YNNA 2E2IA 2JA7K 1AWTA 4XLPA 4C3HK 1AWUA 3MMLB 1B4BA 2NVQK 5KUOA 3CYHA 5C3EC 1M9XA 5IYDC 2RH6A 4P5AA 2Y0SL 1W8VA 3OEPA 4KMUA 4OINA 1JVIA 1WCMC 4LJZA 1I3QC 2FQTA 2FQOA 1CWCA 1ZYRA 1TWFA 1TWFC 5L46A 2YU9K 1ZXOA 2A6EA 4BBSK 1VBTA 4A3MC 5KUWA 3AQPA 2A2NA 1USOA 3ERED 4KN4A 2NVYA 5IOQA 4J5DX 1INNA 4BKWA 4A3MK 1IS1A 5CJ9A 5JHEA 1K83A 3S1MK 1VDNA 5KUSA 1AWQA 3S14C 2PLUA 1QOIA 4GFQA 3TTGA 2X83B 4ZSDA 4KB2A 5JFEA 5C4JC 2X2AA 4G7HA 3S1NK 1GE9A 3CQZK 4BBRK 1M9CA 3EQLA 4KASA 3SZZA 3R4GA 2BIUX 2R93K 1M9DA 5M3FK 2NVXK 3GTKA 1V9TA 2MVZA 3GTJK 3S6MA 4KN7A 3AH5A 2XCQA 4ZSCA 2BE5A 2WAQL 3RZOC 4A93K 2R92K 4C3IC 1I50C 3HOVK 4GTAA 4X6AK 3I4MC 5IORA 3S1QC 1G51A 4A93C 2PMZL 2PA8L 1TWAC 1AWVA 4LK1A 3GTOC 1VGXA 4A3KK 4X6AC 3R59A 1QNHA 3HOXK 4WJ3M 1DCHA 2E2JK 1EK8A 5EGHA 2VUMK 1I6HC 1V5VA 2XGYB 4DGAA 3GTKK 4C3JK 2E2HK 1O25A 1XZQB 3R56A 4BBRC 2B63K 1FGLA 4YUOA 2Y3PA 3M3YC 1OCAA 4KMAA 1EFWA 1IL2A 2HQJA 4OIOA 3S17C 2E2HC 2B63C 2GSUA 1BGWA 3HOYC 4A3CC 3I4NC 4XLNA 2R7ZA 3M3YK 3HOYK 1VLOA 2CFAA 3S17K 4A3CK 1XZPB 3HOXC 3GSIA 4YUJA 4OIRA 1CWJA 5IP7C 3H3VL 1I6HK 2C3BA 4IPZA 3GTMK 2WLWA 1TWHA 2NNZA 4AYBD 1PJ5A 3GTOK 3MMLA 4BY7K 1C0AA 1BJTA 3GTPC 5A0EA 1ISTA 1AB4A 3GTOA 3G4CA 4BY7C
chains in the Genus database with same CATH topology
1A33A 4N1PA 2N0TA 1MZWA 2MS4A 1Y1VA 4J59A 4GTDA 3BT8A 2GW2A 1XQ7A 1B4AA 3R54A 5CBTA 2OSEA 1XXAA 1KQ4A 4J5EX 1AWRA 3ICIA 4J5CX 1O2AA 5CHPA 1AWSA 1WCMA 5KV5A 3V4GA 1TWGA 3RCKX 1Y1WA 3L4JA 1CWIA 2GSNA 4KM9A 1O24A 4KARA 1R9TA 4FRVA 3RCFA 1YNDA 1ZVUA 1X7FA 3FOFA 5KUQA 3S0XA 3FKIA 2RS4A 1M63C 1CWAA 4DDQA 4S1EA 4GTEA 3LPXA 4BLBA 4KMDA 3AQOA 5CCSX 2WFJA 1EH1A 3CAGA 2RGRA 3RDAX 4YULA 5CYHA 1VBSA 3UCHA 4N1SA 4GTBA 4P5BA 3GTQA 4FRUA 2X2DB 3ODIA 2CFAB 5KV3A 4E1QA 1F9NA 3RDBA 4YUMA 1W74A 3BKPA 4G0WA 5CCQA 1CWFA 1XO7A 3H0GA 2GSOA 1DYWA 5KUVA 5KV4A 4O8IA 4EYVA 2CYHA 4J58A 3BUEA 4N1MA 2KWAA 1DD5A 2JA6A 2MZUA 1E3BA 2ESLA 3GTGA 3R49A 5KUNA 3N0CA 3LAJA 1W8LA 4N1NA 5LUDA 4DGEA 4JJMA 3QYUA 3K2CA 1CYNA 1IHGA 3O7TA 1QNGA 3CQZA 1CWHA 4J5AX 4I9YA 4N1QA 3RDCA 5TJ3A 3K0PA 3N3YA 2ZFZA 1I3QA 1ZKCA 5CBVA 1XYHA 5EGEA 4LR2A 1M9EA 4J5BA 4KDDA 2HQ6A 2POEA 4C2MC 1TWCA 3RD9X 1MF8C 4LQYA 5CCRA 1M9FA 1M9YA 2FU0A 3OREA 2CMTA 1O26A 3G4AA 2VUMA 4KC6A 1O27A 1IIPA 2ALFA 3FOEA 2CFEA 1MIKA 2K7NA 4GTFA 5CCNA 4KMHA 4YUIA 3RDDA 2CK1A 2RMCA 3VA7A 4N1OA 2NVXA 4DGCA 2P5MA 2POYA 2WFIA 3FHZA 1A58A 4G0UA 2X25B 1H0PA 4FZBA 4M1XA 4YUNA 4C3JC 5KUZA 3L4KA 1CWBA 5CBUA 3K0NA 3K0RA 2XCRB 4YUGA 4R3EA 1XWNA 1C5FA 4GTCA 1Z81A 5IOSA 1RMHA 4KB4A 3R57A 4O8HA 3GTLA 4N1RA 1NMKA 3N0BA 3T1UA 2P0OA 2PHCB 4C3HC 1I50A 2XCOA 3EOVA 4TOTA 3K0QA 5F66A 4KATA 3RCGA 1E8KA 5KV2A 2ZP2A 3K0MA 3CYSA 1CWOA 2IGWA 2Z6WA 3RCIX 2R99A 1WQFA 4YUHA 5DUDA 1XXBA 1CWKA 3K0OA 1CLHA 2X2CK 1W8MA 2HAQA 1XXCA 1AK4A 1ZKFA 1CWMA 2OJUA 1TWAA 4GT9A 4ILDA 3GTMA 5KV6A 1WIHA 5KV1A 3LAPA 4XNCA 3BO7A 4DGBA 4JCPA 4GTLA 2R93A 3RCLA 1LOPA 5JVOA 4KM8A 2JA7A 1BCKA 4R3FA 2B71A 1SFOA 1WQGA 1ISEA 2RMAA 5IOTA 2IGVA 4BLAA 1O2BA 4YUKA 4KAWX 2JH3A 1ZMFA 2RMBA 2QERA 3PMPA 3GTJA 5KV0A 1J2AA 5KULA 1VAIA 5KV7A 3OPFA 3QX3A 4G0VA 5KUUA 4LQWA 1O28A 2E2HA 2B63A 3RFYA 5CBWA 5KURA 1CWLA 2X7KA 2MC9A 1O29A 2BITX 3ODLA 4S1JA 2HE9A 4CYHA 1ZBSA 2YU9A 3GTPA 1WQHA 2JA5A 2R92A 4J3NA 2OK3A 4FM9A 4HY7A 4DGDA 3NUHA 3ICHA 3JB9d 2NULA 2CPLA 4YUPA 3Q3QA 2E2IA 1AWTA 1AWUA 3MMLB 1B4BA 5KUOA 3CYHA 1M9XA 2RH6A 4P5AA 1W8VA 3OEPA 1CWCA 1TWFA 1ZXOA 1VBTA 5KUWA 3AQPA 2A2NA 3ERED 2NVYA 5IOQA 4J5DX 4BKWA 1IS1A 5CJ9A 5JHEA 1K83A 1VDNA 5KUSA 1AWQA 2PLUA 1QOIA 4GFQA 2X83B 4ZSDA 4KB2A 5JFEA 2X2AA 1GE9A 1M9CA 4KASA 3R4GA 2BIUX 1M9DA 3GTKA 1V9TA 2MVZA 3S6MA 3AH5A 2XCQA 4ZSCA 4C3IC 4GTAA 5IORA 1AWVA 3R59A 1QNHA 1EK8A 5EGHA 2XGYB 4DGAA 1O25A 3R56A 1FGLA 4YUOA 2Y3PA 1OCAA 4KMAA 2HQJA 2GSUA 1BGWA 2R7ZA 2CFAA 4YUJA 1CWJA 2C3BA 4IPZA 2WLWA 1TWHA 3MMLA 1BJTA 5A0EA 1ISTA 1AB4A 3GTOA 3G4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE9 A;  1A33 A;  4N1P A;  3O7T A;  4CYH A;  2XCO A;  2N0T A;  1QNG A;  1MZW A;  2MS4 A;  1WQH A;  1CWH A;  4S1J A;  4J59 A;  4J5A X;  3EOV A;  3BT8 A;  4J3N A;  2GW2 A;  2OK3 A;  1XQ7 A;  4TOT A;  1B4A A;  4I9Y A;  4N1Q A;  4FM9 A;  4HY7 A;  3K0Q A;  3R54 A;  5F66 A;  3ICH A;  3RDC A;  4DGD A;  5CBT A;  3JB9 d;  2OSE A;  1XXA A;  3K0P A;  3NUH A;  2NUL A;  3RCG A;  2CPL A;  1E8K A;  4YUP A;  4J5E X;  1AWR A;  3ICI A;  4J5C X;  5KV2 A;  2ZFZ A;  1AWT A;  1AWS A;  1ZKC A;  5CBV A;  1AWU A;  2ZP2 A;  3MML B;  5KV5 A;  1B4B A;  3V4G A;  5KUO A;  3CYH A;  3K0M A;  1M9X A;  3CYS A;  1XYH A;  1CWO A;  3RCK X;  2IGW A;  2Z6W A;  3L4J A;  1W8V A;  3FOF A;  1CWI A;  1M9E A;  3OEP A;  4J5B A;  3RCI X;  2R99 A;  4KDD A;  2HQ6 A;  2POE A;  1CWC A;  4YUH A;  1WQF A;  5DUD A;  1XXB A;  1CWK A;  3K0O A;  1VBT A;  4FRV A;  1YND A;  3RCF A;  2X2C K;  1MF8 C;  1X7F A;  3RD9 X;  2A2N A;  1W8M A;  5KUQ A;  5CCR A;  5KUW A;  1M9F A;  1ZVU A;  1M9Y A;  2FU0 A;  2HAQ A;  3ERE D;  1XXC A;  3ORE A;  4J5D X;  1CLH A;  2CMT A;  2RS4 A;  1AK4 A;  1ZKF A;  1IS1 A;  1CWM A;  1CWA A;  1M63 C;  5JHE A;  5CJ9 A;  4DDQ A;  1VDN A;  5KUS A;  1AWQ A;  2OJU A;  2PLU A;  4S1E A;  1QOI A;  3LPX A;  4GFQ A;  4KC6 A;  2X83 B;  1IIP A;  4ZSD A;  4KB2 A;  2X2A A;  5KV6 A;  1GE9 A;  2ALF A;  1WIH A;  2CFE A;  1MIK A;  2K7N A;  5KV1 A;  3LAP A;  3FOE A;  1M9C A;  5CCN A;  4XNC A;  3BO7 A;  4DGB A;  3R4G A;  2BIU X;  5CCS X;  2WFJ A;  1M9D A;  1EH1 A;  3CAG A;  2RGR A;  3RDA X;  4JCP A;  1V9T A;  4YUL A;  2MVZ A;  5CYH A;  1VBS A;  3RCL A;  3UCH A;  4N1S A;  1LOP A;  3S6M A;  4YUI A;  2XCQ A;  5JVO A;  4ZSC A;  1BCK A;  2CK1 A;  2RMC A;  4FRU A;  2B71 A;  4R3F A;  3RDD A;  3VA7 A;  2X2D B;  3ODI A;  4N1O A;  5KV3 A;  4DGC A;  2P5M A;  4E1Q A;  1F9N A;  3RDB A;  1WQG A;  2POY A;  2WFI A;  1W74 A;  1A58 A;  3BKP A;  4YUM A;  1AWV A;  2RMA A;  1ISE A;  3FHZ A;  2X25 B;  4G0W A;  1H0P A;  5CCQ A;  2IGV A;  3R59 A;  1CWF A;  1QNH A;  4YUN A;  5KUZ A;  1XO7 A;  4YUK A;  1EK8 A;  3L4K A;  1DYW A;  1CWB A;  4KAW X;  1ZMF A;  2XGY B;  4DGA A;  5KUV A;  5CBU A;  5KV4 A;  3R56 A;  3K0N A;  4O8I A;  3K0R A;  1FGL A;  2RMB A;  4EYV A;  4YUO A;  2Y3P A;  2XCR B;  4YUG A;  4R3E A;  1OCA A;  2CYH A;  4J58 A;  1XWN A;  2HQJ A;  2QER A;  3BUE A;  1C5F A;  3PMP A;  4N1M A;  2KWA A;  1BGW A;  1DD5 A;  1Z81 A;  5KV0 A;  1J2A A;  5KUL A;  1VAI A;  1RMH A;  5KV7 A;  2MZU A;  3OPF A;  1E3B A;  2ESL A;  3R49 A;  5KUN A;  3LAJ A;  3QX3 A;  2PHC B;  4G0V A;  5KUU A;  4YUJ A;  4LQW A;  3R57 A;  1CWJ A;  4O8H A;  4KB4 A;  4G0U A;  1W8L A;  2C3B A;  4N1N A;  5LUD A;  4IPZ A;  3RFY A;  5CBW A;  2WLW A;  4N1R A;  5KUR A;  4DGE A;  4JJM A;  1NMK A;  1CWL A;  2X7K A;  3MML A;  2MC9 A;  1BJT A;  3QYU A;  3K2C A;  5A0E A;  1IST A;  3T1U A;  1AB4 A;  2BIT X;  3ODL A;  2P0O A;  1CYN A;  1IHG A; 
#chains in the Genus database with same CATH topology
 3KOP A;  1A33 A;  4N1P A;  2N0T A;  1MZW A;  2MS4 A;  1Y1V A;  4J59 A;  4GTD A;  1SFO K;  4A3L K;  3BT8 A;  2GW2 A;  1XQ7 A;  1B4A A;  3R54 A;  5CBT A;  2OSE A;  1XXA A;  1KQ4 A;  5C44 K;  3BP8 C;  4J5E X;  1AWR A;  3ICI A;  4J5C X;  3S1N C;  1O2A A;  5CHP A;  1AWS A;  1WCM A;  5KV5 A;  3V4G A;  3S2D K;  1TWG A;  4A3B C;  1J98 A;  3RCK X;  1Y1W C;  1Y1W A;  3L4J A;  1CWI A;  1I3Q K;  2GSN A;  4KM9 A;  1O24 A;  1TWF K;  4BBS C;  3A8K A;  2V6U A;  4KAR A;  1JOE A;  3DXJ A;  4C3I K;  1R9T A;  4FRV A;  3RCF A;  1YND A;  1WCM K;  1ZVU A;  1X7F A;  3BP3 A;  3FOF A;  5KUQ A;  3HXA A;  3S0X A;  4QIW L;  3FKI A;  3GEE A;  2RS4 A;  1M63 C;  1CWA A;  4RMF A;  4DDQ A;  2JA8 K;  1J6W A;  2PPB A;  4S1E A;  4GTE A;  3LPX A;  4BLB A;  1F7U A;  1J6V A;  3GIR A;  4KMD A;  3AQO A;  3X27 A;  4BXX K;  3S14 K;  1DCO A;  3T00 A;  5CCS X;  1K83 K;  2WFJ A;  1EH1 A;  1VH2 A;  3CAG A;  2RGR A;  3RDA X;  4YUL A;  2JA5 K;  5M3M K;  5CYH A;  1VBS A;  3UCH A;  4N1S A;  4GTB A;  4P5B A;  4XSX A;  3GTQ K;  4XCH A;  3RZO K;  5FLM C;  3GTQ A;  4FRU A;  1HQM A;  3S1Q K;  2X2D B;  3ODI A;  3AD7 C;  2CFA B;  5KV3 A;  4A3K C;  2A69 A;  4QJV B;  3GTM C;  4E1Q A;  1F9N A;  3RDB A;  3M4O K;  4YUM A;  1W74 A;  3BKP A;  4A3E K;  4G0W A;  5CCQ A;  1I50 K;  3S1R K;  2WB1 L;  1YNJ A;  1CWF A;  1XO7 A;  3H0G A;  2GSO A;  4AH6 A;  2NVX C;  1DYW A;  4G7Z A;  3H0G K;  5KUV A;  5KV4 A;  4O8I A;  4EYV A;  2CYH A;  4J58 A;  4YFK A;  2R7Z C;  3BUE A;  3GTK C;  4QIW D;  4N1M A;  2KWA A;  1DD5 A;  2JA6 A;  4P9S A;  1RU0 A;  2MZU A;  1L0W A;  1E3B A;  2ESL A;  1IW7 A;  3PO2 C;  3GTG A;  3R49 A;  5KUN A;  3N0C A;  3LAJ A;  1EQR A;  4G7O A;  2PMZ D;  3TFI A;  1W8L A;  4N1N A;  5LUD A;  1IBA A;  1J6X A;  1XPP A;  4YFN A;  1TWG K;  1WOO A;  4DGE A;  1ZX8 A;  4JJM A;  2V6T A;  3HOZ K;  3QYU A;  3ADA C;  3K2C A;  3S16 C;  3PO3 K;  3GTL C;  1CYN A;  2R7Z K;  4LK0 A;  1IHG A;  4JK1 A;  5HL8 A;  5C4X K;  3H0G C;  3O7T A;  5M5Y K;  4A3F K;  1WSV A;  1ZQ1 C;  1QNG A;  4MEY A;  3CQZ A;  2GAG C;  1CWH A;  4J5A X;  3RZD C;  3HOW K;  4I9Y A;  4N1Q A;  3RDC A;  1TWG C;  2NVT C;  5TJ3 A;  4OIP A;  2A6H A;  3K0P A;  3N3Y A;  3GTP K;  2PA8 D;  2NVY K;  4A3G C;  2ZFZ A;  1I3Q A;  4YG2 A;  1VRQ C;  1BDF A;  3SZY A;  4WIL A;  1ZKC A;  5CBV A;  4BXX C;  5M5X K;  3GTG K;  4A3G K;  1XYH A;  1K83 C;  5EGE A;  4LR2 A;  4AYB L;  2O5I A;  4NOI A;  1M9E A;  5E68 A;  4A3B K;  5M5W K;  4J5B A;  4A3J C;  5IP9 C;  4KDD A;  2W7V A;  4A3I C;  2HQ6 A;  2Y0S D;  2E2I C;  2POE A;  4C2M C;  1TWC C;  1TWC A;  4A3J K;  4A3F C;  3S15 C;  5TMF A;  1I6V A;  3FKI C;  3RD9 X;  1MF8 C;  2CW0 A;  4LQY A;  5CCR A;  1M9F A;  1M9Y A;  2FU0 A;  4QJV A;  3S1M C;  3ORE A;  1PJ6 A;  2CMT A;  3GTG C;  1O26 A;  2E2J C;  4Y7N C;  3G4A A;  2VUM A;  4KC6 A;  1O27 A;  1IIP A;  4MQ9 A;  2ALF A;  3FOE A;  2CFE A;  1MIK A;  2K7N A;  4GTF A;  4A3D C;  5CCN A;  3GTQ C;  4WJ4 A;  3S2H K;  2KA0 A;  4ZH4 A;  1VJE A;  1Y1W K;  4KMH A;  4PAB A;  3K7A K;  3TFH A;  3HOV C;  4YUI A;  2JA5 C;  1WOP A;  3A8J A;  3RDD A;  2CK1 A;  2RMC A;  3VA7 A;  4Y52 K;  4N1O A;  2NVX A;  4DGC A;  2P5M A;  2WB1 D;  2POY A;  2WFI A;  3FHZ A;  1A58 A;  4G0U A;  2X25 B;  3WOD A;  1H0P A;  1UV7 A;  4FZB A;  4M1X A;  5IYB C;  4YUN A;  4MEX A;  4C3J C;  5KUZ A;  5IYC K;  2JA8 C;  3L4K A;  1CWB A;  5C4X C;  1R9T K;  1YCL A;  3GDZ A;  5CBU A;  3K0N A;  3K0R A;  4PAA A;  2XCR B;  4YUG A;  4R3E A;  1TWH C;  1XWN A;  2R92 C;  1C5F A;  3HOU K;  1TWH K;  4GTC A;  1Z81 A;  1DCP A;  2WAQ D;  5IOS A;  1RMH A;  5IP7 K;  2JA6 K;  4KB4 A;  3R57 A;  2JA7 C;  4O8H A;  5IYC C;  3GTL A;  2P8T A;  1BS2 A;  3HKZ L;  4N1R A;  1R9T C;  1NMK A;  3N0B A;  3T1U A;  2P0O A;  2PHC B;  4C3H C;  2ZUE A;  1USM A;  3PO3 C;  2O5J A;  1I50 A;  1SFO C;  3S16 K;  5D4D A;  4GZY A;  2XCO A;  2JA6 C;  3EOV A;  2NVY C;  4TOT A;  3K0Q A;  5F66 A;  1XZP A;  4KAT A;  3RCG A;  1E8K A;  3RZD K;  4Q5S A;  2GAH C;  3S2D C;  5KV2 A;  2V6S A;  2NVT K;  2ZP2 A;  2EBB A;  1Y1V C;  5IYD K;  3K0M A;  3CYS A;  3TFJ A;  1CWO A;  1O2F B;  2IGW A;  2Z6W A;  4C2M K;  2E2I K;  3FKI K;  3RCI X;  1HI9 A;  2R99 A;  1F93 A;  4LOW A;  3S15 K;  1WQF A;  4YUH A;  4OIQ A;  5DUD A;  1XXB A;  1CWK A;  3K0O A;  5FJ8 K;  1CLH A;  2X2C K;  1W8M A;  3HKZ D;  2HAQ A;  2ZUF A;  1IE0 A;  1XXC A;  4XSZ A;  3AD8 C;  1AK4 A;  1ZKF A;  2A68 A;  1CWM A;  3H3V D;  2OJU A;  1TWA A;  4GT9 A;  3I4M K;  4ILD A;  1PJ7 A;  4Y7N K;  3GTM A;  5KV6 A;  3T02 A;  1WIH A;  5KV1 A;  3LAP A;  1YX2 A;  4Q4Z A;  4XNC A;  3BO7 A;  5IYB K;  4DGB A;  4BY1 C;  1IQ0 A;  1XZQ A;  3GEH A;  3GTJ C;  3IPJ A;  4JCP A;  4LLG A;  4GTL A;  3I4N K;  2R93 A;  2R93 C;  3RCL A;  1LOP A;  3A8I A;  4O2D A;  5JVO A;  4KM8 A;  5IP9 K;  2JA7 A;  1BCK A;  4R3F A;  2B71 A;  1TWC K;  2D6F C;  1SFO A;  4C45 A;  1WOR A;  1WQG A;  5FLM K;  1ISE A;  2VUM C;  2RMA A;  3CQZ C;  5IOT A;  4Y52 C;  2IGV A;  4BLA A;  1O2B A;  4BY1 K;  1WOS A;  4YUK A;  1TWA K;  4KAW X;  2JH3 A;  1ZMF A;  3K7A C;  1WSR A;  3HOU C;  4A3D K;  2RMB A;  3S2H C;  2QER A;  3AD9 C;  3PMP A;  3GTJ A;  5KV0 A;  1J2A A;  5KUL A;  1VAI A;  5KV7 A;  3OPF A;  3QX3 A;  4G0V A;  5KUU A;  4LQW A;  1O28 A;  3GEI A;  2E2H A;  1Y1V K;  2B63 A;  1EI6 A;  3RFY A;  5CBW A;  5KUR A;  2NVQ C;  1X31 C;  4YFX A;  3GTL K;  3M4O C;  5TMC A;  4A3E C;  1CWL A;  2X7K A;  2MC9 A;  1SMY A;  3S1R C;  1O29 A;  3HOZ C;  2BIT X;  3ODL A;  4S1J A;  4A3I K;  3T01 A;  1F7V A;  2HE9 A;  2YU9 C;  4CYH A;  1ZBS A;  2YU9 A;  3PO2 K;  3GTP A;  1WQH A;  2JA5 A;  3HOW C;  2R92 A;  5C44 C;  4J3N A;  2OK3 A;  4FM9 A;  4HY7 A;  4DGD A;  3NUH A;  3ICH A;  3JB9 d;  3JST A;  1JQW A;  2NUL A;  4A3L C;  2CPL A;  4YUP A;  5C3E K;  3Q3Q A;  5C4J K;  1YNN A;  2E2I A;  2JA7 K;  1AWT A;  4XLP A;  4C3H K;  1AWU A;  3MML B;  1B4B A;  2NVQ K;  5KUO A;  3CYH A;  5C3E C;  1M9X A;  5IYD C;  2RH6 A;  4P5A A;  2Y0S L;  1W8V A;  3OEP A;  4KMU A;  4OIN A;  1JVI A;  1WCM C;  4LJZ A;  1I3Q C;  2FQT A;  2FQO A;  1CWC A;  1ZYR A;  1TWF A;  1TWF C;  5L46 A;  2YU9 K;  1ZXO A;  2A6E A;  4BBS K;  1VBT A;  4A3M C;  5KUW A;  3AQP A;  2A2N A;  1USO A;  3ERE D;  4KN4 A;  2NVY A;  5IOQ A;  4J5D X;  1INN A;  4BKW A;  4A3M K;  1IS1 A;  5CJ9 A;  5JHE A;  1K83 A;  3S1M K;  1VDN A;  5KUS A;  1AWQ A;  3S14 C;  2PLU A;  1QOI A;  4GFQ A;  3TTG A;  2X83 B;  4ZSD A;  4KB2 A;  5JFE A;  5C4J C;  2X2A A;  4G7H A;  3S1N K;  1GE9 A;  3CQZ K;  4BBR K;  1M9C A;  3EQL A;  4KAS A;  3SZZ A;  3R4G A;  2BIU X;  2R93 K;  1M9D A;  5M3F K;  2NVX K;  3GTK A;  1V9T A;  2MVZ A;  3GTJ K;  3S6M A;  4KN7 A;  3AH5 A;  2XCQ A;  4ZSC A;  2BE5 A;  2WAQ L;  3RZO C;  4A93 K;  2R92 K;  4C3I C;  1I50 C;  3HOV K;  4GTA A;  4X6A K;  3I4M C;  5IOR A;  3S1Q C;  1G51 A;  4A93 C;  2PMZ L;  2PA8 L;  1TWA C;  1AWV A;  4LK1 A;  3GTO C;  1VGX A;  4A3K K;  4X6A C;  3R59 A;  1QNH A;  3HOX K;  4WJ3 M;  1DCH A;  2E2J K;  1EK8 A;  5EGH A;  2VUM K;  1I6H C;  1V5V A;  2XGY B;  4DGA A;  3GTK K;  4C3J K;  2E2H K;  1O25 A;  1XZQ B;  3R56 A;  4BBR C;  2B63 K;  1FGL A;  4YUO A;  2Y3P A;  3M3Y C;  1OCA A;  4KMA A;  1EFW A;  1IL2 A;  2HQJ A;  4OIO A;  3S17 C;  2E2H C;  2B63 C;  2GSU A;  1BGW A;  3HOY C;  4A3C C;  3I4N C;  4XLN A;  2R7Z A;  3M3Y K;  3HOY K;  1VLO A;  2CFA A;  3S17 K;  4A3C K;  1XZP B;  3HOX C;  3GSI A;  4YUJ A;  4OIR A;  1CWJ A;  5IP7 C;  3H3V L;  1I6H K;  2C3B A;  4IPZ A;  3GTM K;  2WLW A;  1TWH A;  2NNZ A;  4AYB D;  1PJ5 A;  3GTO K;  3MML A;  4BY7 K;  1C0A A;  1BJT A;  3GTP C;  5A0E A;  1IST A;  1AB4 A;  3GTO A;  3G4C A;  4BY7 C; 
#chains in the Genus database with same CATH homology
 1A33 A;  4N1P A;  2N0T A;  1MZW A;  2MS4 A;  1Y1V A;  4J59 A;  4GTD A;  3BT8 A;  2GW2 A;  1XQ7 A;  1B4A A;  3R54 A;  5CBT A;  2OSE A;  1XXA A;  1KQ4 A;  4J5E X;  1AWR A;  3ICI A;  4J5C X;  1O2A A;  5CHP A;  1AWS A;  1WCM A;  5KV5 A;  3V4G A;  1TWG A;  3RCK X;  1Y1W A;  3L4J A;  1CWI A;  2GSN A;  4KM9 A;  1O24 A;  4KAR A;  1R9T A;  4FRV A;  3RCF A;  1YND A;  1ZVU A;  1X7F A;  3FOF A;  5KUQ A;  3S0X A;  3FKI A;  2RS4 A;  1M63 C;  1CWA A;  4DDQ A;  4S1E A;  4GTE A;  3LPX A;  4BLB A;  4KMD A;  3AQO A;  5CCS X;  2WFJ A;  1EH1 A;  3CAG A;  2RGR A;  3RDA X;  4YUL A;  5CYH A;  1VBS A;  3UCH A;  4N1S A;  4GTB A;  4P5B A;  3GTQ A;  4FRU A;  2X2D B;  3ODI A;  2CFA B;  5KV3 A;  4E1Q A;  1F9N A;  3RDB A;  4YUM A;  1W74 A;  3BKP A;  4G0W A;  5CCQ A;  1CWF A;  1XO7 A;  3H0G A;  2GSO A;  1DYW A;  5KUV A;  5KV4 A;  4O8I A;  4EYV A;  2CYH A;  4J58 A;  3BUE A;  4N1M A;  2KWA A;  1DD5 A;  2JA6 A;  2MZU A;  1E3B A;  2ESL A;  3GTG A;  3R49 A;  5KUN A;  3N0C A;  3LAJ A;  1W8L A;  4N1N A;  5LUD A;  4DGE A;  4JJM A;  3QYU A;  3K2C A;  1CYN A;  1IHG A;  3O7T A;  1QNG A;  3CQZ A;  1CWH A;  4J5A X;  4I9Y A;  4N1Q A;  3RDC A;  5TJ3 A;  3K0P A;  3N3Y A;  2ZFZ A;  1I3Q A;  1ZKC A;  5CBV A;  1XYH A;  5EGE A;  4LR2 A;  1M9E A;  4J5B A;  4KDD A;  2HQ6 A;  2POE A;  4C2M C;  1TWC A;  3RD9 X;  1MF8 C;  4LQY A;  5CCR A;  1M9F A;  1M9Y A;  2FU0 A;  3ORE A;  2CMT A;  1O26 A;  3G4A A;  2VUM A;  4KC6 A;  1O27 A;  1IIP A;  2ALF A;  3FOE A;  2CFE A;  1MIK A;  2K7N A;  4GTF A;  5CCN A;  4KMH A;  4YUI A;  3RDD A;  2CK1 A;  2RMC A;  3VA7 A;  4N1O A;  2NVX A;  4DGC A;  2P5M A;  2POY A;  2WFI A;  3FHZ A;  1A58 A;  4G0U A;  2X25 B;  1H0P A;  4FZB A;  4M1X A;  4YUN A;  4C3J C;  5KUZ A;  3L4K A;  1CWB A;  5CBU A;  3K0N A;  3K0R A;  2XCR B;  4YUG A;  4R3E A;  1XWN A;  1C5F A;  4GTC A;  1Z81 A;  5IOS A;  1RMH A;  4KB4 A;  3R57 A;  4O8H A;  3GTL A;  4N1R A;  1NMK A;  3N0B A;  3T1U A;  2P0O A;  2PHC B;  4C3H C;  1I50 A;  2XCO A;  3EOV A;  4TOT A;  3K0Q A;  5F66 A;  4KAT A;  3RCG A;  1E8K A;  5KV2 A;  2ZP2 A;  3K0M A;  3CYS A;  1CWO A;  2IGW A;  2Z6W A;  3RCI X;  2R99 A;  1WQF A;  4YUH A;  5DUD A;  1XXB A;  1CWK A;  3K0O A;  1CLH A;  2X2C K;  1W8M A;  2HAQ A;  1XXC A;  1AK4 A;  1ZKF A;  1CWM A;  2OJU A;  1TWA A;  4GT9 A;  4ILD A;  3GTM A;  5KV6 A;  1WIH A;  5KV1 A;  3LAP A;  4XNC A;  3BO7 A;  4DGB A;  4JCP A;  4GTL A;  2R93 A;  3RCL A;  1LOP A;  5JVO A;  4KM8 A;  2JA7 A;  1BCK A;  4R3F A;  2B71 A;  1SFO A;  1WQG A;  1ISE A;  2RMA A;  5IOT A;  2IGV A;  4BLA A;  1O2B A;  4YUK A;  4KAW X;  2JH3 A;  1ZMF A;  2RMB A;  2QER A;  3PMP A;  3GTJ A;  5KV0 A;  1J2A A;  5KUL A;  1VAI A;  5KV7 A;  3OPF A;  3QX3 A;  4G0V A;  5KUU A;  4LQW A;  1O28 A;  2E2H A;  2B63 A;  3RFY A;  5CBW A;  5KUR A;  1CWL A;  2X7K A;  2MC9 A;  1O29 A;  2BIT X;  3ODL A;  4S1J A;  2HE9 A;  4CYH A;  1ZBS A;  2YU9 A;  3GTP A;  1WQH A;  2JA5 A;  2R92 A;  4J3N A;  2OK3 A;  4FM9 A;  4HY7 A;  4DGD A;  3NUH A;  3ICH A;  3JB9 d;  2NUL A;  2CPL A;  4YUP A;  3Q3Q A;  2E2I A;  1AWT A;  1AWU A;  3MML B;  1B4B A;  5KUO A;  3CYH A;  1M9X A;  2RH6 A;  4P5A A;  1W8V A;  3OEP A;  1CWC A;  1TWF A;  1ZXO A;  1VBT A;  5KUW A;  3AQP A;  2A2N A;  3ERE D;  2NVY A;  5IOQ A;  4J5D X;  4BKW A;  1IS1 A;  5CJ9 A;  5JHE A;  1K83 A;  1VDN A;  5KUS A;  1AWQ A;  2PLU A;  1QOI A;  4GFQ A;  2X83 B;  4ZSD A;  4KB2 A;  5JFE A;  2X2A A;  1GE9 A;  1M9C A;  4KAS A;  3R4G A;  2BIU X;  1M9D A;  3GTK A;  1V9T A;  2MVZ A;  3S6M A;  3AH5 A;  2XCQ A;  4ZSC A;  4C3I C;  4GTA A;  5IOR A;  1AWV A;  3R59 A;  1QNH A;  1EK8 A;  5EGH A;  2XGY B;  4DGA A;  1O25 A;  3R56 A;  1FGL A;  4YUO A;  2Y3P A;  1OCA A;  4KMA A;  2HQJ A;  2GSU A;  1BGW A;  2R7Z A;  2CFA A;  4YUJ A;  1CWJ A;  2C3B A;  4IPZ A;  2WLW A;  1TWH A;  3MML A;  1BJT A;  5A0E A;  1IST A;  1AB4 A;  3GTO A;  3G4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...