1O29A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o29A00
1KQ4A 4KATA 1O29A 1O2BA 4GTAA 3G4CA 4GTEA 4GT9A 2CFAA 4GTFA 1O27A 5IORA 4GTDA 4P5AA 1O26A 1O25A 1O2AA 3N0CA 3AH5A 4KARA 5IOTA 3G4AA 3N0BA 3N3YA 2CFAB 5JFEA 4KASA 5IOQA 4GTBA 4FZBA 1O28A 4GTCA 5IOSA 1O24A 5CHPA 4P5BA 4GTLA
chains in the Genus database with same CATH superfamily
2ZFZA 4A3DK 3T02A 2NVQK 1WIHA 4GT9A 4LK0A 1TWGA 4C2MK 4A3BK 4A3CK 2PA8L 2JA6C 1TWGK 4OIRA 1F93A 3M4OC 5C4JK 3CQZA 4QIWL 3AD8C 3I4MK 5IP9K 1XXAA 2A68A 1I50C 3FOEA 5JVOA 4A3EC 4A3KC 3PO2K 2GSUA 4YFNA 4C3JK 1TWGC 4WJ4A 3S15C 4YFKA 5HL8A 1JOEA 3HOUC 1DCPA 2XCRB 3FKIA 3RZOC 1EQRA 2NVYK 1KQ4A 2YU9C 3HOYK 3L4KA 1L0WA 1WQFA 1I3QA 1TWAA 1Y1WA 3FOFA 3PO3C 4OIOA 1O25A 3HOWK 1O2AA 4Q5SA 3K7AK 4C3IK 4Y52K 5C4XC 2YU9K 3HOYC 4M1XA 2GSOA 2JA7K 2JA8C 4GZYA 1K83K 4BXXC 1O2BA 2JA5K 1XZPB 2CFAA 1R9TA 3GTOK 2GAGC 4PABA 4BLBA 3M3YK 5C44C 1I6HK 3S1RK 4A3GK 3OEPA 4BBRK 3S1MK 3T00A 3GTGK 4A3DC 2R92K 5M3FK 2JA5C 5FJ8K 2JA7A 4KB4A 4KM9A 3GTOC 4BY7C 1J6WA 4A3MC 3GTPK 1I3QC 1J6XA 3I4MC 4PAAA 2FQTA 3QX3A 1Y1VA 3HXAA 4AYBL 4P5AA 3HOZK 3S15K 1O26A 2R92A 3SZZA 3LAJA 1UV7A 4DDQA 3N0BA 3TFIA 1SFOA 3S2HC 3GTLK 1XZQA 1B4BA 2NVQC 3HOXK 4A3FC 4XSXA 3S2DK 3CQZC 1XZPA 3AQPA 2NVXC 2WB1D 2R93A 2P5MA 4GTCA 1O24A 2R7ZA 2V6UA 1PJ7A 5IP7C 1WCMK 1IBAA 1TWHK 4BBSK 5TMFA 2B63K 3GTMA 4BLAA 4KC6A 1I50K 4LLGA 3HOXC 4A3FK 2NVTK 4C3HC 4A3KK 1WOSA 1SMYA 3PO2C 4LOWA 4KN4A 1TWCA 4KAWX 1BGWA 1HI9A 2R7ZC 2WAQD 1WOOA 2WAQL 3JSTA 3BP8C 2JA6K 3BP3A 2GSNA 4G0UA 5FLMC 2Y0SD 2NVTC 4P5BA 3PO3K 3HOVC 2R92C 3S17C 3GTGC 2PMZD 1ZBSA 4KDDA 5IORA 1TWFK 1WOPA 4MQ9A 3GTOA 1VLOA 5TJ3A 3H0GA 5IOQA 2W7VA 4AYBD 1I6VA 2V6SA 3FKIK 3GTQA 2VUMC 4KB2A 1XXCA 3GTKC 3S16K 1IL2A 3VA7A 4RMFA 5C4JC 4A3JC 5EGEA 1DD5A 2WB1L 3S2DC 1DCOA 1TWAK 4KMHA 3HOUK 2NVXK 5M5YK 3H0GK 2JA8K 1ZYRA 3G4AA 3GTKK 3N3YA 2XCQA 4A3IC 3RZOK 2NVYC 4KM8A 1F9NA 1WORA 3RZDK 1GE9A 2PHCB 2P8TA 4LK1A 1TWCC 5IYCC 3NUHA 2E2IK 4G0VA 4C3HK 1USOA 3S1NK 3GTJC 4Y7NC 3GTQC 4KN7A 1O29A 2VUMA 3L4JA 3IPJA 1I3QK 3GDZA 3AD9C 3GSIA 5IYBK 4OIQA 4FM9A 3GEIA 4X6AC 2R93C 4C45A 2Y3PA 4XLNA 1O28A 4YG2A 4G7ZA 1I6HC 4GFQA 1VJEA 1XXBA 4KMAA 1PJ6A 1ZVUA 3BUEA 3S1QK 1INNA 1WQHA 1O27A 4C3JC 1G51A 1YNJA 3LPXA 3GTPC 4NOIA 2O5IA 4A3LC 3HOVK 3S17K 4A3JK 3S0XA 3V4GA 3H3VD 4A3CC 2PPBA 2PA8D 4KATA 4GTEA 3TFHA 3S14K 1J98A 3GEEA 2KWAA 3GTPA 3GTLC 1TWCK 1BS2A 1VRQC 3RZDC 1F7VA 3FKIC 1WCMC 3GEHA 4Y7NK 5IYCK 1K83C 1USMA 3GTGA 4AH6A 5C3EK 1TWHC 3S14C 2Y0SL 1JQWA 1J6VA 4X6AK 3SZYA 1IS1A 3GTMK 2R93K 4XSZA 2A69A 3GTLA 4GTLA 4QJVB 1DCHA 1V5VA 1WQGA 2NVXA 2RH6A 5M3MK 2R7ZK 4GTFA 1I50A 4GTDA 1SFOC 3A8JA 2YU9A 3GIRA 5FLMK 1ZQ1C 1BJTA 1F7UA 3FHZA 3A8KA 3S1QC 5JFEA 3GTJK 1O2FB 4C2MC 4GTBA 5CJ9A 1K83A 2XCOA 1WSRA 1SFOK 5CHPA 2E2JK 5IP9C 3TFJA 2NVYA 1WSVA 5EGHA 2JA6A 4ILDA 1TWFA 4WILA 1BDFA 4A3GC 4BBRC 3S1MC 2B63A 3H3VL 4BY1C 3S1NC 5E68A 3N0CA 5IYDC 3GTQK 5IOTA 3I4NK 2E2JC 3S16C 1Y1WC 1WCMA 2EBBA 1R9TK 1JVIA 3H0GC 5C4XK 4Y52C 1EH1A 3I4NC 5L46A 3TTGA 1IE0A 4A3IK 3WODA 1Y1WK 1RU0A 1YX2A 1Y1VK 4YFXA 3CQZK 3Q3QA 4A93K 1ZXOA 5M5XK 4KARA 3T01A 4BXXK 2ZUFA 1AB4A 2CFAB 4KASA 3GTJA 2D6FC 2O5JA 3LAPA 3M3YC 5IOSA 1Y1VC 1YNNA 2BE5A 3DXJA 3ERED 3K7AC 4QJVA 4C3IC 4J3NA 4A3MK 4ZH4A 3GTMC 2CW0A 3AD7C 4A3BC 4WJ3M 3HOZC 2ZUEA 4MEXA 4FZBA 4KMDA 4LQYA 1IW7A 3HOWC 2PMZL 4P9SA 4BY1K 3EQLA 4G7HA 4LR2A 3HKZD 4BKWA 1HQMA 3A8IA 1XZQB 3S2HK 3HKZL 5C3EC 4XCHA 3ADAC 4GTAA 3OREA 1EI6A 4QIWD 1EFWA 3AQOA 4G7OA 3CAGA 2E2IC 3OPFA 1C0AA 2JA5A 4A3EK 4BY7K 2JA7C 2VUMK 4G0WA 2V6TA 5IP7K 1PJ5A 2E2IA 2GAHC 1VH2A 5IYBC 2B63C 5M5WK 1B4AA 2RGRA 5C44K 1TWAC 4JK1A 1IQ0A 1VGXA 4A93C 2E2HA 5TMCA 3MMLB 4OINA 2A6HA 2E2HK 3G4CA 1ISEA 4OIPA 1YCLA 4Q4ZA 3GTKA 1TWHA 2JH3A 4MEYA 1R9TC 3AH5A 4KMUA 5D4DA 1XPPA 2FQOA 2A6EA 4BBSC 2E2HC 4O2DA 4XLPA 1X31C 1EK8A 1TWFC 3M4OK 5IYDK 3S1RC 4LJZA 4A3LK
chains in the Genus database with same CATH topology
1XXBA 2ZFZA 4KMAA 1EH1A 1WIHA 1ZVUA 3BUEA 4GT9A 1TWGA 3GTMA 4BLAA 1WQHA 4KC6A 1O27A 4C3JC 3Q3QA 4C3HC 1ZXOA 3LPXA 4KARA 3CQZA 1TWCA 4KAWX 1AB4A 1BGWA 2CFAB 1XXAA 4KASA 3GTJA 3FOEA 3LAPA 5JVOA 3S0XA 2GSNA 3V4GA 4G0UA 2GSUA 5IOSA 4P5BA 2XCRB 3FKIA 3ERED 1KQ4A 4KATA 4GTEA 3L4KA 1ZBSA 2KWAA 4C3IC 1WQFA 3GTPA 4J3NA 4KDDA 5IORA 1I3QA 1TWAA 1Y1WA 3FOFA 1O25A 1O2AA 3GTGA 3GTOA 5TJ3A 3H0GA 5IOQA 4M1XA 4FZBA 4KMDA 4LQYA 3GTQA 1IS1A 4KB2A 1XXCA 3GTLA 4LR2A 4GTLA 4BKWA 2GSOA 1WQGA 3VA7A 1O2BA 4GTAA 3OREA 5EGEA 2NVXA 2RH6A 1DD5A 2CFAA 1R9TA 4GTFA 3AQOA 1I50A 3CAGA 4GTDA 4KMHA 3OPFA 2YU9A 4BLBA 2JA5A 1BJTA 4G0WA 3G4AA 3OEPA 3N3YA 3FHZA 2XCQA 5JFEA 4KM8A 2E2IA 1F9NA 4C2MC 4GTBA 5CJ9A 1K83A 1GE9A 1B4AA 2XCOA 2RGRA 4KB4A 4KM9A 2PHCB 2JA7A 3NUHA 4G0VA 5CHPA 2E2HA 2NVYA 5EGHA 2JA6A 4ILDA 3MMLB 1O29A 1TWFA 2B63A 3G4CA 2VUMA 1ISEA 3L4JA 3QX3A 3GTKA 1Y1VA 1TWHA 4P5AA 1O26A 4FM9A 2R92A 2JH3A 3LAJA 3N0CA 3AH5A 4DDQA 5IOTA 3N0BA 1SFOA 1B4BA 2Y3PA 1EK8A 1WCMA 3AQPA 1O28A 2R93A 2P5MA 4GTCA 1O24A 2R7ZA 4GFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  4KAT A;  1O29 A;  1O2B A;  4GTA A;  3G4C A;  4GTE A;  4GT9 A;  2CFA A;  4GTF A;  1O27 A;  5IOR A;  4GTD A;  4P5A A;  1O26 A;  1O25 A;  1O2A A;  3N0C A;  3AH5 A;  4KAR A;  5IOT A;  3G4A A;  3N0B A;  3N3Y A;  2CFA B;  5JFE A;  4KAS A;  5IOQ A;  4GTB A;  4FZB A;  1O28 A;  4GTC A;  5IOS A;  1O24 A;  5CHP A;  4P5B A;  4GTL A; 
#chains in the Genus database with same CATH topology
 2ZFZ A;  4A3D K;  3T02 A;  2NVQ K;  1WIH A;  4GT9 A;  4LK0 A;  1TWG A;  4C2M K;  4A3B K;  4A3C K;  2PA8 L;  2JA6 C;  1TWG K;  4OIR A;  1F93 A;  3M4O C;  5C4J K;  3CQZ A;  4QIW L;  3AD8 C;  3I4M K;  5IP9 K;  1XXA A;  2A68 A;  1I50 C;  3FOE A;  5JVO A;  4A3E C;  4A3K C;  3PO2 K;  2GSU A;  4YFN A;  4C3J K;  1TWG C;  4WJ4 A;  3S15 C;  4YFK A;  5HL8 A;  1JOE A;  3HOU C;  1DCP A;  2XCR B;  3FKI A;  3RZO C;  1EQR A;  2NVY K;  1KQ4 A;  2YU9 C;  3HOY K;  3L4K A;  1L0W A;  1WQF A;  1I3Q A;  1TWA A;  1Y1W A;  3FOF A;  3PO3 C;  4OIO A;  1O25 A;  3HOW K;  1O2A A;  4Q5S A;  3K7A K;  4C3I K;  4Y52 K;  5C4X C;  2YU9 K;  3HOY C;  4M1X A;  2GSO A;  2JA7 K;  2JA8 C;  4GZY A;  1K83 K;  4BXX C;  1O2B A;  2JA5 K;  1XZP B;  2CFA A;  1R9T A;  3GTO K;  2GAG C;  4PAB A;  4BLB A;  3M3Y K;  5C44 C;  1I6H K;  3S1R K;  4A3G K;  3OEP A;  4BBR K;  3S1M K;  3T00 A;  3GTG K;  4A3D C;  2R92 K;  5M3F K;  2JA5 C;  5FJ8 K;  2JA7 A;  4KB4 A;  4KM9 A;  3GTO C;  4BY7 C;  1J6W A;  4A3M C;  3GTP K;  1I3Q C;  1J6X A;  3I4M C;  4PAA A;  2FQT A;  3QX3 A;  1Y1V A;  3HXA A;  4AYB L;  4P5A A;  3HOZ K;  3S15 K;  1O26 A;  2R92 A;  3SZZ A;  3LAJ A;  1UV7 A;  4DDQ A;  3N0B A;  3TFI A;  1SFO A;  3S2H C;  3GTL K;  1XZQ A;  1B4B A;  2NVQ C;  3HOX K;  4A3F C;  4XSX A;  3S2D K;  3CQZ C;  1XZP A;  3AQP A;  2NVX C;  2WB1 D;  2R93 A;  2P5M A;  4GTC A;  1O24 A;  2R7Z A;  2V6U A;  1PJ7 A;  5IP7 C;  1WCM K;  1IBA A;  1TWH K;  4BBS K;  5TMF A;  2B63 K;  3GTM A;  4BLA A;  4KC6 A;  1I50 K;  4LLG A;  3HOX C;  4A3F K;  2NVT K;  4C3H C;  4A3K K;  1WOS A;  1SMY A;  3PO2 C;  4LOW A;  4KN4 A;  1TWC A;  4KAW X;  1BGW A;  1HI9 A;  2R7Z C;  2WAQ D;  1WOO A;  2WAQ L;  3JST A;  3BP8 C;  2JA6 K;  3BP3 A;  2GSN A;  4G0U A;  5FLM C;  2Y0S D;  2NVT C;  4P5B A;  3PO3 K;  3HOV C;  2R92 C;  3S17 C;  3GTG C;  2PMZ D;  1ZBS A;  4KDD A;  5IOR A;  1TWF K;  1WOP A;  4MQ9 A;  3GTO A;  1VLO A;  5TJ3 A;  3H0G A;  5IOQ A;  2W7V A;  4AYB D;  1I6V A;  2V6S A;  3FKI K;  3GTQ A;  2VUM C;  4KB2 A;  1XXC A;  3GTK C;  3S16 K;  1IL2 A;  3VA7 A;  4RMF A;  5C4J C;  4A3J C;  5EGE A;  1DD5 A;  2WB1 L;  3S2D C;  1DCO A;  1TWA K;  4KMH A;  3HOU K;  2NVX K;  5M5Y K;  3H0G K;  2JA8 K;  1ZYR A;  3G4A A;  3GTK K;  3N3Y A;  2XCQ A;  4A3I C;  3RZO K;  2NVY C;  4KM8 A;  1F9N A;  1WOR A;  3RZD K;  1GE9 A;  2PHC B;  2P8T A;  4LK1 A;  1TWC C;  5IYC C;  3NUH A;  2E2I K;  4G0V A;  4C3H K;  1USO A;  3S1N K;  3GTJ C;  4Y7N C;  3GTQ C;  4KN7 A;  1O29 A;  2VUM A;  3L4J A;  3IPJ A;  1I3Q K;  3GDZ A;  3AD9 C;  3GSI A;  5IYB K;  4OIQ A;  4FM9 A;  3GEI A;  4X6A C;  2R93 C;  4C45 A;  2Y3P A;  4XLN A;  1O28 A;  4YG2 A;  4G7Z A;  1I6H C;  4GFQ A;  1VJE A;  1XXB A;  4KMA A;  1PJ6 A;  1ZVU A;  3BUE A;  3S1Q K;  1INN A;  1WQH A;  1O27 A;  4C3J C;  1G51 A;  1YNJ A;  3LPX A;  3GTP C;  4NOI A;  2O5I A;  4A3L C;  3HOV K;  3S17 K;  4A3J K;  3S0X A;  3V4G A;  3H3V D;  4A3C C;  2PPB A;  2PA8 D;  4KAT A;  4GTE A;  3TFH A;  3S14 K;  1J98 A;  3GEE A;  2KWA A;  3GTP A;  3GTL C;  1TWC K;  1BS2 A;  1VRQ C;  3RZD C;  1F7V A;  3FKI C;  1WCM C;  3GEH A;  4Y7N K;  5IYC K;  1K83 C;  1USM A;  3GTG A;  4AH6 A;  5C3E K;  1TWH C;  3S14 C;  2Y0S L;  1JQW A;  1J6V A;  4X6A K;  3SZY A;  1IS1 A;  3GTM K;  2R93 K;  4XSZ A;  2A69 A;  3GTL A;  4GTL A;  4QJV B;  1DCH A;  1V5V A;  1WQG A;  2NVX A;  2RH6 A;  5M3M K;  2R7Z K;  4GTF A;  1I50 A;  4GTD A;  1SFO C;  3A8J A;  2YU9 A;  3GIR A;  5FLM K;  1ZQ1 C;  1BJT A;  1F7U A;  3FHZ A;  3A8K A;  3S1Q C;  5JFE A;  3GTJ K;  1O2F B;  4C2M C;  4GTB A;  5CJ9 A;  1K83 A;  2XCO A;  1WSR A;  1SFO K;  5CHP A;  2E2J K;  5IP9 C;  3TFJ A;  2NVY A;  1WSV A;  5EGH A;  2JA6 A;  4ILD A;  1TWF A;  4WIL A;  1BDF A;  4A3G C;  4BBR C;  3S1M C;  2B63 A;  3H3V L;  4BY1 C;  3S1N C;  5E68 A;  3N0C A;  5IYD C;  3GTQ K;  5IOT A;  3I4N K;  2E2J C;  3S16 C;  1Y1W C;  1WCM A;  2EBB A;  1R9T K;  1JVI A;  3H0G C;  5C4X K;  4Y52 C;  1EH1 A;  3I4N C;  5L46 A;  3TTG A;  1IE0 A;  4A3I K;  3WOD A;  1Y1W K;  1RU0 A;  1YX2 A;  1Y1V K;  4YFX A;  3CQZ K;  3Q3Q A;  4A93 K;  1ZXO A;  5M5X K;  4KAR A;  3T01 A;  4BXX K;  2ZUF A;  1AB4 A;  2CFA B;  4KAS A;  3GTJ A;  2D6F C;  2O5J A;  3LAP A;  3M3Y C;  5IOS A;  1Y1V C;  1YNN A;  2BE5 A;  3DXJ A;  3ERE D;  3K7A C;  4QJV A;  4C3I C;  4J3N A;  4A3M K;  4ZH4 A;  3GTM C;  2CW0 A;  3AD7 C;  4A3B C;  4WJ3 M;  3HOZ C;  2ZUE A;  4MEX A;  4FZB A;  4KMD A;  4LQY A;  1IW7 A;  3HOW C;  2PMZ L;  4P9S A;  4BY1 K;  3EQL A;  4G7H A;  4LR2 A;  3HKZ D;  4BKW A;  1HQM A;  3A8I A;  1XZQ B;  3S2H K;  3HKZ L;  5C3E C;  4XCH A;  3ADA C;  4GTA A;  3ORE A;  1EI6 A;  4QIW D;  1EFW A;  3AQO A;  4G7O A;  3CAG A;  2E2I C;  3OPF A;  1C0A A;  2JA5 A;  4A3E K;  4BY7 K;  2JA7 C;  2VUM K;  4G0W A;  2V6T A;  5IP7 K;  1PJ5 A;  2E2I A;  2GAH C;  1VH2 A;  5IYB C;  2B63 C;  5M5W K;  1B4A A;  2RGR A;  5C44 K;  1TWA C;  4JK1 A;  1IQ0 A;  1VGX A;  4A93 C;  2E2H A;  5TMC A;  3MML B;  4OIN A;  2A6H A;  2E2H K;  3G4C A;  1ISE A;  4OIP A;  1YCL A;  4Q4Z A;  3GTK A;  1TWH A;  2JH3 A;  4MEY A;  1R9T C;  3AH5 A;  4KMU A;  5D4D A;  1XPP A;  2FQO A;  2A6E A;  4BBS C;  2E2H C;  4O2D A;  4XLP A;  1X31 C;  1EK8 A;  1TWF C;  3M4O K;  5IYD K;  3S1R C;  4LJZ A;  4A3L K; 
#chains in the Genus database with same CATH homology
 1XXB A;  2ZFZ A;  4KMA A;  1EH1 A;  1WIH A;  1ZVU A;  3BUE A;  4GT9 A;  1TWG A;  3GTM A;  4BLA A;  1WQH A;  4KC6 A;  1O27 A;  4C3J C;  3Q3Q A;  4C3H C;  1ZXO A;  3LPX A;  4KAR A;  3CQZ A;  1TWC A;  4KAW X;  1AB4 A;  1BGW A;  2CFA B;  1XXA A;  4KAS A;  3GTJ A;  3FOE A;  3LAP A;  5JVO A;  3S0X A;  2GSN A;  3V4G A;  4G0U A;  2GSU A;  5IOS A;  4P5B A;  2XCR B;  3FKI A;  3ERE D;  1KQ4 A;  4KAT A;  4GTE A;  3L4K A;  1ZBS A;  2KWA A;  4C3I C;  1WQF A;  3GTP A;  4J3N A;  4KDD A;  5IOR A;  1I3Q A;  1TWA A;  1Y1W A;  3FOF A;  1O25 A;  1O2A A;  3GTG A;  3GTO A;  5TJ3 A;  3H0G A;  5IOQ A;  4M1X A;  4FZB A;  4KMD A;  4LQY A;  3GTQ A;  1IS1 A;  4KB2 A;  1XXC A;  3GTL A;  4LR2 A;  4GTL A;  4BKW A;  2GSO A;  1WQG A;  3VA7 A;  1O2B A;  4GTA A;  3ORE A;  5EGE A;  2NVX A;  2RH6 A;  1DD5 A;  2CFA A;  1R9T A;  4GTF A;  3AQO A;  1I50 A;  3CAG A;  4GTD A;  4KMH A;  3OPF A;  2YU9 A;  4BLB A;  2JA5 A;  1BJT A;  4G0W A;  3G4A A;  3OEP A;  3N3Y A;  3FHZ A;  2XCQ A;  5JFE A;  4KM8 A;  2E2I A;  1F9N A;  4C2M C;  4GTB A;  5CJ9 A;  1K83 A;  1GE9 A;  1B4A A;  2XCO A;  2RGR A;  4KB4 A;  4KM9 A;  2PHC B;  2JA7 A;  3NUH A;  4G0V A;  5CHP A;  2E2H A;  2NVY A;  5EGH A;  2JA6 A;  4ILD A;  3MML B;  1O29 A;  1TWF A;  2B63 A;  3G4C A;  2VUM A;  1ISE A;  3L4J A;  3QX3 A;  3GTK A;  1Y1V A;  1TWH A;  4P5A A;  1O26 A;  4FM9 A;  2R92 A;  2JH3 A;  3LAJ A;  3N0C A;  3AH5 A;  4DDQ A;  5IOT A;  3N0B A;  1SFO A;  1B4B A;  2Y3P A;  1EK8 A;  1WCM A;  3AQP A;  1O28 A;  2R93 A;  2P5M A;  4GTC A;  1O24 A;  2R7Z A;  4GFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...