1O29A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o29A00
5JFEA 4KATA 5IOQA 4GTDA 3N3YA 1O28A 2CFAB 4GTAA 2CFAA 4GTEA 5IOTA 4KASA 4P5BA 5IOSA 4KARA 1O24A 1O25A 3N0CA 4GTBA 1O26A 1O29A 3G4CA 4GTLA 4P5AA 1O2BA 5CHPA 1O2AA 4GTCA 3N0BA 3AH5A 5IORA 1O27A 3G4AA 1KQ4A 4FZBA 4GTFA 4GT9A
chains in the Genus database with same CATH superfamily
4KATA 4Y7NK 4A3DC 4KM9A 3V4GA 1J6XA 3AQOA 3N3YA 4G7OA 1WOSA 1WQFA 1IS1A 2PMZL 5IYCK 1I50K 3S2HC 1WOOA 4KC6A 3GTQC 4BBSK 5C4XK 1EQRA 4O2DA 3EQLA 3T00A 3ERED 5FLMK 3A8IA 2VUMC 1TWCA 4XSXA 4ZH4A 1TWGC 3RZOC 4Q5SA 2XCOA 1IL2A 2JA8K 3NUHA 1YCLA 4WILA 4A3DK 2VUMA 1IE0A 1C0AA 2EBBA 4A3GC 1TWGA 2ZFZA 3H3VD 3DXJA 5L46A 1V5VA 2E2HC 3AD7C 3HKZD 4KMAA 1K83K 3S2HK 3T02A 3GTQK 3AQPA 1R9TA 4QJVA 2XCRB 2GSUA 2E2HA 1JVIA 2ZUEA 3S2DC 3AH5A 3G4AA 4LLGA 3IPJA 3HXAA 3M4OK 3PO3C 1VH2A 1F7UA 3JSTA 3AD9C 5M5WK 3OREA 5M5YK 4XCHA 3FKIC 3GTPK 2R92C 1XXAA 2E2JC 4KB2A 3PO2C 5D4DA 4A3MC 1IQ0A 2WB1D 4G0WA 3AD8C 3FKIA 2A68A 3H0GK 2R92A 3GTGC 2PA8D 3I4MK 1TWHK 1G51A 1TWFK 3OPFA 5TMCA 1XZQA 3GEHA 3GEEA 1XZPA 3K7AC 4AH6A 2BE5A 4G0VA 1EFWA 3S16K 2R93C 1VJEA 2R7ZK 1J6VA 3PO2K 3FOEA 4A3MK 4A3EC 2Y0SL 3HOYC 2R93A 4A3CC 3GTGK 4BLBA 4GZYA 4A93C 5IYDK 2NVTC 2ZUFA 4QIWD 4KDDA 2E2IK 3S1QC 4BY1C 4A3BK 4KMHA 4G7ZA 1DCPA 5C4JC 3S17K 4MEYA 3MMLB 1B4AA 4KN4A 4Y7NC 3LAJA 3GTMK 5CJ9A 4KASA 1EK8A 4A3JK 5IYCC 1WSVA 3N0CA 4A3KC 1WOPA 3BUEA 1I50C 2NVQK 2RGRA 4A3CK 5C4XC 1XPPA 1O2BA 2JA7K 1EH1A 5FLMC 4OIQA 3N0BA 3GEIA 3S1QK 4PAAA 1I50A 4BY7C 4M1XA 4LOWA 3L4KA 2JA8C 3CAGA 3FHZA 1Y1WC 1WSRA 2PPBA 4PABA 2CW0A 4XLNA 4GTEA 5IOTA 4P5BA 1O24A 2P5MA 4A3KK 5M3MK 1K83C 1Y1WA 4GTLA 3LPXA 1Y1VC 4C3JK 3H3VL 2D6FC 5TMFA 1K83A 3T01A 4BY7K 2V6UA 3GTQA 4P9SA 4KB4A 3HKZL 1VRQC 3M4OC 2GAGC 4XLPA 1Y1VA 1Y1WK 1INNA 5FJ8K 1DCHA 5M5XK 1BDFA 5EGEA 4MQ9A 3GTPC 4BXXK 3RZDC 3BP8C 4FM9A 1TWAK 3VA7A 1UV7A 2PMZD 3S15K 3G4CA 3GTPA 2A69A 2PHCB 5CHPA 1O2AA 3H0GC 1Y1VK 3I4MC 3M3YC 1GE9A 1B4BA 1TWHC 1TWFC 3HOUC 1XXCA 4YFXA 5C44K 3H0GA 2WB1L 4GTDA 1I6HK 1TWHA 1TWFA 3RZDK 2PA8L 3S16C 2R7ZC 2JH3A 2JA6K 3TFIA 1O26A 4KN7A 4YFKA 4A3IK 3S14K 1PJ6A 2NVYK 1F93A 4RMFA 3M3YK 2R7ZA 5IYDC 4A3LK 1KQ4A 4LK1A 2E2IC 3HOUK 4A3BC 3GTGA 3S17C 1O28A 3GTJK 3GTLK 4MEXA 1AB4A 2E2IA 4Y52K 3GTMC 4A3JC 4QJVB 4QIWL 1X31C 2NVXC 2V6SA 3S1MC 2NVQC 3GTOK 3FOFA 2KWAA 4WJ4A 2FQTA 4KAWX 1J98A 3GTMA 2JA7C 1RU0A 1VGXA 3QX3A 4BBRK 2NVXA 5C3EK 2GAHC 3TTGA 2JA7A 1I6VA 1JQWA 3GIRA 4G7HA 1YX2A 1I3QK 4A3FK 1WQGA 5IOSA 3TFJA 3S1NC 4C3IK 2B63K 4GTBA 1O2FB 2RH6A 2GSNA 2NVXK 1J6WA 4YG2A 3S1MK 1SMYA 3GDZA 4BKWA 4AYBD 1YNJA 4C3JC 5TJ3A 5IP9K 3CQZK 2V6TA 1XZQB 3BP3A 4GT9A 2O5IA 4DDQA 1XZPB 4OIOA 3ADAC 1HQMA 2CFAA 3S1NK 4BXXC 1EI6A 5EGHA 3WODA 4Q4ZA 3L4JA 1TWAC 3S15C 4KMUA 4C45A 1YNNA 1TWAA 3TFHA 4FZBA 2WAQD 5JFEA 3S1RC 2YU9K 2JA5K 1ZXOA 1ZQ1C 3I4NC 5IP7K 1L0WA 3GTKK 5C44C 4XSZA 2W7VA 4LK0A 4C3HC 1F7VA 3SZZA 4WJ3M 1TWCC 3A8JA 5JVOA 1BGWA 1I6HC 1XXBA 4OIRA 4LJZA 3HOXK 4G0UA 1WCMC 2JA6C 1SFOK 3GSIA 4GFQA 4A3IC 1BS2A 1ZYRA 4YFNA 2FQOA 3S14C 2A6EA 2NVYC 1WCMA 2JA6A 3HOVK 4A3LC 4J3NA 3HOWC 4GTFA 5IYBC 4JK1A 3S1RK 1R9TC 4KMDA 3I4NK 2NVYA 2CFAB 4C3HK 1TWCK 2A6HA 3GTJC 3GTLC 4OINA 4Y52C 1WCMK 4X6AC 3SZYA 2VUMK 3A8KA 3GTJA 1ISEA 3GTLA 1ZBSA 1TWGK 3GTOC 4GTCA 1VLOA 3RZOK 1O27A 1HI9A 3HOWK 4BBRC 5IYBK 4A3GK 5C3EC 4NOIA 1R9TK 3GTOA 4KM8A 2E2HK 4KARA 1I3QC 4X6AK 1O25A 4A3FC 4C3IC 2B63C 4OIPA 2Y3PA 1BJTA 4P5AA 3S2DK 1PJ5A 1I3QA 1USMA 2B63A 3PO3K 5HL8A 1WIHA 2P8TA 5IP9C 3CQZC 1ZVUA 4C2MC 3FKIK 3Q3QA 4LQYA 4LR2A 2R92K 1DD5A 4GTAA 2E2JK 3CQZA 2O5JA 4ILDA 4AYBL 3HOZC 1IBAA 3OEPA 2Y0SD 1WQHA 1USOA 2GSOA 1IW7A 3K7AK 4C2MK 5IOQA 2YU9C 2JA5C 2XCQA 2R93K 5IP7C 3GTKC 1PJ7A 3S0XA 4A3EK 1WORA 1JOEA 3HOXC 2YU9A 3HOYK 1DCOA 3HOZK 2JA5A 4BBSC 1F9NA 1O29A 1SFOC 3GTKA 2WAQL 4A93K 2NVTK 4BLAA 5IORA 4BY1K 5M3FK 3LAPA 5C4JK 1SFOA 3HOVC 5E68A
chains in the Genus database with same CATH topology
4KATA 3MMLB 4KM9A 3V4GA 1B4AA 4KMDA 3GTGA 2NVYA 3AQOA 3N3YA 1O28A 2CFAB 3LAJA 1WQFA 1IS1A 1AB4A 2E2IA 5CJ9A 4KASA 1EK8A 3N0CA 3BUEA 4KC6A 2RGRA 3ERED 3GTJA 1ISEA 3FOFA 3GTLA 1O2BA 1TWCA 1ZBSA 2KWAA 1EH1A 4GTCA 4KAWX 3GTMA 3N0BA 1O27A 3QX3A 1I50A 2NVXA 2XCOA 4M1XA 3NUHA 2VUMA 3L4KA 3GTOA 1TWGA 3CAGA 3FHZA 2ZFZA 2JA7A 4KM8A 4GTEA 5IOTA 1WQGA 4KMAA 4KARA 1O24A 4P5BA 5IOSA 1O25A 2P5MA 4GTBA 2RH6A 4C3IC 3AQPA 2GSNA 1R9TA 1Y1WA 2XCRB 4GTLA 2GSUA 2Y3PA 1BJTA 3LPXA 4P5AA 2E2HA 4BKWA 1I3QA 3AH5A 3G4AA 2B63A 1K83A 5TJ3A 4C3JC 3GTQA 4KB4A 1WIHA 4GT9A 4DDQA 1ZVUA 4C2MC 3Q3QA 1Y1VA 3OREA 4LQYA 4LR2A 1DD5A 4GTAA 5EGEA 2CFAA 1XXAA 4KB2A 3CQZA 5EGHA 3L4JA 4FM9A 4ILDA 3VA7A 4G0WA 3FKIA 3G4CA 2R92A 3GTPA 2PHCB 5CHPA 1O2AA 3OEPA 1GE9A 1B4BA 1TWAA 1WQHA 3OPFA 4FZBA 5JFEA 2GSOA 1XXCA 1ZXOA 3H0GA 5IOQA 4GTDA 4G0VA 2XCQA 4C3HC 3S0XA 1TWHA 1TWFA 5JVOA 1BGWA 1XXBA 3FOEA 2JH3A 4G0UA 1O26A 2YU9A 2JA5A 4GFQA 1F9NA 1O29A 3GTKA 2R93A 4BLBA 2R7ZA 4BLAA 1WCMA 5IORA 4KDDA 2JA6A 1KQ4A 3LAPA 1SFOA 4KMHA 4J3NA 4GTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFE A;  4KAT A;  5IOQ A;  4GTD A;  3N3Y A;  1O28 A;  2CFA B;  4GTA A;  2CFA A;  4GTE A;  5IOT A;  4KAS A;  4P5B A;  5IOS A;  4KAR A;  1O24 A;  1O25 A;  3N0C A;  4GTB A;  1O26 A;  1O29 A;  3G4C A;  4GTL A;  4P5A A;  1O2B A;  5CHP A;  1O2A A;  4GTC A;  3N0B A;  3AH5 A;  5IOR A;  1O27 A;  3G4A A;  1KQ4 A;  4FZB A;  4GTF A;  4GT9 A; 
#chains in the Genus database with same CATH topology
 4KAT A;  4Y7N K;  4A3D C;  4KM9 A;  3V4G A;  1J6X A;  3AQO A;  3N3Y A;  4G7O A;  1WOS A;  1WQF A;  1IS1 A;  2PMZ L;  5IYC K;  1I50 K;  3S2H C;  1WOO A;  4KC6 A;  3GTQ C;  4BBS K;  5C4X K;  1EQR A;  4O2D A;  3EQL A;  3T00 A;  3ERE D;  5FLM K;  3A8I A;  2VUM C;  1TWC A;  4XSX A;  4ZH4 A;  1TWG C;  3RZO C;  4Q5S A;  2XCO A;  1IL2 A;  2JA8 K;  3NUH A;  1YCL A;  4WIL A;  4A3D K;  2VUM A;  1IE0 A;  1C0A A;  2EBB A;  4A3G C;  1TWG A;  2ZFZ A;  3H3V D;  3DXJ A;  5L46 A;  1V5V A;  2E2H C;  3AD7 C;  3HKZ D;  4KMA A;  1K83 K;  3S2H K;  3T02 A;  3GTQ K;  3AQP A;  1R9T A;  4QJV A;  2XCR B;  2GSU A;  2E2H A;  1JVI A;  2ZUE A;  3S2D C;  3AH5 A;  3G4A A;  4LLG A;  3IPJ A;  3HXA A;  3M4O K;  3PO3 C;  1VH2 A;  1F7U A;  3JST A;  3AD9 C;  5M5W K;  3ORE A;  5M5Y K;  4XCH A;  3FKI C;  3GTP K;  2R92 C;  1XXA A;  2E2J C;  4KB2 A;  3PO2 C;  5D4D A;  4A3M C;  1IQ0 A;  2WB1 D;  4G0W A;  3AD8 C;  3FKI A;  2A68 A;  3H0G K;  2R92 A;  3GTG C;  2PA8 D;  3I4M K;  1TWH K;  1G51 A;  1TWF K;  3OPF A;  5TMC A;  1XZQ A;  3GEH A;  3GEE A;  1XZP A;  3K7A C;  4AH6 A;  2BE5 A;  4G0V A;  1EFW A;  3S16 K;  2R93 C;  1VJE A;  2R7Z K;  1J6V A;  3PO2 K;  3FOE A;  4A3M K;  4A3E C;  2Y0S L;  3HOY C;  2R93 A;  4A3C C;  3GTG K;  4BLB A;  4GZY A;  4A93 C;  5IYD K;  2NVT C;  2ZUF A;  4QIW D;  4KDD A;  2E2I K;  3S1Q C;  4BY1 C;  4A3B K;  4KMH A;  4G7Z A;  1DCP A;  5C4J C;  3S17 K;  4MEY A;  3MML B;  1B4A A;  4KN4 A;  4Y7N C;  3LAJ A;  3GTM K;  5CJ9 A;  4KAS A;  1EK8 A;  4A3J K;  5IYC C;  1WSV A;  3N0C A;  4A3K C;  1WOP A;  3BUE A;  1I50 C;  2NVQ K;  2RGR A;  4A3C K;  5C4X C;  1XPP A;  1O2B A;  2JA7 K;  1EH1 A;  5FLM C;  4OIQ A;  3N0B A;  3GEI A;  3S1Q K;  4PAA A;  1I50 A;  4BY7 C;  4M1X A;  4LOW A;  3L4K A;  2JA8 C;  3CAG A;  3FHZ A;  1Y1W C;  1WSR A;  2PPB A;  4PAB A;  2CW0 A;  4XLN A;  4GTE A;  5IOT A;  4P5B A;  1O24 A;  2P5M A;  4A3K K;  5M3M K;  1K83 C;  1Y1W A;  4GTL A;  3LPX A;  1Y1V C;  4C3J K;  3H3V L;  2D6F C;  5TMF A;  1K83 A;  3T01 A;  4BY7 K;  2V6U A;  3GTQ A;  4P9S A;  4KB4 A;  3HKZ L;  1VRQ C;  3M4O C;  2GAG C;  4XLP A;  1Y1V A;  1Y1W K;  1INN A;  5FJ8 K;  1DCH A;  5M5X K;  1BDF A;  5EGE A;  4MQ9 A;  3GTP C;  4BXX K;  3RZD C;  3BP8 C;  4FM9 A;  1TWA K;  3VA7 A;  1UV7 A;  2PMZ D;  3S15 K;  3G4C A;  3GTP A;  2A69 A;  2PHC B;  5CHP A;  1O2A A;  3H0G C;  1Y1V K;  3I4M C;  3M3Y C;  1GE9 A;  1B4B A;  1TWH C;  1TWF C;  3HOU C;  1XXC A;  4YFX A;  5C44 K;  3H0G A;  2WB1 L;  4GTD A;  1I6H K;  1TWH A;  1TWF A;  3RZD K;  2PA8 L;  3S16 C;  2R7Z C;  2JH3 A;  2JA6 K;  3TFI A;  1O26 A;  4KN7 A;  4YFK A;  4A3I K;  3S14 K;  1PJ6 A;  2NVY K;  1F93 A;  4RMF A;  3M3Y K;  2R7Z A;  5IYD C;  4A3L K;  1KQ4 A;  4LK1 A;  2E2I C;  3HOU K;  4A3B C;  3GTG A;  3S17 C;  1O28 A;  3GTJ K;  3GTL K;  4MEX A;  1AB4 A;  2E2I A;  4Y52 K;  3GTM C;  4A3J C;  4QJV B;  4QIW L;  1X31 C;  2NVX C;  2V6S A;  3S1M C;  2NVQ C;  3GTO K;  3FOF A;  2KWA A;  4WJ4 A;  2FQT A;  4KAW X;  1J98 A;  3GTM A;  2JA7 C;  1RU0 A;  1VGX A;  3QX3 A;  4BBR K;  2NVX A;  5C3E K;  2GAH C;  3TTG A;  2JA7 A;  1I6V A;  1JQW A;  3GIR A;  4G7H A;  1YX2 A;  1I3Q K;  4A3F K;  1WQG A;  5IOS A;  3TFJ A;  3S1N C;  4C3I K;  2B63 K;  4GTB A;  1O2F B;  2RH6 A;  2GSN A;  2NVX K;  1J6W A;  4YG2 A;  3S1M K;  1SMY A;  3GDZ A;  4BKW A;  4AYB D;  1YNJ A;  4C3J C;  5TJ3 A;  5IP9 K;  3CQZ K;  2V6T A;  1XZQ B;  3BP3 A;  4GT9 A;  2O5I A;  4DDQ A;  1XZP B;  4OIO A;  3ADA C;  1HQM A;  2CFA A;  3S1N K;  4BXX C;  1EI6 A;  5EGH A;  3WOD A;  4Q4Z A;  3L4J A;  1TWA C;  3S15 C;  4KMU A;  4C45 A;  1YNN A;  1TWA A;  3TFH A;  4FZB A;  2WAQ D;  5JFE A;  3S1R C;  2YU9 K;  2JA5 K;  1ZXO A;  1ZQ1 C;  3I4N C;  5IP7 K;  1L0W A;  3GTK K;  5C44 C;  4XSZ A;  2W7V A;  4LK0 A;  4C3H C;  1F7V A;  3SZZ A;  4WJ3 M;  1TWC C;  3A8J A;  5JVO A;  1BGW A;  1I6H C;  1XXB A;  4OIR A;  4LJZ A;  3HOX K;  4G0U A;  1WCM C;  2JA6 C;  1SFO K;  3GSI A;  4GFQ A;  4A3I C;  1BS2 A;  1ZYR A;  4YFN A;  2FQO A;  3S14 C;  2A6E A;  2NVY C;  1WCM A;  2JA6 A;  3HOV K;  4A3L C;  4J3N A;  3HOW C;  4GTF A;  5IYB C;  4JK1 A;  3S1R K;  1R9T C;  4KMD A;  3I4N K;  2NVY A;  2CFA B;  4C3H K;  1TWC K;  2A6H A;  3GTJ C;  3GTL C;  4OIN A;  4Y52 C;  1WCM K;  4X6A C;  3SZY A;  2VUM K;  3A8K A;  3GTJ A;  1ISE A;  3GTL A;  1ZBS A;  1TWG K;  3GTO C;  4GTC A;  1VLO A;  3RZO K;  1O27 A;  1HI9 A;  3HOW K;  4BBR C;  5IYB K;  4A3G K;  5C3E C;  4NOI A;  1R9T K;  3GTO A;  4KM8 A;  2E2H K;  4KAR A;  1I3Q C;  4X6A K;  1O25 A;  4A3F C;  4C3I C;  2B63 C;  4OIP A;  2Y3P A;  1BJT A;  4P5A A;  3S2D K;  1PJ5 A;  1I3Q A;  1USM A;  2B63 A;  3PO3 K;  5HL8 A;  1WIH A;  2P8T A;  5IP9 C;  3CQZ C;  1ZVU A;  4C2M C;  3FKI K;  3Q3Q A;  4LQY A;  4LR2 A;  2R92 K;  1DD5 A;  4GTA A;  2E2J K;  3CQZ A;  2O5J A;  4ILD A;  4AYB L;  3HOZ C;  1IBA A;  3OEP A;  2Y0S D;  1WQH A;  1USO A;  2GSO A;  1IW7 A;  3K7A K;  4C2M K;  5IOQ A;  2YU9 C;  2JA5 C;  2XCQ A;  2R93 K;  5IP7 C;  3GTK C;  1PJ7 A;  3S0X A;  4A3E K;  1WOR A;  1JOE A;  3HOX C;  2YU9 A;  3HOY K;  1DCO A;  3HOZ K;  2JA5 A;  4BBS C;  1F9N A;  1O29 A;  1SFO C;  3GTK A;  2WAQ L;  4A93 K;  2NVT K;  4BLA A;  5IOR A;  4BY1 K;  5M3F K;  3LAP A;  5C4J K;  1SFO A;  3HOV C;  5E68 A; 
#chains in the Genus database with same CATH homology
 4KAT A;  3MML B;  4KM9 A;  3V4G A;  1B4A A;  4KMD A;  3GTG A;  2NVY A;  3AQO A;  3N3Y A;  1O28 A;  2CFA B;  3LAJ A;  1WQF A;  1IS1 A;  1AB4 A;  2E2I A;  5CJ9 A;  4KAS A;  1EK8 A;  3N0C A;  3BUE A;  4KC6 A;  2RGR A;  3ERE D;  3GTJ A;  1ISE A;  3FOF A;  3GTL A;  1O2B A;  1TWC A;  1ZBS A;  2KWA A;  1EH1 A;  4GTC A;  4KAW X;  3GTM A;  3N0B A;  1O27 A;  3QX3 A;  1I50 A;  2NVX A;  2XCO A;  4M1X A;  3NUH A;  2VUM A;  3L4K A;  3GTO A;  1TWG A;  3CAG A;  3FHZ A;  2ZFZ A;  2JA7 A;  4KM8 A;  4GTE A;  5IOT A;  1WQG A;  4KMA A;  4KAR A;  1O24 A;  4P5B A;  5IOS A;  1O25 A;  2P5M A;  4GTB A;  2RH6 A;  4C3I C;  3AQP A;  2GSN A;  1R9T A;  1Y1W A;  2XCR B;  4GTL A;  2GSU A;  2Y3P A;  1BJT A;  3LPX A;  4P5A A;  2E2H A;  4BKW A;  1I3Q A;  3AH5 A;  3G4A A;  2B63 A;  1K83 A;  5TJ3 A;  4C3J C;  3GTQ A;  4KB4 A;  1WIH A;  4GT9 A;  4DDQ A;  1ZVU A;  4C2M C;  3Q3Q A;  1Y1V A;  3ORE A;  4LQY A;  4LR2 A;  1DD5 A;  4GTA A;  5EGE A;  2CFA A;  1XXA A;  4KB2 A;  3CQZ A;  5EGH A;  3L4J A;  4FM9 A;  4ILD A;  3VA7 A;  4G0W A;  3FKI A;  3G4C A;  2R92 A;  3GTP A;  2PHC B;  5CHP A;  1O2A A;  3OEP A;  1GE9 A;  1B4B A;  1TWA A;  1WQH A;  3OPF A;  4FZB A;  5JFE A;  2GSO A;  1XXC A;  1ZXO A;  3H0G A;  5IOQ A;  4GTD A;  4G0V A;  2XCQ A;  4C3H C;  3S0X A;  1TWH A;  1TWF A;  5JVO A;  1BGW A;  1XXB A;  3FOE A;  2JH3 A;  4G0U A;  1O26 A;  2YU9 A;  2JA5 A;  4GFQ A;  1F9N A;  1O29 A;  3GTK A;  2R93 A;  4BLB A;  2R7Z A;  4BLA A;  1WCM A;  5IOR A;  4KDD A;  2JA6 A;  1KQ4 A;  3LAP A;  1SFO A;  4KMH A;  4J3N A;  4GTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...