1O29A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o29A00
4GTDA 5CHPA 3N3YA 5IOTA 4GTFA 5JFEA 1KQ4A 3G4AA 2CFAB 4P5AA 1O28A 4KARA 5IOQA 4GT9A 3N0CA 3G4CA 1O2AA 5IOSA 4GTBA 2CFAA 1O27A 4FZBA 1O24A 4P5BA 1O25A 1O2BA 4GTCA 3AH5A 4GTAA 3N0BA 4GTLA 4KASA 4KATA 5IORA 1O29A 1O26A 4GTEA
chains in the Genus database with same CATH superfamily
3MMLB 1R9TC 4A3GC 1SFOK 1I50C 2Y0SD 5IP7C 4Y7NC 2ZFZA 3GEHA 3S17C 2YU9A 1YNNA 5C4JK 1TWAA 4PAAA 4MEYA 4XSXA 1IS1A 1EI6A 2R93K 2PMZL 4AYBL 3GDZA 4FM9A 3S2DK 4A3LC 4A3MK 3S15C 3Q3QA 5L46A 3PO3C 3GTMC 1ZVUA 4BBSC 3HOVC 1KQ4A 3CQZC 4A3EC 3WODA 1TWGA 1XPPA 4LK0A 3S1MC 3N0CA 1J6VA 1IW7A 1EQRA 1VH2A 3GTKK 1ISEA 4BBRK 4PABA 4C3IK 3GTPA 2JA6K 4BY1K 4Q4ZA 2E2IC 5C4XK 3HOWK 1JVIA 5JVOA 1VLOA 2BE5A 2PA8L 2WAQD 3AH5A 4YFNA 1DD5A 5IORA 1WIHA 1F93A 1R9TA 2JA8K 4RMFA 3IPJA 3RZDK 1VRQC 5IOTA 2Y0SL 4MQ9A 2W7VA 1YNJA 1WQGA 1TWFK 4KARA 2PA8D 4XSZA 5IOQA 4A3JC 1I3QC 4Y52K 4QJVA 2Y3PA 3QX3A 5FLMK 5IP9C 3T02A 2JA5C 4P5BA 2PPBA 4KB4A 2VUMA 3GTMK 4BY7K 1USMA 4C3HC 3N0BA 3CQZA 4KASA 2NVYA 3LPXA 3CQZK 1XXAA 5EGHA 3S14K 3GTMA 3N3YA 2RGRA 1DCOA 3GTPC 1DCPA 5M3MK 4C2MC 4O2DA 3AQOA 5IP7K 4GTBA 5C4JC 2XCRB 4KB2A 1G51A 4ILDA 3GTJA 1ZBSA 5CJ9A 1SMYA 4A3MC 3S15K 1DCHA 1ZQ1C 2NVQC 2B63K 4A3JK 1AB4A 2A68A 3TFJA 5CHPA 2YU9K 5FLMC 1TWHK 4BXXC 1I50A 3A8IA 1PJ6A 1F7VA 4A3IC 1Y1VA 4NOIA 5IOSA 2NVXK 2NVXA 3DXJA 3GSIA 1PJ7A 1YX2A 1I50K 1SFOC 4KMUA 1F7UA 3BP8C 4MEXA 3HOUC 2R92K 4BBRC 3S17K 4BLAA 2WB1L 4KATA 1VGXA 1O26A 1USOA 4A3KC 4XLPA 4LOWA 1VJEA 2V6SA 4BKWA 3G4AA 2PMZD 4AYBD 5IP9K 3H3VD 1B4BA 1EK8A 3PO2C 1TWFC 3BUEA 4DDQA 3EQLA 1R9TK 1Y1WK 5IYDK 1INNA 5FJ8K 3I4MC 4X6AK 1XXCA 4YFXA 2KWAA 2GSUA 4A93C 4KN4A 1GE9A 3S16K 2R92A 1J6WA 3HOWC 3GTPK 2JA6C 4A3FC 3ERED 3SZZA 4OINA 2WB1D 2JA8C 1TWGK 4QJVB 3HOXK 1O2AA 4G0UA 4C3JK 2R92C 5TMCA 1TWCC 2E2JK 2FQOA 4G7OA 4KM8A 3I4NC 4YG2A 4WJ4A 3LAPA 2R93A 4LQYA 4GTCA 1YCLA 2R7ZC 3A8KA 5M5YK 3GTOC 1TWAK 1B4AA 1TWCA 5C3EC 4C3IC 3S1NK 3NUHA 4P5AA 2CFAB 4JK1A 4KAWX 3S1RK 1ZYRA 3H3VL 4GT9A 1X31C 3AD8C 4OIOA 5TMFA 3HOUK 1XZQB 1O27A 3H0GA 4BLBA 1F9NA 3CAGA 5TJ3A 1I6HC 2E2HC 2RH6A 1WQFA 4WJ3M 4LLGA 4Y52C 2VUMK 2NVTC 3PO3K 2P5MA 3HOVK 5JFEA 2PHCB 2JH3A 1WSRA 1IL2A 1XXBA 4XLNA 2A6EA 1Y1VC 3I4MK 4X6AC 1JQWA 2YU9C 3S14C 1WORA 2B63A 3S16C 1WQHA 1TWAC 2GSNA 1O2FB 4ZH4A 3AD7C 3RZOK 3GTOA 3AD9C 1JOEA 5IYCC 1WCMK 4KC6A 4LR2A 1IBAA 3G4CA 2E2HA 1I3QK 2E2HK 3I4NK 3H0GC 3JSTA 5C44C 3FOEA 1O24A 3FHZA 4XCHA 2GSOA 3A8JA 3GTGA 4GZYA 3PO2K 3GTOK 5IYBC 4A3CC 1TWCK 1I6VA 3GTQC 3S2HC 1BJTA 3S1NC 4A3DK 3S1RC 4QIWL 3GTJK 1EFWA 4BBSK 5IYDC 3M4OK 4P9SA 3VA7A 1HQMA 4AH6A 3GTLC 3FKIK 2CFAA 2A69A 4G7ZA 3HOYK 3GEIA 4G0WA 3GEEA 2O5IA 2NVYC 3ADAC 1K83A 1C0AA 4G0VA 1HI9A 4GTLA 3GTGK 2VUMC 4C3JC 2R7ZA 3RZDC 2E2JC 1IE0A 1Y1WC 3OEPA 3K7AK 3H0GK 5C44K 1Y1VK 4YFKA 2R93C 1TWHA 2O5JA 1BS2A 4M1XA 4A3LK 5IYBK 4FZBA 4A3FK 4KMAA 2FQTA 1IQ0A 3M3YC 4GTAA 4C45A 3RZOC 3LAJA 1O29A 1WOPA 4GTEA 4KDDA 2V6UA 2E2IA 4QIWD 3SZYA 4A3KK 4LK1A 4GTDA 4BY1C 5M3FK 1I6HK 2P8TA 5IYCK 2CW0A 1O28A 5M5WK 4KN7A 4WILA 1WCMC 1SFOA 3TTGA 1L0WA 2ZUFA 3BP3A 4OIQA 1V5VA 3T00A 1K83C 3HOZC 4A3BK 3L4JA 3S1QK 3GTQK 3S0XA 2NVQK 1ZXOA 1BGWA 1XZPB 3S1MK 4A3GK 1WOOA 1Y1WA 2EBBA 2JA7C 3FKIA 4C3HK 1XZQA 5M5XK 1TWFA 4Y7NK 4GFQA 4OIRA 4LJZA 1EH1A 2NVTK 3OREA 3S2DC 5HL8A 2D6FC 1BDFA 3HOYC 4OIPA 3GTGC 4KMDA 2JA6A 3GTQA 2NVYK 3TFIA 1RU0A 2JA5K 1PJ5A 1WSVA 4GTFA 3K7AC 5C3EK 3GTKA 1I3QA 3L4KA 2GAHC 3HOZK 3HXAA 1XZPA 1WCMA 2B63C 4A3DC 3HKZD 2JA5A 4BY7C 1UV7A 1J98A 3M3YK 1O25A 2E2IK 3GTKC 3S1QC 2WAQL 4A93K 3GTLK 2JA7A 4C2MK 2JA7K 3FKIC 3AQPA 3HKZL 3GTLA 2V6TA 4J3NA 4G7HA 2A6HA 5E68A 4A3BC 1TWGC 3HOXC 4A3CK 4KM9A 3V4GA 3TFHA 3FOFA 3S2HK 5EGEA 4A3EK 4Q5SA 1J6XA 2ZUEA 3OPFA 3GTJC 3M4OC 3T01A 4KMHA 1WOSA 2XCOA 3GIRA 2XCQA 5D4DA 1O2BA 2R7ZK 2GAGC 4A3IK 1TWHC 4BXXK 2NVXC 1K83K 5C4XC
chains in the Genus database with same CATH topology
3MMLB 4GTDA 5CHPA 2P5MA 5JFEA 1O28A 2PHCB 2JH3A 1I50A 2ZFZA 1Y1VA 5IOSA 1XXBA 2NVXA 1SFOA 2YU9A 1TWAA 2B63A 1IS1A 1WQHA 2GSNA 3L4JA 3S0XA 1ZXOA 1BGWA 4BLAA 4KATA 4FM9A 1O26A 3GTOA 3Q3QA 1ZVUA 4BKWA 1Y1WA 1KQ4A 3G4AA 3FKIA 1TWGA 4KC6A 4LR2A 3N0CA 1TWFA 3G4CA 4GFQA 2E2HA 1B4BA 1EK8A 1EH1A 3BUEA 3FOEA 1ISEA 4DDQA 1O24A 3GTPA 3FHZA 3OREA 2GSOA 3GTGA 1XXCA 5JVOA 2KWAA 3AH5A 2GSUA 1DD5A 4KMDA 5IORA 1BJTA 1GE9A 2R92A 1WIHA 2JA6A 3GTQA 1R9TA 5IOTA 4GTFA 3ERED 3VA7A 3GTKA 1I3QA 3L4KA 1WQGA 4KARA 5IOQA 1O2AA 1WCMA 2Y3PA 4G0UA 3QX3A 2JA5A 2CFAA 4P5BA 1O25A 4G0WA 4KM8A 4KB4A 2VUMA 3LAPA 2R93A 4LQYA 4GTCA 1K83A 4C3HC 4G0VA 3N0BA 4GTLA 3CQZA 4KASA 2NVYA 3LPXA 3GTLA 4C3JC 1XXAA 3AQPA 2JA7A 5EGHA 2R7ZA 1B4AA 1TWCA 3GTMA 3N3YA 4J3NA 4C3IC 2RGRA 3OEPA 3NUHA 4P5AA 2CFAB 4KAWX 4GT9A 4KM9A 3V4GA 3FOFA 4C2MC 1TWHA 4M1XA 5EGEA 3AQOA 4GTBA 1O27A 3H0GA 4FZBA 4BLBA 3OPFA 1F9NA 3CAGA 5TJ3A 4KMAA 2XCRB 4KB2A 4KMHA 4ILDA 2XCOA 3GTJA 1ZBSA 2XCQA 1O2BA 2RH6A 5CJ9A 1WQFA 4GTAA 3LAJA 1O29A 4GTEA 4KDDA 2E2IA 1AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTD A;  5CHP A;  3N3Y A;  5IOT A;  4GTF A;  5JFE A;  1KQ4 A;  3G4A A;  2CFA B;  4P5A A;  1O28 A;  4KAR A;  5IOQ A;  4GT9 A;  3N0C A;  3G4C A;  1O2A A;  5IOS A;  4GTB A;  2CFA A;  1O27 A;  4FZB A;  1O24 A;  4P5B A;  1O25 A;  1O2B A;  4GTC A;  3AH5 A;  4GTA A;  3N0B A;  4GTL A;  4KAS A;  4KAT A;  5IOR A;  1O29 A;  1O26 A;  4GTE A; 
#chains in the Genus database with same CATH topology
 3MML B;  1R9T C;  4A3G C;  1SFO K;  1I50 C;  2Y0S D;  5IP7 C;  4Y7N C;  2ZFZ A;  3GEH A;  3S17 C;  2YU9 A;  1YNN A;  5C4J K;  1TWA A;  4PAA A;  4MEY A;  4XSX A;  1IS1 A;  1EI6 A;  2R93 K;  2PMZ L;  4AYB L;  3GDZ A;  4FM9 A;  3S2D K;  4A3L C;  4A3M K;  3S15 C;  3Q3Q A;  5L46 A;  3PO3 C;  3GTM C;  1ZVU A;  4BBS C;  3HOV C;  1KQ4 A;  3CQZ C;  4A3E C;  3WOD A;  1TWG A;  1XPP A;  4LK0 A;  3S1M C;  3N0C A;  1J6V A;  1IW7 A;  1EQR A;  1VH2 A;  3GTK K;  1ISE A;  4BBR K;  4PAB A;  4C3I K;  3GTP A;  2JA6 K;  4BY1 K;  4Q4Z A;  2E2I C;  5C4X K;  3HOW K;  1JVI A;  5JVO A;  1VLO A;  2BE5 A;  2PA8 L;  2WAQ D;  3AH5 A;  4YFN A;  1DD5 A;  5IOR A;  1WIH A;  1F93 A;  1R9T A;  2JA8 K;  4RMF A;  3IPJ A;  3RZD K;  1VRQ C;  5IOT A;  2Y0S L;  4MQ9 A;  2W7V A;  1YNJ A;  1WQG A;  1TWF K;  4KAR A;  2PA8 D;  4XSZ A;  5IOQ A;  4A3J C;  1I3Q C;  4Y52 K;  4QJV A;  2Y3P A;  3QX3 A;  5FLM K;  5IP9 C;  3T02 A;  2JA5 C;  4P5B A;  2PPB A;  4KB4 A;  2VUM A;  3GTM K;  4BY7 K;  1USM A;  4C3H C;  3N0B A;  3CQZ A;  4KAS A;  2NVY A;  3LPX A;  3CQZ K;  1XXA A;  5EGH A;  3S14 K;  3GTM A;  3N3Y A;  2RGR A;  1DCO A;  3GTP C;  1DCP A;  5M3M K;  4C2M C;  4O2D A;  3AQO A;  5IP7 K;  4GTB A;  5C4J C;  2XCR B;  4KB2 A;  1G51 A;  4ILD A;  3GTJ A;  1ZBS A;  5CJ9 A;  1SMY A;  4A3M C;  3S15 K;  1DCH A;  1ZQ1 C;  2NVQ C;  2B63 K;  4A3J K;  1AB4 A;  2A68 A;  3TFJ A;  5CHP A;  2YU9 K;  5FLM C;  1TWH K;  4BXX C;  1I50 A;  3A8I A;  1PJ6 A;  1F7V A;  4A3I C;  1Y1V A;  4NOI A;  5IOS A;  2NVX K;  2NVX A;  3DXJ A;  3GSI A;  1PJ7 A;  1YX2 A;  1I50 K;  1SFO C;  4KMU A;  1F7U A;  3BP8 C;  4MEX A;  3HOU C;  2R92 K;  4BBR C;  3S17 K;  4BLA A;  2WB1 L;  4KAT A;  1VGX A;  1O26 A;  1USO A;  4A3K C;  4XLP A;  4LOW A;  1VJE A;  2V6S A;  4BKW A;  3G4A A;  2PMZ D;  4AYB D;  5IP9 K;  3H3V D;  1B4B A;  1EK8 A;  3PO2 C;  1TWF C;  3BUE A;  4DDQ A;  3EQL A;  1R9T K;  1Y1W K;  5IYD K;  1INN A;  5FJ8 K;  3I4M C;  4X6A K;  1XXC A;  4YFX A;  2KWA A;  2GSU A;  4A93 C;  4KN4 A;  1GE9 A;  3S16 K;  2R92 A;  1J6W A;  3HOW C;  3GTP K;  2JA6 C;  4A3F C;  3ERE D;  3SZZ A;  4OIN A;  2WB1 D;  2JA8 C;  1TWG K;  4QJV B;  3HOX K;  1O2A A;  4G0U A;  4C3J K;  2R92 C;  5TMC A;  1TWC C;  2E2J K;  2FQO A;  4G7O A;  4KM8 A;  3I4N C;  4YG2 A;  4WJ4 A;  3LAP A;  2R93 A;  4LQY A;  4GTC A;  1YCL A;  2R7Z C;  3A8K A;  5M5Y K;  3GTO C;  1TWA K;  1B4A A;  1TWC A;  5C3E C;  4C3I C;  3S1N K;  3NUH A;  4P5A A;  2CFA B;  4JK1 A;  4KAW X;  3S1R K;  1ZYR A;  3H3V L;  4GT9 A;  1X31 C;  3AD8 C;  4OIO A;  5TMF A;  3HOU K;  1XZQ B;  1O27 A;  3H0G A;  4BLB A;  1F9N A;  3CAG A;  5TJ3 A;  1I6H C;  2E2H C;  2RH6 A;  1WQF A;  4WJ3 M;  4LLG A;  4Y52 C;  2VUM K;  2NVT C;  3PO3 K;  2P5M A;  3HOV K;  5JFE A;  2PHC B;  2JH3 A;  1WSR A;  1IL2 A;  1XXB A;  4XLN A;  2A6E A;  1Y1V C;  3I4M K;  4X6A C;  1JQW A;  2YU9 C;  3S14 C;  1WOR A;  2B63 A;  3S16 C;  1WQH A;  1TWA C;  2GSN A;  1O2F B;  4ZH4 A;  3AD7 C;  3RZO K;  3GTO A;  3AD9 C;  1JOE A;  5IYC C;  1WCM K;  4KC6 A;  4LR2 A;  1IBA A;  3G4C A;  2E2H A;  1I3Q K;  2E2H K;  3I4N K;  3H0G C;  3JST A;  5C44 C;  3FOE A;  1O24 A;  3FHZ A;  4XCH A;  2GSO A;  3A8J A;  3GTG A;  4GZY A;  3PO2 K;  3GTO K;  5IYB C;  4A3C C;  1TWC K;  1I6V A;  3GTQ C;  3S2H C;  1BJT A;  3S1N C;  4A3D K;  3S1R C;  4QIW L;  3GTJ K;  1EFW A;  4BBS K;  5IYD C;  3M4O K;  4P9S A;  3VA7 A;  1HQM A;  4AH6 A;  3GTL C;  3FKI K;  2CFA A;  2A69 A;  4G7Z A;  3HOY K;  3GEI A;  4G0W A;  3GEE A;  2O5I A;  2NVY C;  3ADA C;  1K83 A;  1C0A A;  4G0V A;  1HI9 A;  4GTL A;  3GTG K;  2VUM C;  4C3J C;  2R7Z A;  3RZD C;  2E2J C;  1IE0 A;  1Y1W C;  3OEP A;  3K7A K;  3H0G K;  5C44 K;  1Y1V K;  4YFK A;  2R93 C;  1TWH A;  2O5J A;  1BS2 A;  4M1X A;  4A3L K;  5IYB K;  4FZB A;  4A3F K;  4KMA A;  2FQT A;  1IQ0 A;  3M3Y C;  4GTA A;  4C45 A;  3RZO C;  3LAJ A;  1O29 A;  1WOP A;  4GTE A;  4KDD A;  2V6U A;  2E2I A;  4QIW D;  3SZY A;  4A3K K;  4LK1 A;  4GTD A;  4BY1 C;  5M3F K;  1I6H K;  2P8T A;  5IYC K;  2CW0 A;  1O28 A;  5M5W K;  4KN7 A;  4WIL A;  1WCM C;  1SFO A;  3TTG A;  1L0W A;  2ZUF A;  3BP3 A;  4OIQ A;  1V5V A;  3T00 A;  1K83 C;  3HOZ C;  4A3B K;  3L4J A;  3S1Q K;  3GTQ K;  3S0X A;  2NVQ K;  1ZXO A;  1BGW A;  1XZP B;  3S1M K;  4A3G K;  1WOO A;  1Y1W A;  2EBB A;  2JA7 C;  3FKI A;  4C3H K;  1XZQ A;  5M5X K;  1TWF A;  4Y7N K;  4GFQ A;  4OIR A;  4LJZ A;  1EH1 A;  2NVT K;  3ORE A;  3S2D C;  5HL8 A;  2D6F C;  1BDF A;  3HOY C;  4OIP A;  3GTG C;  4KMD A;  2JA6 A;  3GTQ A;  2NVY K;  3TFI A;  1RU0 A;  2JA5 K;  1PJ5 A;  1WSV A;  4GTF A;  3K7A C;  5C3E K;  3GTK A;  1I3Q A;  3L4K A;  2GAH C;  3HOZ K;  3HXA A;  1XZP A;  1WCM A;  2B63 C;  4A3D C;  3HKZ D;  2JA5 A;  4BY7 C;  1UV7 A;  1J98 A;  3M3Y K;  1O25 A;  2E2I K;  3GTK C;  3S1Q C;  2WAQ L;  4A93 K;  3GTL K;  2JA7 A;  4C2M K;  2JA7 K;  3FKI C;  3AQP A;  3HKZ L;  3GTL A;  2V6T A;  4J3N A;  4G7H A;  2A6H A;  5E68 A;  4A3B C;  1TWG C;  3HOX C;  4A3C K;  4KM9 A;  3V4G A;  3TFH A;  3FOF A;  3S2H K;  5EGE A;  4A3E K;  4Q5S A;  1J6X A;  2ZUE A;  3OPF A;  3GTJ C;  3M4O C;  3T01 A;  4KMH A;  1WOS A;  2XCO A;  3GIR A;  2XCQ A;  5D4D A;  1O2B A;  2R7Z K;  2GAG C;  4A3I K;  1TWH C;  4BXX K;  2NVX C;  1K83 K;  5C4X C; 
#chains in the Genus database with same CATH homology
 3MML B;  4GTD A;  5CHP A;  2P5M A;  5JFE A;  1O28 A;  2PHC B;  2JH3 A;  1I50 A;  2ZFZ A;  1Y1V A;  5IOS A;  1XXB A;  2NVX A;  1SFO A;  2YU9 A;  1TWA A;  2B63 A;  1IS1 A;  1WQH A;  2GSN A;  3L4J A;  3S0X A;  1ZXO A;  1BGW A;  4BLA A;  4KAT A;  4FM9 A;  1O26 A;  3GTO A;  3Q3Q A;  1ZVU A;  4BKW A;  1Y1W A;  1KQ4 A;  3G4A A;  3FKI A;  1TWG A;  4KC6 A;  4LR2 A;  3N0C A;  1TWF A;  3G4C A;  4GFQ A;  2E2H A;  1B4B A;  1EK8 A;  1EH1 A;  3BUE A;  3FOE A;  1ISE A;  4DDQ A;  1O24 A;  3GTP A;  3FHZ A;  3ORE A;  2GSO A;  3GTG A;  1XXC A;  5JVO A;  2KWA A;  3AH5 A;  2GSU A;  1DD5 A;  4KMD A;  5IOR A;  1BJT A;  1GE9 A;  2R92 A;  1WIH A;  2JA6 A;  3GTQ A;  1R9T A;  5IOT A;  4GTF A;  3ERE D;  3VA7 A;  3GTK A;  1I3Q A;  3L4K A;  1WQG A;  4KAR A;  5IOQ A;  1O2A A;  1WCM A;  2Y3P A;  4G0U A;  3QX3 A;  2JA5 A;  2CFA A;  4P5B A;  1O25 A;  4G0W A;  4KM8 A;  4KB4 A;  2VUM A;  3LAP A;  2R93 A;  4LQY A;  4GTC A;  1K83 A;  4C3H C;  4G0V A;  3N0B A;  4GTL A;  3CQZ A;  4KAS A;  2NVY A;  3LPX A;  3GTL A;  4C3J C;  1XXA A;  3AQP A;  2JA7 A;  5EGH A;  2R7Z A;  1B4A A;  1TWC A;  3GTM A;  3N3Y A;  4J3N A;  4C3I C;  2RGR A;  3OEP A;  3NUH A;  4P5A A;  2CFA B;  4KAW X;  4GT9 A;  4KM9 A;  3V4G A;  3FOF A;  4C2M C;  1TWH A;  4M1X A;  5EGE A;  3AQO A;  4GTB A;  1O27 A;  3H0G A;  4FZB A;  4BLB A;  3OPF A;  1F9N A;  3CAG A;  5TJ3 A;  4KMA A;  2XCR B;  4KB2 A;  4KMH A;  4ILD A;  2XCO A;  3GTJ A;  1ZBS A;  2XCQ A;  1O2B A;  2RH6 A;  5CJ9 A;  1WQF A;  4GTA A;  3LAJ A;  1O29 A;  4GTE A;  4KDD A;  2E2I A;  1AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...