1O29A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o29A00
1O25A 1O26A 4GTFA 5JFEA 4KATA 4KARA 4GTBA 2CFAA 4KASA 3AH5A 3G4AA 1O29A 5IOTA 4GTAA 1O28A 5IORA 2CFAB 4P5BA 3G4CA 1O27A 5CHPA 4GTLA 1KQ4A 4GTDA 4P5AA 4GTEA 4GTCA 1O2AA 3N0BA 4GT9A 3N0CA 4FZBA 5IOSA 1O24A 3N3YA 5IOQA 1O2BA
chains in the Genus database with same CATH superfamily
4LK0A 4LLGA 4C2MK 3MMLB 1F7UA 4YG2A 2JA5A 3HOUK 2XCOA 3AH5A 4Y52K 4BBRC 2A68A 2NVXA 4G0VA 1BDFA 2YU9A 2PPBA 2R7ZK 3RZOC 4KM9A 1PJ5A 2R92A 1USOA 2JA8C 1TWGA 1I50C 4Q4ZA 4Q5SA 1WORA 1C0AA 4C2MC 1JQWA 2WAQD 3RZDC 1ZYRA 2ZFZA 3HOUC 4KDDA 4Y52C 3A8IA 3GDZA 4KC6A 2GSNA 4XLPA 4A3EK 3TFJA 2FQTA 4KASA 4XSZA 1IL2A 2R7ZC 5IOTA 1WCMA 3AD8C 2PMZD 1EH1A 2NVTC 3S1MK 1J6VA 3HOYK 5C3EK 5C4XC 1SMYA 3H3VL 3A8JA 4KMDA 1YCLA 4A3EC 1O25A 1O26A 4JK1A 4LK1A 5TJ3A 1X31C 3LPXA 2JA6K 4X6AK 3GTQK 4QIWL 3G4AA 2E2JK 4YFNA 3S1MC 3AQOA 2JA7A 3HOYC 4GTAA 5C3EC 4BLBA 4P5BA 2RH6A 4G7ZA 1TWCA 4G7OA 1DD5A 1XZPA 3GSIA 4WILA 3PO2K 1ISEA 3CQZK 4A3DK 1F93A 5IOSA 4G0UA 1ZVUA 2JA6C 4X6AC 3GTQC 1WQHA 4RMFA 2E2JC 4KN4A 3GTKK 2WB1D 2JA5K 5JVOA 1IBAA 2E2IC 4BXXK 5IYCK 5M3FK 1ZBSA 2NVXK 3LAJA 3I4NK 3S16K 3PO2C 3CQZC 3Q3QA 4XSXA 4A3DC 5IYDC 3LAPA 1I3QA 5IP7K 4QJVB 5EGHA 3GTGK 3GTKC 5IYCC 3S17K 1RU0A 4GTBA 5HL8A 2V6UA 3JSTA 3I4NC 3SZZA 3S16C 1BGWA 4A3KK 1WSRA 4P5AA 5C44K 3GTPK 5IP7C 1ZQ1C 4A3IK 4FM9A 3GTGC 3HOXK 3S17C 1O2BA 4GFQA 5C4JK 4BBSC 1XZQA 5JFEA 1JOEA 4KARA 4MQ9A 1EI6A 1SFOA 4AYBD 3HOVK 3T00A 3TFHA 3OPFA 4A3KC 3S1QC 4MEYA 5C44C 2FQOA 1Y1VA 3GTPC 2PHCB 3DXJA 4G7HA 1Y1WA 2NVYK 4A3IC 4A3GK 4LJZA 4A3JK 2V6SA 3HOXC 2WAQL 3GTJA 1VRQC 3FKIK 2R93A 4FZBA 5C4JC 1WQFA 3GTLA 4BKWA 5TMCA 3HOVC 3GTMK 4YFXA 1AB4A 3S14K 2PMZL 1BS2A 3GTOA 2KWAA 1L0WA 2NVYC 4A3JC 1WOPA 4QJVA 1IW7A 1K83A 3S15K 4PAAA 2A6HA 3V4GA 1KQ4A 4ZH4A 4GTLA 2E2HK 3FKIC 4KN7A 1O2AA 1XXBA 1EQRA 3S1NK 2EBBA 2VUMA 2B63A 2JH3A 3GTMC 4OIPA 1VLOA 3H0GK 1WSVA 3BP3A 3S14C 3S2DK 1TWAK 4ILDA 5M3MK 3PO3K 3A8KA 3WODA 3IPJA 5M5XK 3S15C 2E2HC 1IE0A 2CFAB 4XLNA 3G4CA 2P5MA 3GEIA 3S1NC 1B4BA 1DCHA 4GTEA 4KB4A 5FLMK 1V5VA 1TWFK 1I50A 1INNA 1HQMA 3H0GC 1YNNA 3S2DC 4A93K 1TWAC 2WB1L 4GTFA 3PO3C 5CJ9A 4OIRA 2R7ZA 2PA8D 5IORA 5FLMC 2YU9K 1TWFC 4OINA 4A3BK 3BP8C 2R92K 4A93C 1R9TA 1TWGK 1PJ7A 1F7VA 1O24A 3N3YA 1JVIA 3AD9C 3GTLK 4C3JK 2JA5C 3HOZK 3QX3A 1TWHA 4BXXC 1IQ0A 1F9NA 2NVXC 2YU9C 2P8TA 1J6WA 2GSUA 1WCMK 4A3BC 4KAWX 1O27A 4MEXA 2R92C 1G51A 4G0WA 1TWGC 3VA7A 3HKZD 3S1RK 3L4KA 3L4JA 2Y0SD 4C3JC 3OREA 3HOZC 2JA6A 1GE9A 1DCPA 3GTQA 4KMAA 1O2FB 3T02A 4AYBL 5IYBK 1WQGA 4A3FK 5M5YK 3M4OK 3TTGA 3FHZA 1WCMC 2E2IA 1PJ6A 3S2HK 4A3LK 1XPPA 3AQPA 4C3IK 1WIHA 2JA7K 3S1RC 4GTDA 3CQZA 1TWCK 2JA8K 3HOWK 5FJ8K 4A3CK 3HXAA 1HI9A 1XZPB 5IYBC 4A3FC 4BY1K 3GTKA 2W7VA 3M4OC 3ERED 3RZDK 4GZYA 1EFWA 4P9SA 2Y3PA 3S2HC 2BE5A 3T01A 3FOFA 4A3LC 3K7AK 2O5JA 4LOWA 4C3IC 1BJTA 5E68A 2JA7C 4KMHA 4DDQA 4A3GC 5CHPA 1TWCC 2NVTK 3HOWC 5C4XK 4A3CC 3N0BA 1UV7A 3EQLA 4BY1C 3GTGA 3N0CA 3ADAC 3GIRA 4M1XA 1XXCA 1R9TK 1I3QK 4C45A 3K7AC 3S0XA 2NVQK 1J98A 1TWHK 2XCQA 4KB2A 1WOSA 1DCOA 1O28A 4WJ3M 3I4MK 3GTPA 4OIOA 4BLAA 1J6XA 3OEPA 4C3HK 1R9TC 3NUHA 1I3QC 4GT9A 5EGEA 1USMA 2GAHC 4PABA 1I6VA 3H3VD 2NVQC 1TWHC 4YFKA 1VH2A 3BUEA 4Y7NK 2PA8L 3I4MC 4QIWD 2E2IK 1XZQB 1SFOK 2NVYA 5M5WK 2RGRA 4WJ4A 2CW0A 4C3HC 1Y1VK 3FKIA 1Y1WK 1YX2A 2GSOA 4LQYA 3GEEA 3GTJK 5IYDK 3GTMA 4XCHA 2R93K 1VJEA 4Y7NC 1SFOC 4NOIA 1YNJA 4OIQA 5D4DA 2XCRB 3M3YK 2E2HA 3GTOK 1Y1VC 1Y1WC 4BY7K 2D6FC 1IS1A 3HKZL 4LR2A 2ZUFA 2A6EA 4A3MK 2Y0SL 1K83K 4AH6A 5L46A 1WOOA 3GTJC 1I6HK 5IP9K 2R93C 3H0GA 4KMUA 3GTLC 3SZYA 4J3NA 4KM8A 5IOQA 2B63K 1ZXOA 2VUMK 1TWAA 4KATA 2CFAA 4BBSK 3M3YC 1VGXA 3TFIA 1XXAA 3GTOC 1O29A 3FOEA 4BY7C 1B4AA 3GEHA 2V6TA 4BBRK 2ZUEA 3AD7C 2A69A 3S1QK 5TMFA 4A3MC 1EK8A 1K83C 3CAGA 1TWFA 3RZOK 1I6HC 4O2DA 4GTCA 5IP9C 2O5IA 2VUMC 2B63C 1I50K 2GAGC
chains in the Genus database with same CATH topology
3MMLB 4GTFA 2JA5A 5CJ9A 4GTBA 3S0XA 2XCOA 3AH5A 2R7ZA 2XCQA 2NVXA 4G0VA 4KB2A 2YU9A 4KM9A 1O28A 1BGWA 5IORA 3GTPA 2R92A 4P5AA 4BLAA 1TWGA 3OEPA 3NUHA 4FM9A 4GT9A 4C2MC 1R9TA 1O24A 3N3YA 5EGEA 1O2BA 4GFQA 2ZFZA 4KDDA 4KC6A 5JFEA 2GSNA 3QX3A 1TWHA 4KARA 4KASA 1F9NA 3BUEA 1SFOA 5IOTA 1WCMA 3OPFA 2NVYA 2GSUA 1EH1A 2RGRA 1Y1VA 4KAWX 2PHCB 1O27A 1Y1WA 4C3HC 4M1XA 4G0WA 3FKIA 2GSOA 3VA7A 3GTJA 4LQYA 3L4KA 3L4JA 4C3JC 2R93A 4FZBA 3OREA 4KMDA 1WQFA 2JA6A 3GTLA 1GE9A 4BKWA 3GTMA 3GTQA 1O25A 1O26A 5TJ3A 4KMAA 3LPXA 1WQGA 1AB4A 3G4AA 3FHZA 2E2IA 3GTOA 3AQOA 2KWAA 2JA7A 2XCRB 4GTAA 2E2HA 4BLBA 3AQPA 2RH6A 1WIHA 4P5BA 1K83A 1TWCA 1KQ4A 1IS1A 4GTDA 1DD5A 3CQZA 4GTLA 4LR2A 3V4GA 1O2AA 1XXBA 1ISEA 2VUMA 2B63A 5IOSA 3H0GA 1ZVUA 4G0UA 4J3NA 2JH3A 4KM8A 5IOQA 1ZXOA 1WQHA 3GTKA 3ERED 1TWAA 4KATA 2Y3PA 3FOFA 2CFAA 5JVOA 1XXAA 4ILDA 1O29A 3FOEA 4C3IC 1BJTA 1ZBSA 1B4AA 3LAJA 4KMHA 2CFAB 4DDQA 1EK8A 3CAGA 3G4CA 1TWFA 2P5MA 5CHPA 1B4BA 4GTEA 4GTCA 3Q3QA 4KB4A 1I50A 3N0BA 3GTGA 3LAPA 1I3QA 3N0CA 1XXCA 5EGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O25 A;  1O26 A;  4GTF A;  5JFE A;  4KAT A;  4KAR A;  4GTB A;  2CFA A;  4KAS A;  3AH5 A;  3G4A A;  1O29 A;  5IOT A;  4GTA A;  1O28 A;  5IOR A;  2CFA B;  4P5B A;  3G4C A;  1O27 A;  5CHP A;  4GTL A;  1KQ4 A;  4GTD A;  4P5A A;  4GTE A;  4GTC A;  1O2A A;  3N0B A;  4GT9 A;  3N0C A;  4FZB A;  5IOS A;  1O24 A;  3N3Y A;  5IOQ A;  1O2B A; 
#chains in the Genus database with same CATH topology
 4LK0 A;  4LLG A;  4C2M K;  3MML B;  1F7U A;  4YG2 A;  2JA5 A;  3HOU K;  2XCO A;  3AH5 A;  4Y52 K;  4BBR C;  2A68 A;  2NVX A;  4G0V A;  1BDF A;  2YU9 A;  2PPB A;  2R7Z K;  3RZO C;  4KM9 A;  1PJ5 A;  2R92 A;  1USO A;  2JA8 C;  1TWG A;  1I50 C;  4Q4Z A;  4Q5S A;  1WOR A;  1C0A A;  4C2M C;  1JQW A;  2WAQ D;  3RZD C;  1ZYR A;  2ZFZ A;  3HOU C;  4KDD A;  4Y52 C;  3A8I A;  3GDZ A;  4KC6 A;  2GSN A;  4XLP A;  4A3E K;  3TFJ A;  2FQT A;  4KAS A;  4XSZ A;  1IL2 A;  2R7Z C;  5IOT A;  1WCM A;  3AD8 C;  2PMZ D;  1EH1 A;  2NVT C;  3S1M K;  1J6V A;  3HOY K;  5C3E K;  5C4X C;  1SMY A;  3H3V L;  3A8J A;  4KMD A;  1YCL A;  4A3E C;  1O25 A;  1O26 A;  4JK1 A;  4LK1 A;  5TJ3 A;  1X31 C;  3LPX A;  2JA6 K;  4X6A K;  3GTQ K;  4QIW L;  3G4A A;  2E2J K;  4YFN A;  3S1M C;  3AQO A;  2JA7 A;  3HOY C;  4GTA A;  5C3E C;  4BLB A;  4P5B A;  2RH6 A;  4G7Z A;  1TWC A;  4G7O A;  1DD5 A;  1XZP A;  3GSI A;  4WIL A;  3PO2 K;  1ISE A;  3CQZ K;  4A3D K;  1F93 A;  5IOS A;  4G0U A;  1ZVU A;  2JA6 C;  4X6A C;  3GTQ C;  1WQH A;  4RMF A;  2E2J C;  4KN4 A;  3GTK K;  2WB1 D;  2JA5 K;  5JVO A;  1IBA A;  2E2I C;  4BXX K;  5IYC K;  5M3F K;  1ZBS A;  2NVX K;  3LAJ A;  3I4N K;  3S16 K;  3PO2 C;  3CQZ C;  3Q3Q A;  4XSX A;  4A3D C;  5IYD C;  3LAP A;  1I3Q A;  5IP7 K;  4QJV B;  5EGH A;  3GTG K;  3GTK C;  5IYC C;  3S17 K;  1RU0 A;  4GTB A;  5HL8 A;  2V6U A;  3JST A;  3I4N C;  3SZZ A;  3S16 C;  1BGW A;  4A3K K;  1WSR A;  4P5A A;  5C44 K;  3GTP K;  5IP7 C;  1ZQ1 C;  4A3I K;  4FM9 A;  3GTG C;  3HOX K;  3S17 C;  1O2B A;  4GFQ A;  5C4J K;  4BBS C;  1XZQ A;  5JFE A;  1JOE A;  4KAR A;  4MQ9 A;  1EI6 A;  1SFO A;  4AYB D;  3HOV K;  3T00 A;  3TFH A;  3OPF A;  4A3K C;  3S1Q C;  4MEY A;  5C44 C;  2FQO A;  1Y1V A;  3GTP C;  2PHC B;  3DXJ A;  4G7H A;  1Y1W A;  2NVY K;  4A3I C;  4A3G K;  4LJZ A;  4A3J K;  2V6S A;  3HOX C;  2WAQ L;  3GTJ A;  1VRQ C;  3FKI K;  2R93 A;  4FZB A;  5C4J C;  1WQF A;  3GTL A;  4BKW A;  5TMC A;  3HOV C;  3GTM K;  4YFX A;  1AB4 A;  3S14 K;  2PMZ L;  1BS2 A;  3GTO A;  2KWA A;  1L0W A;  2NVY C;  4A3J C;  1WOP A;  4QJV A;  1IW7 A;  1K83 A;  3S15 K;  4PAA A;  2A6H A;  3V4G A;  1KQ4 A;  4ZH4 A;  4GTL A;  2E2H K;  3FKI C;  4KN7 A;  1O2A A;  1XXB A;  1EQR A;  3S1N K;  2EBB A;  2VUM A;  2B63 A;  2JH3 A;  3GTM C;  4OIP A;  1VLO A;  3H0G K;  1WSV A;  3BP3 A;  3S14 C;  3S2D K;  1TWA K;  4ILD A;  5M3M K;  3PO3 K;  3A8K A;  3WOD A;  3IPJ A;  5M5X K;  3S15 C;  2E2H C;  1IE0 A;  2CFA B;  4XLN A;  3G4C A;  2P5M A;  3GEI A;  3S1N C;  1B4B A;  1DCH A;  4GTE A;  4KB4 A;  5FLM K;  1V5V A;  1TWF K;  1I50 A;  1INN A;  1HQM A;  3H0G C;  1YNN A;  3S2D C;  4A93 K;  1TWA C;  2WB1 L;  4GTF A;  3PO3 C;  5CJ9 A;  4OIR A;  2R7Z A;  2PA8 D;  5IOR A;  5FLM C;  2YU9 K;  1TWF C;  4OIN A;  4A3B K;  3BP8 C;  2R92 K;  4A93 C;  1R9T A;  1TWG K;  1PJ7 A;  1F7V A;  1O24 A;  3N3Y A;  1JVI A;  3AD9 C;  3GTL K;  4C3J K;  2JA5 C;  3HOZ K;  3QX3 A;  1TWH A;  4BXX C;  1IQ0 A;  1F9N A;  2NVX C;  2YU9 C;  2P8T A;  1J6W A;  2GSU A;  1WCM K;  4A3B C;  4KAW X;  1O27 A;  4MEX A;  2R92 C;  1G51 A;  4G0W A;  1TWG C;  3VA7 A;  3HKZ D;  3S1R K;  3L4K A;  3L4J A;  2Y0S D;  4C3J C;  3ORE A;  3HOZ C;  2JA6 A;  1GE9 A;  1DCP A;  3GTQ A;  4KMA A;  1O2F B;  3T02 A;  4AYB L;  5IYB K;  1WQG A;  4A3F K;  5M5Y K;  3M4O K;  3TTG A;  3FHZ A;  1WCM C;  2E2I A;  1PJ6 A;  3S2H K;  4A3L K;  1XPP A;  3AQP A;  4C3I K;  1WIH A;  2JA7 K;  3S1R C;  4GTD A;  3CQZ A;  1TWC K;  2JA8 K;  3HOW K;  5FJ8 K;  4A3C K;  3HXA A;  1HI9 A;  1XZP B;  5IYB C;  4A3F C;  4BY1 K;  3GTK A;  2W7V A;  3M4O C;  3ERE D;  3RZD K;  4GZY A;  1EFW A;  4P9S A;  2Y3P A;  3S2H C;  2BE5 A;  3T01 A;  3FOF A;  4A3L C;  3K7A K;  2O5J A;  4LOW A;  4C3I C;  1BJT A;  5E68 A;  2JA7 C;  4KMH A;  4DDQ A;  4A3G C;  5CHP A;  1TWC C;  2NVT K;  3HOW C;  5C4X K;  4A3C C;  3N0B A;  1UV7 A;  3EQL A;  4BY1 C;  3GTG A;  3N0C A;  3ADA C;  3GIR A;  4M1X A;  1XXC A;  1R9T K;  1I3Q K;  4C45 A;  3K7A C;  3S0X A;  2NVQ K;  1J98 A;  1TWH K;  2XCQ A;  4KB2 A;  1WOS A;  1DCO A;  1O28 A;  4WJ3 M;  3I4M K;  3GTP A;  4OIO A;  4BLA A;  1J6X A;  3OEP A;  4C3H K;  1R9T C;  3NUH A;  1I3Q C;  4GT9 A;  5EGE A;  1USM A;  2GAH C;  4PAB A;  1I6V A;  3H3V D;  2NVQ C;  1TWH C;  4YFK A;  1VH2 A;  3BUE A;  4Y7N K;  2PA8 L;  3I4M C;  4QIW D;  2E2I K;  1XZQ B;  1SFO K;  2NVY A;  5M5W K;  2RGR A;  4WJ4 A;  2CW0 A;  4C3H C;  1Y1V K;  3FKI A;  1Y1W K;  1YX2 A;  2GSO A;  4LQY A;  3GEE A;  3GTJ K;  5IYD K;  3GTM A;  4XCH A;  2R93 K;  1VJE A;  4Y7N C;  1SFO C;  4NOI A;  1YNJ A;  4OIQ A;  5D4D A;  2XCR B;  3M3Y K;  2E2H A;  3GTO K;  1Y1V C;  1Y1W C;  4BY7 K;  2D6F C;  1IS1 A;  3HKZ L;  4LR2 A;  2ZUF A;  2A6E A;  4A3M K;  2Y0S L;  1K83 K;  4AH6 A;  5L46 A;  1WOO A;  3GTJ C;  1I6H K;  5IP9 K;  2R93 C;  3H0G A;  4KMU A;  3GTL C;  3SZY A;  4J3N A;  4KM8 A;  5IOQ A;  2B63 K;  1ZXO A;  2VUM K;  1TWA A;  4KAT A;  2CFA A;  4BBS K;  3M3Y C;  1VGX A;  3TFI A;  1XXA A;  3GTO C;  1O29 A;  3FOE A;  4BY7 C;  1B4A A;  3GEH A;  2V6T A;  4BBR K;  2ZUE A;  3AD7 C;  2A69 A;  3S1Q K;  5TMF A;  4A3M C;  1EK8 A;  1K83 C;  3CAG A;  1TWF A;  3RZO K;  1I6H C;  4O2D A;  4GTC A;  5IP9 C;  2O5I A;  2VUM C;  2B63 C;  1I50 K;  2GAG C; 
#chains in the Genus database with same CATH homology
 3MML B;  4GTF A;  2JA5 A;  5CJ9 A;  4GTB A;  3S0X A;  2XCO A;  3AH5 A;  2R7Z A;  2XCQ A;  2NVX A;  4G0V A;  4KB2 A;  2YU9 A;  4KM9 A;  1O28 A;  1BGW A;  5IOR A;  3GTP A;  2R92 A;  4P5A A;  4BLA A;  1TWG A;  3OEP A;  3NUH A;  4FM9 A;  4GT9 A;  4C2M C;  1R9T A;  1O24 A;  3N3Y A;  5EGE A;  1O2B A;  4GFQ A;  2ZFZ A;  4KDD A;  4KC6 A;  5JFE A;  2GSN A;  3QX3 A;  1TWH A;  4KAR A;  4KAS A;  1F9N A;  3BUE A;  1SFO A;  5IOT A;  1WCM A;  3OPF A;  2NVY A;  2GSU A;  1EH1 A;  2RGR A;  1Y1V A;  4KAW X;  2PHC B;  1O27 A;  1Y1W A;  4C3H C;  4M1X A;  4G0W A;  3FKI A;  2GSO A;  3VA7 A;  3GTJ A;  4LQY A;  3L4K A;  3L4J A;  4C3J C;  2R93 A;  4FZB A;  3ORE A;  4KMD A;  1WQF A;  2JA6 A;  3GTL A;  1GE9 A;  4BKW A;  3GTM A;  3GTQ A;  1O25 A;  1O26 A;  5TJ3 A;  4KMA A;  3LPX A;  1WQG A;  1AB4 A;  3G4A A;  3FHZ A;  2E2I A;  3GTO A;  3AQO A;  2KWA A;  2JA7 A;  2XCR B;  4GTA A;  2E2H A;  4BLB A;  3AQP A;  2RH6 A;  1WIH A;  4P5B A;  1K83 A;  1TWC A;  1KQ4 A;  1IS1 A;  4GTD A;  1DD5 A;  3CQZ A;  4GTL A;  4LR2 A;  3V4G A;  1O2A A;  1XXB A;  1ISE A;  2VUM A;  2B63 A;  5IOS A;  3H0G A;  1ZVU A;  4G0U A;  4J3N A;  2JH3 A;  4KM8 A;  5IOQ A;  1ZXO A;  1WQH A;  3GTK A;  3ERE D;  1TWA A;  4KAT A;  2Y3P A;  3FOF A;  2CFA A;  5JVO A;  1XXA A;  4ILD A;  1O29 A;  3FOE A;  4C3I C;  1BJT A;  1ZBS A;  1B4A A;  3LAJ A;  4KMH A;  2CFA B;  4DDQ A;  1EK8 A;  3CAG A;  3G4C A;  1TWF A;  2P5M A;  5CHP A;  1B4B A;  4GTE A;  4GTC A;  3Q3Q A;  4KB4 A;  1I50 A;  3N0B A;  3GTG A;  3LAP A;  1I3Q A;  3N0C A;  1XXC A;  5EGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...