1O29A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o29A00
5IORA 4P5AA 4KARA 3G4AA 4GTLA 1O27A 4FZBA 4GTEA 4P5BA 5IOSA 4GTAA 4KASA 1O25A 3N0BA 1O24A 1O2BA 5CHPA 4GTCA 3AH5A 1O2AA 1KQ4A 5IOQA 1O28A 4GTDA 4GTFA 5JFEA 3N0CA 2CFAB 3N3YA 1O29A 4GT9A 5IOTA 2CFAA 4GTBA 1O26A 3G4CA 4KATA
chains in the Genus database with same CATH superfamily
5IORA 5TJ3A 4A3DC 4A3CC 4Q4ZA 3S17K 4Y7NK 1YCLA 2D6FC 2JA5C 3GEHA 3S14K 3S1MK 2PA8D 4A3KC 3BP3A 3VA7A 4BBSK 4BKWA 3HOWK 3GTLA 3GTOA 2NVYK 2B63K 4A3EC 4A3IK 5IYCK 3GEIA 2E2IA 1BS2A 1O29A 4A93K 4C2MK 2BE5A 1F93A 1G51A 3GTMA 1ZVUA 1IW7A 4G0WA 3LAJA 4C45A 2GAHC 2A68A 2WAQD 3S17C 1O27A 3T02A 3H3VD 3S1MC 5D4DA 3S16K 4PABA 3A8JA 3CAGA 4LK0A 1VGXA 4XSZA 1I50A 3HOWC 1TWFC 2JA6K 4WJ3M 2NVYC 1K83K 2Y3PA 3PO2K 2B63C 4G7OA 3T00A 3LAPA 3GTQA 4OIPA 3M4OK 2NVXK 2R92A 2CFAA 1TWCA 1JOEA 1F7UA 5TMFA 3GTKK 3FHZA 2JA7K 3I4MC 3S16C 1O2FB 3S1QK 4A3GK 1I6VA 3I4NK 1TWAK 2O5IA 3HXAA 2R7ZA 2JA6C 1K83C 5L46A 3PO2C 1BJTA 2ZFZA 2E2JK 4OINA 2NVXC 1SFOK 2RH6A 4GTBA 4AYBD 3S2DK 1I3QK 1XXBA 1EK8A 4QIWD 4C3IK 3GTKC 1JVIA 5IP9K 3GTPK 3S1QC 2JA8C 3M3YC 2PMZD 4A3GC 1VJEA 4X6AC 3I4NC 1TWAC 4A3LK 3HOYK 1R9TC 1USOA 2CFAB 4M1XA 5M5WK 1ZYRA 3TFJA 4RMFA 4KM8A 3GTJA 4WILA 5M3FK 1SFOC 3A8IA 4P5AA 1I3QC 2E2IC 4C3IC 1IBAA 5IP9C 1RU0A 5IYBK 2YU9A 3GTPC 3AQOA 2W7VA 3S1NK 1XZPA 3GTGA 1KQ4A 3K7AK 3HOUK 1VRQC 4A3LC 2GSUA 3HOYC 3AQPA 3N0CA 3H0GA 1DCOA 3AD8C 4A3JC 2NVTK 4OIRA 3L4KA 3G4CA 4KATA 2Y0SL 3FKIK 2WB1L 4LK1A 2EBBA 4P5BA 2VUMA 3S1RK 3RZDK 4KN7A 1WORA 1TWCC 5IYBC 4BLBA 5EGEA 3S1NC 2A6HA 1O2AA 1WCMA 3K7AC 1TWFK 1Y1VK 3HOUC 3TTGA 4BXXK 1TWGK 2E2HK 3IPJA 4GT9A 2JA7A 1ISEA 4J3NA 5FLMC 3GSIA 1O26A 3SZZA 2NVTC 1Y1WK 4LLGA 1J98A 3FKIC 2FQOA 5C44K 4GTAA 1XZPB 4KB2A 1J6XA 3S1RC 1O25A 3I4MK 4C3JK 3RZDC 4ILDA 4BLAA 3AH5A 1SMYA 3GIRA 3SZYA 1TWHK 3FOEA 4G7ZA 4GTFA 4C3HK 1Y1VC 3H3VL 1WOOA 4BXXC 4MEYA 1TWGC 1WOPA 2E2HC 1PJ5A 3CQZA 4PAAA 5HL8A 4XSXA 4YG2A 4GTLA 1Y1WC 3QX3A 5C44C 3AD7C 2RGRA 5IP7K 1ZXOA 2R93A 2VUMK 4C3JC 2JA8K 1EFWA 3M3YK 3AD9C 4X6AK 1TWHC 2JH3A 4ZH4A 1X31C 1R9TK 3RZOC 4C3HC 2JA5A 4LQYA 4KN4A 3GTLK 3GTGC 2V6TA 4OIQA 5CJ9A 3GTOK 1F7VA 4GFQA 4KARA 4LJZA 2E2IK 1DCHA 4KMHA 3GTMK 1O2BA 5IP7C 1J6WA 2VUMC 2P5MA 1HI9A 3A8KA 4XCHA 3HOXK 1WSVA 3HKZL 4G0VA 3N3YA 3S0XA 4YFXA 5IYDK 4A3JK 2GSOA 1I50K 5M5YK 3GTLC 1V5VA 4XLNA 3GTOC 3GDZA 1PJ7A 3G4AA 1TWFA 2A6EA 2A69A 4FZBA 2NVYA 3GTQK 2B63A 4OIOA 2P8TA 2R92K 1HQMA 1TWCK 2NVQK 3HOVK 3GTMC 1J6VA 1XPPA 2V6SA 1XXAA 4KM9A 3HOXC 4G7HA 3ADAC 4WJ4A 3MMLB 1EH1A 5IYDC 5C4JC 3GEEA 4FM9A 3DXJA 2GAGC 5FLMK 1I50C 4KC6A 4KDDA 2R7ZK 1VLOA 3HOZK 4MQ9A 4JK1A 2JA6A 1IQ0A 1K83A 3GTQC 4DDQA 3FOFA 3CQZC 3JSTA 2R92C 2NVQC 2ZUFA 3HOVC 2NVXA 4Y52K 3PO3K 1BGWA 1AB4A 1ZQ1C 1WOSA 1YNNA 1YX2A 4KMDA 2XCQA 3GTKA 2PA8L 2R93C 2WB1D 5C3EC 2R7ZC 3HOZC 1TWAA 4KAWX 4BBRK 1R9TA 4GTEA 3LPXA 3GTJK 1I6HK 3Q3QA 5CHPA 1WQGA 4LOWA 5M3MK 1SFOA 4Y52C 3PO3C 2WAQL 4A3FK 1I3QA 5EGHA 3RZOK 2YU9K 4QJVA 1UV7A 3OPFA 1WIHA 3GTPA 3GTGK 4A3MK 4NOIA 2KWAA 4Y7NC 4Q5SA 3H0GK 5TMCA 5E68A 2FQTA 4BBRC 1ZBSA 3S14C 4KMAA 3OEPA 4KASA 3GTJC 1I6HC 1JQWA 3N0BA 4BBSC 1L0WA 1O28A 4A3FC 2CW0A 5JFEA 1USMA 4A3IC 5IYCC 1PJ6A 4BY7K 1DD5A 2YU9C 4A93C 3TFHA 4A3BK 4C2MC 1B4AA 1YNJA 1WCMK 1XXCA 1WSRA 2GSNA 3BUEA 2XCRB 1EQRA 4A3MC 2V6UA 4GZYA 1BDFA 3H0GC 2PHCB 3T01A 1WQFA 4AYBL 4QIWL 5M5XK 4QJVB 5IOQA 4GTDA 2O5JA 1VH2A 1B4BA 1INNA 3FKIA 4BY7C 3EQLA 1XZQA 3M4OC 3S2HK 5C4JK 4A3BC 2PMZL 1WCMC 1GE9A 3S15K 5FJ8K 4XLPA 1Y1VA 5IOSA 1WQHA 3HKZD 2JA7C 3CQZK 1TWGA 2E2HA 3V4GA 4GTCA 4KB4A 1Y1WA 3L4JA 2R93K 4BY1K 1IE0A 2E2JC 3S2HC 5C4XK 3S2DC 4AH6A 5C3EK 5IOTA 4A3DK 4A3CK 4YFNA 2PPBA 4P9SA 3S15C 1TWHA 3TFIA 2JA5K 4A3KK 1DCPA 4MEXA 3WODA 1IL2A 3OREA 3BP8C 1EI6A 2XCOA 4KMUA 1XZQB 4G0UA 4YFKA 1C0AA 4A3EK 2Y0SD 3NUHA 5JVOA 2ZUEA 4LR2A 4O2DA 1IS1A 4BY1C 1F9NA 3ERED 1O24A 5C4XC
chains in the Genus database with same CATH topology
5IORA 4P5AA 5TJ3A 4GFQA 4KARA 2KWAA 4C3IC 1ZBSA 4KMAA 3OEPA 4KMHA 2YU9A 4KASA 3VA7A 3N0BA 1O2BA 3AQOA 2P5MA 4BKWA 3GTLA 3GTGA 1KQ4A 3GTOA 1O28A 5JFEA 2GSUA 4G0VA 3AQPA 3N0CA 2E2IA 3H0GA 3N3YA 1DD5A 3S0XA 1O29A 4C2MC 1B4AA 2GSOA 3GTMA 1XXCA 1ZVUA 3L4KA 3G4CA 2GSNA 4KATA 3LAJA 4G0WA 3BUEA 2XCRB 3G4AA 1TWFA 1O27A 4FZBA 2NVYA 4P5BA 2VUMA 2B63A 2PHCB 1WQFA 4BLBA 3CAGA 5EGEA 1XXAA 1O2AA 4KM9A 1WCMA 1I50A 5IOQA 4GTDA 2Y3PA 1B4BA 3FKIA 3MMLB 3LAPA 1EH1A 3GTQA 4GT9A 2JA7A 1ISEA 4FM9A 2R92A 4J3NA 2CFAA 1TWCA 4KC6A 1O26A 4KDDA 1GE9A 1Y1VA 2JA6A 5IOSA 1WQHA 1K83A 4GTAA 4DDQA 3FHZA 3FOFA 4KB2A 1TWGA 1O25A 2E2HA 3V4GA 4ILDA 4GTCA 4BLAA 3AH5A 2NVXA 1BGWA 1AB4A 3FOEA 4KB4A 4GTFA 2R7ZA 4KMDA 2XCQA 3GTKA 3L4JA 1Y1WA 1BJTA 2ZFZA 3CQZA 2RH6A 4GTBA 5IOTA 1XXBA 1EK8A 4GTLA 1TWHA 1TWAA 4KAWX 3QX3A 1R9TA 4GTEA 3LPXA 2RGRA 1ZXOA 3Q3QA 2R93A 3OREA 5CHPA 4C3JC 1WQGA 2XCOA 1SFOA 4G0UA 2JH3A 5EGHA 1I3QA 3NUHA 5JVOA 4C3HC 2CFAB 4M1XA 2JA5A 4LR2A 3OPFA 4LQYA 1IS1A 1WIHA 4KM8A 3GTPA 3GTJA 1F9NA 5CJ9A 3ERED 1O24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOR A;  4P5A A;  4KAR A;  3G4A A;  4GTL A;  1O27 A;  4FZB A;  4GTE A;  4P5B A;  5IOS A;  4GTA A;  4KAS A;  1O25 A;  3N0B A;  1O24 A;  1O2B A;  5CHP A;  4GTC A;  3AH5 A;  1O2A A;  1KQ4 A;  5IOQ A;  1O28 A;  4GTD A;  4GTF A;  5JFE A;  3N0C A;  2CFA B;  3N3Y A;  1O29 A;  4GT9 A;  5IOT A;  2CFA A;  4GTB A;  1O26 A;  3G4C A;  4KAT A; 
#chains in the Genus database with same CATH topology
 5IOR A;  5TJ3 A;  4A3D C;  4A3C C;  4Q4Z A;  3S17 K;  4Y7N K;  1YCL A;  2D6F C;  2JA5 C;  3GEH A;  3S14 K;  3S1M K;  2PA8 D;  4A3K C;  3BP3 A;  3VA7 A;  4BBS K;  4BKW A;  3HOW K;  3GTL A;  3GTO A;  2NVY K;  2B63 K;  4A3E C;  4A3I K;  5IYC K;  3GEI A;  2E2I A;  1BS2 A;  1O29 A;  4A93 K;  4C2M K;  2BE5 A;  1F93 A;  1G51 A;  3GTM A;  1ZVU A;  1IW7 A;  4G0W A;  3LAJ A;  4C45 A;  2GAH C;  2A68 A;  2WAQ D;  3S17 C;  1O27 A;  3T02 A;  3H3V D;  3S1M C;  5D4D A;  3S16 K;  4PAB A;  3A8J A;  3CAG A;  4LK0 A;  1VGX A;  4XSZ A;  1I50 A;  3HOW C;  1TWF C;  2JA6 K;  4WJ3 M;  2NVY C;  1K83 K;  2Y3P A;  3PO2 K;  2B63 C;  4G7O A;  3T00 A;  3LAP A;  3GTQ A;  4OIP A;  3M4O K;  2NVX K;  2R92 A;  2CFA A;  1TWC A;  1JOE A;  1F7U A;  5TMF A;  3GTK K;  3FHZ A;  2JA7 K;  3I4M C;  3S16 C;  1O2F B;  3S1Q K;  4A3G K;  1I6V A;  3I4N K;  1TWA K;  2O5I A;  3HXA A;  2R7Z A;  2JA6 C;  1K83 C;  5L46 A;  3PO2 C;  1BJT A;  2ZFZ A;  2E2J K;  4OIN A;  2NVX C;  1SFO K;  2RH6 A;  4GTB A;  4AYB D;  3S2D K;  1I3Q K;  1XXB A;  1EK8 A;  4QIW D;  4C3I K;  3GTK C;  1JVI A;  5IP9 K;  3GTP K;  3S1Q C;  2JA8 C;  3M3Y C;  2PMZ D;  4A3G C;  1VJE A;  4X6A C;  3I4N C;  1TWA C;  4A3L K;  3HOY K;  1R9T C;  1USO A;  2CFA B;  4M1X A;  5M5W K;  1ZYR A;  3TFJ A;  4RMF A;  4KM8 A;  3GTJ A;  4WIL A;  5M3F K;  1SFO C;  3A8I A;  4P5A A;  1I3Q C;  2E2I C;  4C3I C;  1IBA A;  5IP9 C;  1RU0 A;  5IYB K;  2YU9 A;  3GTP C;  3AQO A;  2W7V A;  3S1N K;  1XZP A;  3GTG A;  1KQ4 A;  3K7A K;  3HOU K;  1VRQ C;  4A3L C;  2GSU A;  3HOY C;  3AQP A;  3N0C A;  3H0G A;  1DCO A;  3AD8 C;  4A3J C;  2NVT K;  4OIR A;  3L4K A;  3G4C A;  4KAT A;  2Y0S L;  3FKI K;  2WB1 L;  4LK1 A;  2EBB A;  4P5B A;  2VUM A;  3S1R K;  3RZD K;  4KN7 A;  1WOR A;  1TWC C;  5IYB C;  4BLB A;  5EGE A;  3S1N C;  2A6H A;  1O2A A;  1WCM A;  3K7A C;  1TWF K;  1Y1V K;  3HOU C;  3TTG A;  4BXX K;  1TWG K;  2E2H K;  3IPJ A;  4GT9 A;  2JA7 A;  1ISE A;  4J3N A;  5FLM C;  3GSI A;  1O26 A;  3SZZ A;  2NVT C;  1Y1W K;  4LLG A;  1J98 A;  3FKI C;  2FQO A;  5C44 K;  4GTA A;  1XZP B;  4KB2 A;  1J6X A;  3S1R C;  1O25 A;  3I4M K;  4C3J K;  3RZD C;  4ILD A;  4BLA A;  3AH5 A;  1SMY A;  3GIR A;  3SZY A;  1TWH K;  3FOE A;  4G7Z A;  4GTF A;  4C3H K;  1Y1V C;  3H3V L;  1WOO A;  4BXX C;  4MEY A;  1TWG C;  1WOP A;  2E2H C;  1PJ5 A;  3CQZ A;  4PAA A;  5HL8 A;  4XSX A;  4YG2 A;  4GTL A;  1Y1W C;  3QX3 A;  5C44 C;  3AD7 C;  2RGR A;  5IP7 K;  1ZXO A;  2R93 A;  2VUM K;  4C3J C;  2JA8 K;  1EFW A;  3M3Y K;  3AD9 C;  4X6A K;  1TWH C;  2JH3 A;  4ZH4 A;  1X31 C;  1R9T K;  3RZO C;  4C3H C;  2JA5 A;  4LQY A;  4KN4 A;  3GTL K;  3GTG C;  2V6T A;  4OIQ A;  5CJ9 A;  3GTO K;  1F7V A;  4GFQ A;  4KAR A;  4LJZ A;  2E2I K;  1DCH A;  4KMH A;  3GTM K;  1O2B A;  5IP7 C;  1J6W A;  2VUM C;  2P5M A;  1HI9 A;  3A8K A;  4XCH A;  3HOX K;  1WSV A;  3HKZ L;  4G0V A;  3N3Y A;  3S0X A;  4YFX A;  5IYD K;  4A3J K;  2GSO A;  1I50 K;  5M5Y K;  3GTL C;  1V5V A;  4XLN A;  3GTO C;  3GDZ A;  1PJ7 A;  3G4A A;  1TWF A;  2A6E A;  2A69 A;  4FZB A;  2NVY A;  3GTQ K;  2B63 A;  4OIO A;  2P8T A;  2R92 K;  1HQM A;  1TWC K;  2NVQ K;  3HOV K;  3GTM C;  1J6V A;  1XPP A;  2V6S A;  1XXA A;  4KM9 A;  3HOX C;  4G7H A;  3ADA C;  4WJ4 A;  3MML B;  1EH1 A;  5IYD C;  5C4J C;  3GEE A;  4FM9 A;  3DXJ A;  2GAG C;  5FLM K;  1I50 C;  4KC6 A;  4KDD A;  2R7Z K;  1VLO A;  3HOZ K;  4MQ9 A;  4JK1 A;  2JA6 A;  1IQ0 A;  1K83 A;  3GTQ C;  4DDQ A;  3FOF A;  3CQZ C;  3JST A;  2R92 C;  2NVQ C;  2ZUF A;  3HOV C;  2NVX A;  4Y52 K;  3PO3 K;  1BGW A;  1AB4 A;  1ZQ1 C;  1WOS A;  1YNN A;  1YX2 A;  4KMD A;  2XCQ A;  3GTK A;  2PA8 L;  2R93 C;  2WB1 D;  5C3E C;  2R7Z C;  3HOZ C;  1TWA A;  4KAW X;  4BBR K;  1R9T A;  4GTE A;  3LPX A;  3GTJ K;  1I6H K;  3Q3Q A;  5CHP A;  1WQG A;  4LOW A;  5M3M K;  1SFO A;  4Y52 C;  3PO3 C;  2WAQ L;  4A3F K;  1I3Q A;  5EGH A;  3RZO K;  2YU9 K;  4QJV A;  1UV7 A;  3OPF A;  1WIH A;  3GTP A;  3GTG K;  4A3M K;  4NOI A;  2KWA A;  4Y7N C;  4Q5S A;  3H0G K;  5TMC A;  5E68 A;  2FQT A;  4BBR C;  1ZBS A;  3S14 C;  4KMA A;  3OEP A;  4KAS A;  3GTJ C;  1I6H C;  1JQW A;  3N0B A;  4BBS C;  1L0W A;  1O28 A;  4A3F C;  2CW0 A;  5JFE A;  1USM A;  4A3I C;  5IYC C;  1PJ6 A;  4BY7 K;  1DD5 A;  2YU9 C;  4A93 C;  3TFH A;  4A3B K;  4C2M C;  1B4A A;  1YNJ A;  1WCM K;  1XXC A;  1WSR A;  2GSN A;  3BUE A;  2XCR B;  1EQR A;  4A3M C;  2V6U A;  4GZY A;  1BDF A;  3H0G C;  2PHC B;  3T01 A;  1WQF A;  4AYB L;  4QIW L;  5M5X K;  4QJV B;  5IOQ A;  4GTD A;  2O5J A;  1VH2 A;  1B4B A;  1INN A;  3FKI A;  4BY7 C;  3EQL A;  1XZQ A;  3M4O C;  3S2H K;  5C4J K;  4A3B C;  2PMZ L;  1WCM C;  1GE9 A;  3S15 K;  5FJ8 K;  4XLP A;  1Y1V A;  5IOS A;  1WQH A;  3HKZ D;  2JA7 C;  3CQZ K;  1TWG A;  2E2H A;  3V4G A;  4GTC A;  4KB4 A;  1Y1W A;  3L4J A;  2R93 K;  4BY1 K;  1IE0 A;  2E2J C;  3S2H C;  5C4X K;  3S2D C;  4AH6 A;  5C3E K;  5IOT A;  4A3D K;  4A3C K;  4YFN A;  2PPB A;  4P9S A;  3S15 C;  1TWH A;  3TFI A;  2JA5 K;  4A3K K;  1DCP A;  4MEX A;  3WOD A;  1IL2 A;  3ORE A;  3BP8 C;  1EI6 A;  2XCO A;  4KMU A;  1XZQ B;  4G0U A;  4YFK A;  1C0A A;  4A3E K;  2Y0S D;  3NUH A;  5JVO A;  2ZUE A;  4LR2 A;  4O2D A;  1IS1 A;  4BY1 C;  1F9N A;  3ERE D;  1O24 A;  5C4X C; 
#chains in the Genus database with same CATH homology
 5IOR A;  4P5A A;  5TJ3 A;  4GFQ A;  4KAR A;  2KWA A;  4C3I C;  1ZBS A;  4KMA A;  3OEP A;  4KMH A;  2YU9 A;  4KAS A;  3VA7 A;  3N0B A;  1O2B A;  3AQO A;  2P5M A;  4BKW A;  3GTL A;  3GTG A;  1KQ4 A;  3GTO A;  1O28 A;  5JFE A;  2GSU A;  4G0V A;  3AQP A;  3N0C A;  2E2I A;  3H0G A;  3N3Y A;  1DD5 A;  3S0X A;  1O29 A;  4C2M C;  1B4A A;  2GSO A;  3GTM A;  1XXC A;  1ZVU A;  3L4K A;  3G4C A;  2GSN A;  4KAT A;  3LAJ A;  4G0W A;  3BUE A;  2XCR B;  3G4A A;  1TWF A;  1O27 A;  4FZB A;  2NVY A;  4P5B A;  2VUM A;  2B63 A;  2PHC B;  1WQF A;  4BLB A;  3CAG A;  5EGE A;  1XXA A;  1O2A A;  4KM9 A;  1WCM A;  1I50 A;  5IOQ A;  4GTD A;  2Y3P A;  1B4B A;  3FKI A;  3MML B;  3LAP A;  1EH1 A;  3GTQ A;  4GT9 A;  2JA7 A;  1ISE A;  4FM9 A;  2R92 A;  4J3N A;  2CFA A;  1TWC A;  4KC6 A;  1O26 A;  4KDD A;  1GE9 A;  1Y1V A;  2JA6 A;  5IOS A;  1WQH A;  1K83 A;  4GTA A;  4DDQ A;  3FHZ A;  3FOF A;  4KB2 A;  1TWG A;  1O25 A;  2E2H A;  3V4G A;  4ILD A;  4GTC A;  4BLA A;  3AH5 A;  2NVX A;  1BGW A;  1AB4 A;  3FOE A;  4KB4 A;  4GTF A;  2R7Z A;  4KMD A;  2XCQ A;  3GTK A;  3L4J A;  1Y1W A;  1BJT A;  2ZFZ A;  3CQZ A;  2RH6 A;  4GTB A;  5IOT A;  1XXB A;  1EK8 A;  4GTL A;  1TWH A;  1TWA A;  4KAW X;  3QX3 A;  1R9T A;  4GTE A;  3LPX A;  2RGR A;  1ZXO A;  3Q3Q A;  2R93 A;  3ORE A;  5CHP A;  4C3J C;  1WQG A;  2XCO A;  1SFO A;  4G0U A;  2JH3 A;  5EGH A;  1I3Q A;  3NUH A;  5JVO A;  4C3H C;  2CFA B;  4M1X A;  2JA5 A;  4LR2 A;  3OPF A;  4LQY A;  1IS1 A;  1WIH A;  4KM8 A;  3GTP A;  3GTJ A;  1F9N A;  5CJ9 A;  3ERE D;  1O24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...