1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1VGXA 1J98A 1JQWA 1J6WA 1J6VA 1JVIA 2FQTA 1VJEA 4XCHA 1INNA 1VH2A 5E68A 1IE0A 2FQOA 1JOEA 1J6XA 1YCLA
chains in the Genus database with same CATH superfamily
2RGRA 1DCHA 2R92A 2D6FC 4C3IC 2Y0SD 5JFEA 4KATA 3GSIA 1WQGA 4GFQA 4BY1C 3GTLA 3T02A 3S1MC 4BXXK 2A6EA 3NUHA 1VRQC 2R92C 5HL8A 3SZZA 3RZDK 4BBSK 4A3DK 2E2HK 3ADAC 3LAJA 2P5MA 5C3EK 4KMDA 1K83A 1B4BA 2PMZD 1TWAA 3GTPA 4C3JK 4C2MK 1SFOA 3L4JA 3I4NK 2PPBA 4GTBA 3G4AA 4GTDA 3S1MK 4BXXC 1F9NA 1R9TK 3GTLC 2NVXK 3S1NC 1C0AA 4Y7NK 1ZYRA 5L46A 4ILDA 1O28A 2V6TA 3T00A 3T01A 2JA5A 1J6WA 1WIHA 3GTOA 1USMA 4KDDA 2A68A 3GTMC 1IS1A 4C3HC 4X6AC 4G0UA 2Y3PA 1XZQA 3S1RK 3BP3A 3FKIK 2WAQL 4GTFA 3TFHA 1BDFA 3S17C 5IYDK 3FKIA 5M3MK 5C4XK 3S1QK 4KB4A 3S16C 1PJ6A 1PJ7A 4KAWX 1HQMA 1JQWA 2P8TA 2JA5K 4GZYA 2WB1D 3GTLK 4C3HK 2ZUEA 3HKZD 3S1NK 3AD8C 1Y1WC 5IYBK 5M5XK 1AB4A 3M4OK 1JVIA 3GTMK 2GSOA 4X6AK 1O2BA 3FOEA 3TFJA 1WQFA 3HOXC 4OIQA 1DD5A 4OIPA 4Q4ZA 3VA7A 3S1RC 4LK1A 1IE0A 1O29A 5C44C 1TWCK 4LOWA 4GTCA 4A3CK 1TWAC 3GTJC 1G51A 2CFAA 2E2HA 4QIWL 1USOA 2R93A 1IQ0A 4BBRC 1TWFA 3GTKC 3HOVC 2RH6A 2GSUA 1SMYA 1YX2A 3FKIC 3OPFA 1L0WA 3LPXA 5IYCK 3N3YA 2NVYC 2W7VA 5CJ9A 2R92K 3S17K 2CW0A 3HOZK 3HOUC 4KASA 4A3DC 1WCMK 4A3CC 3PO2C 3GTMA 3M4OC 3V4GA 2O5JA 4A3KC 1F93A 4YFXA 1RU0A 4YFNA 2NVQK 4BY1K 1UV7A 2JA5C 4MQ9A 4BLAA 2XCOA 2B63K 3HOXK 1IBAA 5C4JC 1I6HC 1EQRA 3RZOK 5IYBC 5IOTA 3AH5A 2CFAB 4YFKA 3OREA 4KC6A 3ERED 3AQOA 1SFOC 3HOZC 1O27A 2FQOA 2ZFZA 2R7ZK 1YNJA 1TWGK 4A3MC 1VGXA 4XLNA 4C2MC 2PHCB 2E2HC 3CAGA 5M3FK 3GTJA 5C44K 1K83C 1TWHK 3M3YK 3Q3QA 5FLMK 2V6SA 3GTQC 3GTKK 3FOFA 3GTOK 1WOOA 2JA7A 2V6UA 3S15C 4A3KK 4QIWD 3GTGK 1J6VA 5IYCC 4KM9A 4WJ3M 2NVXC 2GSNA 1WORA 5IP9K 4XLPA 3I4MK 1ZXOA 2JA7K 1I50A 3WODA 1EK8A 3K7AK 2E2JK 1SFOK 3PO2K 1GE9A 1O25A 1WOSA 1Y1WK 1VJEA 5E68A 1V5VA 3H0GA 3H0GC 1K83K 4A3JK 3TTGA 1VH2A 5FLMC 2YU9A 3GTQK 2Y0SL 4P9SA 3QX3A 4XCHA 4QJVA 2O5IA 3S15K 3GTGC 3A8IA 4GTAA 4RMFA 2NVTC 4DDQA 1JOEA 1BS2A 2JA6A 1F7VA 1IW7A 1VLOA 5IP9C 5IP7C 4FM9A 3IPJA 3N0BA 1TWCC 4AH6A 4PABA 1O24A 1WCMA 4BLBA 1Y1VA 2PA8D 1I3QA 1Y1WA 3BP8C 4Y52C 3JSTA 5M5WK 2XCQA 1EI6A 5IORA 1WQHA 2YU9C 2GAGC 4G0WA 3S2DC 4KN7A 5C4JK 5JVOA 4A3EC 3K7AC 1O2AA 2E2JC 4O2DA 3G4CA 3AD7C 2XCRB 2JA8K 3CQZA 3GEIA 4MEYA 1WCMC 3PO3C 1TWCA 2PMZL 2E2IK 3H0GK 4OIRA 2VUMK 1Y1VK 2NVQC 4A3JC 4NOIA 1F7UA 3AQPA 5CHPA 5IP7K 3H3VD 4KMHA 5IOQA 1I6VA 5IYDC 3S2DK 3GEEA 3A8JA 4A3BC 1XZPA 4Y52K 4OINA 4G7ZA 4KN4A 4LR2A 1ZBSA 4A3IC 3EQLA 3PO3K 3N0CA 4A93K 3HKZL 5EGHA 3GTQA 3HOWC 4J3NA 4A3EK 1B4AA 1TWFC 3GTKA 3GEHA 4FZBA 3GTPC 2R93C 2JA8C 4G0VA 3S1QC 2R7ZC 1ZQ1C 1DCOA 2VUMA 2E2IC 1TWHC 3M3YC 1WSVA 1YNNA 4JK1A 5FJ8K 1EFWA 4A3FC 5EGEA 4C45A 2GAHC 1BJTA 4KMUA 3OEPA 4C3IK 2JA7C 4KB2A 1TWFK 3GTGA 1XZQB 1O26A 2R93K 1J6XA 1ISEA 2PA8L 4BBRK 2VUMC 4BY7C 1WOPA 4Q5SA 3LAPA 5M5YK 4A3IK 2B63A 1XXCA 2A69A 3S0XA 1YCLA 4ZH4A 3I4MC 3HOWK 4KM8A 2NVYK 3FHZA 2NVYA 3BUEA 4A3FK 3CQZK 1I50K 1TWGA 5TJ3A 3MMLB 4GT9A 4WJ4A 2A6HA 3GDZA 4KMAA 1IL2A 4MEXA 4OIOA 2YU9K 1O2FB 3HOUK 3GIRA 3S2HK 1I3QK 4BY7K 2NVTK 3I4NC 4LJZA 4A3GK 1XPPA 1XXBA 4LLGA 1TWGC 2EBBA 3CQZC 1R9TC 1I6HK 2BE5A 3DXJA 4G7OA 4LK0A 4A3LK 2JH3A 3RZOC 4P5AA 4LQYA 1WSRA 4QJVB 3HXAA 4G7HA 4GTLA 3L4KA 1I50C 2ZUFA 3S14K 4M1XA 3H3VL 1ZVUA 4A3MK 1I3QC 4PAAA 1DCPA 2NVXA 1Y1VC 1R9TA 2WB1L 4P5BA 3HOYK 4WILA 2KWAA 3RZDC 4BBSC 4A93C 5C4XC 1KQ4A 1PJ5A 3S16K 3S2HC 2JA6C 3A8KA 4AYBD 1HI9A 1X31C 1TWHA 3GTJK 3GTOC 2E2IA 4A3BK 1J98A 3AD9C 4A3GC 2WAQD 2R7ZA 3HOVK 5TMCA 1XXAA 3S14C 4GTEA 4KARA 3SZYA 5IOSA 2FQTA 4Y7NC 5D4DA 4XSXA 4YG2A 4AYBL 4C3JC 4A3LC 3TFIA 5C3EC 3GTPK 1BGWA 3HOYC 1TWAK 1EH1A 2B63C 1INNA 4XSZA 4BKWA 5TMFA 2JA6K 1XZPB
chains in the Genus database with same CATH topology
1VGXA 1J98A 1JQWA 1J6WA 1J6VA 1JVIA 2FQTA 1VJEA 4XCHA 1INNA 1VH2A 5E68A 1IE0A 2FQOA 1JOEA 1J6XA 1YCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGX A;  1J98 A;  1JQW A;  1J6W A;  1J6V A;  1JVI A;  2FQT A;  1VJE A;  4XCH A;  1INN A;  1VH2 A;  5E68 A;  1IE0 A;  2FQO A;  1JOE A;  1J6X A;  1YCL A; 
#chains in the Genus database with same CATH topology
 2RGR A;  1DCH A;  2R92 A;  2D6F C;  4C3I C;  2Y0S D;  5JFE A;  4KAT A;  3GSI A;  1WQG A;  4GFQ A;  4BY1 C;  3GTL A;  3T02 A;  3S1M C;  4BXX K;  2A6E A;  3NUH A;  1VRQ C;  2R92 C;  5HL8 A;  3SZZ A;  3RZD K;  4BBS K;  4A3D K;  2E2H K;  3ADA C;  3LAJ A;  2P5M A;  5C3E K;  4KMD A;  1K83 A;  1B4B A;  2PMZ D;  1TWA A;  3GTP A;  4C3J K;  4C2M K;  1SFO A;  3L4J A;  3I4N K;  2PPB A;  4GTB A;  3G4A A;  4GTD A;  3S1M K;  4BXX C;  1F9N A;  1R9T K;  3GTL C;  2NVX K;  3S1N C;  1C0A A;  4Y7N K;  1ZYR A;  5L46 A;  4ILD A;  1O28 A;  2V6T A;  3T00 A;  3T01 A;  2JA5 A;  1J6W A;  1WIH A;  3GTO A;  1USM A;  4KDD A;  2A68 A;  3GTM C;  1IS1 A;  4C3H C;  4X6A C;  4G0U A;  2Y3P A;  1XZQ A;  3S1R K;  3BP3 A;  3FKI K;  2WAQ L;  4GTF A;  3TFH A;  1BDF A;  3S17 C;  5IYD K;  3FKI A;  5M3M K;  5C4X K;  3S1Q K;  4KB4 A;  3S16 C;  1PJ6 A;  1PJ7 A;  4KAW X;  1HQM A;  1JQW A;  2P8T A;  2JA5 K;  4GZY A;  2WB1 D;  3GTL K;  4C3H K;  2ZUE A;  3HKZ D;  3S1N K;  3AD8 C;  1Y1W C;  5IYB K;  5M5X K;  1AB4 A;  3M4O K;  1JVI A;  3GTM K;  2GSO A;  4X6A K;  1O2B A;  3FOE A;  3TFJ A;  1WQF A;  3HOX C;  4OIQ A;  1DD5 A;  4OIP A;  4Q4Z A;  3VA7 A;  3S1R C;  4LK1 A;  1IE0 A;  1O29 A;  5C44 C;  1TWC K;  4LOW A;  4GTC A;  4A3C K;  1TWA C;  3GTJ C;  1G51 A;  2CFA A;  2E2H A;  4QIW L;  1USO A;  2R93 A;  1IQ0 A;  4BBR C;  1TWF A;  3GTK C;  3HOV C;  2RH6 A;  2GSU A;  1SMY A;  1YX2 A;  3FKI C;  3OPF A;  1L0W A;  3LPX A;  5IYC K;  3N3Y A;  2NVY C;  2W7V A;  5CJ9 A;  2R92 K;  3S17 K;  2CW0 A;  3HOZ K;  3HOU C;  4KAS A;  4A3D C;  1WCM K;  4A3C C;  3PO2 C;  3GTM A;  3M4O C;  3V4G A;  2O5J A;  4A3K C;  1F93 A;  4YFX A;  1RU0 A;  4YFN A;  2NVQ K;  4BY1 K;  1UV7 A;  2JA5 C;  4MQ9 A;  4BLA A;  2XCO A;  2B63 K;  3HOX K;  1IBA A;  5C4J C;  1I6H C;  1EQR A;  3RZO K;  5IYB C;  5IOT A;  3AH5 A;  2CFA B;  4YFK A;  3ORE A;  4KC6 A;  3ERE D;  3AQO A;  1SFO C;  3HOZ C;  1O27 A;  2FQO A;  2ZFZ A;  2R7Z K;  1YNJ A;  1TWG K;  4A3M C;  1VGX A;  4XLN A;  4C2M C;  2PHC B;  2E2H C;  3CAG A;  5M3F K;  3GTJ A;  5C44 K;  1K83 C;  1TWH K;  3M3Y K;  3Q3Q A;  5FLM K;  2V6S A;  3GTQ C;  3GTK K;  3FOF A;  3GTO K;  1WOO A;  2JA7 A;  2V6U A;  3S15 C;  4A3K K;  4QIW D;  3GTG K;  1J6V A;  5IYC C;  4KM9 A;  4WJ3 M;  2NVX C;  2GSN A;  1WOR A;  5IP9 K;  4XLP A;  3I4M K;  1ZXO A;  2JA7 K;  1I50 A;  3WOD A;  1EK8 A;  3K7A K;  2E2J K;  1SFO K;  3PO2 K;  1GE9 A;  1O25 A;  1WOS A;  1Y1W K;  1VJE A;  5E68 A;  1V5V A;  3H0G A;  3H0G C;  1K83 K;  4A3J K;  3TTG A;  1VH2 A;  5FLM C;  2YU9 A;  3GTQ K;  2Y0S L;  4P9S A;  3QX3 A;  4XCH A;  4QJV A;  2O5I A;  3S15 K;  3GTG C;  3A8I A;  4GTA A;  4RMF A;  2NVT C;  4DDQ A;  1JOE A;  1BS2 A;  2JA6 A;  1F7V A;  1IW7 A;  1VLO A;  5IP9 C;  5IP7 C;  4FM9 A;  3IPJ A;  3N0B A;  1TWC C;  4AH6 A;  4PAB A;  1O24 A;  1WCM A;  4BLB A;  1Y1V A;  2PA8 D;  1I3Q A;  1Y1W A;  3BP8 C;  4Y52 C;  3JST A;  5M5W K;  2XCQ A;  1EI6 A;  5IOR A;  1WQH A;  2YU9 C;  2GAG C;  4G0W A;  3S2D C;  4KN7 A;  5C4J K;  5JVO A;  4A3E C;  3K7A C;  1O2A A;  2E2J C;  4O2D A;  3G4C A;  3AD7 C;  2XCR B;  2JA8 K;  3CQZ A;  3GEI A;  4MEY A;  1WCM C;  3PO3 C;  1TWC A;  2PMZ L;  2E2I K;  3H0G K;  4OIR A;  2VUM K;  1Y1V K;  2NVQ C;  4A3J C;  4NOI A;  1F7U A;  3AQP A;  5CHP A;  5IP7 K;  3H3V D;  4KMH A;  5IOQ A;  1I6V A;  5IYD C;  3S2D K;  3GEE A;  3A8J A;  4A3B C;  1XZP A;  4Y52 K;  4OIN A;  4G7Z A;  4KN4 A;  4LR2 A;  1ZBS A;  4A3I C;  3EQL A;  3PO3 K;  3N0C A;  4A93 K;  3HKZ L;  5EGH A;  3GTQ A;  3HOW C;  4J3N A;  4A3E K;  1B4A A;  1TWF C;  3GTK A;  3GEH A;  4FZB A;  3GTP C;  2R93 C;  2JA8 C;  4G0V A;  3S1Q C;  2R7Z C;  1ZQ1 C;  1DCO A;  2VUM A;  2E2I C;  1TWH C;  3M3Y C;  1WSV A;  1YNN A;  4JK1 A;  5FJ8 K;  1EFW A;  4A3F C;  5EGE A;  4C45 A;  2GAH C;  1BJT A;  4KMU A;  3OEP A;  4C3I K;  2JA7 C;  4KB2 A;  1TWF K;  3GTG A;  1XZQ B;  1O26 A;  2R93 K;  1J6X A;  1ISE A;  2PA8 L;  4BBR K;  2VUM C;  4BY7 C;  1WOP A;  4Q5S A;  3LAP A;  5M5Y K;  4A3I K;  2B63 A;  1XXC A;  2A69 A;  3S0X A;  1YCL A;  4ZH4 A;  3I4M C;  3HOW K;  4KM8 A;  2NVY K;  3FHZ A;  2NVY A;  3BUE A;  4A3F K;  3CQZ K;  1I50 K;  1TWG A;  5TJ3 A;  3MML B;  4GT9 A;  4WJ4 A;  2A6H A;  3GDZ A;  4KMA A;  1IL2 A;  4MEX A;  4OIO A;  2YU9 K;  1O2F B;  3HOU K;  3GIR A;  3S2H K;  1I3Q K;  4BY7 K;  2NVT K;  3I4N C;  4LJZ A;  4A3G K;  1XPP A;  1XXB A;  4LLG A;  1TWG C;  2EBB A;  3CQZ C;  1R9T C;  1I6H K;  2BE5 A;  3DXJ A;  4G7O A;  4LK0 A;  4A3L K;  2JH3 A;  3RZO C;  4P5A A;  4LQY A;  1WSR A;  4QJV B;  3HXA A;  4G7H A;  4GTL A;  3L4K A;  1I50 C;  2ZUF A;  3S14 K;  4M1X A;  3H3V L;  1ZVU A;  4A3M K;  1I3Q C;  4PAA A;  1DCP A;  2NVX A;  1Y1V C;  1R9T A;  2WB1 L;  4P5B A;  3HOY K;  4WIL A;  2KWA A;  3RZD C;  4BBS C;  4A93 C;  5C4X C;  1KQ4 A;  1PJ5 A;  3S16 K;  3S2H C;  2JA6 C;  3A8K A;  4AYB D;  1HI9 A;  1X31 C;  1TWH A;  3GTJ K;  3GTO C;  2E2I A;  4A3B K;  1J98 A;  3AD9 C;  4A3G C;  2WAQ D;  2R7Z A;  3HOV K;  5TMC A;  1XXA A;  3S14 C;  4GTE A;  4KAR A;  3SZY A;  5IOS A;  2FQT A;  4Y7N C;  5D4D A;  4XSX A;  4YG2 A;  4AYB L;  4C3J C;  4A3L C;  3TFI A;  5C3E C;  3GTP K;  1BGW A;  3HOY C;  1TWA K;  1EH1 A;  2B63 C;  1INN A;  4XSZ A;  4BKW A;  5TMF A;  2JA6 K;  1XZP B; 
#chains in the Genus database with same CATH homology
 1VGX A;  1J98 A;  1JQW A;  1J6W A;  1J6V A;  1JVI A;  2FQT A;  1VJE A;  4XCH A;  1INN A;  1VH2 A;  5E68 A;  1IE0 A;  2FQO A;  1JOE A;  1J6X A;  1YCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...