1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
molecule tags Signaling protein
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1JVIA 1IE0A 1INNA 1JOEA 2FQOA 4XCHA 1VH2A 1VGXA 1J98A 2FQTA 1YCLA 1J6WA 1J6VA 5E68A 1VJEA 1J6XA 1JQWA
chains in the Genus database with same CATH superfamily
1SFOK 4A3BC 4KDDA 5C3EC 2PMZL 1WCMA 1HQMA 1O29A 4GFQA 2FQOA 2NVXK 1PJ6A 3RZDC 1I50C 3H0GA 1HI9A 1O27A 3CQZK 3HOZK 1ZXOA 4GTDA 3OREA 4QJVA 1INNA 4JK1A 3N3YA 1WORA 2B63K 2YU9K 2PA8L 2KWAA 4NOIA 1SMYA 2A68A 1TWFK 3M4OC 5CJ9A 5IP7K 1IQ0A 3BUEA 4A3EK 3GTGC 2D6FC 1YNNA 2JA8C 3M3YK 5C4XC 4A3LC 1EFWA 2GSNA 4WILA 3H0GC 4MEYA 3T00A 4OINA 4A3BK 3S14C 5C3EK 4X6AC 1WQGA 3S2HC 4XSXA 2WB1L 1USMA 2BE5A 4Q5SA 4XLNA 3RZDK 1I50K 1TWHA 1BDFA 3GTJC 4C3JC 4M1XA 5IOSA 1J6VA 2A69A 2EBBA 5M5WK 5FJ8K 3IPJA 1TWAA 3M4OK 4C3HC 1ISEA 1VLOA 1G51A 1B4AA 4PAAA 2NVYA 4XCHA 3GTGK 4A3IC 2R93C 4WJ4A 4QJVB 2JA8K 2VUMC 4O2DA 1TWCC 5C4XK 3I4MC 4A3LK 3GTMA 4LLGA 3H0GK 3HOWC 2R7ZC 1EH1A 3S0XA 1F93A 1PJ5A 1ZVUA 3L4KA 3S1QC 4KM9A 3S14K 4X6AK 1TWAC 3S2HK 3AH5A 2CFAA 3Q3QA 1J98A 4OIRA 4BLAA 2NVYC 3DXJA 1PJ7A 3GTJK 4C3JK 1C0AA 4G0VA 1O28A 2JA6A 3AQPA 3SZYA 4KMUA 3WODA 4C3HK 2W7VA 4A3FC 1XZQA 3HKZL 4A3IK 2R93K 3T02A 3OEPA 5JFEA 5TMCA 2VUMK 1TWCK 3I4MK 3LAJA 3AD8C 3JSTA 3HOWK 2XCQA 2R7ZK 3TFHA 4C45A 3S1QK 1ZBSA 4KB4A 2P5MA 2JA5C 1TWAK 4LK0A 5M5XK 4C2MC 4GZYA 1GE9A 2V6TA 2E2JC 1ZQ1C 2NVYK 1Y1WA 4BBRC 1YNJA 2CW0A 4YFKA 5D4DA 2V6SA 5M3FK 3H3VL 3FOFA 5C4JC 3TFJA 3S17C 4QIWD 1F9NA 3FKIC 4BXXC 2CFAB 4P5AA 4A3FK 4GTLA 4GTAA 3ERED 4AH6A 1KQ4A 2JH3A 2V6UA 5IOQA 2E2HA 3OPFA 1Y1VC 3N0BA 2Y0SL 3GTQA 1XZQB 1UV7A 1JQWA 2R92C 2JA5K 2XCOA 4C2MK 4BLBA 1K83C 2A6EA 2E2JK 3L4JA 1WCMC 4BBRK 3HOYC 5M3MK 3A8JA 3K7AC 5TJ3A 3TFIA 4A3KC 5EGHA 1IS1A 5C4JK 3S17K 2A6HA 4Y52C 1X31C 2GAGC 4KMDA 4YFNA 4Q4ZA 3FKIK 2E2HC 4LK1A 2RGRA 4BXXK 3GTQC 3PO3C 1IL2A 1I6HC 3GSIA 5L46A 1BS2A 4BY1C 3BP3A 2FQTA 3BP8C 1Y1VK 4PABA 2O5JA 3GTKA 4G7OA 4A3DC 1WOOA 2E2IA 4Y7NC 4WJ3M 4AYBD 4G0WA 1DD5A 2R92K 4LQYA 2ZUEA 3QX3A 1VH2A 4G7ZA 3S2DC 1K83K 3GEHA 1XXBA 1JOEA 1WCMK 2O5IA 3HOYK 3K7AK 4A3KK 2WAQD 1J6WA 2GSOA 1TWHC 1AB4A 4Y52K 5IORA 2E2HK 3GTKC 3GTQK 3PO3K 4KM8A 1I6HK 3LPXA 2NVTC 4KN7A 5HL8A 3GTPA 5IOTA 4BY1K 4XLPA 1EI6A 1XPPA 3LAPA 2JA7A 1ZYRA 4A3DK 3GTMC 4KC6A 4ZH4A 4C3IC 4Y7NK 5M5YK 1YCLA 2P8TA 1SFOA 1VJEA 4KASA 3S2DK 4MEXA 3AD7C 3GDZA 3GEEA 3HOVC 2NVXA 4DDQA 3CQZA 3CAGA 2PA8D 3GTPC 1TWHK 1IW7A 4KB2A 2B63A 1F7UA 3V4GA 3GTKK 1TWFA 3TTGA 3MMLB 1B4BA 2JA6C 5TMFA 2NVTK 1VRQC 4P9SA 1XXAA 5IYCC 3GTMK 4C3IK 4BKWA 2WB1D 4KMHA 3SZZA 4YG2A 1JVIA 4GTFA 3GIRA 2PPBA 3HOVK 3GTLA 1I50A 1TWGA 4P5BA 1WSVA 1Y1WC 3GTPK 4J3NA 3VA7A 3GEIA 1RU0A 3I4NC 2JA6K 1F7VA 1O26A 3AD9C 3GTGA 1USOA 3S15C 5IYCK 3S1MC 3GTLC 2XCRB 1TWGC 4G7HA 4YFXA 4G0UA 1O25A 3N0CA 4LJZA 4GTCA 4A3CC 4A3MC 4GTBA 4LOWA 5E68A 5C44C 1IBAA 1IE0A 1V5VA 3GTJA 4A3JC 1EK8A 1Y1WK 4LR2A 2Y3PA 3NUHA 1DCPA 5IYBC 3I4NK 3A8KA 3HKZD 1I3QA 1XZPA 5CHPA 3ADAC 4QIWL 2R93A 3G4AA 3PO2C 3S15K 2NVQC 2VUMA 1TWCA 1WQFA 3S1MK 3GTLK 3GTOA 1TWGK 2R7ZA 1O2FB 1DCOA 4BY7C 1O24A 4A3CK 3A8IA 4A3MK 4KN4A 5IP9C 3HOUC 1L0WA 2E2IC 1O2AA 5C44K 4GTEA 1WSRA 1I3QC 4FZBA 4A3GC 3H3VD 4A3JK 2RH6A 1WIHA 4A93C 3S16C 4FM9A 5FLMC 3GTOC 1R9TA 4OIPA 4KMAA 5IYBK 2PMZD 3HOXC 3RZOC 1I6VA 3FHZA 4BBSC 1BJTA 3PO2K 4KATA 3AQOA 5IYDC 2NVQK 2Y0SD 1DCHA 3G4CA 1WOPA 4GT9A 3HXAA 1XZPB 4BY7K 2YU9A 2JA7C 1VGXA 3S1NC 5IP9K 1R9TC 3HOUK 4RMFA 2E2IK 3EQLA 4KARA 2JA5A 3S1RC 3T01A 1I3QK 1SFOC 2GAHC 5JVOA 4A3GK 4AYBL 1WOSA 2ZUFA 4OIQA 2NVXC 4A93K 3S16K 1BGWA 3HOZC 3CQZC 5FLMK 3GTOK 1J6XA 1WQHA 4KAWX 3FKIA 2WAQL 4XSZA 2B63C 3HOXK 4OIOA 3RZOK 2YU9C 1YX2A 5EGEA 1XXCA 4BBSK 1TWFC 2GSUA 5IP7C 5IYDK 4A3EC 1EQRA 1O2BA 1Y1VA 3FOEA 4ILDA 3M3YC 3S1NK 4MQ9A 2JA7K 2ZFZA 2PHCB 1R9TK 2R92A 3S1RK 1K83A
chains in the Genus database with same CATH topology
1JVIA 1IE0A 1INNA 1JOEA 2FQOA 4XCHA 1VH2A 1VGXA 1J98A 2FQTA 1YCLA 1J6WA 1J6VA 5E68A 1VJEA 1J6XA 1JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  1IE0 A;  1INN A;  1JOE A;  2FQO A;  4XCH A;  1VH2 A;  1VGX A;  1J98 A;  2FQT A;  1YCL A;  1J6W A;  1J6V A;  5E68 A;  1VJE A;  1J6X A;  1JQW A; 
#chains in the Genus database with same CATH topology
 1SFO K;  4A3B C;  4KDD A;  5C3E C;  2PMZ L;  1WCM A;  1HQM A;  1O29 A;  4GFQ A;  2FQO A;  2NVX K;  1PJ6 A;  3RZD C;  1I50 C;  3H0G A;  1HI9 A;  1O27 A;  3CQZ K;  3HOZ K;  1ZXO A;  4GTD A;  3ORE A;  4QJV A;  1INN A;  4JK1 A;  3N3Y A;  1WOR A;  2B63 K;  2YU9 K;  2PA8 L;  2KWA A;  4NOI A;  1SMY A;  2A68 A;  1TWF K;  3M4O C;  5CJ9 A;  5IP7 K;  1IQ0 A;  3BUE A;  4A3E K;  3GTG C;  2D6F C;  1YNN A;  2JA8 C;  3M3Y K;  5C4X C;  4A3L C;  1EFW A;  2GSN A;  4WIL A;  3H0G C;  4MEY A;  3T00 A;  4OIN A;  4A3B K;  3S14 C;  5C3E K;  4X6A C;  1WQG A;  3S2H C;  4XSX A;  2WB1 L;  1USM A;  2BE5 A;  4Q5S A;  4XLN A;  3RZD K;  1I50 K;  1TWH A;  1BDF A;  3GTJ C;  4C3J C;  4M1X A;  5IOS A;  1J6V A;  2A69 A;  2EBB A;  5M5W K;  5FJ8 K;  3IPJ A;  1TWA A;  3M4O K;  4C3H C;  1ISE A;  1VLO A;  1G51 A;  1B4A A;  4PAA A;  2NVY A;  4XCH A;  3GTG K;  4A3I C;  2R93 C;  4WJ4 A;  4QJV B;  2JA8 K;  2VUM C;  4O2D A;  1TWC C;  5C4X K;  3I4M C;  4A3L K;  3GTM A;  4LLG A;  3H0G K;  3HOW C;  2R7Z C;  1EH1 A;  3S0X A;  1F93 A;  1PJ5 A;  1ZVU A;  3L4K A;  3S1Q C;  4KM9 A;  3S14 K;  4X6A K;  1TWA C;  3S2H K;  3AH5 A;  2CFA A;  3Q3Q A;  1J98 A;  4OIR A;  4BLA A;  2NVY C;  3DXJ A;  1PJ7 A;  3GTJ K;  4C3J K;  1C0A A;  4G0V A;  1O28 A;  2JA6 A;  3AQP A;  3SZY A;  4KMU A;  3WOD A;  4C3H K;  2W7V A;  4A3F C;  1XZQ A;  3HKZ L;  4A3I K;  2R93 K;  3T02 A;  3OEP A;  5JFE A;  5TMC A;  2VUM K;  1TWC K;  3I4M K;  3LAJ A;  3AD8 C;  3JST A;  3HOW K;  2XCQ A;  2R7Z K;  3TFH A;  4C45 A;  3S1Q K;  1ZBS A;  4KB4 A;  2P5M A;  2JA5 C;  1TWA K;  4LK0 A;  5M5X K;  4C2M C;  4GZY A;  1GE9 A;  2V6T A;  2E2J C;  1ZQ1 C;  2NVY K;  1Y1W A;  4BBR C;  1YNJ A;  2CW0 A;  4YFK A;  5D4D A;  2V6S A;  5M3F K;  3H3V L;  3FOF A;  5C4J C;  3TFJ A;  3S17 C;  4QIW D;  1F9N A;  3FKI C;  4BXX C;  2CFA B;  4P5A A;  4A3F K;  4GTL A;  4GTA A;  3ERE D;  4AH6 A;  1KQ4 A;  2JH3 A;  2V6U A;  5IOQ A;  2E2H A;  3OPF A;  1Y1V C;  3N0B A;  2Y0S L;  3GTQ A;  1XZQ B;  1UV7 A;  1JQW A;  2R92 C;  2JA5 K;  2XCO A;  4C2M K;  4BLB A;  1K83 C;  2A6E A;  2E2J K;  3L4J A;  1WCM C;  4BBR K;  3HOY C;  5M3M K;  3A8J A;  3K7A C;  5TJ3 A;  3TFI A;  4A3K C;  5EGH A;  1IS1 A;  5C4J K;  3S17 K;  2A6H A;  4Y52 C;  1X31 C;  2GAG C;  4KMD A;  4YFN A;  4Q4Z A;  3FKI K;  2E2H C;  4LK1 A;  2RGR A;  4BXX K;  3GTQ C;  3PO3 C;  1IL2 A;  1I6H C;  3GSI A;  5L46 A;  1BS2 A;  4BY1 C;  3BP3 A;  2FQT A;  3BP8 C;  1Y1V K;  4PAB A;  2O5J A;  3GTK A;  4G7O A;  4A3D C;  1WOO A;  2E2I A;  4Y7N C;  4WJ3 M;  4AYB D;  4G0W A;  1DD5 A;  2R92 K;  4LQY A;  2ZUE A;  3QX3 A;  1VH2 A;  4G7Z A;  3S2D C;  1K83 K;  3GEH A;  1XXB A;  1JOE A;  1WCM K;  2O5I A;  3HOY K;  3K7A K;  4A3K K;  2WAQ D;  1J6W A;  2GSO A;  1TWH C;  1AB4 A;  4Y52 K;  5IOR A;  2E2H K;  3GTK C;  3GTQ K;  3PO3 K;  4KM8 A;  1I6H K;  3LPX A;  2NVT C;  4KN7 A;  5HL8 A;  3GTP A;  5IOT A;  4BY1 K;  4XLP A;  1EI6 A;  1XPP A;  3LAP A;  2JA7 A;  1ZYR A;  4A3D K;  3GTM C;  4KC6 A;  4ZH4 A;  4C3I C;  4Y7N K;  5M5Y K;  1YCL A;  2P8T A;  1SFO A;  1VJE A;  4KAS A;  3S2D K;  4MEX A;  3AD7 C;  3GDZ A;  3GEE A;  3HOV C;  2NVX A;  4DDQ A;  3CQZ A;  3CAG A;  2PA8 D;  3GTP C;  1TWH K;  1IW7 A;  4KB2 A;  2B63 A;  1F7U A;  3V4G A;  3GTK K;  1TWF A;  3TTG A;  3MML B;  1B4B A;  2JA6 C;  5TMF A;  2NVT K;  1VRQ C;  4P9S A;  1XXA A;  5IYC C;  3GTM K;  4C3I K;  4BKW A;  2WB1 D;  4KMH A;  3SZZ A;  4YG2 A;  1JVI A;  4GTF A;  3GIR A;  2PPB A;  3HOV K;  3GTL A;  1I50 A;  1TWG A;  4P5B A;  1WSV A;  1Y1W C;  3GTP K;  4J3N A;  3VA7 A;  3GEI A;  1RU0 A;  3I4N C;  2JA6 K;  1F7V A;  1O26 A;  3AD9 C;  3GTG A;  1USO A;  3S15 C;  5IYC K;  3S1M C;  3GTL C;  2XCR B;  1TWG C;  4G7H A;  4YFX A;  4G0U A;  1O25 A;  3N0C A;  4LJZ A;  4GTC A;  4A3C C;  4A3M C;  4GTB A;  4LOW A;  5E68 A;  5C44 C;  1IBA A;  1IE0 A;  1V5V A;  3GTJ A;  4A3J C;  1EK8 A;  1Y1W K;  4LR2 A;  2Y3P A;  3NUH A;  1DCP A;  5IYB C;  3I4N K;  3A8K A;  3HKZ D;  1I3Q A;  1XZP A;  5CHP A;  3ADA C;  4QIW L;  2R93 A;  3G4A A;  3PO2 C;  3S15 K;  2NVQ C;  2VUM A;  1TWC A;  1WQF A;  3S1M K;  3GTL K;  3GTO A;  1TWG K;  2R7Z A;  1O2F B;  1DCO A;  4BY7 C;  1O24 A;  4A3C K;  3A8I A;  4A3M K;  4KN4 A;  5IP9 C;  3HOU C;  1L0W A;  2E2I C;  1O2A A;  5C44 K;  4GTE A;  1WSR A;  1I3Q C;  4FZB A;  4A3G C;  3H3V D;  4A3J K;  2RH6 A;  1WIH A;  4A93 C;  3S16 C;  4FM9 A;  5FLM C;  3GTO C;  1R9T A;  4OIP A;  4KMA A;  5IYB K;  2PMZ D;  3HOX C;  3RZO C;  1I6V A;  3FHZ A;  4BBS C;  1BJT A;  3PO2 K;  4KAT A;  3AQO A;  5IYD C;  2NVQ K;  2Y0S D;  1DCH A;  3G4C A;  1WOP A;  4GT9 A;  3HXA A;  1XZP B;  4BY7 K;  2YU9 A;  2JA7 C;  1VGX A;  3S1N C;  5IP9 K;  1R9T C;  3HOU K;  4RMF A;  2E2I K;  3EQL A;  4KAR A;  2JA5 A;  3S1R C;  3T01 A;  1I3Q K;  1SFO C;  2GAH C;  5JVO A;  4A3G K;  4AYB L;  1WOS A;  2ZUF A;  4OIQ A;  2NVX C;  4A93 K;  3S16 K;  1BGW A;  3HOZ C;  3CQZ C;  5FLM K;  3GTO K;  1J6X A;  1WQH A;  4KAW X;  3FKI A;  2WAQ L;  4XSZ A;  2B63 C;  3HOX K;  4OIO A;  3RZO K;  2YU9 C;  1YX2 A;  5EGE A;  1XXC A;  4BBS K;  1TWF C;  2GSU A;  5IP7 C;  5IYD K;  4A3E C;  1EQR A;  1O2B A;  1Y1V A;  3FOE A;  4ILD A;  3M3Y C;  3S1N K;  4MQ9 A;  2JA7 K;  2ZFZ A;  2PHC B;  1R9T K;  2R92 A;  3S1R K;  1K83 A; 
#chains in the Genus database with same CATH homology
 1JVI A;  1IE0 A;  1INN A;  1JOE A;  2FQO A;  4XCH A;  1VH2 A;  1VGX A;  1J98 A;  2FQT A;  1YCL A;  1J6W A;  1J6V A;  5E68 A;  1VJE A;  1J6X A;  1JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...