1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1JVIA 1YCLA 1VH2A 1J98A 1J6WA 2FQTA 1JOEA 2FQOA 1INNA 4XCHA 1JQWA 5E68A 1J6XA 1VGXA 1J6VA 1IE0A 1VJEA
chains in the Genus database with same CATH superfamily
4Q5SA 3GTMA 2WB1L 4BY1C 4P9SA 1JVIA 1TWFK 1YCLA 1I6HC 4XLNA 5EGEA 2NVXA 4KMDA 4A3BK 3GDZA 4LOWA 2XCOA 3GTOC 1R9TA 3S17C 4Y7NC 1F7VA 2R7ZC 4GTBA 3L4JA 3S2DC 3S16C 4BY7C 1J98A 1SMYA 2CFAA 1L0WA 5IOTA 2JA7C 4M1XA 5CJ9A 4BY1K 5D4DA 1TWAA 2JH3A 1I3QC 3MMLB 4Q4ZA 1XXBA 1TWGK 3S1QC 4A3GK 5E68A 3T01A 3GTLK 3TFHA 4NOIA 3T00A 1VH2A 3AQPA 3AH5A 1IL2A 1V5VA 5HL8A 4MQ9A 2JA5K 1ZXOA 2E2IK 4OINA 3FHZA 1WCMC 3S14K 4BLBA 3G4AA 4GTFA 3S15C 3RZDC 2NVXK 4GTAA 4P5AA 2JA8K 2FQTA 5C44K 3GTPK 1O27A 1O2AA 5C4JC 1TWFA 3S2HK 3HKZL 1IE0A 1XZPB 3V4GA 1B4AA 5EGHA 4KMAA 4LJZA 1ZQ1C 2NVTC 3HOWK 2YU9A 1AB4A 1Y1WC 5TMCA 5FLMC 4A3MC 4LLGA 4LQYA 3CQZA 4OIOA 4MEXA 4YFNA 2JA8C 1USMA 1WOOA 2E2HK 4X6AK 4FZBA 2R7ZA 1R9TC 3DXJA 2BE5A 3GTKA 2A68A 3IPJA 5M5WK 2KWAA 3I4MC 3AD8C 4YG2A 1ZBSA 5M5XK 3GTJA 5M3FK 2PPBA 3S1RC 1SFOC 1BDFA 3T02A 2NVYA 5C4JK 2GAHC 4KDDA 3OREA 4G7ZA 3HOXK 1YNNA 1IW7A 4LR2A 3GTGK 4A93K 4C3HK 1INNA 3HKZD 1K83K 3RZOC 1YX2A 4A3FK 4QIWD 1K83A 3S1NK 3GEEA 1O25A 1VGXA 4A3EK 3NUHA 3I4MK 3EQLA 3ADAC 3BP8C 3S17K 3K7AC 3VA7A 3BP3A 1PJ5A 4KM9A 1IQ0A 4G0WA 3TFIA 1TWGA 1PJ7A 2Y0SL 1DCPA 1TWAK 3QX3A 4Y52K 3H3VL 3GTLA 1HI9A 3LPXA 2FQOA 2PMZL 3SZZA 3M3YC 4GZYA 2R93A 3PO2K 2R92C 4QJVA 5IORA 1F9NA 1XPPA 2O5IA 4YFKA 3GTPA 1O29A 3S1MK 3GTKC 4A3IC 5IYDK 4C3HC 4KAWX 3CAGA 4KB2A 3GTLC 2VUMC 1F93A 5C44C 1IS1A 4QIWL 2JA6C 3HOUK 5IOSA 1WQGA 3GTQK 3S15K 2CW0A 2GSUA 1TWAC 1GE9A 3GEHA 5M3MK 1I3QA 1JOEA 2V6TA 4G7HA 4GTDA 1O28A 4KMUA 1Y1VC 2VUMK 4A3MK 1O24A 3SZYA 1F7UA 1EH1A 2RH6A 3RZDK 1WCMA 4C2MC 2ZUFA 1X31C 1WSVA 4C3JK 3HOYC 3CQZK 1EI6A 5C4XK 4KASA 1TWHK 5CHPA 3H0GC 3RZOK 1EFWA 5FJ8K 4KC6A 4KN4A 3JSTA 4AH6A 4WJ4A 1EQRA 3FKIA 5IYDC 3N3YA 4A3IK 2A6HA 3S1RK 1SFOK 4BXXK 4BBSC 3S1NC 4A3DC 1DCOA 4J3NA 3CQZC 2R92K 2YU9C 4WILA 3S2DK 5IP9C 4A3GC 4A93C 5IP7C 4A3CC 4JK1A 1ZVUA 2ZUEA 2YU9K 2A69A 4KB4A 4A3EC 4AYBD 1TWHC 1YNJA 1B4BA 5C4XC 3H3VD 4XLPA 3A8JA 1KQ4A 2NVQK 1I50A 2EBBA 4GFQA 3K7AK 4BLAA 4A3CK 3GEIA 5IP9K 2W7VA 4KN7A 2P5MA 4O2DA 1EK8A 1Y1VA 1DCHA 2GSOA 1VLOA 3H0GK 4PAAA 1DD5A 5JFEA 4BBSK 2O5JA 4G7OA 1K83C 3S1MC 4PABA 4FM9A 2JA5C 3HOZC 3GTQC 1BJTA 5IOQA 2GSNA 3WODA 2E2HC 1O26A 3PO2C 1IBAA 1I6VA 2JA6K 1XZPA 3GSIA 3OEPA 1J6XA 2CFAB 1TWGC 1WSRA 4XSXA 3HOWC 2A6EA 3FOFA 1HQMA 1RU0A 4A3JK 2NVQC 3I4NC 3TTGA 4GTCA 2E2JK 4A3LC 2Y3PA 2R93C 3HOUC 1TWHA 2PMZD 3A8IA 4AYBL 1BGWA 3PO3C 4G0UA 3GTOA 1Y1WK 3M3YK 4A3KC 2ZFZA 3GTOK 2E2JC 4A3LK 2E2HA 3LAJA 1WCMK 1XZQB 1USOA 2E2IC 1WOPA 4A3JC 3I4NK 1J6WA 1XZQA 3FOEA 3L4KA 4C45A 2VUMA 4MEYA 4OIQA 5TJ3A 4XCHA 3TFJA 5IYCK 1BS2A 2WAQD 3M4OC 1WORA 4BKWA 3LAPA 4C3IC 1C0AA 4BBRC 5IYBK 4GTLA 3FKIC 4ILDA 3A8KA 4BXXC 4KMHA 4BY7K 4YFXA 3FKIK 3S16K 3AD9C 4C2MK 5IYBC 1O2BA 1TWCC 3GTQA 4A3KK 4X6AC 4Y7NK 4OIPA 5IP7K 2PHCB 3PO3K 5IYCC 1I3QK 3Q3QA 1TWFC 1I6HK 4LK0A 2XCQA 2JA7K 1WIHA 4ZH4A 1VRQC 2B63A 3HXAA 4A3FC 1I50K 5L46A 3HOVC 2JA7A 2D6FC 3AQOA 1WQHA 3S0XA 2PA8D 1WOSA 4C3IK 1O2FB 4P5BA 1TWCK 1Y1VK 5JVOA 2B63C 4A3BC 1TWCA 5FLMK 2R93K 2P8TA 2NVYK 1XXCA 4G0VA 4LK1A 2E2IA 2JA6A 3S14C 2JA5A 2WAQL 1WQFA 4C3JC 3HOYK 1UV7A 1R9TK 4BBRK 1J6VA 3AD7C 1PJ6A 2NVYC 3HOXC 2V6SA 1SFOA 3S2HC 3GTJC 3GTMK 1XXAA 3GTPC 4XSZA 4GT9A 4WJ3M 4QJVB 5C3EC 3HOZK 4OIRA 3N0CA 4KM8A 4Y52C 1I50C 3HOVK 2Y0SD 2R92A 2V6UA 3N0BA 1VJEA 1ZYRA 2B63K 4RMFA 1Y1WA 3GIRA 3GTJK 3GTMC 2R7ZK 4GTEA 1G51A 3BUEA 1ISEA 5TMFA 3GTGA 3GTKK 2NVTK 3OPFA 2PA8L 4KATA 4A3DK 1JQWA 5C3EK 2GAGC 3ERED 4DDQA 3G4CA 2XCRB 3S1QK 4KARA 3GTGC 3M4OK 5M5YK 2RGRA 2NVXC 3H0GA 2WB1D
chains in the Genus database with same CATH topology
1JVIA 1YCLA 1VH2A 1J98A 1J6WA 2FQTA 1JOEA 2FQOA 1INNA 4XCHA 1JQWA 5E68A 1J6XA 1VGXA 1J6VA 1IE0A 1VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  1YCL A;  1VH2 A;  1J98 A;  1J6W A;  2FQT A;  1JOE A;  2FQO A;  1INN A;  4XCH A;  1JQW A;  5E68 A;  1J6X A;  1VGX A;  1J6V A;  1IE0 A;  1VJE A; 
#chains in the Genus database with same CATH topology
 4Q5S A;  3GTM A;  2WB1 L;  4BY1 C;  4P9S A;  1JVI A;  1TWF K;  1YCL A;  1I6H C;  4XLN A;  5EGE A;  2NVX A;  4KMD A;  4A3B K;  3GDZ A;  4LOW A;  2XCO A;  3GTO C;  1R9T A;  3S17 C;  4Y7N C;  1F7V A;  2R7Z C;  4GTB A;  3L4J A;  3S2D C;  3S16 C;  4BY7 C;  1J98 A;  1SMY A;  2CFA A;  1L0W A;  5IOT A;  2JA7 C;  4M1X A;  5CJ9 A;  4BY1 K;  5D4D A;  1TWA A;  2JH3 A;  1I3Q C;  3MML B;  4Q4Z A;  1XXB A;  1TWG K;  3S1Q C;  4A3G K;  5E68 A;  3T01 A;  3GTL K;  3TFH A;  4NOI A;  3T00 A;  1VH2 A;  3AQP A;  3AH5 A;  1IL2 A;  1V5V A;  5HL8 A;  4MQ9 A;  2JA5 K;  1ZXO A;  2E2I K;  4OIN A;  3FHZ A;  1WCM C;  3S14 K;  4BLB A;  3G4A A;  4GTF A;  3S15 C;  3RZD C;  2NVX K;  4GTA A;  4P5A A;  2JA8 K;  2FQT A;  5C44 K;  3GTP K;  1O27 A;  1O2A A;  5C4J C;  1TWF A;  3S2H K;  3HKZ L;  1IE0 A;  1XZP B;  3V4G A;  1B4A A;  5EGH A;  4KMA A;  4LJZ A;  1ZQ1 C;  2NVT C;  3HOW K;  2YU9 A;  1AB4 A;  1Y1W C;  5TMC A;  5FLM C;  4A3M C;  4LLG A;  4LQY A;  3CQZ A;  4OIO A;  4MEX A;  4YFN A;  2JA8 C;  1USM A;  1WOO A;  2E2H K;  4X6A K;  4FZB A;  2R7Z A;  1R9T C;  3DXJ A;  2BE5 A;  3GTK A;  2A68 A;  3IPJ A;  5M5W K;  2KWA A;  3I4M C;  3AD8 C;  4YG2 A;  1ZBS A;  5M5X K;  3GTJ A;  5M3F K;  2PPB A;  3S1R C;  1SFO C;  1BDF A;  3T02 A;  2NVY A;  5C4J K;  2GAH C;  4KDD A;  3ORE A;  4G7Z A;  3HOX K;  1YNN A;  1IW7 A;  4LR2 A;  3GTG K;  4A93 K;  4C3H K;  1INN A;  3HKZ D;  1K83 K;  3RZO C;  1YX2 A;  4A3F K;  4QIW D;  1K83 A;  3S1N K;  3GEE A;  1O25 A;  1VGX A;  4A3E K;  3NUH A;  3I4M K;  3EQL A;  3ADA C;  3BP8 C;  3S17 K;  3K7A C;  3VA7 A;  3BP3 A;  1PJ5 A;  4KM9 A;  1IQ0 A;  4G0W A;  3TFI A;  1TWG A;  1PJ7 A;  2Y0S L;  1DCP A;  1TWA K;  3QX3 A;  4Y52 K;  3H3V L;  3GTL A;  1HI9 A;  3LPX A;  2FQO A;  2PMZ L;  3SZZ A;  3M3Y C;  4GZY A;  2R93 A;  3PO2 K;  2R92 C;  4QJV A;  5IOR A;  1F9N A;  1XPP A;  2O5I A;  4YFK A;  3GTP A;  1O29 A;  3S1M K;  3GTK C;  4A3I C;  5IYD K;  4C3H C;  4KAW X;  3CAG A;  4KB2 A;  3GTL C;  2VUM C;  1F93 A;  5C44 C;  1IS1 A;  4QIW L;  2JA6 C;  3HOU K;  5IOS A;  1WQG A;  3GTQ K;  3S15 K;  2CW0 A;  2GSU A;  1TWA C;  1GE9 A;  3GEH A;  5M3M K;  1I3Q A;  1JOE A;  2V6T A;  4G7H A;  4GTD A;  1O28 A;  4KMU A;  1Y1V C;  2VUM K;  4A3M K;  1O24 A;  3SZY A;  1F7U A;  1EH1 A;  2RH6 A;  3RZD K;  1WCM A;  4C2M C;  2ZUF A;  1X31 C;  1WSV A;  4C3J K;  3HOY C;  3CQZ K;  1EI6 A;  5C4X K;  4KAS A;  1TWH K;  5CHP A;  3H0G C;  3RZO K;  1EFW A;  5FJ8 K;  4KC6 A;  4KN4 A;  3JST A;  4AH6 A;  4WJ4 A;  1EQR A;  3FKI A;  5IYD C;  3N3Y A;  4A3I K;  2A6H A;  3S1R K;  1SFO K;  4BXX K;  4BBS C;  3S1N C;  4A3D C;  1DCO A;  4J3N A;  3CQZ C;  2R92 K;  2YU9 C;  4WIL A;  3S2D K;  5IP9 C;  4A3G C;  4A93 C;  5IP7 C;  4A3C C;  4JK1 A;  1ZVU A;  2ZUE A;  2YU9 K;  2A69 A;  4KB4 A;  4A3E C;  4AYB D;  1TWH C;  1YNJ A;  1B4B A;  5C4X C;  3H3V D;  4XLP A;  3A8J A;  1KQ4 A;  2NVQ K;  1I50 A;  2EBB A;  4GFQ A;  3K7A K;  4BLA A;  4A3C K;  3GEI A;  5IP9 K;  2W7V A;  4KN7 A;  2P5M A;  4O2D A;  1EK8 A;  1Y1V A;  1DCH A;  2GSO A;  1VLO A;  3H0G K;  4PAA A;  1DD5 A;  5JFE A;  4BBS K;  2O5J A;  4G7O A;  1K83 C;  3S1M C;  4PAB A;  4FM9 A;  2JA5 C;  3HOZ C;  3GTQ C;  1BJT A;  5IOQ A;  2GSN A;  3WOD A;  2E2H C;  1O26 A;  3PO2 C;  1IBA A;  1I6V A;  2JA6 K;  1XZP A;  3GSI A;  3OEP A;  1J6X A;  2CFA B;  1TWG C;  1WSR A;  4XSX A;  3HOW C;  2A6E A;  3FOF A;  1HQM A;  1RU0 A;  4A3J K;  2NVQ C;  3I4N C;  3TTG A;  4GTC A;  2E2J K;  4A3L C;  2Y3P A;  2R93 C;  3HOU C;  1TWH A;  2PMZ D;  3A8I A;  4AYB L;  1BGW A;  3PO3 C;  4G0U A;  3GTO A;  1Y1W K;  3M3Y K;  4A3K C;  2ZFZ A;  3GTO K;  2E2J C;  4A3L K;  2E2H A;  3LAJ A;  1WCM K;  1XZQ B;  1USO A;  2E2I C;  1WOP A;  4A3J C;  3I4N K;  1J6W A;  1XZQ A;  3FOE A;  3L4K A;  4C45 A;  2VUM A;  4MEY A;  4OIQ A;  5TJ3 A;  4XCH A;  3TFJ A;  5IYC K;  1BS2 A;  2WAQ D;  3M4O C;  1WOR A;  4BKW A;  3LAP A;  4C3I C;  1C0A A;  4BBR C;  5IYB K;  4GTL A;  3FKI C;  4ILD A;  3A8K A;  4BXX C;  4KMH A;  4BY7 K;  4YFX A;  3FKI K;  3S16 K;  3AD9 C;  4C2M K;  5IYB C;  1O2B A;  1TWC C;  3GTQ A;  4A3K K;  4X6A C;  4Y7N K;  4OIP A;  5IP7 K;  2PHC B;  3PO3 K;  5IYC C;  1I3Q K;  3Q3Q A;  1TWF C;  1I6H K;  4LK0 A;  2XCQ A;  2JA7 K;  1WIH A;  4ZH4 A;  1VRQ C;  2B63 A;  3HXA A;  4A3F C;  1I50 K;  5L46 A;  3HOV C;  2JA7 A;  2D6F C;  3AQO A;  1WQH A;  3S0X A;  2PA8 D;  1WOS A;  4C3I K;  1O2F B;  4P5B A;  1TWC K;  1Y1V K;  5JVO A;  2B63 C;  4A3B C;  1TWC A;  5FLM K;  2R93 K;  2P8T A;  2NVY K;  1XXC A;  4G0V A;  4LK1 A;  2E2I A;  2JA6 A;  3S14 C;  2JA5 A;  2WAQ L;  1WQF A;  4C3J C;  3HOY K;  1UV7 A;  1R9T K;  4BBR K;  1J6V A;  3AD7 C;  1PJ6 A;  2NVY C;  3HOX C;  2V6S A;  1SFO A;  3S2H C;  3GTJ C;  3GTM K;  1XXA A;  3GTP C;  4XSZ A;  4GT9 A;  4WJ3 M;  4QJV B;  5C3E C;  3HOZ K;  4OIR A;  3N0C A;  4KM8 A;  4Y52 C;  1I50 C;  3HOV K;  2Y0S D;  2R92 A;  2V6U A;  3N0B A;  1VJE A;  1ZYR A;  2B63 K;  4RMF A;  1Y1W A;  3GIR A;  3GTJ K;  3GTM C;  2R7Z K;  4GTE A;  1G51 A;  3BUE A;  1ISE A;  5TMF A;  3GTG A;  3GTK K;  2NVT K;  3OPF A;  2PA8 L;  4KAT A;  4A3D K;  1JQW A;  5C3E K;  2GAG C;  3ERE D;  4DDQ A;  3G4C A;  2XCR B;  3S1Q K;  4KAR A;  3GTG C;  3M4O K;  5M5Y K;  2RGR A;  2NVX C;  3H0G A;  2WB1 D; 
#chains in the Genus database with same CATH homology
 1JVI A;  1YCL A;  1VH2 A;  1J98 A;  1J6W A;  2FQT A;  1JOE A;  2FQO A;  1INN A;  4XCH A;  1JQW A;  5E68 A;  1J6X A;  1VGX A;  1J6V A;  1IE0 A;  1VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...