1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
b'VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
molecule tags Signaling protein
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1IE0A 4XCHA 1INNA 1J98A 1JQWA 1J6XA 1J6VA 1VGXA 1YCLA 1J6WA 2FQOA 5E68A 1VH2A 1JVIA 1JOEA 1VJEA 2FQTA
chains in the Genus database with same CATH superfamily
1ZVUA 2B63K 4GTFA 3T01A 2PPBA 4GTDA 4GT9A 1JVIA 4KMHA 3HKZL 2WB1D 2FQOA 2NVTC 2JA8K 1TWCA 4OIOA 3MMLB 1VJEA 5TJ3A 2PMZD 3RZDK 1YNJA 5IYBK 3HXAA 1F93A 1UV7A 4A3LK 4JK1A 1ZQ1C 1J6WA 3GSIA 4C3HK 2E2HC 4OIRA 1PJ7A 2XCOA 4MEYA 4KDDA 3GTOA 1C0AA 3M3YK 1Y1WA 1BJTA 1XZQB 3FOEA 4GTLA 3HOZC 2JA6K 3H3VD 2YU9K 3OREA 2FQTA 4PABA 1XXCA 3FKIC 4BLBA 4DDQA 4A3EK 1GE9A 1DCPA 4P5BA 2R92C 3S1RK 2PA8D 2WAQL 2R93C 3GIRA 5FJ8K 1USMA 3HOWC 1IBAA 2E2IK 2NVXA 2A68A 1I50K 1VGXA 4LJZA 5HL8A 3M4OK 1DD5A 2NVYK 1TWAK 1K83K 1BDFA 4FM9A 1EFWA 1TWHC 3DXJA 4BXXK 5D4DA 1TWFC 3PO3C 3S2DC 3HOYC 3GTPA 3ERED 3GTLC 1O29A 2PHCB 2JA7K 4BY7K 4YFNA 5M3FK 1XZQA 4KMAA 2WB1L 5IP9C 2XCQA 1R9TK 4J3NA 5C4XC 3GTMC 1IW7A 1O24A 1IE0A 2PMZL 4P5AA 2B63C 2RH6A 2V6UA 3S2HK 3BUEA 3LPXA 1F7UA 5C3EK 2JA8C 4LK1A 2JA6A 4A3KK 1WOSA 2GSOA 4C3JC 2YU9A 4A93K 5IYBC 3A8IA 4G0UA 3GTOK 1VH2A 1Y1WK 4LLGA 1XPPA 1Y1VA 3HOXK 3H3VL 4GFQA 1USOA 2V6SA 5CJ9A 3HOUK 5IORA 4YG2A 3GTGK 2E2IA 1I50A 4BBRC 4GTEA 2PA8L 1TWAA 5EGHA 1BGWA 1K83A 3LAPA 3S16K 1XXAA 1SFOK 4XLPA 4A3EC 3S1RC 3CAGA 1WOOA 1I6HC 1WIHA 4MQ9A 4A3IC 3LAJA 3TFIA 4A3FK 3AD7C 4NOIA 4A3MK 4OINA 3GTPK 4XSXA 5CHPA 3S15K 2NVYC 1R9TA 1XXBA 1WCMA 1I3QA 4OIQA 5TMFA 4G0WA 4Q5SA 4WILA 3SZYA 3IPJA 5C4JK 3WODA 4C3IK 2JA5A 4GZYA 4O2DA 2JA7C 1JOEA 3Q3QA 5FLMC 1AB4A 4A3BK 3OPFA 1ISEA 3NUHA 4BBSK 2KWAA 3HOVK 5IYCK 1EI6A 1TWCC 3I4NK 4G7OA 2W7VA 1ZBSA 4X6AC 3GTGA 1DCOA 4Y52K 4A3CC 4Q4ZA 3RZOC 4BLAA 4G7ZA 2GAGC 3A8JA 3CQZK 5JVOA 5C3EC 2Y0SD 3N3YA 4Y7NK 1TWGK 1Y1VK 5EGEA 5JFEA 3GTKK 2ZFZA 4MEXA 2VUMK 1V5VA 4A93C 2O5IA 1ZXOA 3GTOC 1SFOA 3PO2K 1Y1WC 2R7ZC 3S1MK 2A69A 3GTQK 1WQHA 3S1QK 2D6FC 3A8KA 5TMCA 1TWFA 1BS2A 3BP8C 4BKWA 3S17C 5M5WK 3SZZA 2P5MA 3VA7A 3TTGA 2NVXC 2A6EA 3S1NC 1J98A 1VRQC 4WJ4A 5E68A 4YFXA 1WCMK 4KAWX 5C44K 1I3QK 1HI9A 1F9NA 3OEPA 4A3FC 4KATA 4QIWD 5IP7K 4A3MC 2JA5K 3L4JA 1VLOA 3EQLA 2ZUEA 2E2HK 3RZDC 4KC6A 2E2JK 4M1XA 4KB4A 4PAAA 4XSZA 2Y3PA 1XZPB 5C4JC 4A3LC 4C3IC 3JSTA 3CQZA 2CFAB 1YCLA 4AYBD 1TWGA 4LOWA 4C3HC 4A3BC 1WOPA 3GTKA 2VUMA 1EQRA 1O27A 3TFHA 2R92K 4P9SA 2A6HA 3M3YC 4BBSC 3L4KA 4G7HA 3HOVC 1O2AA 5IYCC 3GTQA 2R93K 1G51A 2Y0SL 2JA6C 3GTJA 3HOWK 5M5YK 3H0GA 4KM9A 2YU9C 3I4MK 1INNA 4OIPA 3S0XA 3G4CA 5M5XK 3N0BA 4C45A 2P8TA 4Y7NC 3AQPA 1WSVA 3K7AK 4FZBA 2GSNA 1TWFK 2E2IC 3HOYK 2ZUFA 1I50C 3PO2C 3GTLK 3N0CA 3M4OC 4KMDA 2NVQK 2CW0A 1TWAC 3S1QC 3ADAC 1K83C 1XZPA 2BE5A 2O5JA 4BXXC 1F7VA 1O25A 2CFAA 3FOFA 1KQ4A 5C4XK 3GEHA 5L46A 3AD8C 5IYDK 4BY7C 2E2HA 4ZH4A 4QIWL 1O28A 2RGRA 1R9TC 1RU0A 4XCHA 1WCMC 4C3JK 5C44C 1I3QC 4QJVB 3QX3A 2XCRB 1SMYA 3FKIA 5IP7C 3S2HC 3S14K 3BP3A 3AD9C 2JA5C 2R92A 1WQGA 1IL2A 2R93A 4AYBL 4A3KC 4A3GK 4LR2A 4C2MK 2E2JC 1WORA 4A3DK 4BBRK 2R7ZA 3T02A 1X31C 1L0WA 3GTJK 4BY1K 3HOXC 1ZYRA 3H0GK 1B4AA 4A3JK 4G0VA 1PJ5A 1TWHA 3HOUC 3GTGC 4WJ3M 1J6XA 1YX2A 4KASA 4KARA 3GTLA 5IOQA 4LQYA 1EH1A 2GAHC 4XLNA 4KN7A 1I6HK 5M3MK 3S16C 4A3IK 1WQFA 3I4MC 1SFOC 4YFKA 1HQMA 2NVTK 3V4GA 1I6VA 3GTMA 4QJVA 1WSRA 2B63A 3K7AC 3AQOA 3HKZD 3GTPC 1PJ6A 4RMFA 3TFJA 3S15C 3GEIA 5IOSA 2NVQC 2JH3A 5FLMK 4GTBA 5IOTA 4ILDA 3G4AA 4KMUA 4KN4A 1TWCK 3FHZA 3HOZK 5IYDC 4X6AK 1IQ0A 4GTCA 1IS1A 4A3CK 3GDZA 3FKIK 3RZOK 1B4BA 3GEEA 1O2BA 3I4NC 4GTAA 3AH5A 4LK0A 4Y52C 2R7ZK 4AH6A 3S14C 4KB2A 1YNNA 2WAQD 2EBBA 3CQZC 1DCHA 2V6TA 1TWGC 1Y1VC 4A3GC 4C2MC 3GTKC 1O2FB 2VUMC 1TWHK 4A3DC 3PO3K 4KM8A 3S2DK 1JQWA 3T00A 3S1MC 3S17K 2NVYA 3GTQC 1O26A 3GTJC 4BY1C 1J6VA 3H0GC 4A3JC 2NVXK 3S1NK 5IP9K 1EK8A 2GSUA 2JA7A 3GTMK
chains in the Genus database with same CATH topology
1IE0A 4XCHA 1INNA 1J98A 1JQWA 1J6XA 1J6VA 1VGXA 1YCLA 1J6WA 2FQOA 5E68A 1VH2A 1JVIA 1JOEA 1VJEA 2FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IE0 A;  4XCH A;  1INN A;  1J98 A;  1JQW A;  1J6X A;  1J6V A;  1VGX A;  1YCL A;  1J6W A;  2FQO A;  5E68 A;  1VH2 A;  1JVI A;  1JOE A;  1VJE A;  2FQT A; 
#chains in the Genus database with same CATH topology
 1ZVU A;  2B63 K;  4GTF A;  3T01 A;  2PPB A;  4GTD A;  4GT9 A;  1JVI A;  4KMH A;  3HKZ L;  2WB1 D;  2FQO A;  2NVT C;  2JA8 K;  1TWC A;  4OIO A;  3MML B;  1VJE A;  5TJ3 A;  2PMZ D;  3RZD K;  1YNJ A;  5IYB K;  3HXA A;  1F93 A;  1UV7 A;  4A3L K;  4JK1 A;  1ZQ1 C;  1J6W A;  3GSI A;  4C3H K;  2E2H C;  4OIR A;  1PJ7 A;  2XCO A;  4MEY A;  4KDD A;  3GTO A;  1C0A A;  3M3Y K;  1Y1W A;  1BJT A;  1XZQ B;  3FOE A;  4GTL A;  3HOZ C;  2JA6 K;  3H3V D;  2YU9 K;  3ORE A;  2FQT A;  4PAB A;  1XXC A;  3FKI C;  4BLB A;  4DDQ A;  4A3E K;  1GE9 A;  1DCP A;  4P5B A;  2R92 C;  3S1R K;  2PA8 D;  2WAQ L;  2R93 C;  3GIR A;  5FJ8 K;  1USM A;  3HOW C;  1IBA A;  2E2I K;  2NVX A;  2A68 A;  1I50 K;  1VGX A;  4LJZ A;  5HL8 A;  3M4O K;  1DD5 A;  2NVY K;  1TWA K;  1K83 K;  1BDF A;  4FM9 A;  1EFW A;  1TWH C;  3DXJ A;  4BXX K;  5D4D A;  1TWF C;  3PO3 C;  3S2D C;  3HOY C;  3GTP A;  3ERE D;  3GTL C;  1O29 A;  2PHC B;  2JA7 K;  4BY7 K;  4YFN A;  5M3F K;  1XZQ A;  4KMA A;  2WB1 L;  5IP9 C;  2XCQ A;  1R9T K;  4J3N A;  5C4X C;  3GTM C;  1IW7 A;  1O24 A;  1IE0 A;  2PMZ L;  4P5A A;  2B63 C;  2RH6 A;  2V6U A;  3S2H K;  3BUE A;  3LPX A;  1F7U A;  5C3E K;  2JA8 C;  4LK1 A;  2JA6 A;  4A3K K;  1WOS A;  2GSO A;  4C3J C;  2YU9 A;  4A93 K;  5IYB C;  3A8I A;  4G0U A;  3GTO K;  1VH2 A;  1Y1W K;  4LLG A;  1XPP A;  1Y1V A;  3HOX K;  3H3V L;  4GFQ A;  1USO A;  2V6S A;  5CJ9 A;  3HOU K;  5IOR A;  4YG2 A;  3GTG K;  2E2I A;  1I50 A;  4BBR C;  4GTE A;  2PA8 L;  1TWA A;  5EGH A;  1BGW A;  1K83 A;  3LAP A;  3S16 K;  1XXA A;  1SFO K;  4XLP A;  4A3E C;  3S1R C;  3CAG A;  1WOO A;  1I6H C;  1WIH A;  4MQ9 A;  4A3I C;  3LAJ A;  3TFI A;  4A3F K;  3AD7 C;  4NOI A;  4A3M K;  4OIN A;  3GTP K;  4XSX A;  5CHP A;  3S15 K;  2NVY C;  1R9T A;  1XXB A;  1WCM A;  1I3Q A;  4OIQ A;  5TMF A;  4G0W A;  4Q5S A;  4WIL A;  3SZY A;  3IPJ A;  5C4J K;  3WOD A;  4C3I K;  2JA5 A;  4GZY A;  4O2D A;  2JA7 C;  1JOE A;  3Q3Q A;  5FLM C;  1AB4 A;  4A3B K;  3OPF A;  1ISE A;  3NUH A;  4BBS K;  2KWA A;  3HOV K;  5IYC K;  1EI6 A;  1TWC C;  3I4N K;  4G7O A;  2W7V A;  1ZBS A;  4X6A C;  3GTG A;  1DCO A;  4Y52 K;  4A3C C;  4Q4Z A;  3RZO C;  4BLA A;  4G7Z A;  2GAG C;  3A8J A;  3CQZ K;  5JVO A;  5C3E C;  2Y0S D;  3N3Y A;  4Y7N K;  1TWG K;  1Y1V K;  5EGE A;  5JFE A;  3GTK K;  2ZFZ A;  4MEX A;  2VUM K;  1V5V A;  4A93 C;  2O5I A;  1ZXO A;  3GTO C;  1SFO A;  3PO2 K;  1Y1W C;  2R7Z C;  3S1M K;  2A69 A;  3GTQ K;  1WQH A;  3S1Q K;  2D6F C;  3A8K A;  5TMC A;  1TWF A;  1BS2 A;  3BP8 C;  4BKW A;  3S17 C;  5M5W K;  3SZZ A;  2P5M A;  3VA7 A;  3TTG A;  2NVX C;  2A6E A;  3S1N C;  1J98 A;  1VRQ C;  4WJ4 A;  5E68 A;  4YFX A;  1WCM K;  4KAW X;  5C44 K;  1I3Q K;  1HI9 A;  1F9N A;  3OEP A;  4A3F C;  4KAT A;  4QIW D;  5IP7 K;  4A3M C;  2JA5 K;  3L4J A;  1VLO A;  3EQL A;  2ZUE A;  2E2H K;  3RZD C;  4KC6 A;  2E2J K;  4M1X A;  4KB4 A;  4PAA A;  4XSZ A;  2Y3P A;  1XZP B;  5C4J C;  4A3L C;  4C3I C;  3JST A;  3CQZ A;  2CFA B;  1YCL A;  4AYB D;  1TWG A;  4LOW A;  4C3H C;  4A3B C;  1WOP A;  3GTK A;  2VUM A;  1EQR A;  1O27 A;  3TFH A;  2R92 K;  4P9S A;  2A6H A;  3M3Y C;  4BBS C;  3L4K A;  4G7H A;  3HOV C;  1O2A A;  5IYC C;  3GTQ A;  2R93 K;  1G51 A;  2Y0S L;  2JA6 C;  3GTJ A;  3HOW K;  5M5Y K;  3H0G A;  4KM9 A;  2YU9 C;  3I4M K;  1INN A;  4OIP A;  3S0X A;  3G4C A;  5M5X K;  3N0B A;  4C45 A;  2P8T A;  4Y7N C;  3AQP A;  1WSV A;  3K7A K;  4FZB A;  2GSN A;  1TWF K;  2E2I C;  3HOY K;  2ZUF A;  1I50 C;  3PO2 C;  3GTL K;  3N0C A;  3M4O C;  4KMD A;  2NVQ K;  2CW0 A;  1TWA C;  3S1Q C;  3ADA C;  1K83 C;  1XZP A;  2BE5 A;  2O5J A;  4BXX C;  1F7V A;  1O25 A;  2CFA A;  3FOF A;  1KQ4 A;  5C4X K;  3GEH A;  5L46 A;  3AD8 C;  5IYD K;  4BY7 C;  2E2H A;  4ZH4 A;  4QIW L;  1O28 A;  2RGR A;  1R9T C;  1RU0 A;  4XCH A;  1WCM C;  4C3J K;  5C44 C;  1I3Q C;  4QJV B;  3QX3 A;  2XCR B;  1SMY A;  3FKI A;  5IP7 C;  3S2H C;  3S14 K;  3BP3 A;  3AD9 C;  2JA5 C;  2R92 A;  1WQG A;  1IL2 A;  2R93 A;  4AYB L;  4A3K C;  4A3G K;  4LR2 A;  4C2M K;  2E2J C;  1WOR A;  4A3D K;  4BBR K;  2R7Z A;  3T02 A;  1X31 C;  1L0W A;  3GTJ K;  4BY1 K;  3HOX C;  1ZYR A;  3H0G K;  1B4A A;  4A3J K;  4G0V A;  1PJ5 A;  1TWH A;  3HOU C;  3GTG C;  4WJ3 M;  1J6X A;  1YX2 A;  4KAS A;  4KAR A;  3GTL A;  5IOQ A;  4LQY A;  1EH1 A;  2GAH C;  4XLN A;  4KN7 A;  1I6H K;  5M3M K;  3S16 C;  4A3I K;  1WQF A;  3I4M C;  1SFO C;  4YFK A;  1HQM A;  2NVT K;  3V4G A;  1I6V A;  3GTM A;  4QJV A;  1WSR A;  2B63 A;  3K7A C;  3AQO A;  3HKZ D;  3GTP C;  1PJ6 A;  4RMF A;  3TFJ A;  3S15 C;  3GEI A;  5IOS A;  2NVQ C;  2JH3 A;  5FLM K;  4GTB A;  5IOT A;  4ILD A;  3G4A A;  4KMU A;  4KN4 A;  1TWC K;  3FHZ A;  3HOZ K;  5IYD C;  4X6A K;  1IQ0 A;  4GTC A;  1IS1 A;  4A3C K;  3GDZ A;  3FKI K;  3RZO K;  1B4B A;  3GEE A;  1O2B A;  3I4N C;  4GTA A;  3AH5 A;  4LK0 A;  4Y52 C;  2R7Z K;  4AH6 A;  3S14 C;  4KB2 A;  1YNN A;  2WAQ D;  2EBB A;  3CQZ C;  1DCH A;  2V6T A;  1TWG C;  1Y1V C;  4A3G C;  4C2M C;  3GTK C;  1O2F B;  2VUM C;  1TWH K;  4A3D C;  3PO3 K;  4KM8 A;  3S2D K;  1JQW A;  3T00 A;  3S1M C;  3S17 K;  2NVY A;  3GTQ C;  1O26 A;  3GTJ C;  4BY1 C;  1J6V A;  3H0G C;  4A3J C;  2NVX K;  3S1N K;  5IP9 K;  1EK8 A;  2GSU A;  2JA7 A;  3GTM K; 
#chains in the Genus database with same CATH homology
 1IE0 A;  4XCH A;  1INN A;  1J98 A;  1JQW A;  1J6X A;  1J6V A;  1VGX A;  1YCL A;  1J6W A;  2FQO A;  5E68 A;  1VH2 A;  1JVI A;  1JOE A;  1VJE A;  2FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...