1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
molecule tags Signaling protein
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1INNA 1J6XA 1JVIA 1YCLA 1JOEA 1J6VA 1IE0A 1VH2A 4XCHA 2FQTA 1VJEA 1J98A 1VGXA 2FQOA 5E68A 1J6WA 1JQWA
chains in the Genus database with same CATH superfamily
3MMLB 2EBBA 3AD7C 3S1MK 2V6SA 4QIWD 4A3CC 1K83C 3HOUC 1EI6A 3QX3A 3S1NK 5HL8A 3FHZA 3HKZL 4A3BC 5IOTA 2JA7A 5CHPA 2JA5A 4A3DK 4OIQA 3GTGK 1XXCA 2R93C 4Y7NC 3H3VL 3HXAA 3GTLC 2CFAB 3S15K 2GSNA 4Y52K 5IOSA 1DCOA 1PJ7A 4KB4A 5M5YK 1SFOC 2R7ZK 2XCOA 1AB4A 3AQOA 5FJ8K 3GTMK 4LK1A 4KDDA 1YNNA 4DDQA 5IYBC 1O26A 3CAGA 2Y0SD 3CQZA 1XZPA 1PJ5A 4BY1C 3Q3QA 5IP7C 2GAHC 4C3JC 1I6VA 4RMFA 2VUMC 5C3EC 3GTQA 4XLNA 4BKWA 2FQTA 3HOZC 2JA8C 4GTCA 5D4DA 3OPFA 3S0XA 3M4OC 1INNA 3GTKC 2Y3PA 2YU9C 1I3QC 1BDFA 1X31C 5M5WK 1Y1VA 5TMFA 1Y1WC 4KAWX 4OIOA 1F7UA 4YFKA 3S2DK 4GTAA 3S16K 4A93C 1TWCC 4C3HK 1JOEA 3N0BA 3ERED 3AH5A 4KC6A 1EFWA 1EQRA 5TJ3A 4A3CK 1K83K 3HOUK 4KM9A 4A3BK 2FQOA 3BUEA 4LQYA 5JFEA 3JSTA 1WORA 3K7AK 5C4XC 2R93K 3HOWC 4GTDA 4Y7NK 1TWGA 2P8TA 2WB1L 4AH6A 1TWFA 3L4JA 1TWCA 1R9TA 4BY7C 3GTPC 3OEPA 2E2IC 1SFOK 1BS2A 4OINA 1I6HC 4GFQA 1J98A 1ZYRA 3FKIA 5EGEA 5IYBK 3L4KA 3T01A 4KN4A 3A8KA 2W7VA 4PABA 4BY1K 5IP7K 4J3NA 2BE5A 4C3JK 2JA7C 2VUMK 5C3EK 2PA8L 5IYCC 3HOZK 4A3MK 2JA5C 4A3KK 4GTFA 2A6HA 1EH1A 4KMAA 3M4OK 5C44C 3GTKK 1B4BA 2YU9K 1I3QK 5JVOA 2NVXA 2NVYA 2E2IA 2R92A 2PMZD 2XCQA 3V4GA 4A93K 4GTBA 3PO2C 3VA7A 4ZH4A 2PPBA 4KN7A 2E2HA 2NVQC 3CQZC 3AD9C 3M3YK 4BBSC 4ILDA 5C4JC 1IL2A 4C45A 3HOVK 3GTQC 3GTMA 1YNJA 1YCLA 2E2JC 4KB2A 1VRQC 3S1RC 1O28A 1WSRA 4LOWA 1I50A 4O2DA 1J6WA 1ISEA 1O27A 3GTPK 1F93A 1Y1VC 1B4AA 1TWAA 1WOPA 3GIRA 3OREA 1I6HK 1O29A 1USOA 2CFAA 3H0GC 4LLGA 4AYBD 3RZOC 5IYDC 2A6EA 1C0AA 1O2FB 4LR2A 3HOXC 2JA7K 3S2HC 4YG2A 3WODA 5IYCK 4FM9A 2JA5K 1V5VA 4WJ3M 1VJEA 1GE9A 2PHCB 2JA6A 5EGHA 2V6UA 1TWGC 4P5BA 4OIPA 1TWFC 3T02A 1USMA 1VLOA 5TMCA 3S14C 3I4MK 2V6TA 1TWHA 1R9TC 3H0GA 4LJZA 4WILA 3HKZD 3GEIA 3PO3C 3S1QC 3FKIC 4KATA 1WCMC 2NVQK 2CW0A 4KM8A 3CQZK 1UV7A 1J6VA 2WAQL 4GT9A 4BLBA 4BBSK 1XXBA 5C4JK 3GEHA 3GTQK 3H3VD 1BGWA 3FOEA 4BXXC 1ZQ1C 2JH3A 5E68A 2E2JK 2ZUEA 3S1MC 3FOFA 3HOYC 3GTLK 3EQLA 3S1RK 4XSZA 3GTJA 4QIWL 3TFIA 4YFNA 3GTOA 5IP9C 2NVXC 2NVYC 2RH6A 2R92C 2D6FC 1Y1VK 1F9NA 2GSOA 4GZYA 1WCMA 5FLMC 2B63A 3RZOK 2E2HC 3GSIA 3S15C 3GEEA 4KASA 4A3GC 5IYDK 3S17C 2A68A 4G0WA 3HOXK 2O5JA 1JQWA 4LK0A 2JA8K 3S2HK 4BBRC 1O24A 3GTMC 2A69A 3I4NC 1WQFA 1PJ6A 1O25A 3LAJA 4GTLA 1VGXA 2Y0SL 1TWGK 4QJVB 1Y1WK 1I50C 1TWFK 4MEXA 3GTGA 3S14K 1IS1A 1TWCK 1R9TK 1O2BA 4OIRA 1TWAC 1XZQB 4JK1A 3SZYA 3N0CA 4KMUA 3ADAC 3TFHA 3S1QK 3LAPA 4C2MC 3FKIK 3RZDC 2R7ZA 4XLPA 1HQMA 1XXAA 4GTEA 1KQ4A 4G7ZA 5C4XK 1IE0A 3HOWK 4C3HC 5M3FK 4WJ4A 4BXXK 2WB1D 4G0VA 1DCHA 4G7HA 4A3IC 3HOYK 2JA6C 3IPJA 5IP9K 4C3IC 3BP8C 4BY7K 2RGRA 2NVXK 2NVYK 2E2IK 2R92K 1WQHA 1IBAA 3K7AC 1ZBSA 1TWHC 4KMDA 4BLAA 3G4AA 4MQ9A 4FZBA 2GAGC 5FLMK 2O5IA 4X6AC 2E2HK 1XZPB 4A3GK 2PA8D 3BP3A 4P9SA 3S17K 4A3LC 1WQGA 4MEYA 4A3FC 1K83A 5C44K 5CJ9A 4BBRK 3I4NK 2P5MA 4XSXA 4NOIA 5L46A 1ZXOA 3N3YA 3GTJC 1BJTA 1I50K 3SZZA 3GTOC 2R93A 4A3EC 1DCPA 2GSUA 2NVTC 3PO2K 4A3MC 1TWAK 5IORA 4A3KC 3A8IA 3GTLA 1EK8A 4A3JC 1WSVA 3TFJA 3G4CA 1G51A 4C2MK 4P5AA 1SFOA 3RZDK 2B63C 5M5XK 4G0UA 2PMZL 5IOQA 1L0WA 4Q5SA 1WOOA 3T00A 3S1NC 4A3IK 4YFXA 2JA6K 2VUMA 3AQPA 4C3IK 4A3DC 3M3YC 1SMYA 3GTGC 1JVIA 3GTKA 3HOVC 1HI9A 1O2AA 2YU9A 3TTGA 1TWHK 1I3QA 3H0GK 4KMHA 2XCRB 2ZFZA 1VH2A 4Y52C 1Y1WA 4X6AK 3DXJA 4KARA 1WOSA 1YX2A 2R7ZC 2KWAA 4A3LK 1IW7A 4A3FK 4Q4ZA 1DD5A 3LPXA 3GDZA 1RU0A 1ZVUA 4G7OA 3GTJK 4AYBL 3A8JA 1WIHA 2ZUFA 3GTOK 4A3EK 4PAAA 1J6XA 2NVTK 3AD8C 4A3JK 3PO3K 2WAQD 4QJVA 1WCMK 3NUHA 3GTPA 1F7VA 4XCHA 5M3MK 2B63K 3S2DC 3I4MC 1IQ0A 3S16C 4M1XA 1XZQA 1XPPA
chains in the Genus database with same CATH topology
1INNA 1J6XA 1JVIA 1YCLA 1JOEA 1J6VA 1IE0A 1VH2A 4XCHA 2FQTA 1VJEA 1J98A 1VGXA 2FQOA 5E68A 1J6WA 1JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INN A;  1J6X A;  1JVI A;  1YCL A;  1JOE A;  1J6V A;  1IE0 A;  1VH2 A;  4XCH A;  2FQT A;  1VJE A;  1J98 A;  1VGX A;  2FQO A;  5E68 A;  1J6W A;  1JQW A; 
#chains in the Genus database with same CATH topology
 3MML B;  2EBB A;  3AD7 C;  3S1M K;  2V6S A;  4QIW D;  4A3C C;  1K83 C;  3HOU C;  1EI6 A;  3QX3 A;  3S1N K;  5HL8 A;  3FHZ A;  3HKZ L;  4A3B C;  5IOT A;  2JA7 A;  5CHP A;  2JA5 A;  4A3D K;  4OIQ A;  3GTG K;  1XXC A;  2R93 C;  4Y7N C;  3H3V L;  3HXA A;  3GTL C;  2CFA B;  3S15 K;  2GSN A;  4Y52 K;  5IOS A;  1DCO A;  1PJ7 A;  4KB4 A;  5M5Y K;  1SFO C;  2R7Z K;  2XCO A;  1AB4 A;  3AQO A;  5FJ8 K;  3GTM K;  4LK1 A;  4KDD A;  1YNN A;  4DDQ A;  5IYB C;  1O26 A;  3CAG A;  2Y0S D;  3CQZ A;  1XZP A;  1PJ5 A;  4BY1 C;  3Q3Q A;  5IP7 C;  2GAH C;  4C3J C;  1I6V A;  4RMF A;  2VUM C;  5C3E C;  3GTQ A;  4XLN A;  4BKW A;  2FQT A;  3HOZ C;  2JA8 C;  4GTC A;  5D4D A;  3OPF A;  3S0X A;  3M4O C;  1INN A;  3GTK C;  2Y3P A;  2YU9 C;  1I3Q C;  1BDF A;  1X31 C;  5M5W K;  1Y1V A;  5TMF A;  1Y1W C;  4KAW X;  4OIO A;  1F7U A;  4YFK A;  3S2D K;  4GTA A;  3S16 K;  4A93 C;  1TWC C;  4C3H K;  1JOE A;  3N0B A;  3ERE D;  3AH5 A;  4KC6 A;  1EFW A;  1EQR A;  5TJ3 A;  4A3C K;  1K83 K;  3HOU K;  4KM9 A;  4A3B K;  2FQO A;  3BUE A;  4LQY A;  5JFE A;  3JST A;  1WOR A;  3K7A K;  5C4X C;  2R93 K;  3HOW C;  4GTD A;  4Y7N K;  1TWG A;  2P8T A;  2WB1 L;  4AH6 A;  1TWF A;  3L4J A;  1TWC A;  1R9T A;  4BY7 C;  3GTP C;  3OEP A;  2E2I C;  1SFO K;  1BS2 A;  4OIN A;  1I6H C;  4GFQ A;  1J98 A;  1ZYR A;  3FKI A;  5EGE A;  5IYB K;  3L4K A;  3T01 A;  4KN4 A;  3A8K A;  2W7V A;  4PAB A;  4BY1 K;  5IP7 K;  4J3N A;  2BE5 A;  4C3J K;  2JA7 C;  2VUM K;  5C3E K;  2PA8 L;  5IYC C;  3HOZ K;  4A3M K;  2JA5 C;  4A3K K;  4GTF A;  2A6H A;  1EH1 A;  4KMA A;  3M4O K;  5C44 C;  3GTK K;  1B4B A;  2YU9 K;  1I3Q K;  5JVO A;  2NVX A;  2NVY A;  2E2I A;  2R92 A;  2PMZ D;  2XCQ A;  3V4G A;  4A93 K;  4GTB A;  3PO2 C;  3VA7 A;  4ZH4 A;  2PPB A;  4KN7 A;  2E2H A;  2NVQ C;  3CQZ C;  3AD9 C;  3M3Y K;  4BBS C;  4ILD A;  5C4J C;  1IL2 A;  4C45 A;  3HOV K;  3GTQ C;  3GTM A;  1YNJ A;  1YCL A;  2E2J C;  4KB2 A;  1VRQ C;  3S1R C;  1O28 A;  1WSR A;  4LOW A;  1I50 A;  4O2D A;  1J6W A;  1ISE A;  1O27 A;  3GTP K;  1F93 A;  1Y1V C;  1B4A A;  1TWA A;  1WOP A;  3GIR A;  3ORE A;  1I6H K;  1O29 A;  1USO A;  2CFA A;  3H0G C;  4LLG A;  4AYB D;  3RZO C;  5IYD C;  2A6E A;  1C0A A;  1O2F B;  4LR2 A;  3HOX C;  2JA7 K;  3S2H C;  4YG2 A;  3WOD A;  5IYC K;  4FM9 A;  2JA5 K;  1V5V A;  4WJ3 M;  1VJE A;  1GE9 A;  2PHC B;  2JA6 A;  5EGH A;  2V6U A;  1TWG C;  4P5B A;  4OIP A;  1TWF C;  3T02 A;  1USM A;  1VLO A;  5TMC A;  3S14 C;  3I4M K;  2V6T A;  1TWH A;  1R9T C;  3H0G A;  4LJZ A;  4WIL A;  3HKZ D;  3GEI A;  3PO3 C;  3S1Q C;  3FKI C;  4KAT A;  1WCM C;  2NVQ K;  2CW0 A;  4KM8 A;  3CQZ K;  1UV7 A;  1J6V A;  2WAQ L;  4GT9 A;  4BLB A;  4BBS K;  1XXB A;  5C4J K;  3GEH A;  3GTQ K;  3H3V D;  1BGW A;  3FOE A;  4BXX C;  1ZQ1 C;  2JH3 A;  5E68 A;  2E2J K;  2ZUE A;  3S1M C;  3FOF A;  3HOY C;  3GTL K;  3EQL A;  3S1R K;  4XSZ A;  3GTJ A;  4QIW L;  3TFI A;  4YFN A;  3GTO A;  5IP9 C;  2NVX C;  2NVY C;  2RH6 A;  2R92 C;  2D6F C;  1Y1V K;  1F9N A;  2GSO A;  4GZY A;  1WCM A;  5FLM C;  2B63 A;  3RZO K;  2E2H C;  3GSI A;  3S15 C;  3GEE A;  4KAS A;  4A3G C;  5IYD K;  3S17 C;  2A68 A;  4G0W A;  3HOX K;  2O5J A;  1JQW A;  4LK0 A;  2JA8 K;  3S2H K;  4BBR C;  1O24 A;  3GTM C;  2A69 A;  3I4N C;  1WQF A;  1PJ6 A;  1O25 A;  3LAJ A;  4GTL A;  1VGX A;  2Y0S L;  1TWG K;  4QJV B;  1Y1W K;  1I50 C;  1TWF K;  4MEX A;  3GTG A;  3S14 K;  1IS1 A;  1TWC K;  1R9T K;  1O2B A;  4OIR A;  1TWA C;  1XZQ B;  4JK1 A;  3SZY A;  3N0C A;  4KMU A;  3ADA C;  3TFH A;  3S1Q K;  3LAP A;  4C2M C;  3FKI K;  3RZD C;  2R7Z A;  4XLP A;  1HQM A;  1XXA A;  4GTE A;  1KQ4 A;  4G7Z A;  5C4X K;  1IE0 A;  3HOW K;  4C3H C;  5M3F K;  4WJ4 A;  4BXX K;  2WB1 D;  4G0V A;  1DCH A;  4G7H A;  4A3I C;  3HOY K;  2JA6 C;  3IPJ A;  5IP9 K;  4C3I C;  3BP8 C;  4BY7 K;  2RGR A;  2NVX K;  2NVY K;  2E2I K;  2R92 K;  1WQH A;  1IBA A;  3K7A C;  1ZBS A;  1TWH C;  4KMD A;  4BLA A;  3G4A A;  4MQ9 A;  4FZB A;  2GAG C;  5FLM K;  2O5I A;  4X6A C;  2E2H K;  1XZP B;  4A3G K;  2PA8 D;  3BP3 A;  4P9S A;  3S17 K;  4A3L C;  1WQG A;  4MEY A;  4A3F C;  1K83 A;  5C44 K;  5CJ9 A;  4BBR K;  3I4N K;  2P5M A;  4XSX A;  4NOI A;  5L46 A;  1ZXO A;  3N3Y A;  3GTJ C;  1BJT A;  1I50 K;  3SZZ A;  3GTO C;  2R93 A;  4A3E C;  1DCP A;  2GSU A;  2NVT C;  3PO2 K;  4A3M C;  1TWA K;  5IOR A;  4A3K C;  3A8I A;  3GTL A;  1EK8 A;  4A3J C;  1WSV A;  3TFJ A;  3G4C A;  1G51 A;  4C2M K;  4P5A A;  1SFO A;  3RZD K;  2B63 C;  5M5X K;  4G0U A;  2PMZ L;  5IOQ A;  1L0W A;  4Q5S A;  1WOO A;  3T00 A;  3S1N C;  4A3I K;  4YFX A;  2JA6 K;  2VUM A;  3AQP A;  4C3I K;  4A3D C;  3M3Y C;  1SMY A;  3GTG C;  1JVI A;  3GTK A;  3HOV C;  1HI9 A;  1O2A A;  2YU9 A;  3TTG A;  1TWH K;  1I3Q A;  3H0G K;  4KMH A;  2XCR B;  2ZFZ A;  1VH2 A;  4Y52 C;  1Y1W A;  4X6A K;  3DXJ A;  4KAR A;  1WOS A;  1YX2 A;  2R7Z C;  2KWA A;  4A3L K;  1IW7 A;  4A3F K;  4Q4Z A;  1DD5 A;  3LPX A;  3GDZ A;  1RU0 A;  1ZVU A;  4G7O A;  3GTJ K;  4AYB L;  3A8J A;  1WIH A;  2ZUF A;  3GTO K;  4A3E K;  4PAA A;  1J6X A;  2NVT K;  3AD8 C;  4A3J K;  3PO3 K;  2WAQ D;  4QJV A;  1WCM K;  3NUH A;  3GTP A;  1F7V A;  4XCH A;  5M3M K;  2B63 K;  3S2D C;  3I4M C;  1IQ0 A;  3S16 C;  4M1X A;  1XZQ A;  1XPP A; 
#chains in the Genus database with same CATH homology
 1INN A;  1J6X A;  1JVI A;  1YCL A;  1JOE A;  1J6V A;  1IE0 A;  1VH2 A;  4XCH A;  2FQT A;  1VJE A;  1J98 A;  1VGX A;  2FQO A;  5E68 A;  1J6W A;  1JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...