1JOEA

Crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
VDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN
publication title CRYSTAL STRUCTURE OF AUTOINDUCER-2 PRODUCTION PROTEIN (LUXS) FROM HEAMOPHILUS INFLUENZAE--A CASE OF TWINNED CRYSTAL
rcsb
source organism Haemophilus influenzae rd
total genus 32
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1joeA00
1J6XA 1J6VA 1IE0A 1VJEA 5E68A 2FQOA 2FQTA 1JOEA 1YCLA 1J98A 1JQWA 1J6WA 1INNA 1VH2A 1VGXA 4XCHA 1JVIA
chains in the Genus database with same CATH superfamily
2JA5A 2ZFZA 5IP9K 5D4DA 1R9TK 3GTJA 2W7VA 1K83K 3S2DK 3GTPC 3S16C 4FM9A 3IPJA 4XCHA 1WSVA 4GFQA 5C3EC 4QJVA 5EGHA 1YX2A 4BLAA 4KASA 1PJ5A 1TWGK 4C3HK 1ZVUA 1ZQ1C 2NVXA 3WODA 1O2FB 4A3MK 3RZDK 2JH3A 5IP9C 1R9TC 3A8KA 3TFIA 4G0VA 5JFEA 4A3KK 1K83C 3S2DC 2V6TA 1WCMK 5IOSA 1O2BA 4FZBA 3GTLA 4KN4A 3A8IA 3M4OK 3H0GC 1DCHA 4BY7K 3BP3A 1B4AA 1TWAC 3GTKA 4G0UA 2KWAA 2Y3PA 4G7OA 1TWGC 4KMUA 4C3HC 4AH6A 4DDQA 1I6HK 2JA8C 1HQMA 5C44K 4A3MC 3RZDC 4G7HA 3QX3A 4WILA 4A3KC 3LPXA 2NVQK 1WCMC 4OIOA 1V5VA 4A3LK 2JA7A 2GSOA 1WOOA 4GTCA 3AD8C 3HKZL 4BY7C 1SFOC 3S17K 2FQOA 4LLGA 1I6HC 3AD7C 1WOPA 5C44C 3GSIA 5TMFA 1YNNA 2NVQC 5M3FK 4OIPA 4A3LC 4A3CK 1Y1VA 2PMZD 4GT9A 2R92K 4KMDA 3S17C 3L4JA 3T02A 4MQ9A 1DCOA 1XZQA 1TWFK 3GTQA 2VUMK 2PPBA 1I50A 2PA8L 3FKIA 2JA5K 4G0WA 2R92C 2NVYA 4ILDA 2Y0SL 4GZYA 4QIWD 4AYBD 3GTGA 3JSTA 3GTMA 1O25A 1PJ6A 4OINA 3T00A 1TWFC 2CW0A 4A3JK 4KN7A 1RU0A 2VUMC 2A6HA 3S1QK 2NVXK 2WAQL 4KB4A 1J98A 5TJ3A 2EBBA 3N0CA 2GSUA 1EI6A 2XCRB 1DD5A 4WJ4A 4MEYA 1Y1WC 3S0XA 4GTEA 3GTKK 1BDFA 4A3JC 3S1QC 3GTOA 2NVXC 1WQGA 3HOWK 4O2DA 3I4MK 4MEXA 2D6FC 1I3QA 1O29A 2JA7K 1USOA 3OEPA 2YU9A 3FHZA 3GTKC 2ZUFA 3AQPA 3G4CA 3HOZK 1ZXOA 3HOWC 3I4MC 3HOYK 1O24A 1DCPA 4C2MK 2P5MA 3VA7A 1USMA 1YCLA 2JA7C 1Y1VK 5IORA 3S1NK 2RGRA 4GTFA 4C3JK 2E2JK 2V6SA 3S1RK 4YFNA 4LK1A 3HOZC 3SZZA 2E2IA 1O27A 4KARA 4C2MC 3GTQK 4BBSK 1F7VA 3H3VD 1I50K 3FKIK 1Y1VC 2CFAA 2GAGC 1F93A 2FQTA 3S1NC 2NVYK 3Q3QA 4A3FK 4C3JC 2E2JC 2R93A 3M4OC 3TTGA 3S1RC 3GTGK 1IS1A 2PMZL 3GTMK 1WSRA 3LAPA 1EK8A 4PAAA 3GTQC 4KM8A 4BBSC 1J6WA 2BE5A 3FKIC 1EFWA 4A3IK 3TFHA 1YNJA 2NVYC 4A3FC 5M5WK 3G4AA 1I6VA 3HOVK 3GTGC 3EQLA 3N3YA 4Q5SA 5CHPA 3H0GA 1IE0A 4OIQA 4QIWL 4AYBL 1XPPA 1TWAA 4Y7NK 3GTOK 3OPFA 5IYBK 1KQ4A 2WB1D 2E2HA 4LOWA 4A3IC 3PO2K 4JK1A 3A8JA 4KM9A 4Q4ZA 1INNA 1I3QK 3TFJA 3N0BA 4A3CC 1X31C 2A68A 3GTJK 2NVTK 2JA6A 3GIRA 3HOVC 3V4GA 2YU9K 4Y52K 1IL2A 5C4JK 1J6VA 5IP7K 1IBAA 1L0WA 5M3MK 1SFOA 4GTAA 3ERED 3GTOC 4Y7NC 5IYBC 3RZOK 1ZBSA 4XSXA 3PO2C 3CAGA 1XZPB 3BP8C 4A93K 1XXCA 2P8TA 1I3QC 5CJ9A 4BLBA 2O5JA 2JA5C 3GTJC 3I4NK 2NVTC 3GEHA 1AB4A 5IYDK 4Y52C 1B4BA 2YU9C 4C45A 3GTLK 5C4JC 4GTBA 5IP7C 4LK0A 3CQZA 2PHCB 2XCQA 2GAHC 3RZOC 1TWHA 4P5BA 4G7ZA 2E2IK 3SZYA 1ZYRA 1BGWA 2R7ZA 1WQFA 4KAWX 4A93C 4XSZA 3I4NC 5IYDC 1TWCA 1ISEA 3GTLC 3PO3K 1J6XA 4XLPA 3HOXK 2R93K 1HI9A 1VGXA 1GE9A 1WIHA 3GEIA 4A3EK 1XXBA 4YFXA 1O26A 3HOUK 4LJZA 1C0AA 1BJTA 3BUEA 3FOFA 3S1MK 4ZH4A 4GTDA 2B63A 3PO3C 3HOXC 3H3VL 2R93C 5JVOA 3MMLB 3K7AK 2V6UA 1EQRA 1EH1A 1Y1WA 1VLOA 3H0GK 4KMAA 5IOQA 1IW7A 1TWAK 4A3EC 4P5AA 1XZPA 3HOYC 2E2HK 3HOUC 3HXAA 1XZQB 5IYCK 2JA8K 3S1MC 1VJEA 1O28A 4LR2A 2JA6K 3K7AC 5HL8A 4BXXK 2RH6A 2ZUEA 4KB2A 1G51A 4XLNA 3GTPA 5C4XK 5TMCA 1SFOK 5IOTA 3S2HK 1UV7A 4A3DK 5L46A 3AD9C 2E2HC 1VH2A 5IYCC 5FJ8K 1I50C 4A3BK 4A3GK 1JQWA 3T01A 3NUHA 2WB1L 2JA6C 4BXXC 1R9TA 3AQOA 4OIRA 1K83A 4KC6A 1PJ7A 4YFKA 3GTMC 5C4XC 3CQZK 4KDDA 3S2HC 1IQ0A 4A3DC 1TWHK 1O2AA 3S14K 2R7ZK 5FLMK 1TWGA 1WOSA 4A3BC 4A3GC 4YG2A 3L4KA 1XXAA 1WORA 1WQHA 1TWCK 5E68A 3HKZD 3LAJA 1WCMA 3GDZA 3CQZC 3S15K 4BY1K 1JOEA 1TWHC 4X6AK 4M1XA 4RMFA 3S14C 2XCOA 5FLMC 1SMYA 2R7ZC 4QJVB 3DXJA 4C3IK 3AH5A 1TWCC 2B63K 3S15C 4BY1C 4X6AC 4BBRK 1Y1WK 3ADAC 4WJ3M 3M3YK 3FOEA 4J3NA 2PA8D 4C3IC 4GTLA 2A6EA 2Y0SD 2B63C 5EGEA 4BKWA 2CFAB 5M5YK 1F7UA 2R92A 2GSNA 1BS2A 1VRQC 4BBRC 3OREA 4KMHA 4LQYA 3GTPK 3S16K 4PABA 3M3YC 1F9NA 4NOIA 4KATA 2E2IC 2WAQD 3GEEA 4P9SA 5C3EK 1TWFA 2VUMA 2O5IA 5M5XK 1JVIA 2A69A
chains in the Genus database with same CATH topology
1J6XA 1J6VA 1IE0A 1VJEA 5E68A 2FQOA 2FQTA 1JOEA 1YCLA 1J98A 1JQWA 1J6WA 1INNA 1VH2A 1VGXA 4XCHA 1JVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6X A;  1J6V A;  1IE0 A;  1VJE A;  5E68 A;  2FQO A;  2FQT A;  1JOE A;  1YCL A;  1J98 A;  1JQW A;  1J6W A;  1INN A;  1VH2 A;  1VGX A;  4XCH A;  1JVI A; 
#chains in the Genus database with same CATH topology
 2JA5 A;  2ZFZ A;  5IP9 K;  5D4D A;  1R9T K;  3GTJ A;  2W7V A;  1K83 K;  3S2D K;  3GTP C;  3S16 C;  4FM9 A;  3IPJ A;  4XCH A;  1WSV A;  4GFQ A;  5C3E C;  4QJV A;  5EGH A;  1YX2 A;  4BLA A;  4KAS A;  1PJ5 A;  1TWG K;  4C3H K;  1ZVU A;  1ZQ1 C;  2NVX A;  3WOD A;  1O2F B;  4A3M K;  3RZD K;  2JH3 A;  5IP9 C;  1R9T C;  3A8K A;  3TFI A;  4G0V A;  5JFE A;  4A3K K;  1K83 C;  3S2D C;  2V6T A;  1WCM K;  5IOS A;  1O2B A;  4FZB A;  3GTL A;  4KN4 A;  3A8I A;  3M4O K;  3H0G C;  1DCH A;  4BY7 K;  3BP3 A;  1B4A A;  1TWA C;  3GTK A;  4G0U A;  2KWA A;  2Y3P A;  4G7O A;  1TWG C;  4KMU A;  4C3H C;  4AH6 A;  4DDQ A;  1I6H K;  2JA8 C;  1HQM A;  5C44 K;  4A3M C;  3RZD C;  4G7H A;  3QX3 A;  4WIL A;  4A3K C;  3LPX A;  2NVQ K;  1WCM C;  4OIO A;  1V5V A;  4A3L K;  2JA7 A;  2GSO A;  1WOO A;  4GTC A;  3AD8 C;  3HKZ L;  4BY7 C;  1SFO C;  3S17 K;  2FQO A;  4LLG A;  1I6H C;  3AD7 C;  1WOP A;  5C44 C;  3GSI A;  5TMF A;  1YNN A;  2NVQ C;  5M3F K;  4OIP A;  4A3L C;  4A3C K;  1Y1V A;  2PMZ D;  4GT9 A;  2R92 K;  4KMD A;  3S17 C;  3L4J A;  3T02 A;  4MQ9 A;  1DCO A;  1XZQ A;  1TWF K;  3GTQ A;  2VUM K;  2PPB A;  1I50 A;  2PA8 L;  3FKI A;  2JA5 K;  4G0W A;  2R92 C;  2NVY A;  4ILD A;  2Y0S L;  4GZY A;  4QIW D;  4AYB D;  3GTG A;  3JST A;  3GTM A;  1O25 A;  1PJ6 A;  4OIN A;  3T00 A;  1TWF C;  2CW0 A;  4A3J K;  4KN7 A;  1RU0 A;  2VUM C;  2A6H A;  3S1Q K;  2NVX K;  2WAQ L;  4KB4 A;  1J98 A;  5TJ3 A;  2EBB A;  3N0C A;  2GSU A;  1EI6 A;  2XCR B;  1DD5 A;  4WJ4 A;  4MEY A;  1Y1W C;  3S0X A;  4GTE A;  3GTK K;  1BDF A;  4A3J C;  3S1Q C;  3GTO A;  2NVX C;  1WQG A;  3HOW K;  4O2D A;  3I4M K;  4MEX A;  2D6F C;  1I3Q A;  1O29 A;  2JA7 K;  1USO A;  3OEP A;  2YU9 A;  3FHZ A;  3GTK C;  2ZUF A;  3AQP A;  3G4C A;  3HOZ K;  1ZXO A;  3HOW C;  3I4M C;  3HOY K;  1O24 A;  1DCP A;  4C2M K;  2P5M A;  3VA7 A;  1USM A;  1YCL A;  2JA7 C;  1Y1V K;  5IOR A;  3S1N K;  2RGR A;  4GTF A;  4C3J K;  2E2J K;  2V6S A;  3S1R K;  4YFN A;  4LK1 A;  3HOZ C;  3SZZ A;  2E2I A;  1O27 A;  4KAR A;  4C2M C;  3GTQ K;  4BBS K;  1F7V A;  3H3V D;  1I50 K;  3FKI K;  1Y1V C;  2CFA A;  2GAG C;  1F93 A;  2FQT A;  3S1N C;  2NVY K;  3Q3Q A;  4A3F K;  4C3J C;  2E2J C;  2R93 A;  3M4O C;  3TTG A;  3S1R C;  3GTG K;  1IS1 A;  2PMZ L;  3GTM K;  1WSR A;  3LAP A;  1EK8 A;  4PAA A;  3GTQ C;  4KM8 A;  4BBS C;  1J6W A;  2BE5 A;  3FKI C;  1EFW A;  4A3I K;  3TFH A;  1YNJ A;  2NVY C;  4A3F C;  5M5W K;  3G4A A;  1I6V A;  3HOV K;  3GTG C;  3EQL A;  3N3Y A;  4Q5S A;  5CHP A;  3H0G A;  1IE0 A;  4OIQ A;  4QIW L;  4AYB L;  1XPP A;  1TWA A;  4Y7N K;  3GTO K;  3OPF A;  5IYB K;  1KQ4 A;  2WB1 D;  2E2H A;  4LOW A;  4A3I C;  3PO2 K;  4JK1 A;  3A8J A;  4KM9 A;  4Q4Z A;  1INN A;  1I3Q K;  3TFJ A;  3N0B A;  4A3C C;  1X31 C;  2A68 A;  3GTJ K;  2NVT K;  2JA6 A;  3GIR A;  3HOV C;  3V4G A;  2YU9 K;  4Y52 K;  1IL2 A;  5C4J K;  1J6V A;  5IP7 K;  1IBA A;  1L0W A;  5M3M K;  1SFO A;  4GTA A;  3ERE D;  3GTO C;  4Y7N C;  5IYB C;  3RZO K;  1ZBS A;  4XSX A;  3PO2 C;  3CAG A;  1XZP B;  3BP8 C;  4A93 K;  1XXC A;  2P8T A;  1I3Q C;  5CJ9 A;  4BLB A;  2O5J A;  2JA5 C;  3GTJ C;  3I4N K;  2NVT C;  3GEH A;  1AB4 A;  5IYD K;  4Y52 C;  1B4B A;  2YU9 C;  4C45 A;  3GTL K;  5C4J C;  4GTB A;  5IP7 C;  4LK0 A;  3CQZ A;  2PHC B;  2XCQ A;  2GAH C;  3RZO C;  1TWH A;  4P5B A;  4G7Z A;  2E2I K;  3SZY A;  1ZYR A;  1BGW A;  2R7Z A;  1WQF A;  4KAW X;  4A93 C;  4XSZ A;  3I4N C;  5IYD C;  1TWC A;  1ISE A;  3GTL C;  3PO3 K;  1J6X A;  4XLP A;  3HOX K;  2R93 K;  1HI9 A;  1VGX A;  1GE9 A;  1WIH A;  3GEI A;  4A3E K;  1XXB A;  4YFX A;  1O26 A;  3HOU K;  4LJZ A;  1C0A A;  1BJT A;  3BUE A;  3FOF A;  3S1M K;  4ZH4 A;  4GTD A;  2B63 A;  3PO3 C;  3HOX C;  3H3V L;  2R93 C;  5JVO A;  3MML B;  3K7A K;  2V6U A;  1EQR A;  1EH1 A;  1Y1W A;  1VLO A;  3H0G K;  4KMA A;  5IOQ A;  1IW7 A;  1TWA K;  4A3E C;  4P5A A;  1XZP A;  3HOY C;  2E2H K;  3HOU C;  3HXA A;  1XZQ B;  5IYC K;  2JA8 K;  3S1M C;  1VJE A;  1O28 A;  4LR2 A;  2JA6 K;  3K7A C;  5HL8 A;  4BXX K;  2RH6 A;  2ZUE A;  4KB2 A;  1G51 A;  4XLN A;  3GTP A;  5C4X K;  5TMC A;  1SFO K;  5IOT A;  3S2H K;  1UV7 A;  4A3D K;  5L46 A;  3AD9 C;  2E2H C;  1VH2 A;  5IYC C;  5FJ8 K;  1I50 C;  4A3B K;  4A3G K;  1JQW A;  3T01 A;  3NUH A;  2WB1 L;  2JA6 C;  4BXX C;  1R9T A;  3AQO A;  4OIR A;  1K83 A;  4KC6 A;  1PJ7 A;  4YFK A;  3GTM C;  5C4X C;  3CQZ K;  4KDD A;  3S2H C;  1IQ0 A;  4A3D C;  1TWH K;  1O2A A;  3S14 K;  2R7Z K;  5FLM K;  1TWG A;  1WOS A;  4A3B C;  4A3G C;  4YG2 A;  3L4K A;  1XXA A;  1WOR A;  1WQH A;  1TWC K;  5E68 A;  3HKZ D;  3LAJ A;  1WCM A;  3GDZ A;  3CQZ C;  3S15 K;  4BY1 K;  1JOE A;  1TWH C;  4X6A K;  4M1X A;  4RMF A;  3S14 C;  2XCO A;  5FLM C;  1SMY A;  2R7Z C;  4QJV B;  3DXJ A;  4C3I K;  3AH5 A;  1TWC C;  2B63 K;  3S15 C;  4BY1 C;  4X6A C;  4BBR K;  1Y1W K;  3ADA C;  4WJ3 M;  3M3Y K;  3FOE A;  4J3N A;  2PA8 D;  4C3I C;  4GTL A;  2A6E A;  2Y0S D;  2B63 C;  5EGE A;  4BKW A;  2CFA B;  5M5Y K;  1F7U A;  2R92 A;  2GSN A;  1BS2 A;  1VRQ C;  4BBR C;  3ORE A;  4KMH A;  4LQY A;  3GTP K;  3S16 K;  4PAB A;  3M3Y C;  1F9N A;  4NOI A;  4KAT A;  2E2I C;  2WAQ D;  3GEE A;  4P9S A;  5C3E K;  1TWF A;  2VUM A;  2O5I A;  5M5X K;  1JVI A;  2A69 A; 
#chains in the Genus database with same CATH homology
 1J6X A;  1J6V A;  1IE0 A;  1VJE A;  5E68 A;  2FQO A;  2FQT A;  1JOE A;  1YCL A;  1J98 A;  1JQW A;  1J6W A;  1INN A;  1VH2 A;  1VGX A;  4XCH A;  1JVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...