2R7ZK

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r7zK00
4QJVB 3I4MK 4KMUA 3DXJA 4BBRC 5M5XK 2WAQL 2R92C 4XSXA 1WCMK 3GTOC 3HOUC 3GTGC 4MEYA 4YG2A 2E2IC 3GTQC 1I50K 3HKZL 4BY7C 3FKIC 4BBSK 5IYCC 2O5IA 2NVXC 4A3CC 3S14K 3HOYK 3S17C 1TWHC 5C3EK 4A3JK 2WAQD 3GTMK 4X6AC 1YNJA 2BE5A 4A3KK 3PO2C 1YNNA 2VUMC 2CW0A 4A3FK 3HOWK 4ZH4A 1SFOK 3HOZK 3RZOC 4A93C 2A68A 4Y52K 4OINA 4BY1K 4YFNA 3S1NC 2E2HK 3WODA 3EQLA 4MQ9A 2JA7C 3S16C 1Y1VC 4MEXA 3GTPC 3I4NC 5M3MK 4XSZA 4OIPA 2JA8K 1SMYA 2PMZD 1HQMA 2YU9K 4A3BK 2A6EA 3GTKK 1Y1WC 2A69A 4A3LC 3S2HC 3S1MK 4G7HA 5C44K 4C2MK 4A3EK 1R9TK 2JA5K 2R7ZC 3HOVK 2JA6C 5IP7C 1I6HC 1I6VA 4JK1A 4Y7NK 2E2JK 4A3DK 5C4XC 3S1QK 2B63K 2PMZL 3M4OC 3PO3C 3K7AC 4LK1A 3H3VD 5IYDC 1TWAK 3S2DC 2R93K 1I3QC 1TWCC 5IP9K 5FLMK 4BXXC 4C3JK 4A3MC 4BXXK 1K83C 4G7OA 3S1RK 5D4DA 3M3YC 2PPBA 1TWGC 2NVYC 3H0GC 3CQZC 3RZDK 3HOXK 4A3IC 3GTJC 4LK0A 4AYBD 2NVTC 2NVQK 1TWFK 5TMCA 3GTLK 3H3VL 3S15K 4A3GK 5IYBK 5FLMC 2A6HA 5C4JK 4Q5SA 3I4MC 4LJZA 4BBRK 2WB1D 2R92K 2O5JA 3GTOK 1WCMC 3HOUK 3GTGK 4AYBL 1IW7A 2E2IK 4OIQA 1I50C 2PA8D 3GTQK 1ZYRA 4C3HK 4BY7K 3FKIK 4Q4ZA 5IYCK 4XLPA 2NVXK 4A3CK 4BBSC 4C3IK 3HOYC 3S14C 1TWHK 5C3EC 3S17K 4A3JC 2WB1L 3GTMC 4X6AK 4A3KC 3PO2K 2VUMK 4A3FC 4OIRA 3HOWC 1SFOC 3HOZC 4Y52C 3RZOK 2PA8L 4A93K 5M5YK 4QIWD 4BY1C 3S1NK 2E2HC 2JA7K 3S16K 2Y0SL 1BDFA 1Y1VK 4YFXA 3GTPK 4G7ZA 3I4NK 4QJVA 4KN4A 2JA8C 4QIWL 2YU9C 3GTKC 1Y1WK 4NOIA 5M5WK 4A3LK 4LLGA 5FJ8K 2Y0SD 4GZYA 3S2HK 3S1MC 5C44C 4A3EC 1R9TC 2R7ZK 2JA5C 3HOVC 4A3BC 4OIOA 5IP7K 2JA6K 1I6HK 4Y7NC 5C4XK 2E2JC 4A3DC 3S1QC 2B63C 3M4OK 3PO3K 3K7AK 5IYDK 1TWAC 5TMFA 4YFKA 3S2DK 2R93C 1I3QK 1XPPA 1TWCK 5IP9C 4A3MK 1K83K 3S1RC 3M3YK 3H0GK 1TWGK 2NVYK 3CQZK 3RZDC 3HOXC 4A3IK 4KN7A 3GTJK 4XLNA 2NVQC 2NVTK 1TWFC 5M3FK 3HKZD 3GTLC 3S15C 4A3GC 5IYBC 5C4JC
chains in the Genus database with same CATH superfamily
3DXJA 4BBRC 3H0GA 2WAQL 4KMAA 4GTDA 4YG2A 3GTQC 4AH6A 2O5IA 1O29A 3S17C 5C3EK 4GTAA 1JVIA 3GTMK 4P5BA 4A3KK 1F93A 1WQGA 4Y52K 4OINA 3LAJA 3S1NC 2XCOA 4M1XA 2E2HK 1YCLA 5IORA 3S16C 1RU0A 1Y1WA 4KASA 4MEXA 1USMA 3A8JA 2JA8K 1EH1A 2PMZD 2YU9K 2A6EA 1Y1WC 3ERED 4A3LC 2R7ZC 2JA5K 1I6HC 4JK1A 5C4XC 2PMZL 4KB2A 3M4OC 3K7AC 4LK1A 3S2DC 2XCRB 1DCOA 4G7OA 3S1RK 1ZQ1C 2P5MA 3M3YC 1HI9A 4BXXC 2NVTC 3CQZC 4KM9A 3HOXK 1X31C 4LK0A 2XCQA 5IYBK 5C4JK 4FZBA 3I4MC 1VLOA 4KDDA 5TJ3A 3TTGA 1EQRA 4OIQA 1I50C 2PA8D 1O2FB 2GSUA 4C3IK 3L4KA 3S17K 3OEPA 1O27A 3N0BA 4A3KC 1Y1VA 5IOTA 3HOWC 4Y52C 2PA8L 3S1NK 1ZXOA 3T01A 1Y1VK 3G4CA 1WOOA 3I4NK 4QJVA 4KN4A 3A8IA 1IS1A 2JA8C 4LQYA 4QIWL 4GFQA 5M5WK 4GZYA 4BKWA 1EK8A 3S1MC 2R7ZK 1XXCA 1GE9A 3LPXA 3GEHA 2ZUFA 3G4AA 4G0VA 2B63C 3M4OK 1TWAC 2JA5A 4YFKA 1WSVA 3GTLA 1I3QK 1XPPA 4C3JC 1J98A 2R7ZA 5IOQA 3GTQA 4BXXK 3GTJK 1XZQA 1TWFC 5M3FK 4QJVB 4DDQA 1O26A 3AQPA 3GTGC 4MEYA 2V6SA 2E2IC 1I50K 3HKZL 1WQHA 4BY7C 1O2AA 3MMLB 3T00A 5IYCC 3S14K 3HOYK 1YNJA 2CW0A 3HOWK 2GSNA 4P9SA 5EGHA 4BY1K 5CHPA 3WODA 4MQ9A 1BS2A 1TWHA 3I4NC 3QX3A 1B4AA 2RGRA 1HQMA 1ISEA 4PAAA 4A3EK 1DCPA 1I6VA 2E2JK 3S1QK 3N0CA 5IYDC 1TWAK 4G0WA 1I3QC 1XXAA 1TWCC 5IP9K 3BP3A 3GIRA 1K83C 1BJTA 1TWGC 3RZDK 2NVQK 2R92A 4KATA 4AYBD 1USOA 1TWFK 5FLMC 3FHZA 3AH5A 3NUHA 4BBRK 3T02A 2NVXA 2O5JA 1J6XA 3V4GA 3GTOK 3HOUK 2GAHC 5JFEA 4BLBA 4AYBL 3JSTA 4J3NA 2RH6A 4KC6A 5IYCK 3S14C 1B4BA 5EGEA 5C3EC 2E2IA 1WOPA 3PO2K 3LAPA 1J6VA 5L46A 2VUMK 1SFOC 3A8KA 2GAGC 2Y0SL 3FOEA 1BDFA 1V5VA 4G7ZA 4WJ3M 1TWAA 2YU9C 4GT9A 4NOIA 2B63A 4A3LK 4LLGA 5FJ8K 2Y0SD 1VGXA 4KARA 4KAWX 4WILA 2E2HA 4C2MC 2JA5C 2JA6K 3BUEA 5HL8A 2E2JC 3S1QC 1DD5A 3PO3K 3K7AK 2NVYA 5TMFA 3S2DK 2GSOA 4KMHA 4GTCA 2D6FC 2V6UA 1TWGK 2NVYK 3RZDC 3CQZK 3HOXC 4KMDA 4KN7A 4A3IK 4XLNA 2R93A 2P8TA 3N3YA 5C4JC 3I4MK 3GTMA 4KMUA 1WORA 1TWGA 5M5XK 3CQZA 4XSXA 1WCMK 3TFHA 3GTOC 3HOUC 4GTLA 4ILDA 1IQ0A 4C45A 1UV7A 4C3IC 1TWHC 4A3JK 2WAQD 4X6AC 2BE5A 3PO2C 1YNNA 2VUMC 4A3FK 3L4JA 3RZOC 4ZH4A 3HOZK 3GTPA 2A68A 1F9NA 1J6WA 1R9TA 3AQOA 1Y1VC 3GTPC 1WQFA 1WOSA 4XSZA 1SMYA 3GTKK 3TFIA 4WJ4A 3S2HC 5C44K 4C2MK 1R9TK 3HOVK 2JA6C 5IP7C 4Y7NK 3AD9C 1I3QA 4A3DK 2YU9A 1F7VA 2B63K 3PO3C 3GTJA 1PJ5A 1VJEA 1BGWA 2PPBA 1PJ7A 4A3BK 3GTJC 3S15K 5TMCA 4A3GK 2A6HA 3S0XA 2WB1D 3GTGK 3GTQK 1ZYRA 4BY7K 3FKIK 4Q4ZA 4XLPA 1SFOA 4BBSC 4A3CK 3TFJA 4A3JC 2CFAA 2WB1L 3GTMC 4X6AK 1O28A 4A93K 3HOZC 3GTGA 1ZBSA 5M5YK 4QIWD 2E2HC 1I50A 1O25A 3GSIA 3S16K 1L0WA 3GTPK 1Y1WK 3CAGA 3AD7C 3Q3QA 5C44C 4GTFA 4OIOA 4Y7NC 5C4XK 3GTKA 1VRQC 5CJ9A 5IYDK 2FQOA 1C0AA 3FOFA 2R93C 1XXBA 4P5AA 1TWCK 5IP9C 4G0UA 1K83K 1IBAA 3S1RC 4LOWA 2NVQC 3S15C 5IOSA 3HKZD 5FLMK 1JQWA 1IE0A 2KWAA 2R92C 1JOEA 1K83A 1DCHA 2EBBA 3VA7A 4C3HC 3FKIC 4BBSK 2NVXC 4A3CC 2ZFZA 3GEEA 1EFWA 4A93C 3FKIA 1SFOK 4KB4A 4YFNA 1YX2A 3EQLA 2JA7C 5JVOA 1F7UA 1KQ4A 5M3MK 3OPFA 4GTEA 4OIPA 2JA6A 3GEIA 2A69A 1TWCA 4FM9A 1WIHA 2W7VA 4G7HA 3S1MK 1G51A 1EI6A 1PJ6A 4KM8A 1XZQB 2FQTA 5E68A 1IL2A 1VH2A 2ZUEA 3OREA 3H3VD 2R93K 1TWFA 4C3JK 4A3MC 1XZPA 5D4DA 3H0GC 2NVYC 3SZZA 1WCMA 4RMFA 4A3IC 3GTLK 3H3VL 1WSRA 4GTBA 1O2BA 4Q5SA 2PHCB 3HXAA 4LJZA 3GDZA 2R92K 4BLAA 1WCMC 1O24A 1IW7A 2E2IK 4C3HK 1ZVUA 2NVXK 3GTOA 3HOYC 1TWHK 3IPJA 1INNA 4A3FC 4OIRA 3RZOK 4BY1C 3BP8C 1AB4A 2JA7K 2JH3A 4YFXA 2VUMA 2JA7A 4XCHA 3GTKC 1XZPB 3S2HK 4A3EC 4O2DA 1R9TC 3HOVC 1I6HK 5IP7K 4A3DC 2V6TA 4LR2A 3ADAC 4A3MK 4PABA 3AD8C 3M3YK 3H0GK 2NVTK 4A3BC 3GTLC 2CFAB 3SZYA 4A3GC 5IYBC 2Y3PA
chains in the Genus database with same CATH topology
4QJVB 3I4MK 4KMUA 3DXJA 4BBRC 5M5XK 2WAQL 2R92C 4XSXA 1WCMK 3GTOC 3HOUC 3GTGC 4MEYA 4YG2A 2E2IC 3GTQC 1I50K 3HKZL 4BY7C 3FKIC 4BBSK 5IYCC 2O5IA 2NVXC 4A3CC 3S14K 3HOYK 3S17C 1TWHC 5C3EK 4A3JK 2WAQD 3GTMK 4X6AC 1YNJA 2BE5A 4A3KK 3PO2C 1YNNA 2VUMC 2CW0A 4A3FK 3HOWK 4ZH4A 1SFOK 3HOZK 3RZOC 4A93C 2A68A 4Y52K 4OINA 4BY1K 4YFNA 3S1NC 2E2HK 3WODA 3EQLA 4MQ9A 2JA7C 3S16C 1Y1VC 4MEXA 3GTPC 3I4NC 5M3MK 4XSZA 4OIPA 2JA8K 1SMYA 2PMZD 1HQMA 2YU9K 4A3BK 2A6EA 3GTKK 1Y1WC 2A69A 4A3LC 3S2HC 3S1MK 4G7HA 5C44K 4C2MK 4A3EK 1R9TK 2JA5K 2R7ZC 3HOVK 2JA6C 5IP7C 1I6HC 1I6VA 4JK1A 4Y7NK 2E2JK 4A3DK 5C4XC 3S1QK 2B63K 2PMZL 3M4OC 3PO3C 3K7AC 4LK1A 3H3VD 5IYDC 1TWAK 3S2DC 2R93K 1I3QC 1TWCC 5IP9K 5FLMK 4BXXC 4C3JK 4A3MC 4BXXK 1K83C 4G7OA 3S1RK 5D4DA 3M3YC 2PPBA 1TWGC 2NVYC 3H0GC 3CQZC 3RZDK 3HOXK 4A3IC 3GTJC 4LK0A 4AYBD 2NVTC 2NVQK 1TWFK 5TMCA 3GTLK 3H3VL 3S15K 4A3GK 5IYBK 5FLMC 2A6HA 5C4JK 4Q5SA 3I4MC 4LJZA 4BBRK 2WB1D 2R92K 2O5JA 3GTOK 1WCMC 3HOUK 3GTGK 4AYBL 1IW7A 2E2IK 4OIQA 1I50C 2PA8D 3GTQK 1ZYRA 4C3HK 4BY7K 3FKIK 4Q4ZA 5IYCK 4XLPA 2NVXK 4A3CK 4BBSC 4C3IK 3HOYC 3S14C 1TWHK 5C3EC 3S17K 4A3JC 2WB1L 3GTMC 4X6AK 4A3KC 3PO2K 2VUMK 4A3FC 4OIRA 3HOWC 1SFOC 3HOZC 4Y52C 3RZOK 2PA8L 4A93K 5M5YK 4QIWD 4BY1C 3S1NK 2E2HC 2JA7K 3S16K 2Y0SL 1BDFA 1Y1VK 4YFXA 3GTPK 4G7ZA 3I4NK 4QJVA 4KN4A 2JA8C 4QIWL 2YU9C 3GTKC 1Y1WK 4NOIA 5M5WK 4A3LK 4LLGA 5FJ8K 2Y0SD 4GZYA 3S2HK 3S1MC 5C44C 4A3EC 1R9TC 2R7ZK 2JA5C 3HOVC 4A3BC 4OIOA 5IP7K 2JA6K 1I6HK 4Y7NC 5C4XK 2E2JC 4A3DC 3S1QC 2B63C 3M4OK 3PO3K 3K7AK 5IYDK 1TWAC 5TMFA 4YFKA 3S2DK 2R93C 1I3QK 1XPPA 1TWCK 5IP9C 4A3MK 1K83K 3S1RC 3M3YK 3H0GK 1TWGK 2NVYK 3CQZK 3RZDC 3HOXC 4A3IK 4KN7A 3GTJK 4XLNA 2NVQC 2NVTK 1TWFC 5M3FK 3HKZD 3GTLC 3S15C 4A3GC 5IYBC 5C4JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJV B;  3I4M K;  4KMU A;  3DXJ A;  4BBR C;  5M5X K;  2WAQ L;  2R92 C;  4XSX A;  1WCM K;  3GTO C;  3HOU C;  3GTG C;  4MEY A;  4YG2 A;  2E2I C;  3GTQ C;  1I50 K;  3HKZ L;  4BY7 C;  3FKI C;  4BBS K;  5IYC C;  2O5I A;  2NVX C;  4A3C C;  3S14 K;  3HOY K;  3S17 C;  1TWH C;  5C3E K;  4A3J K;  2WAQ D;  3GTM K;  4X6A C;  1YNJ A;  2BE5 A;  4A3K K;  3PO2 C;  1YNN A;  2VUM C;  2CW0 A;  4A3F K;  3HOW K;  4ZH4 A;  1SFO K;  3HOZ K;  3RZO C;  4A93 C;  2A68 A;  4Y52 K;  4OIN A;  4BY1 K;  4YFN A;  3S1N C;  2E2H K;  3WOD A;  3EQL A;  4MQ9 A;  2JA7 C;  3S16 C;  1Y1V C;  4MEX A;  3GTP C;  3I4N C;  5M3M K;  4XSZ A;  4OIP A;  2JA8 K;  1SMY A;  2PMZ D;  1HQM A;  2YU9 K;  4A3B K;  2A6E A;  3GTK K;  1Y1W C;  2A69 A;  4A3L C;  3S2H C;  3S1M K;  4G7H A;  5C44 K;  4C2M K;  4A3E K;  1R9T K;  2JA5 K;  2R7Z C;  3HOV K;  2JA6 C;  5IP7 C;  1I6H C;  1I6V A;  4JK1 A;  4Y7N K;  2E2J K;  4A3D K;  5C4X C;  3S1Q K;  2B63 K;  2PMZ L;  3M4O C;  3PO3 C;  3K7A C;  4LK1 A;  3H3V D;  5IYD C;  1TWA K;  3S2D C;  2R93 K;  1I3Q C;  1TWC C;  5IP9 K;  5FLM K;  4BXX C;  4C3J K;  4A3M C;  4BXX K;  1K83 C;  4G7O A;  3S1R K;  5D4D A;  3M3Y C;  2PPB A;  1TWG C;  2NVY C;  3H0G C;  3CQZ C;  3RZD K;  3HOX K;  4A3I C;  3GTJ C;  4LK0 A;  4AYB D;  2NVT C;  2NVQ K;  1TWF K;  5TMC A;  3GTL K;  3H3V L;  3S15 K;  4A3G K;  5IYB K;  5FLM C;  2A6H A;  5C4J K;  4Q5S A;  3I4M C;  4LJZ A;  4BBR K;  2WB1 D;  2R92 K;  2O5J A;  3GTO K;  1WCM C;  3HOU K;  3GTG K;  4AYB L;  1IW7 A;  2E2I K;  4OIQ A;  1I50 C;  2PA8 D;  3GTQ K;  1ZYR A;  4C3H K;  4BY7 K;  3FKI K;  4Q4Z A;  5IYC K;  4XLP A;  2NVX K;  4A3C K;  4BBS C;  4C3I K;  3HOY C;  3S14 C;  1TWH K;  5C3E C;  3S17 K;  4A3J C;  2WB1 L;  3GTM C;  4X6A K;  4A3K C;  3PO2 K;  2VUM K;  4A3F C;  4OIR A;  3HOW C;  1SFO C;  3HOZ C;  4Y52 C;  3RZO K;  2PA8 L;  4A93 K;  5M5Y K;  4QIW D;  4BY1 C;  3S1N K;  2E2H C;  2JA7 K;  3S16 K;  2Y0S L;  1BDF A;  1Y1V K;  4YFX A;  3GTP K;  4G7Z A;  3I4N K;  4QJV A;  4KN4 A;  2JA8 C;  4QIW L;  2YU9 C;  3GTK C;  1Y1W K;  4NOI A;  5M5W K;  4A3L K;  4LLG A;  5FJ8 K;  2Y0S D;  4GZY A;  3S2H K;  3S1M C;  5C44 C;  4A3E C;  1R9T C;  2R7Z K;  2JA5 C;  3HOV C;  4A3B C;  4OIO A;  5IP7 K;  2JA6 K;  1I6H K;  4Y7N C;  5C4X K;  2E2J C;  4A3D C;  3S1Q C;  2B63 C;  3M4O K;  3PO3 K;  3K7A K;  5IYD K;  1TWA C;  5TMF A;  4YFK A;  3S2D K;  2R93 C;  1I3Q K;  1XPP A;  1TWC K;  5IP9 C;  4A3M K;  1K83 K;  3S1R C;  3M3Y K;  3H0G K;  1TWG K;  2NVY K;  3CQZ K;  3RZD C;  3HOX C;  4A3I K;  4KN7 A;  3GTJ K;  4XLN A;  2NVQ C;  2NVT K;  1TWF C;  5M3F K;  3HKZ D;  3GTL C;  3S15 C;  4A3G C;  5IYB C;  5C4J C; 
#chains in the Genus database with same CATH topology
 3DXJ A;  4BBR C;  3H0G A;  2WAQ L;  4KMA A;  4GTD A;  4YG2 A;  3GTQ C;  4AH6 A;  2O5I A;  1O29 A;  3S17 C;  5C3E K;  4GTA A;  1JVI A;  3GTM K;  4P5B A;  4A3K K;  1F93 A;  1WQG A;  4Y52 K;  4OIN A;  3LAJ A;  3S1N C;  2XCO A;  4M1X A;  2E2H K;  1YCL A;  5IOR A;  3S16 C;  1RU0 A;  1Y1W A;  4KAS A;  4MEX A;  1USM A;  3A8J A;  2JA8 K;  1EH1 A;  2PMZ D;  2YU9 K;  2A6E A;  1Y1W C;  3ERE D;  4A3L C;  2R7Z C;  2JA5 K;  1I6H C;  4JK1 A;  5C4X C;  2PMZ L;  4KB2 A;  3M4O C;  3K7A C;  4LK1 A;  3S2D C;  2XCR B;  1DCO A;  4G7O A;  3S1R K;  1ZQ1 C;  2P5M A;  3M3Y C;  1HI9 A;  4BXX C;  2NVT C;  3CQZ C;  4KM9 A;  3HOX K;  1X31 C;  4LK0 A;  2XCQ A;  5IYB K;  5C4J K;  4FZB A;  3I4M C;  1VLO A;  4KDD A;  5TJ3 A;  3TTG A;  1EQR A;  4OIQ A;  1I50 C;  2PA8 D;  1O2F B;  2GSU A;  4C3I K;  3L4K A;  3S17 K;  3OEP A;  1O27 A;  3N0B A;  4A3K C;  1Y1V A;  5IOT A;  3HOW C;  4Y52 C;  2PA8 L;  3S1N K;  1ZXO A;  3T01 A;  1Y1V K;  3G4C A;  1WOO A;  3I4N K;  4QJV A;  4KN4 A;  3A8I A;  1IS1 A;  2JA8 C;  4LQY A;  4QIW L;  4GFQ A;  5M5W K;  4GZY A;  4BKW A;  1EK8 A;  3S1M C;  2R7Z K;  1XXC A;  1GE9 A;  3LPX A;  3GEH A;  2ZUF A;  3G4A A;  4G0V A;  2B63 C;  3M4O K;  1TWA C;  2JA5 A;  4YFK A;  1WSV A;  3GTL A;  1I3Q K;  1XPP A;  4C3J C;  1J98 A;  2R7Z A;  5IOQ A;  3GTQ A;  4BXX K;  3GTJ K;  1XZQ A;  1TWF C;  5M3F K;  4QJV B;  4DDQ A;  1O26 A;  3AQP A;  3GTG C;  4MEY A;  2V6S A;  2E2I C;  1I50 K;  3HKZ L;  1WQH A;  4BY7 C;  1O2A A;  3MML B;  3T00 A;  5IYC C;  3S14 K;  3HOY K;  1YNJ A;  2CW0 A;  3HOW K;  2GSN A;  4P9S A;  5EGH A;  4BY1 K;  5CHP A;  3WOD A;  4MQ9 A;  1BS2 A;  1TWH A;  3I4N C;  3QX3 A;  1B4A A;  2RGR A;  1HQM A;  1ISE A;  4PAA A;  4A3E K;  1DCP A;  1I6V A;  2E2J K;  3S1Q K;  3N0C A;  5IYD C;  1TWA K;  4G0W A;  1I3Q C;  1XXA A;  1TWC C;  5IP9 K;  3BP3 A;  3GIR A;  1K83 C;  1BJT A;  1TWG C;  3RZD K;  2NVQ K;  2R92 A;  4KAT A;  4AYB D;  1USO A;  1TWF K;  5FLM C;  3FHZ A;  3AH5 A;  3NUH A;  4BBR K;  3T02 A;  2NVX A;  2O5J A;  1J6X A;  3V4G A;  3GTO K;  3HOU K;  2GAH C;  5JFE A;  4BLB A;  4AYB L;  3JST A;  4J3N A;  2RH6 A;  4KC6 A;  5IYC K;  3S14 C;  1B4B A;  5EGE A;  5C3E C;  2E2I A;  1WOP A;  3PO2 K;  3LAP A;  1J6V A;  5L46 A;  2VUM K;  1SFO C;  3A8K A;  2GAG C;  2Y0S L;  3FOE A;  1BDF A;  1V5V A;  4G7Z A;  4WJ3 M;  1TWA A;  2YU9 C;  4GT9 A;  4NOI A;  2B63 A;  4A3L K;  4LLG A;  5FJ8 K;  2Y0S D;  1VGX A;  4KAR A;  4KAW X;  4WIL A;  2E2H A;  4C2M C;  2JA5 C;  2JA6 K;  3BUE A;  5HL8 A;  2E2J C;  3S1Q C;  1DD5 A;  3PO3 K;  3K7A K;  2NVY A;  5TMF A;  3S2D K;  2GSO A;  4KMH A;  4GTC A;  2D6F C;  2V6U A;  1TWG K;  2NVY K;  3RZD C;  3CQZ K;  3HOX C;  4KMD A;  4KN7 A;  4A3I K;  4XLN A;  2R93 A;  2P8T A;  3N3Y A;  5C4J C;  3I4M K;  3GTM A;  4KMU A;  1WOR A;  1TWG A;  5M5X K;  3CQZ A;  4XSX A;  1WCM K;  3TFH A;  3GTO C;  3HOU C;  4GTL A;  4ILD A;  1IQ0 A;  4C45 A;  1UV7 A;  4C3I C;  1TWH C;  4A3J K;  2WAQ D;  4X6A C;  2BE5 A;  3PO2 C;  1YNN A;  2VUM C;  4A3F K;  3L4J A;  3RZO C;  4ZH4 A;  3HOZ K;  3GTP A;  2A68 A;  1F9N A;  1J6W A;  1R9T A;  3AQO A;  1Y1V C;  3GTP C;  1WQF A;  1WOS A;  4XSZ A;  1SMY A;  3GTK K;  3TFI A;  4WJ4 A;  3S2H C;  5C44 K;  4C2M K;  1R9T K;  3HOV K;  2JA6 C;  5IP7 C;  4Y7N K;  3AD9 C;  1I3Q A;  4A3D K;  2YU9 A;  1F7V A;  2B63 K;  3PO3 C;  3GTJ A;  1PJ5 A;  1VJE A;  1BGW A;  2PPB A;  1PJ7 A;  4A3B K;  3GTJ C;  3S15 K;  5TMC A;  4A3G K;  2A6H A;  3S0X A;  2WB1 D;  3GTG K;  3GTQ K;  1ZYR A;  4BY7 K;  3FKI K;  4Q4Z A;  4XLP A;  1SFO A;  4BBS C;  4A3C K;  3TFJ A;  4A3J C;  2CFA A;  2WB1 L;  3GTM C;  4X6A K;  1O28 A;  4A93 K;  3HOZ C;  3GTG A;  1ZBS A;  5M5Y K;  4QIW D;  2E2H C;  1I50 A;  1O25 A;  3GSI A;  3S16 K;  1L0W A;  3GTP K;  1Y1W K;  3CAG A;  3AD7 C;  3Q3Q A;  5C44 C;  4GTF A;  4OIO A;  4Y7N C;  5C4X K;  3GTK A;  1VRQ C;  5CJ9 A;  5IYD K;  2FQO A;  1C0A A;  3FOF A;  2R93 C;  1XXB A;  4P5A A;  1TWC K;  5IP9 C;  4G0U A;  1K83 K;  1IBA A;  3S1R C;  4LOW A;  2NVQ C;  3S15 C;  5IOS A;  3HKZ D;  5FLM K;  1JQW A;  1IE0 A;  2KWA A;  2R92 C;  1JOE A;  1K83 A;  1DCH A;  2EBB A;  3VA7 A;  4C3H C;  3FKI C;  4BBS K;  2NVX C;  4A3C C;  2ZFZ A;  3GEE A;  1EFW A;  4A93 C;  3FKI A;  1SFO K;  4KB4 A;  4YFN A;  1YX2 A;  3EQL A;  2JA7 C;  5JVO A;  1F7U A;  1KQ4 A;  5M3M K;  3OPF A;  4GTE A;  4OIP A;  2JA6 A;  3GEI A;  2A69 A;  1TWC A;  4FM9 A;  1WIH A;  2W7V A;  4G7H A;  3S1M K;  1G51 A;  1EI6 A;  1PJ6 A;  4KM8 A;  1XZQ B;  2FQT A;  5E68 A;  1IL2 A;  1VH2 A;  2ZUE A;  3ORE A;  3H3V D;  2R93 K;  1TWF A;  4C3J K;  4A3M C;  1XZP A;  5D4D A;  3H0G C;  2NVY C;  3SZZ A;  1WCM A;  4RMF A;  4A3I C;  3GTL K;  3H3V L;  1WSR A;  4GTB A;  1O2B A;  4Q5S A;  2PHC B;  3HXA A;  4LJZ A;  3GDZ A;  2R92 K;  4BLA A;  1WCM C;  1O24 A;  1IW7 A;  2E2I K;  4C3H K;  1ZVU A;  2NVX K;  3GTO A;  3HOY C;  1TWH K;  3IPJ A;  1INN A;  4A3F C;  4OIR A;  3RZO K;  4BY1 C;  3BP8 C;  1AB4 A;  2JA7 K;  2JH3 A;  4YFX A;  2VUM A;  2JA7 A;  4XCH A;  3GTK C;  1XZP B;  3S2H K;  4A3E C;  4O2D A;  1R9T C;  3HOV C;  1I6H K;  5IP7 K;  4A3D C;  2V6T A;  4LR2 A;  3ADA C;  4A3M K;  4PAB A;  3AD8 C;  3M3Y K;  3H0G K;  2NVT K;  4A3B C;  3GTL C;  2CFA B;  3SZY A;  4A3G C;  5IYB C;  2Y3P A; 
#chains in the Genus database with same CATH homology
 4QJV B;  3I4M K;  4KMU A;  3DXJ A;  4BBR C;  5M5X K;  2WAQ L;  2R92 C;  4XSX A;  1WCM K;  3GTO C;  3HOU C;  3GTG C;  4MEY A;  4YG2 A;  2E2I C;  3GTQ C;  1I50 K;  3HKZ L;  4BY7 C;  3FKI C;  4BBS K;  5IYC C;  2O5I A;  2NVX C;  4A3C C;  3S14 K;  3HOY K;  3S17 C;  1TWH C;  5C3E K;  4A3J K;  2WAQ D;  3GTM K;  4X6A C;  1YNJ A;  2BE5 A;  4A3K K;  3PO2 C;  1YNN A;  2VUM C;  2CW0 A;  4A3F K;  3HOW K;  4ZH4 A;  1SFO K;  3HOZ K;  3RZO C;  4A93 C;  2A68 A;  4Y52 K;  4OIN A;  4BY1 K;  4YFN A;  3S1N C;  2E2H K;  3WOD A;  3EQL A;  4MQ9 A;  2JA7 C;  3S16 C;  1Y1V C;  4MEX A;  3GTP C;  3I4N C;  5M3M K;  4XSZ A;  4OIP A;  2JA8 K;  1SMY A;  2PMZ D;  1HQM A;  2YU9 K;  4A3B K;  2A6E A;  3GTK K;  1Y1W C;  2A69 A;  4A3L C;  3S2H C;  3S1M K;  4G7H A;  5C44 K;  4C2M K;  4A3E K;  1R9T K;  2JA5 K;  2R7Z C;  3HOV K;  2JA6 C;  5IP7 C;  1I6H C;  1I6V A;  4JK1 A;  4Y7N K;  2E2J K;  4A3D K;  5C4X C;  3S1Q K;  2B63 K;  2PMZ L;  3M4O C;  3PO3 C;  3K7A C;  4LK1 A;  3H3V D;  5IYD C;  1TWA K;  3S2D C;  2R93 K;  1I3Q C;  1TWC C;  5IP9 K;  5FLM K;  4BXX C;  4C3J K;  4A3M C;  4BXX K;  1K83 C;  4G7O A;  3S1R K;  5D4D A;  3M3Y C;  2PPB A;  1TWG C;  2NVY C;  3H0G C;  3CQZ C;  3RZD K;  3HOX K;  4A3I C;  3GTJ C;  4LK0 A;  4AYB D;  2NVT C;  2NVQ K;  1TWF K;  5TMC A;  3GTL K;  3H3V L;  3S15 K;  4A3G K;  5IYB K;  5FLM C;  2A6H A;  5C4J K;  4Q5S A;  3I4M C;  4LJZ A;  4BBR K;  2WB1 D;  2R92 K;  2O5J A;  3GTO K;  1WCM C;  3HOU K;  3GTG K;  4AYB L;  1IW7 A;  2E2I K;  4OIQ A;  1I50 C;  2PA8 D;  3GTQ K;  1ZYR A;  4C3H K;  4BY7 K;  3FKI K;  4Q4Z A;  5IYC K;  4XLP A;  2NVX K;  4A3C K;  4BBS C;  4C3I K;  3HOY C;  3S14 C;  1TWH K;  5C3E C;  3S17 K;  4A3J C;  2WB1 L;  3GTM C;  4X6A K;  4A3K C;  3PO2 K;  2VUM K;  4A3F C;  4OIR A;  3HOW C;  1SFO C;  3HOZ C;  4Y52 C;  3RZO K;  2PA8 L;  4A93 K;  5M5Y K;  4QIW D;  4BY1 C;  3S1N K;  2E2H C;  2JA7 K;  3S16 K;  2Y0S L;  1BDF A;  1Y1V K;  4YFX A;  3GTP K;  4G7Z A;  3I4N K;  4QJV A;  4KN4 A;  2JA8 C;  4QIW L;  2YU9 C;  3GTK C;  1Y1W K;  4NOI A;  5M5W K;  4A3L K;  4LLG A;  5FJ8 K;  2Y0S D;  4GZY A;  3S2H K;  3S1M C;  5C44 C;  4A3E C;  1R9T C;  2R7Z K;  2JA5 C;  3HOV C;  4A3B C;  4OIO A;  5IP7 K;  2JA6 K;  1I6H K;  4Y7N C;  5C4X K;  2E2J C;  4A3D C;  3S1Q C;  2B63 C;  3M4O K;  3PO3 K;  3K7A K;  5IYD K;  1TWA C;  5TMF A;  4YFK A;  3S2D K;  2R93 C;  1I3Q K;  1XPP A;  1TWC K;  5IP9 C;  4A3M K;  1K83 K;  3S1R C;  3M3Y K;  3H0G K;  1TWG K;  2NVY K;  3CQZ K;  3RZD C;  3HOX C;  4A3I K;  4KN7 A;  3GTJ K;  4XLN A;  2NVQ C;  2NVT K;  1TWF C;  5M3F K;  3HKZ D;  3GTL C;  3S15 C;  4A3G C;  5IYB C;  5C4J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...