2R7ZK

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r7zK00
3S2DC 2VUMK 4MQ9A 3HOYK 2JA8C 2R93C 3S14C 2JA6K 3I4NK 3RZDK 2NVTK 3M3YK 3H0GK 3HKZL 4OIPA 4A3GK 1SFOK 5IP7K 4BY1C 5IYCK 5FLMC 4A3JK 2JA7K 4G7OA 4JK1A 3M4OC 4A3KC 3GTMK 4A3DK 4X6AK 2E2IK 2A69A 3S1NK 4OIRA 1TWFC 3GTKK 3GTQK 2BE5A 2NVXK 4YFXA 2E2JK 3HKZD 2NVQK 3S17K 2NVTC 5C44K 2WAQL 4KN4A 3PO3C 1SFOC 3S1MK 1K83C 3I4MK 1Y1VK 3GTLC 4BBSK 2O5IA 3K7AK 3HOWC 4GZYA 5M5WK 4XLNA 3GTGK 1I3QC 5C4XK 2PA8L 2E2HK 4Y52K 4Y7NK 3RZOC 4KN7A 4LJZA 3FKIC 5C3EK 1I6HC 1TWGC 1R9TK 1BDFA 5IP9C 3GTPK 4QJVA 2NVXC 2R92K 1TWCK 2WAQD 3HOZK 3S1QK 3S16K 3S1RC 4Q5SA 2CW0A 4C2MK 4NOIA 4A93C 4BBSC 5IYBC 4OIQA 4QJVB 3GTOC 2PA8D 1I50C 3K7AC 3S15K 4A3LK 1IW7A 2VUMC 4YFKA 3HOYC 5TMFA 5C4JK 2JA5K 2B63K 3HOVK 5M3FK 4A3CK 2JA6C 3I4NC 3RZDC 2YU9K 4A3IK 3M3YC 2WB1L 3H0GC 4A3MK 1TWCC 4A3GC 3S2DK 3S1QC 4LK0A 5IP7C 4KMUA 4BY7K 4BXXK 5IYCC 3GTJK 3S2HK 4A3JC 2JA7C 1TWAK 2Y0SL 1WCMK 2NVYK 4C3IK 5FJ8K 3HOXK 3GTMC 2E2IC 3S15C 4A3DC 3S1NC 1SMYA 3GTKC 4OINA 3GTQC 3HOVC 4A3EK 4A3BK 1TWHK 2WB1D 1XPPA 2E2JC 5M3MK 2NVQC 3S17C 5C44C 2A68A 3DXJA 2JA8K 2R7ZK 2R93K 4X6AC 4XLPA 2A6EA 3HOUK 3S1MC 1Y1WK 3I4MC 1Y1VC 4AYBL 4A3BC 2Y0SD 3CQZK 3H3VL 3GTGC 3PO2K 5C4XC 4QIWL 4Y52C 2PMZD 2E2HC 4Y7NC 4YG2A 5C3EC 5FLMK 4A3FK 5IYDK 4YFNA 1R9TC 3GTPC 4A3KK 3M4OK 2R92C 4XSZA 1TWHC 4ZH4A 4C3JK 2R7ZC 1TWFK 5D4DA 3HOZC 3S16C 4LK1A 4Q4ZA 4AYBD 4G7ZA 3HOUC 4BBRK 1Y1WC 3H3VD 4QIWD 2A6HA 4A3LC 1YNJA 3CQZC 3PO3K 3PO2C 2PMZL 4XSXA 4MEYA 5M5YK 1K83K 2O5JA 2JA5C 5C4JC 3GTLK 2B63C 5IYDC 4A3FC 3HOWK 4A3CC 1I3QK 4LLGA 2YU9C 4A3IC 3RZOK 4G7HA 4A3MC 3FKIK 1I6HK 1TWGK 3S14K 4MEXA 5IP9K 4BY7C 4BXXC 3GTJC 3S2HC 5M5XK 2PPBA 1YNNA 1TWAC 4BBRC 4C3HK 4BY1K 1WCMC 2NVYC 3WODA 3S1RK 3HOXC 4OIOA 4A93K 5TMCA 1I6VA 5IYBK 1HQMA 3GTOK 1I50K 4A3EC 1ZYRA 3EQLA
chains in the Genus database with same CATH superfamily
3T02A 2JA6A 2RGRA 3I4NK 1AB4A 2NVTK 3S0XA 2ZUEA 4KASA 1SFOK 1ZVUA 4RMFA 5E68A 5FLMC 1RU0A 4G7OA 3A8IA 4JK1A 4A3KC 4GTDA 2XCOA 2A69A 3CAGA 1JVIA 4OIRA 1F7VA 3HKZD 3S17K 2NVTC 4G0UA 1XZQB 3GDZA 1SFOC 3S1MK 4BBSK 1VRQC 3K7AK 3TFJA 1IE0A 4LJZA 5C3EK 1O24A 2R92A 1TWHA 4KM9A 5IP9C 1F9NA 5IOTA 1XZPA 4C3HC 1Y1WA 3S1RC 1J6VA 3CQZA 4BBSC 1O29A 3K7AC 3GSIA 2VUMC 3HOYC 1L0WA 2V6SA 2JA6C 3RZDC 2YU9K 4A3IK 1PJ5A 4A3GC 5IP7C 4BXXK 3S2HK 3TFHA 3NUHA 2EBBA 2Y0SL 4A3DC 5FJ8K 1HI9A 3HOXK 4BKWA 2E2IC 4A3BK 2R93A 1J6XA 1TWHK 3S2DK 4KATA 1USOA 3FOFA 3HOUK 1Y1WK 4KARA 4AYBL 3CQZK 3H3VL 3PO2K 3LPXA 4YG2A 3L4KA 3AD8C 3IPJA 3M4OK 2R92C 1TWHC 3S16C 2V6UA 2FQOA 3HOUC 3VA7A 4BBRK 1Y1WC 1PJ6A 1WOPA 1K83A 1XXCA 2A6HA 3CQZC 3PO2C 3AH5A 1I3QA 3HOWK 4PABA 4A3CC 3FKIA 4LLGA 1TWGA 1I6HK 1IBAA 1JQWA 4KMDA 4BBRC 4C3IC 2NVYC 4BY1K 4A93K 5IYBK 1EK8A 1VGXA 5IORA 2JA8C 2R93C 1TWCA 4WJ4A 1IQ0A 1J6WA 3OREA 1XXBA 1IL2A 3FOEA 3QX3A 1BGWA 4BY1C 4GT9A 2JA7K 4X6AK 3GTMK 2JA5A 3G4CA 4C3JC 1BJTA 4P5AA 1XZPB 3GTQK 2NVQK 5C44K 2WAQL 1EI6A 4KN4A 3PO3C 1O2FB 1K83C 1F93A 3I4MK 4P9SA 3GTLC 1G51A 1I3QC 3GEIA 3BP8C 3FKIC 1DCPA 1TWGC 3GTPK 4QJVA 2R7ZA 3N0BA 1XXAA 1TWCK 3S1QK 3OEPA 4Q5SA 2CW0A 3T01A 4C2MK 4OIQA 4A3LK 4LQYA 4YFKA 2JA5K 5C4JK 2YU9A 2B63K 3SZZA 5M3FK 3I4NC 3AQOA 3BP3A 2WB1L 4BLAA 1TWCC 3BUEA 3S1QC 4LK0A 3HXAA 4XCHA 4C2MC 3ERED 1TWAK 1WCMK 3ADAC 4A3EK 1B4BA 2RH6A 3A8JA 3S17C 2R7ZK 3DXJA 4WILA 3S1MC 1DCHA 2Y0SD 2JH3A 4QIWL 5C3EC 1I50A 4FZBA 4YFNA 4XSZA 2R7ZC 1TWFK 4Q4ZA 4AYBD 4C45A 4G7ZA 3H3VD 1PJ7A 3LAPA 4MEYA 5M5YK 1O2AA 3SZYA 2YU9C 4A3IC 3RZOK 3GTKA 4KMAA 3S14K 2W7VA 4BXXC 3S2HC 2P5MA 2D6FC 1C0AA 3HOXC 4OIOA 1I6VA 3GTOK 1I50K 4BLBA 4M1XA 4A3BC 3EQLA 3S2DC 3OPFA 3Q3QA 3S14C 2PHCB 3M3YK 3H0GK 1EH1A 4OIPA 1KQ4A 2JA7A 2GAHC 5IYCK 4DDQA 3GTMA 4A3JK 3M4OC 1XZQA 4KMHA 3GTQA 3S1NK 4KM8A 3GTKK 2BE5A 4YFXA 2E2JK 4PAAA 4KB2A 4AH6A 3TTGA 1Y1VK 2O5IA 3HOWC 4XLNA 3GTGK 5C4XK 2PA8L 2E2HK 4Y52K 4Y7NK 3GTPA 4KN7A 1I6HC 1R9TK 1WQHA 1X31C 2Y3PA 2WAQD 1EFWA 1WQFA 3HOZK 1VH2A 2GAGC 2CFAA 4A93C 5IYBC 2GSOA 3S15K 1IW7A 2B63A 4GFQA 1O28A 5EGEA 1ZXOA 3HOVK 1O2BA 3TFIA 5JVOA 4LR2A 1ZYRA 4A3MK 1WSVA 1WSRA 4GTCA 5CHPA 4BY7K 1TWAA 5L46A 3GTJK 1WCMA 2JA7C 3AD7C 4X6AC 3GTMC 3S15C 3GTQC 3HOVC 2NVQC 2WB1D 1XPPA 5M3MK 1O27A 5C44C 5EGHA 4XLPA 3I4MC 1V5VA 4FM9A 1VJEA 2XCRB 5CJ9A 4KAWX 4GTLA 4A3FK 5FLMK 5IYDK 1O26A 3GTPC 4A3KK 1TWFA 4ZH4A 5D4DA 4LK1A 1IS1A 3GEHA 3AQPA 4QIWD 4A3LC 2O5JA 2JA5C 3GEEA 5C4JC 2B63C 5IYDC 4A3FC 2E2IA 3G4AA 4G7HA 2NVXA 5IOQA 1B4AA 5IP9K 1DD5A 4GTFA 5M5XK 2PPBA 1YNNA 2ZUFA 1TWAC 4C3HK 1WCMC 1WIHA 3S1RK 2FQTA 3GTOA 1USMA 1YX2A 1HQMA 4P5BA 2V6TA 4A3EC 2VUMK 1ZQ1C 4MQ9A 3HOYK 3L4JA 3H0GA 2JA6K 3RZDK 4GTAA 3HKZL 4A3GK 2XCQA 4KDDA 5IP7K 4A3DK 2E2IK 1WQGA 1EQRA 1TWFC 3A8KA 2NVXK 4ILDA 2CFAB 1WOSA 1Y1VA 3AD9C 5TJ3A 3GTGA 2KWAA 2NVYA 4GZYA 2E2HA 5M5WK 1UV7A 1WOOA 1R9TA 3RZOC 1WORA 4O2DA 1BDFA 2NVXC 2R92K 4LOWA 3LAJA 3N0CA 3S16K 1ZBSA 1ISEA 4NOIA 1F7UA 1BS2A 2GSUA 4KB4A 4QJVB 3GTOC 2PA8D 1I50C 4J3NA 5IOSA 4KC6A 5TMFA 1O25A 4G0VA 4A3CK 5JFEA 1INNA 3M3YC 3H0GC 3GTJA 4KMUA 5HL8A 5IYCC 4A3JC 4C3IK 2NVYK 3GTLA 3S1NC 1SMYA 3JSTA 3T00A 4OINA 3GIRA 3GTKC 2E2JC 2A68A 2JA8K 2R93K 1JOEA 2A6EA 1Y1VC 4G0WA 3GTGC 5C4XC 4Y52C 2PMZD 2E2HC 4Y7NC 1YCLA 1DCOA 1R9TC 1GE9A 4WJ3M 3N3YA 4C3JK 3HOZC 3V4GA 1SFOA 4GTBA 2P8TA 1YNJA 3PO3K 2PMZL 4XSXA 1K83K 1VLOA 3GTLK 2ZFZA 1I3QK 4A3MC 3FKIK 1TWGK 4MEXA 3FHZA 4BY7C 4GTEA 3GTJC 1J98A 3WODA 2GSNA 5TMCA 2VUMA 3MMLB
chains in the Genus database with same CATH topology
3S2DC 2VUMK 4MQ9A 3HOYK 2JA8C 2R93C 3S14C 2JA6K 3I4NK 3RZDK 2NVTK 3M3YK 3H0GK 3HKZL 4OIPA 4A3GK 1SFOK 5IP7K 4BY1C 5IYCK 5FLMC 4A3JK 2JA7K 4G7OA 4JK1A 3M4OC 4A3KC 3GTMK 4A3DK 4X6AK 2E2IK 2A69A 3S1NK 4OIRA 1TWFC 3GTKK 3GTQK 2BE5A 2NVXK 4YFXA 2E2JK 3HKZD 2NVQK 3S17K 2NVTC 5C44K 2WAQL 4KN4A 3PO3C 1SFOC 3S1MK 1K83C 3I4MK 1Y1VK 3GTLC 4BBSK 2O5IA 3K7AK 3HOWC 4GZYA 5M5WK 4XLNA 3GTGK 1I3QC 5C4XK 2PA8L 2E2HK 4Y52K 4Y7NK 3RZOC 4KN7A 4LJZA 3FKIC 5C3EK 1I6HC 1TWGC 1R9TK 1BDFA 5IP9C 3GTPK 4QJVA 2NVXC 2R92K 1TWCK 2WAQD 3HOZK 3S1QK 3S16K 3S1RC 4Q5SA 2CW0A 4C2MK 4NOIA 4A93C 4BBSC 5IYBC 4OIQA 4QJVB 3GTOC 2PA8D 1I50C 3K7AC 3S15K 4A3LK 1IW7A 2VUMC 4YFKA 3HOYC 5TMFA 5C4JK 2JA5K 2B63K 3HOVK 5M3FK 4A3CK 2JA6C 3I4NC 3RZDC 2YU9K 4A3IK 3M3YC 2WB1L 3H0GC 4A3MK 1TWCC 4A3GC 3S2DK 3S1QC 4LK0A 5IP7C 4KMUA 4BY7K 4BXXK 5IYCC 3GTJK 3S2HK 4A3JC 2JA7C 1TWAK 2Y0SL 1WCMK 2NVYK 4C3IK 5FJ8K 3HOXK 3GTMC 2E2IC 3S15C 4A3DC 3S1NC 1SMYA 3GTKC 4OINA 3GTQC 3HOVC 4A3EK 4A3BK 1TWHK 2WB1D 1XPPA 2E2JC 5M3MK 2NVQC 3S17C 5C44C 2A68A 3DXJA 2JA8K 2R7ZK 2R93K 4X6AC 4XLPA 2A6EA 3HOUK 3S1MC 1Y1WK 3I4MC 1Y1VC 4AYBL 4A3BC 2Y0SD 3CQZK 3H3VL 3GTGC 3PO2K 5C4XC 4QIWL 4Y52C 2PMZD 2E2HC 4Y7NC 4YG2A 5C3EC 5FLMK 4A3FK 5IYDK 4YFNA 1R9TC 3GTPC 4A3KK 3M4OK 2R92C 4XSZA 1TWHC 4ZH4A 4C3JK 2R7ZC 1TWFK 5D4DA 3HOZC 3S16C 4LK1A 4Q4ZA 4AYBD 4G7ZA 3HOUC 4BBRK 1Y1WC 3H3VD 4QIWD 2A6HA 4A3LC 1YNJA 3CQZC 3PO3K 3PO2C 2PMZL 4XSXA 4MEYA 5M5YK 1K83K 2O5JA 2JA5C 5C4JC 3GTLK 2B63C 5IYDC 4A3FC 3HOWK 4A3CC 1I3QK 4LLGA 2YU9C 4A3IC 3RZOK 4G7HA 4A3MC 3FKIK 1I6HK 1TWGK 3S14K 4MEXA 5IP9K 4BY7C 4BXXC 3GTJC 3S2HC 5M5XK 2PPBA 1YNNA 1TWAC 4BBRC 4C3HK 4BY1K 1WCMC 2NVYC 3WODA 3S1RK 3HOXC 4OIOA 4A93K 5TMCA 1I6VA 5IYBK 1HQMA 3GTOK 1I50K 4A3EC 1ZYRA 3EQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D C;  2VUM K;  4MQ9 A;  3HOY K;  2JA8 C;  2R93 C;  3S14 C;  2JA6 K;  3I4N K;  3RZD K;  2NVT K;  3M3Y K;  3H0G K;  3HKZ L;  4OIP A;  4A3G K;  1SFO K;  5IP7 K;  4BY1 C;  5IYC K;  5FLM C;  4A3J K;  2JA7 K;  4G7O A;  4JK1 A;  3M4O C;  4A3K C;  3GTM K;  4A3D K;  4X6A K;  2E2I K;  2A69 A;  3S1N K;  4OIR A;  1TWF C;  3GTK K;  3GTQ K;  2BE5 A;  2NVX K;  4YFX A;  2E2J K;  3HKZ D;  2NVQ K;  3S17 K;  2NVT C;  5C44 K;  2WAQ L;  4KN4 A;  3PO3 C;  1SFO C;  3S1M K;  1K83 C;  3I4M K;  1Y1V K;  3GTL C;  4BBS K;  2O5I A;  3K7A K;  3HOW C;  4GZY A;  5M5W K;  4XLN A;  3GTG K;  1I3Q C;  5C4X K;  2PA8 L;  2E2H K;  4Y52 K;  4Y7N K;  3RZO C;  4KN7 A;  4LJZ A;  3FKI C;  5C3E K;  1I6H C;  1TWG C;  1R9T K;  1BDF A;  5IP9 C;  3GTP K;  4QJV A;  2NVX C;  2R92 K;  1TWC K;  2WAQ D;  3HOZ K;  3S1Q K;  3S16 K;  3S1R C;  4Q5S A;  2CW0 A;  4C2M K;  4NOI A;  4A93 C;  4BBS C;  5IYB C;  4OIQ A;  4QJV B;  3GTO C;  2PA8 D;  1I50 C;  3K7A C;  3S15 K;  4A3L K;  1IW7 A;  2VUM C;  4YFK A;  3HOY C;  5TMF A;  5C4J K;  2JA5 K;  2B63 K;  3HOV K;  5M3F K;  4A3C K;  2JA6 C;  3I4N C;  3RZD C;  2YU9 K;  4A3I K;  3M3Y C;  2WB1 L;  3H0G C;  4A3M K;  1TWC C;  4A3G C;  3S2D K;  3S1Q C;  4LK0 A;  5IP7 C;  4KMU A;  4BY7 K;  4BXX K;  5IYC C;  3GTJ K;  3S2H K;  4A3J C;  2JA7 C;  1TWA K;  2Y0S L;  1WCM K;  2NVY K;  4C3I K;  5FJ8 K;  3HOX K;  3GTM C;  2E2I C;  3S15 C;  4A3D C;  3S1N C;  1SMY A;  3GTK C;  4OIN A;  3GTQ C;  3HOV C;  4A3E K;  4A3B K;  1TWH K;  2WB1 D;  1XPP A;  2E2J C;  5M3M K;  2NVQ C;  3S17 C;  5C44 C;  2A68 A;  3DXJ A;  2JA8 K;  2R7Z K;  2R93 K;  4X6A C;  4XLP A;  2A6E A;  3HOU K;  3S1M C;  1Y1W K;  3I4M C;  1Y1V C;  4AYB L;  4A3B C;  2Y0S D;  3CQZ K;  3H3V L;  3GTG C;  3PO2 K;  5C4X C;  4QIW L;  4Y52 C;  2PMZ D;  2E2H C;  4Y7N C;  4YG2 A;  5C3E C;  5FLM K;  4A3F K;  5IYD K;  4YFN A;  1R9T C;  3GTP C;  4A3K K;  3M4O K;  2R92 C;  4XSZ A;  1TWH C;  4ZH4 A;  4C3J K;  2R7Z C;  1TWF K;  5D4D A;  3HOZ C;  3S16 C;  4LK1 A;  4Q4Z A;  4AYB D;  4G7Z A;  3HOU C;  4BBR K;  1Y1W C;  3H3V D;  4QIW D;  2A6H A;  4A3L C;  1YNJ A;  3CQZ C;  3PO3 K;  3PO2 C;  2PMZ L;  4XSX A;  4MEY A;  5M5Y K;  1K83 K;  2O5J A;  2JA5 C;  5C4J C;  3GTL K;  2B63 C;  5IYD C;  4A3F C;  3HOW K;  4A3C C;  1I3Q K;  4LLG A;  2YU9 C;  4A3I C;  3RZO K;  4G7H A;  4A3M C;  3FKI K;  1I6H K;  1TWG K;  3S14 K;  4MEX A;  5IP9 K;  4BY7 C;  4BXX C;  3GTJ C;  3S2H C;  5M5X K;  2PPB A;  1YNN A;  1TWA C;  4BBR C;  4C3H K;  4BY1 K;  1WCM C;  2NVY C;  3WOD A;  3S1R K;  3HOX C;  4OIO A;  4A93 K;  5TMC A;  1I6V A;  5IYB K;  1HQM A;  3GTO K;  1I50 K;  4A3E C;  1ZYR A;  3EQL A; 
#chains in the Genus database with same CATH topology
 3T02 A;  2JA6 A;  2RGR A;  3I4N K;  1AB4 A;  2NVT K;  3S0X A;  2ZUE A;  4KAS A;  1SFO K;  1ZVU A;  4RMF A;  5E68 A;  5FLM C;  1RU0 A;  4G7O A;  3A8I A;  4JK1 A;  4A3K C;  4GTD A;  2XCO A;  2A69 A;  3CAG A;  1JVI A;  4OIR A;  1F7V A;  3HKZ D;  3S17 K;  2NVT C;  4G0U A;  1XZQ B;  3GDZ A;  1SFO C;  3S1M K;  4BBS K;  1VRQ C;  3K7A K;  3TFJ A;  1IE0 A;  4LJZ A;  5C3E K;  1O24 A;  2R92 A;  1TWH A;  4KM9 A;  5IP9 C;  1F9N A;  5IOT A;  1XZP A;  4C3H C;  1Y1W A;  3S1R C;  1J6V A;  3CQZ A;  4BBS C;  1O29 A;  3K7A C;  3GSI A;  2VUM C;  3HOY C;  1L0W A;  2V6S A;  2JA6 C;  3RZD C;  2YU9 K;  4A3I K;  1PJ5 A;  4A3G C;  5IP7 C;  4BXX K;  3S2H K;  3TFH A;  3NUH A;  2EBB A;  2Y0S L;  4A3D C;  5FJ8 K;  1HI9 A;  3HOX K;  4BKW A;  2E2I C;  4A3B K;  2R93 A;  1J6X A;  1TWH K;  3S2D K;  4KAT A;  1USO A;  3FOF A;  3HOU K;  1Y1W K;  4KAR A;  4AYB L;  3CQZ K;  3H3V L;  3PO2 K;  3LPX A;  4YG2 A;  3L4K A;  3AD8 C;  3IPJ A;  3M4O K;  2R92 C;  1TWH C;  3S16 C;  2V6U A;  2FQO A;  3HOU C;  3VA7 A;  4BBR K;  1Y1W C;  1PJ6 A;  1WOP A;  1K83 A;  1XXC A;  2A6H A;  3CQZ C;  3PO2 C;  3AH5 A;  1I3Q A;  3HOW K;  4PAB A;  4A3C C;  3FKI A;  4LLG A;  1TWG A;  1I6H K;  1IBA A;  1JQW A;  4KMD A;  4BBR C;  4C3I C;  2NVY C;  4BY1 K;  4A93 K;  5IYB K;  1EK8 A;  1VGX A;  5IOR A;  2JA8 C;  2R93 C;  1TWC A;  4WJ4 A;  1IQ0 A;  1J6W A;  3ORE A;  1XXB A;  1IL2 A;  3FOE A;  3QX3 A;  1BGW A;  4BY1 C;  4GT9 A;  2JA7 K;  4X6A K;  3GTM K;  2JA5 A;  3G4C A;  4C3J C;  1BJT A;  4P5A A;  1XZP B;  3GTQ K;  2NVQ K;  5C44 K;  2WAQ L;  1EI6 A;  4KN4 A;  3PO3 C;  1O2F B;  1K83 C;  1F93 A;  3I4M K;  4P9S A;  3GTL C;  1G51 A;  1I3Q C;  3GEI A;  3BP8 C;  3FKI C;  1DCP A;  1TWG C;  3GTP K;  4QJV A;  2R7Z A;  3N0B A;  1XXA A;  1TWC K;  3S1Q K;  3OEP A;  4Q5S A;  2CW0 A;  3T01 A;  4C2M K;  4OIQ A;  4A3L K;  4LQY A;  4YFK A;  2JA5 K;  5C4J K;  2YU9 A;  2B63 K;  3SZZ A;  5M3F K;  3I4N C;  3AQO A;  3BP3 A;  2WB1 L;  4BLA A;  1TWC C;  3BUE A;  3S1Q C;  4LK0 A;  3HXA A;  4XCH A;  4C2M C;  3ERE D;  1TWA K;  1WCM K;  3ADA C;  4A3E K;  1B4B A;  2RH6 A;  3A8J A;  3S17 C;  2R7Z K;  3DXJ A;  4WIL A;  3S1M C;  1DCH A;  2Y0S D;  2JH3 A;  4QIW L;  5C3E C;  1I50 A;  4FZB A;  4YFN A;  4XSZ A;  2R7Z C;  1TWF K;  4Q4Z A;  4AYB D;  4C45 A;  4G7Z A;  3H3V D;  1PJ7 A;  3LAP A;  4MEY A;  5M5Y K;  1O2A A;  3SZY A;  2YU9 C;  4A3I C;  3RZO K;  3GTK A;  4KMA A;  3S14 K;  2W7V A;  4BXX C;  3S2H C;  2P5M A;  2D6F C;  1C0A A;  3HOX C;  4OIO A;  1I6V A;  3GTO K;  1I50 K;  4BLB A;  4M1X A;  4A3B C;  3EQL A;  3S2D C;  3OPF A;  3Q3Q A;  3S14 C;  2PHC B;  3M3Y K;  3H0G K;  1EH1 A;  4OIP A;  1KQ4 A;  2JA7 A;  2GAH C;  5IYC K;  4DDQ A;  3GTM A;  4A3J K;  3M4O C;  1XZQ A;  4KMH A;  3GTQ A;  3S1N K;  4KM8 A;  3GTK K;  2BE5 A;  4YFX A;  2E2J K;  4PAA A;  4KB2 A;  4AH6 A;  3TTG A;  1Y1V K;  2O5I A;  3HOW C;  4XLN A;  3GTG K;  5C4X K;  2PA8 L;  2E2H K;  4Y52 K;  4Y7N K;  3GTP A;  4KN7 A;  1I6H C;  1R9T K;  1WQH A;  1X31 C;  2Y3P A;  2WAQ D;  1EFW A;  1WQF A;  3HOZ K;  1VH2 A;  2GAG C;  2CFA A;  4A93 C;  5IYB C;  2GSO A;  3S15 K;  1IW7 A;  2B63 A;  4GFQ A;  1O28 A;  5EGE A;  1ZXO A;  3HOV K;  1O2B A;  3TFI A;  5JVO A;  4LR2 A;  1ZYR A;  4A3M K;  1WSV A;  1WSR A;  4GTC A;  5CHP A;  4BY7 K;  1TWA A;  5L46 A;  3GTJ K;  1WCM A;  2JA7 C;  3AD7 C;  4X6A C;  3GTM C;  3S15 C;  3GTQ C;  3HOV C;  2NVQ C;  2WB1 D;  1XPP A;  5M3M K;  1O27 A;  5C44 C;  5EGH A;  4XLP A;  3I4M C;  1V5V A;  4FM9 A;  1VJE A;  2XCR B;  5CJ9 A;  4KAW X;  4GTL A;  4A3F K;  5FLM K;  5IYD K;  1O26 A;  3GTP C;  4A3K K;  1TWF A;  4ZH4 A;  5D4D A;  4LK1 A;  1IS1 A;  3GEH A;  3AQP A;  4QIW D;  4A3L C;  2O5J A;  2JA5 C;  3GEE A;  5C4J C;  2B63 C;  5IYD C;  4A3F C;  2E2I A;  3G4A A;  4G7H A;  2NVX A;  5IOQ A;  1B4A A;  5IP9 K;  1DD5 A;  4GTF A;  5M5X K;  2PPB A;  1YNN A;  2ZUF A;  1TWA C;  4C3H K;  1WCM C;  1WIH A;  3S1R K;  2FQT A;  3GTO A;  1USM A;  1YX2 A;  1HQM A;  4P5B A;  2V6T A;  4A3E C;  2VUM K;  1ZQ1 C;  4MQ9 A;  3HOY K;  3L4J A;  3H0G A;  2JA6 K;  3RZD K;  4GTA A;  3HKZ L;  4A3G K;  2XCQ A;  4KDD A;  5IP7 K;  4A3D K;  2E2I K;  1WQG A;  1EQR A;  1TWF C;  3A8K A;  2NVX K;  4ILD A;  2CFA B;  1WOS A;  1Y1V A;  3AD9 C;  5TJ3 A;  3GTG A;  2KWA A;  2NVY A;  4GZY A;  2E2H A;  5M5W K;  1UV7 A;  1WOO A;  1R9T A;  3RZO C;  1WOR A;  4O2D A;  1BDF A;  2NVX C;  2R92 K;  4LOW A;  3LAJ A;  3N0C A;  3S16 K;  1ZBS A;  1ISE A;  4NOI A;  1F7U A;  1BS2 A;  2GSU A;  4KB4 A;  4QJV B;  3GTO C;  2PA8 D;  1I50 C;  4J3N A;  5IOS A;  4KC6 A;  5TMF A;  1O25 A;  4G0V A;  4A3C K;  5JFE A;  1INN A;  3M3Y C;  3H0G C;  3GTJ A;  4KMU A;  5HL8 A;  5IYC C;  4A3J C;  4C3I K;  2NVY K;  3GTL A;  3S1N C;  1SMY A;  3JST A;  3T00 A;  4OIN A;  3GIR A;  3GTK C;  2E2J C;  2A68 A;  2JA8 K;  2R93 K;  1JOE A;  2A6E A;  1Y1V C;  4G0W A;  3GTG C;  5C4X C;  4Y52 C;  2PMZ D;  2E2H C;  4Y7N C;  1YCL A;  1DCO A;  1R9T C;  1GE9 A;  4WJ3 M;  3N3Y A;  4C3J K;  3HOZ C;  3V4G A;  1SFO A;  4GTB A;  2P8T A;  1YNJ A;  3PO3 K;  2PMZ L;  4XSX A;  1K83 K;  1VLO A;  3GTL K;  2ZFZ A;  1I3Q K;  4A3M C;  3FKI K;  1TWG K;  4MEX A;  3FHZ A;  4BY7 C;  4GTE A;  3GTJ C;  1J98 A;  3WOD A;  2GSN A;  5TMC A;  2VUM A;  3MML B; 
#chains in the Genus database with same CATH homology
 3S2D C;  2VUM K;  4MQ9 A;  3HOY K;  2JA8 C;  2R93 C;  3S14 C;  2JA6 K;  3I4N K;  3RZD K;  2NVT K;  3M3Y K;  3H0G K;  3HKZ L;  4OIP A;  4A3G K;  1SFO K;  5IP7 K;  4BY1 C;  5IYC K;  5FLM C;  4A3J K;  2JA7 K;  4G7O A;  4JK1 A;  3M4O C;  4A3K C;  3GTM K;  4A3D K;  4X6A K;  2E2I K;  2A69 A;  3S1N K;  4OIR A;  1TWF C;  3GTK K;  3GTQ K;  2BE5 A;  2NVX K;  4YFX A;  2E2J K;  3HKZ D;  2NVQ K;  3S17 K;  2NVT C;  5C44 K;  2WAQ L;  4KN4 A;  3PO3 C;  1SFO C;  3S1M K;  1K83 C;  3I4M K;  1Y1V K;  3GTL C;  4BBS K;  2O5I A;  3K7A K;  3HOW C;  4GZY A;  5M5W K;  4XLN A;  3GTG K;  1I3Q C;  5C4X K;  2PA8 L;  2E2H K;  4Y52 K;  4Y7N K;  3RZO C;  4KN7 A;  4LJZ A;  3FKI C;  5C3E K;  1I6H C;  1TWG C;  1R9T K;  1BDF A;  5IP9 C;  3GTP K;  4QJV A;  2NVX C;  2R92 K;  1TWC K;  2WAQ D;  3HOZ K;  3S1Q K;  3S16 K;  3S1R C;  4Q5S A;  2CW0 A;  4C2M K;  4NOI A;  4A93 C;  4BBS C;  5IYB C;  4OIQ A;  4QJV B;  3GTO C;  2PA8 D;  1I50 C;  3K7A C;  3S15 K;  4A3L K;  1IW7 A;  2VUM C;  4YFK A;  3HOY C;  5TMF A;  5C4J K;  2JA5 K;  2B63 K;  3HOV K;  5M3F K;  4A3C K;  2JA6 C;  3I4N C;  3RZD C;  2YU9 K;  4A3I K;  3M3Y C;  2WB1 L;  3H0G C;  4A3M K;  1TWC C;  4A3G C;  3S2D K;  3S1Q C;  4LK0 A;  5IP7 C;  4KMU A;  4BY7 K;  4BXX K;  5IYC C;  3GTJ K;  3S2H K;  4A3J C;  2JA7 C;  1TWA K;  2Y0S L;  1WCM K;  2NVY K;  4C3I K;  5FJ8 K;  3HOX K;  3GTM C;  2E2I C;  3S15 C;  4A3D C;  3S1N C;  1SMY A;  3GTK C;  4OIN A;  3GTQ C;  3HOV C;  4A3E K;  4A3B K;  1TWH K;  2WB1 D;  1XPP A;  2E2J C;  5M3M K;  2NVQ C;  3S17 C;  5C44 C;  2A68 A;  3DXJ A;  2JA8 K;  2R7Z K;  2R93 K;  4X6A C;  4XLP A;  2A6E A;  3HOU K;  3S1M C;  1Y1W K;  3I4M C;  1Y1V C;  4AYB L;  4A3B C;  2Y0S D;  3CQZ K;  3H3V L;  3GTG C;  3PO2 K;  5C4X C;  4QIW L;  4Y52 C;  2PMZ D;  2E2H C;  4Y7N C;  4YG2 A;  5C3E C;  5FLM K;  4A3F K;  5IYD K;  4YFN A;  1R9T C;  3GTP C;  4A3K K;  3M4O K;  2R92 C;  4XSZ A;  1TWH C;  4ZH4 A;  4C3J K;  2R7Z C;  1TWF K;  5D4D A;  3HOZ C;  3S16 C;  4LK1 A;  4Q4Z A;  4AYB D;  4G7Z A;  3HOU C;  4BBR K;  1Y1W C;  3H3V D;  4QIW D;  2A6H A;  4A3L C;  1YNJ A;  3CQZ C;  3PO3 K;  3PO2 C;  2PMZ L;  4XSX A;  4MEY A;  5M5Y K;  1K83 K;  2O5J A;  2JA5 C;  5C4J C;  3GTL K;  2B63 C;  5IYD C;  4A3F C;  3HOW K;  4A3C C;  1I3Q K;  4LLG A;  2YU9 C;  4A3I C;  3RZO K;  4G7H A;  4A3M C;  3FKI K;  1I6H K;  1TWG K;  3S14 K;  4MEX A;  5IP9 K;  4BY7 C;  4BXX C;  3GTJ C;  3S2H C;  5M5X K;  2PPB A;  1YNN A;  1TWA C;  4BBR C;  4C3H K;  4BY1 K;  1WCM C;  2NVY C;  3WOD A;  3S1R K;  3HOX C;  4OIO A;  4A93 K;  5TMC A;  1I6V A;  5IYB K;  1HQM A;  3GTO K;  1I50 K;  4A3E C;  1ZYR A;  3EQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...