2R7ZK

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r7zK00
3S2HC 5IP9C 3S14K 3S16K 3M4OK 3DXJA 1TWHC 1WCMC 1I50C 3HOZK 4A3CC 5M5XK 2YU9K 3CQZC 4KN4A 4C3HK 5M3MK 3HOVC 3PO2K 4XSZA 2JA6K 4YFKA 1I3QK 1IW7A 4A3MK 2NVTK 4XLPA 4A3BK 4A3GK 2WB1D 3GTMK 2O5JA 3FKIK 3H3VD 4OIOA 3S1NK 4A3LC 1Y1VK 4A3JC 3S14C 1TWFK 3M4OC 3M3YC 1TWHK 1WCMK 5C44C 4MEYA 4A3CK 3K7AC 3S2DK 1I6HC 4Y7NK 3RZDK 3CQZK 3S1RK 4JK1A 3S17C 4LK0A 2E2JC 4A3DK 1TWCC 3HOUC 2E2IC 4OIRA 3EQLA 5M3FK 3HKZD 5C3EC 3HOXK 4A3KC 2VUMC 3S15C 4GZYA 5IYBK 2R7ZK 2PMZD 4MEXA 2WAQL 2Y0SD 4QIWD 1TWGC 5M5YK 3GTKK 2CW0A 2B63K 4Q5SA 2NVQC 3I4MK 3GTLK 3S1MC 3HKZL 2PA8L 2JA7C 1TWFC 4NOIA 4OIPA 4Y52C 5FJ8K 3M3YK 3PO3K 2NVXK 3S1QC 2JA8C 3GTQC 3GTJK 3GTOK 3K7AK 2E2HK 3S2DC 3H0GK 2NVYK 4C3JK 4KMUA 3S2HK 4G7ZA 5FLMK 5C4JK 2E2IK 2A68A 2BE5A 4XSXA 3HOWC 1I50K 5M5WK 1R9TK 4OIQA 3HOZC 1K83K 3PO2C 1TWGK 3GTKC 1I3QC 4QIWL 4A3FK 4A3MC 3PO3C 4BY7K 4X6AK 5TMFA 1YNJA 3GTQK 2JA5C 3S1NC 4MQ9A 5D4DA 2R92K 3GTPK 3HOYK 3I4NC 4A3JK 5IP7K 4QJVA 2WB1L 5FLMC 5C4JC 4A3IC 1Y1WK 3RZOK 3GTGK 1I6HK 4C2MK 2O5IA 4QJVB 5IP9K 1ZYRA 1TWCK 3S16C 3HOUK 4A93K 4A3FC 2VUMK 4A3KK 5IYBC 3WODA 2R7ZC 4BBSK 2YU9C 4LJZA 4Q4ZA 4YFXA 1SMYA 1SFOC 2JA6C 2NVQK 3I4MC 4G7OA 3GTLC 3GTPC 3I4NK 3S1MK 2NVTC 4Y52K 1TWAK 3FKIC 5C4XC 4BXXK 2PPBA 1Y1WC 5IYDK 3GTJC 4BBRC 2R93K 4A3EC 2E2HC 3GTGC 4LK1A 3H0GC 5TMCA 1XPPA 4BY1K 4AYBD 1BDFA 4XLNA 4A93C 3HOWK 5C44K 1R9TC 4YG2A 4X6AC 2A6HA 4Y7NC 5IYCC 1K83C 2WAQD 3RZDC 3S1RC 2Y0SL 4BY1C 3S17K 4BBSC 1YNNA 1SFOK 2PMZL 4LLGA 2E2JK 4A3DC 1I6VA 2A69A 5C3EK 3HOXC 4BY7C 3S15K 2A6EA 1TWAC 5C4XK 5IYDC 4BXXC 2PA8D 3HOVK 4BBRK 2R93C 2JA5K 4C3IK 4ZH4A 4A3EK 3H3VL 2B63C 2R92C 3HOYC 4A3BC 4OINA 4KN7A 2JA7K 5IP7C 4A3GC 4G7HA 4YFNA 3GTMC 3S1QK 2NVXC 4A3IK 1HQMA 2JA8K 3RZOC 3GTOC 4AYBL 4A3LK 1Y1VC 5IYCK 2NVYC
chains in the Genus database with same CATH superfamily
3A8KA 1J6XA 3M4OK 5IOQA 4A3CC 3CQZC 4KN4A 2JA6K 1IW7A 2NVTK 4A3GK 4O2DA 2VUMA 3H3VD 4OIOA 1B4AA 4A3LC 2Y3PA 4G0UA 2W7VA 3M4OC 4KMHA 2ZUEA 4A3CK 3IPJA 4Y7NK 3CQZK 3S1RK 2E2JC 1O26A 1TWCC 4OIRA 2FQTA 4LR2A 4GZYA 3A8IA 2P5MA 2Y0SD 5M5YK 2CW0A 3GTLK 5JFEA 2JA7C 4Y52C 5FJ8K 3GTJK 3H0GK 2RGRA 3GTJA 3GEIA 5C4JK 1R9TK 3PO2C 1WORA 4ILDA 1I3QC 5TMFA 2JA5C 3S1NC 3T01A 2R92K 3AD9C 4A3JK 1XZPA 5C4JC 2R92A 4A3IC 1Y1WK 3RZOK 1F9NA 5E68A 3HOUK 3LAJA 1O2BA 2VUMK 3LAPA 2V6SA 5EGHA 5IYBC 2R7ZC 2YU9C 4RMFA 4Q4ZA 1SFOC 4PAAA 1L0WA 3Q3QA 5C4XC 3N0CA 1B4BA 1Y1WC 4BBRC 1TWAA 2E2HC 5TMCA 1J6VA 1WOPA 4YG2A 3GDZA 1YNNA 1SFOK 2PMZL 4LLGA 2NVYA 4A3DC 1VJEA 3ADAC 3NUHA 4WJ3M 4BY7C 3S15K 1IBAA 2JA5A 2E2IA 1PJ7A 5C4XK 3A8JA 4BBRK 5CHPA 3H3VL 1UV7A 4G0VA 3HOYC 4G7HA 4YFNA 4GTBA 4WJ4A 2NVXC 2JA8K 2JA7A 4PABA 1Y1VC 1JVIA 1IE0A 3S2HC 1EH1A 3S14K 4KB4A 2YU9A 3TFJA 3HOZK 1AB4A 3BUEA 2JA6A 5M3MK 4J3NA 4YFKA 4FZBA 3GTMA 4A3MK 3GSIA 1I3QA 3FKIK 3GTGA 1EQRA 2XCRB 1Y1VK 3BP3A 3S14C 1TWFK 3FOFA 2FQOA 4JK1A 3AD7C 3GTKK 2B63K 2NVQC 3I4MK 3S1MC 4X6AC 1TWFC 4OIPA 3T00A 3GTQC 3GTOK 4KMUA 5IOTA 5FLMK 1O2FB 1J6WA 3HOWC 1ISEA 4OIQA 1K83K 4KASA 3GTKC 4P9SA 1XXCA 4QIWL 4X6AK 3T02A 3GTQA 1ZVUA 1O2AA 3GTQK 4MQ9A 1F7VA 3GTPK 5IP7K 5JVOA 2WB1L 5FLMC 3FKIA 3GTGK 1Y1WA 4FM9A 2O5IA 3N0BA 1Y1VA 5IP9K 1ZYRA 1TWCK 3S16C 4BKWA 4A93K 4BLBA 4KC6A 3WODA 2GSNA 1SMYA 1TWFA 1G51A 3GTLC 3GTPC 1IS1A 4Y52K 1WQFA 3GTJC 3QX3A 4A3EC 3GTGC 4LK1A 3H0GC 4XCHA 2R93A 1DCPA 1ZXOA 2B63A 4A93C 1BDFA 5C44K 1R9TC 3RZDC 3AH5A 3S17K 5C3EK 3HOXC 4KM8A 2A6EA 1BGWA 3HOVK 2JA5K 4A3EK 4ZH4A 1J98A 2R92C 4OINA 4KN7A 3S1QK 4KARA 4A3IK 1HQMA 3JSTA 1XZQB 3RZOC 4P5AA 2NVYC 1XZQA 5CJ9A 1TWHC 5TJ3A 1I50C 4KM9A 2ZFZA 4C3HK 2YU9K 3HOVC 4XSZA 3GTPA 1YX2A 4XLPA 3G4AA 4LQYA 5HL8A 1VRQC 2O5JA 1XZPB 3GEEA 3M3YC 1O27A 1TWHK 3K7AC 1I6HC 4C2MC 1YCLA 4C3HC 4C3JC 1PJ5A 4A3DK 1DD5A 2E2IC 1GE9A 2GSOA 4A3KC 3S15C 3BP8C 4MEXA 2WAQL 1PJ6A 1X31C 1EK8A 4Q5SA 2R7ZA 2ZUFA 1VGXA 3GTKA 3HKZL 3PO3K 4NOIA 3GTOA 1BS2A 3M3YK 2NVXK 2JA8C 3TTGA 3K7AK 4C3JK 3S2HK 3H0GA 2E2IK 2A68A 2BE5A 3HOZC 2JH3A 4GTLA 1K83A 1O28A 4A3MC 3PO3C 1V5VA 1YNJA 5D4DA 4QJVA 1VLOA 4KMDA 1TWCA 3OREA 4GTDA 4QJVB 1EI6A 4BBSK 1WCMA 3OPFA 4YFXA 3FHZA 3TFHA 2NVQK 2JA6C 3I4MC 3S1MK 2NVTC 1WOOA 1TWAK 4AH6A 5IYDK 3FOEA 1XPPA 1DCHA 3HXAA 1HI9A 4XLNA 4GTAA 3HOWK 5L46A 4Y7NC 1SFOA 4BY1C 1K83C 4BBSC 3S1RC 3GTLA 2E2JK 2P8TA 1I6VA 4KDDA 5IYDC 1TWAC 2E2HA 2PA8D 1JOEA 1TWGA 3AQPA 4A3BC 2JA7K 5IP7C 1R9TA 3GTMC 1EFWA 2GAGC 2D6FC 4BY1K 1KQ4A 1O24A 4LOWA 5IP9C 3S16K 1VH2A 4WILA 3DXJA 1WCMC 3GEHA 5M5XK 1WSVA 1USMA 3PO2K 1I3QK 4A3BK 2WB1D 3GTMK 1C0AA 4KATA 3S1NK 4GTCA 4A3JC 2V6TA 4GTFA 1WCMK 5C44C 4MEYA 3S2DK 1XXBA 3RZDK 1WQGA 1O25A 3S17C 2V6UA 4LK0A 4C45A 3HOUC 1WSRA 3EQLA 5M3FK 3HKZD 5C3EC 3HOXK 2VUMC 5IYBK 2R7ZK 2XCQA 2PMZD 4QIWD 1TWGC 1BJTA 2GAHC 1USOA 2NVXA 3LPXA 2PA8L 1F93A 3V4GA 3S1QC 3S2DC 2E2HK 5IOSA 1INNA 2NVYK 3G4CA 3ERED 1IL2A 4G7ZA 4KAWX 4XSXA 1I50K 5M5WK 4GT9A 1TWGK 4A3FK 4BY7K 4DDQA 3L4JA 2RH6A 3CAGA 3HOYK 3I4NC 1IQ0A 1WOSA 5EGEA 4BLAA 2EBBA 1ZQ1C 4KMAA 1I6HK 4C2MK 5IORA 1DCOA 3N3YA 4A3FC 3AQOA 4A3KK 3GIRA 2CFAA 1TWHA 4LJZA 1O29A 3CQZA 3TFIA 1WIHA 4G0WA 4G7OA 3I4NK 1JQWA 2CFAB 2XCOA 3FKIC 4BXXK 2PPBA 2KWAA 2R93K 3SZZA 4C3IC 2GSUA 3S0XA 4AYBD 3AD8C 3OEPA 2A6HA 5IYCC 1RU0A 2WAQD 4GTEA 4GFQA 2Y0SL 3VA7A 1WQHA 2A69A 1XXAA 4BXXC 1I50A 3MMLB 1ZBSA 2R93C 4C3IK 2B63C 4M1XA 3L4KA 4A3GC 4P5BA 3SZYA 4KB2A 2PHCB 3GTOC 4AYBL 4A3LK 5IYCK 1F7UA
chains in the Genus database with same CATH topology
3S2HC 5IP9C 3S14K 3S16K 3M4OK 3DXJA 1TWHC 1WCMC 1I50C 3HOZK 4A3CC 5M5XK 2YU9K 3CQZC 4KN4A 4C3HK 5M3MK 3HOVC 3PO2K 4XSZA 2JA6K 4YFKA 1I3QK 1IW7A 4A3MK 2NVTK 4XLPA 4A3BK 4A3GK 2WB1D 3GTMK 2O5JA 3FKIK 3H3VD 4OIOA 3S1NK 4A3LC 1Y1VK 4A3JC 3S14C 1TWFK 3M4OC 3M3YC 1TWHK 1WCMK 5C44C 4MEYA 4A3CK 3K7AC 3S2DK 1I6HC 4Y7NK 3RZDK 3CQZK 3S1RK 4JK1A 3S17C 4LK0A 2E2JC 4A3DK 1TWCC 3HOUC 2E2IC 4OIRA 3EQLA 5M3FK 3HKZD 5C3EC 3HOXK 4A3KC 2VUMC 3S15C 4GZYA 5IYBK 2R7ZK 2PMZD 4MEXA 2WAQL 2Y0SD 4QIWD 1TWGC 5M5YK 3GTKK 2CW0A 2B63K 4Q5SA 2NVQC 3I4MK 3GTLK 3S1MC 3HKZL 2PA8L 2JA7C 1TWFC 4NOIA 4OIPA 4Y52C 5FJ8K 3M3YK 3PO3K 2NVXK 3S1QC 2JA8C 3GTQC 3GTJK 3GTOK 3K7AK 2E2HK 3S2DC 3H0GK 2NVYK 4C3JK 4KMUA 3S2HK 4G7ZA 5FLMK 5C4JK 2E2IK 2A68A 2BE5A 4XSXA 3HOWC 1I50K 5M5WK 1R9TK 4OIQA 3HOZC 1K83K 3PO2C 1TWGK 3GTKC 1I3QC 4QIWL 4A3FK 4A3MC 3PO3C 4BY7K 4X6AK 5TMFA 1YNJA 3GTQK 2JA5C 3S1NC 4MQ9A 5D4DA 2R92K 3GTPK 3HOYK 3I4NC 4A3JK 5IP7K 4QJVA 2WB1L 5FLMC 5C4JC 4A3IC 1Y1WK 3RZOK 3GTGK 1I6HK 4C2MK 2O5IA 4QJVB 5IP9K 1ZYRA 1TWCK 3S16C 3HOUK 4A93K 4A3FC 2VUMK 4A3KK 5IYBC 3WODA 2R7ZC 4BBSK 2YU9C 4LJZA 4Q4ZA 4YFXA 1SMYA 1SFOC 2JA6C 2NVQK 3I4MC 4G7OA 3GTLC 3GTPC 3I4NK 3S1MK 2NVTC 4Y52K 1TWAK 3FKIC 5C4XC 4BXXK 2PPBA 1Y1WC 5IYDK 3GTJC 4BBRC 2R93K 4A3EC 2E2HC 3GTGC 4LK1A 3H0GC 5TMCA 1XPPA 4BY1K 4AYBD 1BDFA 4XLNA 4A93C 3HOWK 5C44K 1R9TC 4YG2A 4X6AC 2A6HA 4Y7NC 5IYCC 1K83C 2WAQD 3RZDC 3S1RC 2Y0SL 4BY1C 3S17K 4BBSC 1YNNA 1SFOK 2PMZL 4LLGA 2E2JK 4A3DC 1I6VA 2A69A 5C3EK 3HOXC 4BY7C 3S15K 2A6EA 1TWAC 5C4XK 5IYDC 4BXXC 2PA8D 3HOVK 4BBRK 2R93C 2JA5K 4C3IK 4ZH4A 4A3EK 3H3VL 2B63C 2R92C 3HOYC 4A3BC 4OINA 4KN7A 2JA7K 5IP7C 4A3GC 4G7HA 4YFNA 3GTMC 3S1QK 2NVXC 4A3IK 1HQMA 2JA8K 3RZOC 3GTOC 4AYBL 4A3LK 1Y1VC 5IYCK 2NVYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H C;  5IP9 C;  3S14 K;  3S16 K;  3M4O K;  3DXJ A;  1TWH C;  1WCM C;  1I50 C;  3HOZ K;  4A3C C;  5M5X K;  2YU9 K;  3CQZ C;  4KN4 A;  4C3H K;  5M3M K;  3HOV C;  3PO2 K;  4XSZ A;  2JA6 K;  4YFK A;  1I3Q K;  1IW7 A;  4A3M K;  2NVT K;  4XLP A;  4A3B K;  4A3G K;  2WB1 D;  3GTM K;  2O5J A;  3FKI K;  3H3V D;  4OIO A;  3S1N K;  4A3L C;  1Y1V K;  4A3J C;  3S14 C;  1TWF K;  3M4O C;  3M3Y C;  1TWH K;  1WCM K;  5C44 C;  4MEY A;  4A3C K;  3K7A C;  3S2D K;  1I6H C;  4Y7N K;  3RZD K;  3CQZ K;  3S1R K;  4JK1 A;  3S17 C;  4LK0 A;  2E2J C;  4A3D K;  1TWC C;  3HOU C;  2E2I C;  4OIR A;  3EQL A;  5M3F K;  3HKZ D;  5C3E C;  3HOX K;  4A3K C;  2VUM C;  3S15 C;  4GZY A;  5IYB K;  2R7Z K;  2PMZ D;  4MEX A;  2WAQ L;  2Y0S D;  4QIW D;  1TWG C;  5M5Y K;  3GTK K;  2CW0 A;  2B63 K;  4Q5S A;  2NVQ C;  3I4M K;  3GTL K;  3S1M C;  3HKZ L;  2PA8 L;  2JA7 C;  1TWF C;  4NOI A;  4OIP A;  4Y52 C;  5FJ8 K;  3M3Y K;  3PO3 K;  2NVX K;  3S1Q C;  2JA8 C;  3GTQ C;  3GTJ K;  3GTO K;  3K7A K;  2E2H K;  3S2D C;  3H0G K;  2NVY K;  4C3J K;  4KMU A;  3S2H K;  4G7Z A;  5FLM K;  5C4J K;  2E2I K;  2A68 A;  2BE5 A;  4XSX A;  3HOW C;  1I50 K;  5M5W K;  1R9T K;  4OIQ A;  3HOZ C;  1K83 K;  3PO2 C;  1TWG K;  3GTK C;  1I3Q C;  4QIW L;  4A3F K;  4A3M C;  3PO3 C;  4BY7 K;  4X6A K;  5TMF A;  1YNJ A;  3GTQ K;  2JA5 C;  3S1N C;  4MQ9 A;  5D4D A;  2R92 K;  3GTP K;  3HOY K;  3I4N C;  4A3J K;  5IP7 K;  4QJV A;  2WB1 L;  5FLM C;  5C4J C;  4A3I C;  1Y1W K;  3RZO K;  3GTG K;  1I6H K;  4C2M K;  2O5I A;  4QJV B;  5IP9 K;  1ZYR A;  1TWC K;  3S16 C;  3HOU K;  4A93 K;  4A3F C;  2VUM K;  4A3K K;  5IYB C;  3WOD A;  2R7Z C;  4BBS K;  2YU9 C;  4LJZ A;  4Q4Z A;  4YFX A;  1SMY A;  1SFO C;  2JA6 C;  2NVQ K;  3I4M C;  4G7O A;  3GTL C;  3GTP C;  3I4N K;  3S1M K;  2NVT C;  4Y52 K;  1TWA K;  3FKI C;  5C4X C;  4BXX K;  2PPB A;  1Y1W C;  5IYD K;  3GTJ C;  4BBR C;  2R93 K;  4A3E C;  2E2H C;  3GTG C;  4LK1 A;  3H0G C;  5TMC A;  1XPP A;  4BY1 K;  4AYB D;  1BDF A;  4XLN A;  4A93 C;  3HOW K;  5C44 K;  1R9T C;  4YG2 A;  4X6A C;  2A6H A;  4Y7N C;  5IYC C;  1K83 C;  2WAQ D;  3RZD C;  3S1R C;  2Y0S L;  4BY1 C;  3S17 K;  4BBS C;  1YNN A;  1SFO K;  2PMZ L;  4LLG A;  2E2J K;  4A3D C;  1I6V A;  2A69 A;  5C3E K;  3HOX C;  4BY7 C;  3S15 K;  2A6E A;  1TWA C;  5C4X K;  5IYD C;  4BXX C;  2PA8 D;  3HOV K;  4BBR K;  2R93 C;  2JA5 K;  4C3I K;  4ZH4 A;  4A3E K;  3H3V L;  2B63 C;  2R92 C;  3HOY C;  4A3B C;  4OIN A;  4KN7 A;  2JA7 K;  5IP7 C;  4A3G C;  4G7H A;  4YFN A;  3GTM C;  3S1Q K;  2NVX C;  4A3I K;  1HQM A;  2JA8 K;  3RZO C;  3GTO C;  4AYB L;  4A3L K;  1Y1V C;  5IYC K;  2NVY C; 
#chains in the Genus database with same CATH topology
 3A8K A;  1J6X A;  3M4O K;  5IOQ A;  4A3C C;  3CQZ C;  4KN4 A;  2JA6 K;  1IW7 A;  2NVT K;  4A3G K;  4O2D A;  2VUM A;  3H3V D;  4OIO A;  1B4A A;  4A3L C;  2Y3P A;  4G0U A;  2W7V A;  3M4O C;  4KMH A;  2ZUE A;  4A3C K;  3IPJ A;  4Y7N K;  3CQZ K;  3S1R K;  2E2J C;  1O26 A;  1TWC C;  4OIR A;  2FQT A;  4LR2 A;  4GZY A;  3A8I A;  2P5M A;  2Y0S D;  5M5Y K;  2CW0 A;  3GTL K;  5JFE A;  2JA7 C;  4Y52 C;  5FJ8 K;  3GTJ K;  3H0G K;  2RGR A;  3GTJ A;  3GEI A;  5C4J K;  1R9T K;  3PO2 C;  1WOR A;  4ILD A;  1I3Q C;  5TMF A;  2JA5 C;  3S1N C;  3T01 A;  2R92 K;  3AD9 C;  4A3J K;  1XZP A;  5C4J C;  2R92 A;  4A3I C;  1Y1W K;  3RZO K;  1F9N A;  5E68 A;  3HOU K;  3LAJ A;  1O2B A;  2VUM K;  3LAP A;  2V6S A;  5EGH A;  5IYB C;  2R7Z C;  2YU9 C;  4RMF A;  4Q4Z A;  1SFO C;  4PAA A;  1L0W A;  3Q3Q A;  5C4X C;  3N0C A;  1B4B A;  1Y1W C;  4BBR C;  1TWA A;  2E2H C;  5TMC A;  1J6V A;  1WOP A;  4YG2 A;  3GDZ A;  1YNN A;  1SFO K;  2PMZ L;  4LLG A;  2NVY A;  4A3D C;  1VJE A;  3ADA C;  3NUH A;  4WJ3 M;  4BY7 C;  3S15 K;  1IBA A;  2JA5 A;  2E2I A;  1PJ7 A;  5C4X K;  3A8J A;  4BBR K;  5CHP A;  3H3V L;  1UV7 A;  4G0V A;  3HOY C;  4G7H A;  4YFN A;  4GTB A;  4WJ4 A;  2NVX C;  2JA8 K;  2JA7 A;  4PAB A;  1Y1V C;  1JVI A;  1IE0 A;  3S2H C;  1EH1 A;  3S14 K;  4KB4 A;  2YU9 A;  3TFJ A;  3HOZ K;  1AB4 A;  3BUE A;  2JA6 A;  5M3M K;  4J3N A;  4YFK A;  4FZB A;  3GTM A;  4A3M K;  3GSI A;  1I3Q A;  3FKI K;  3GTG A;  1EQR A;  2XCR B;  1Y1V K;  3BP3 A;  3S14 C;  1TWF K;  3FOF A;  2FQO A;  4JK1 A;  3AD7 C;  3GTK K;  2B63 K;  2NVQ C;  3I4M K;  3S1M C;  4X6A C;  1TWF C;  4OIP A;  3T00 A;  3GTQ C;  3GTO K;  4KMU A;  5IOT A;  5FLM K;  1O2F B;  1J6W A;  3HOW C;  1ISE A;  4OIQ A;  1K83 K;  4KAS A;  3GTK C;  4P9S A;  1XXC A;  4QIW L;  4X6A K;  3T02 A;  3GTQ A;  1ZVU A;  1O2A A;  3GTQ K;  4MQ9 A;  1F7V A;  3GTP K;  5IP7 K;  5JVO A;  2WB1 L;  5FLM C;  3FKI A;  3GTG K;  1Y1W A;  4FM9 A;  2O5I A;  3N0B A;  1Y1V A;  5IP9 K;  1ZYR A;  1TWC K;  3S16 C;  4BKW A;  4A93 K;  4BLB A;  4KC6 A;  3WOD A;  2GSN A;  1SMY A;  1TWF A;  1G51 A;  3GTL C;  3GTP C;  1IS1 A;  4Y52 K;  1WQF A;  3GTJ C;  3QX3 A;  4A3E C;  3GTG C;  4LK1 A;  3H0G C;  4XCH A;  2R93 A;  1DCP A;  1ZXO A;  2B63 A;  4A93 C;  1BDF A;  5C44 K;  1R9T C;  3RZD C;  3AH5 A;  3S17 K;  5C3E K;  3HOX C;  4KM8 A;  2A6E A;  1BGW A;  3HOV K;  2JA5 K;  4A3E K;  4ZH4 A;  1J98 A;  2R92 C;  4OIN A;  4KN7 A;  3S1Q K;  4KAR A;  4A3I K;  1HQM A;  3JST A;  1XZQ B;  3RZO C;  4P5A A;  2NVY C;  1XZQ A;  5CJ9 A;  1TWH C;  5TJ3 A;  1I50 C;  4KM9 A;  2ZFZ A;  4C3H K;  2YU9 K;  3HOV C;  4XSZ A;  3GTP A;  1YX2 A;  4XLP A;  3G4A A;  4LQY A;  5HL8 A;  1VRQ C;  2O5J A;  1XZP B;  3GEE A;  3M3Y C;  1O27 A;  1TWH K;  3K7A C;  1I6H C;  4C2M C;  1YCL A;  4C3H C;  4C3J C;  1PJ5 A;  4A3D K;  1DD5 A;  2E2I C;  1GE9 A;  2GSO A;  4A3K C;  3S15 C;  3BP8 C;  4MEX A;  2WAQ L;  1PJ6 A;  1X31 C;  1EK8 A;  4Q5S A;  2R7Z A;  2ZUF A;  1VGX A;  3GTK A;  3HKZ L;  3PO3 K;  4NOI A;  3GTO A;  1BS2 A;  3M3Y K;  2NVX K;  2JA8 C;  3TTG A;  3K7A K;  4C3J K;  3S2H K;  3H0G A;  2E2I K;  2A68 A;  2BE5 A;  3HOZ C;  2JH3 A;  4GTL A;  1K83 A;  1O28 A;  4A3M C;  3PO3 C;  1V5V A;  1YNJ A;  5D4D A;  4QJV A;  1VLO A;  4KMD A;  1TWC A;  3ORE A;  4GTD A;  4QJV B;  1EI6 A;  4BBS K;  1WCM A;  3OPF A;  4YFX A;  3FHZ A;  3TFH A;  2NVQ K;  2JA6 C;  3I4M C;  3S1M K;  2NVT C;  1WOO A;  1TWA K;  4AH6 A;  5IYD K;  3FOE A;  1XPP A;  1DCH A;  3HXA A;  1HI9 A;  4XLN A;  4GTA A;  3HOW K;  5L46 A;  4Y7N C;  1SFO A;  4BY1 C;  1K83 C;  4BBS C;  3S1R C;  3GTL A;  2E2J K;  2P8T A;  1I6V A;  4KDD A;  5IYD C;  1TWA C;  2E2H A;  2PA8 D;  1JOE A;  1TWG A;  3AQP A;  4A3B C;  2JA7 K;  5IP7 C;  1R9T A;  3GTM C;  1EFW A;  2GAG C;  2D6F C;  4BY1 K;  1KQ4 A;  1O24 A;  4LOW A;  5IP9 C;  3S16 K;  1VH2 A;  4WIL A;  3DXJ A;  1WCM C;  3GEH A;  5M5X K;  1WSV A;  1USM A;  3PO2 K;  1I3Q K;  4A3B K;  2WB1 D;  3GTM K;  1C0A A;  4KAT A;  3S1N K;  4GTC A;  4A3J C;  2V6T A;  4GTF A;  1WCM K;  5C44 C;  4MEY A;  3S2D K;  1XXB A;  3RZD K;  1WQG A;  1O25 A;  3S17 C;  2V6U A;  4LK0 A;  4C45 A;  3HOU C;  1WSR A;  3EQL A;  5M3F K;  3HKZ D;  5C3E C;  3HOX K;  2VUM C;  5IYB K;  2R7Z K;  2XCQ A;  2PMZ D;  4QIW D;  1TWG C;  1BJT A;  2GAH C;  1USO A;  2NVX A;  3LPX A;  2PA8 L;  1F93 A;  3V4G A;  3S1Q C;  3S2D C;  2E2H K;  5IOS A;  1INN A;  2NVY K;  3G4C A;  3ERE D;  1IL2 A;  4G7Z A;  4KAW X;  4XSX A;  1I50 K;  5M5W K;  4GT9 A;  1TWG K;  4A3F K;  4BY7 K;  4DDQ A;  3L4J A;  2RH6 A;  3CAG A;  3HOY K;  3I4N C;  1IQ0 A;  1WOS A;  5EGE A;  4BLA A;  2EBB A;  1ZQ1 C;  4KMA A;  1I6H K;  4C2M K;  5IOR A;  1DCO A;  3N3Y A;  4A3F C;  3AQO A;  4A3K K;  3GIR A;  2CFA A;  1TWH A;  4LJZ A;  1O29 A;  3CQZ A;  3TFI A;  1WIH A;  4G0W A;  4G7O A;  3I4N K;  1JQW A;  2CFA B;  2XCO A;  3FKI C;  4BXX K;  2PPB A;  2KWA A;  2R93 K;  3SZZ A;  4C3I C;  2GSU A;  3S0X A;  4AYB D;  3AD8 C;  3OEP A;  2A6H A;  5IYC C;  1RU0 A;  2WAQ D;  4GTE A;  4GFQ A;  2Y0S L;  3VA7 A;  1WQH A;  2A69 A;  1XXA A;  4BXX C;  1I50 A;  3MML B;  1ZBS A;  2R93 C;  4C3I K;  2B63 C;  4M1X A;  3L4K A;  4A3G C;  4P5B A;  3SZY A;  4KB2 A;  2PHC B;  3GTO C;  4AYB L;  4A3L K;  5IYC K;  1F7U A; 
#chains in the Genus database with same CATH homology
 3S2H C;  5IP9 C;  3S14 K;  3S16 K;  3M4O K;  3DXJ A;  1TWH C;  1WCM C;  1I50 C;  3HOZ K;  4A3C C;  5M5X K;  2YU9 K;  3CQZ C;  4KN4 A;  4C3H K;  5M3M K;  3HOV C;  3PO2 K;  4XSZ A;  2JA6 K;  4YFK A;  1I3Q K;  1IW7 A;  4A3M K;  2NVT K;  4XLP A;  4A3B K;  4A3G K;  2WB1 D;  3GTM K;  2O5J A;  3FKI K;  3H3V D;  4OIO A;  3S1N K;  4A3L C;  1Y1V K;  4A3J C;  3S14 C;  1TWF K;  3M4O C;  3M3Y C;  1TWH K;  1WCM K;  5C44 C;  4MEY A;  4A3C K;  3K7A C;  3S2D K;  1I6H C;  4Y7N K;  3RZD K;  3CQZ K;  3S1R K;  4JK1 A;  3S17 C;  4LK0 A;  2E2J C;  4A3D K;  1TWC C;  3HOU C;  2E2I C;  4OIR A;  3EQL A;  5M3F K;  3HKZ D;  5C3E C;  3HOX K;  4A3K C;  2VUM C;  3S15 C;  4GZY A;  5IYB K;  2R7Z K;  2PMZ D;  4MEX A;  2WAQ L;  2Y0S D;  4QIW D;  1TWG C;  5M5Y K;  3GTK K;  2CW0 A;  2B63 K;  4Q5S A;  2NVQ C;  3I4M K;  3GTL K;  3S1M C;  3HKZ L;  2PA8 L;  2JA7 C;  1TWF C;  4NOI A;  4OIP A;  4Y52 C;  5FJ8 K;  3M3Y K;  3PO3 K;  2NVX K;  3S1Q C;  2JA8 C;  3GTQ C;  3GTJ K;  3GTO K;  3K7A K;  2E2H K;  3S2D C;  3H0G K;  2NVY K;  4C3J K;  4KMU A;  3S2H K;  4G7Z A;  5FLM K;  5C4J K;  2E2I K;  2A68 A;  2BE5 A;  4XSX A;  3HOW C;  1I50 K;  5M5W K;  1R9T K;  4OIQ A;  3HOZ C;  1K83 K;  3PO2 C;  1TWG K;  3GTK C;  1I3Q C;  4QIW L;  4A3F K;  4A3M C;  3PO3 C;  4BY7 K;  4X6A K;  5TMF A;  1YNJ A;  3GTQ K;  2JA5 C;  3S1N C;  4MQ9 A;  5D4D A;  2R92 K;  3GTP K;  3HOY K;  3I4N C;  4A3J K;  5IP7 K;  4QJV A;  2WB1 L;  5FLM C;  5C4J C;  4A3I C;  1Y1W K;  3RZO K;  3GTG K;  1I6H K;  4C2M K;  2O5I A;  4QJV B;  5IP9 K;  1ZYR A;  1TWC K;  3S16 C;  3HOU K;  4A93 K;  4A3F C;  2VUM K;  4A3K K;  5IYB C;  3WOD A;  2R7Z C;  4BBS K;  2YU9 C;  4LJZ A;  4Q4Z A;  4YFX A;  1SMY A;  1SFO C;  2JA6 C;  2NVQ K;  3I4M C;  4G7O A;  3GTL C;  3GTP C;  3I4N K;  3S1M K;  2NVT C;  4Y52 K;  1TWA K;  3FKI C;  5C4X C;  4BXX K;  2PPB A;  1Y1W C;  5IYD K;  3GTJ C;  4BBR C;  2R93 K;  4A3E C;  2E2H C;  3GTG C;  4LK1 A;  3H0G C;  5TMC A;  1XPP A;  4BY1 K;  4AYB D;  1BDF A;  4XLN A;  4A93 C;  3HOW K;  5C44 K;  1R9T C;  4YG2 A;  4X6A C;  2A6H A;  4Y7N C;  5IYC C;  1K83 C;  2WAQ D;  3RZD C;  3S1R C;  2Y0S L;  4BY1 C;  3S17 K;  4BBS C;  1YNN A;  1SFO K;  2PMZ L;  4LLG A;  2E2J K;  4A3D C;  1I6V A;  2A69 A;  5C3E K;  3HOX C;  4BY7 C;  3S15 K;  2A6E A;  1TWA C;  5C4X K;  5IYD C;  4BXX C;  2PA8 D;  3HOV K;  4BBR K;  2R93 C;  2JA5 K;  4C3I K;  4ZH4 A;  4A3E K;  3H3V L;  2B63 C;  2R92 C;  3HOY C;  4A3B C;  4OIN A;  4KN7 A;  2JA7 K;  5IP7 C;  4A3G C;  4G7H A;  4YFN A;  3GTM C;  3S1Q K;  2NVX C;  4A3I K;  1HQM A;  2JA8 K;  3RZO C;  3GTO C;  4AYB L;  4A3L K;  1Y1V C;  5IYC K;  2NVY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...