2R7ZK

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r7zK00
2JA8K 2CW0A 5C3EK 1I6HK 3PO2C 1SFOK 3HOVK 5IYBK 1TWAK 2R93K 3PO3C 4C3JK 3GTGC 4BXXC 3HOWC 4G7ZA 3HOWK 1TWHK 3S1NK 3FKIC 1K83C 4QIWL 4YFNA 4A3IC 4BY7K 2JA7C 4Q5SA 2PMZD 4A3BC 5IP7K 2VUMC 3RZDC 3S2HC 3M4OC 3GTOC 3GTQK 3GTGK 4YFKA 4BXXK 5IYDK 1I3QC 2WAQL 1TWFK 4JK1A 1R9TK 2E2HC 5IYCK 3GTJK 2E2JC 2NVXC 2WB1L 1Y1WK 1YNJA 3GTMK 2PA8L 4KMUA 3S1MC 2PPBA 4A93C 3HKZD 5M5XK 3GTLK 1I50C 3I4NC 5D4DA 4A3IK 4OINA 2A69A 5M3MK 5M5WK 4A3MC 3S16K 3H3VL 4A3EK 4KN7A 3GTKK 3EQLA 3S1RC 2JA6K 3HOZC 3S2DK 2JA5C 2NVYK 2A6EA 4QJVA 5FLMK 4Y7NC 2E2JK 3CQZC 3S15C 3GTPK 3HOXK 2YU9C 4XSXA 3S1MK 4Y52K 4A3CK 1IW7A 1TWCC 4MEXA 2O5IA 1BDFA 5IP9C 3S1QK 4A3DC 3H3VD 3M3YK 4XLNA 4NOIA 3PO2K 5FJ8K 1HQMA 5C44C 2R92C 4LJZA 2NVQC 4AYBL 2NVTC 2Y0SL 4Y7NK 3PO3K 4BBRC 4QJVB 4YG2A 2YU9K 4YFXA 4G7OA 1TWCK 4A3KC 3S17C 4MEYA 4A3JC 4QIWD 4MQ9A 5M3FK 1TWGC 3S14C 2B63C 2R7ZC 3FKIK 1K83K 3K7AC 5C44K 2R92K 1Y1VC 2JA7K 2NVTK 3I4MK 4A3BK 2WAQD 4Q4ZA 4BBSC 2VUMK 3RZDK 4X6AC 3H0GC 3HOYC 3S2HK 2WB1D 3GTOK 3M4OK 4A3GC 2PA8D 4A3KK 1I3QK 4A3FC 1I6VA 2E2HK 5C4JC 2A68A 4LLGA 2NVXK 4XLPA 4BY1C 4A93K 1WCMC 3HOUC 3DXJA 1I50K 3I4NK 2JA8C 1I6HC 4ZH4A 1SFOC 4A3MK 3HOVC 3H0GK 5IYBC 1TWAC 3S1RK 3HOZK 2R93C 2BE5A 2JA5K 4OIQA 4KN4A 4GZYA 3S15K 3CQZK 1SMYA 1TWHC 2A6HA 5IP9K 4A3DK 2E2IC 5M5YK 3S1NC 4C2MK 4AYBD 2Y0SD 4XSZA 4BY7C 4LK1A 3RZOC 4C3HK 1ZYRA 5TMFA 5IP7C 2NVQK 5IYDC 4BBRK 3GTQC 4A3LC 5C4XC 2PMZL 1R9TC 1TWFC 3I4MC 5IYCC 3GTJC 3S17K 4OIPA 1Y1WC 2E2IK 4A3JK 3GTMC 2O5JA 1TWGK 4C3IK 4LK0A 2B63K 3GTLC 2R7ZK 4OIOA 3S14K 3WODA 3K7AK 3RZOK 1Y1VK 5C3EC 3HKZL 3S16C 4BBSK 4A3EC 3GTKC 4OIRA 5C4XK 2JA6C 4A3LK 3S2DC 3HOYK 4X6AK 4A3GK 2NVYC 4G7HA 5FLMC 4A3FK 4BY1K 3GTPC 5C4JK 4Y52C 3HOXC 1YNNA 4A3CC 3S1QC 1WCMK 3HOUK 5TMCA 3M3YC 1XPPA
chains in the Genus database with same CATH superfamily
2JA8K 2CW0A 4PABA 5C3EK 3PO3C 3S1NK 4O2DA 4Q5SA 2PMZD 1XXAA 3Q3QA 5IYDK 3GTQK 4KB4A 3A8KA 2GAHC 2WAQL 4JK1A 1R9TK 3GEIA 3I4MK 5IYCK 3GTJK 1Y1WK 1YNJA 2PA8L 4KMUA 4AH6A 3S1MC 1Y1WA 3HKZD 2A69A 5M3MK 1VRQC 5IORA 3EQLA 3G4AA 1WSRA 2NVYK 2E2JK 2NVYA 3CQZC 3GTPK 1DCPA 3GTPA 1WQHA 2PHCB 2O5IA 4XLNA 4C2MC 3PO2K 4C3HC 5C44C 1F93A 2NVQC 2Y0SL 4Y7NK 4BBRC 3L4KA 2YU9K 4YFXA 4G7OA 1TWCK 4A3KC 3GTGA 1B4AA 3T00A 3N0BA 4MQ9A 1TWGC 1BJTA 2B63C 3CAGA 1XXCA 1Y1VC 2JA7K 2JA7A 1VJEA 4BLAA 3M4OK 3GTOK 1WQFA 3GTOA 1I3QK 1I6VA 5JVOA 5C4JC 4A93K 1O2BA 1WCMC 3GSIA 3I4NK 5IOTA 3GDZA 1J6WA 3QX3A 1XZQA 3HOVC 2R93C 1TWAC 2BE5A 2P8TA 2JA5K 2JA5A 3S15K 4DDQA 5IP9K 2CFAA 1F9NA 5M5YK 1WSVA 2GAGC 4XSZA 1ZYRA 5IP7C 1F7VA 1XXBA 2PMZL 4WILA 5EGEA 2E2IK 4C3IK 5IOSA 4PAAA 3AQPA 3HKZL 4BKWA 4A3EC 3S2DC 2JA6C 1USMA 1EK8A 3H0GA 1JOEA 4WJ4A 4A3FK 4Y52C 1X31C 1WORA 3HOWC 2W7VA 5CHPA 3GIRA 1SFOK 4KC6A 3OPFA 5IYBK 3N3YA 4RMFA 4C3JK 4GTDA 5HL8A 4G7ZA 3HXAA 3FHZA 2EBBA 3FKIC 4A3IC 4BY7K 1PJ6A 4A3BC 5EGHA 3RZDC 4WJ3M 5M5XK 3GTLK 3GTLA 2GSUA 5M5WK 4M1XA 3S16K 3H3VL 4KN7A 3GTKK 3S1RC 4KMDA 3GTKA 2A6EA 3G4CA 5FLMK 1BGWA 1G51A 3HOXK 3S1MK 3MMLB 1IS1A 1IW7A 1BDFA 1YCLA 2JH3A 1HQMA 2R92C 5TJ3A 2NVTC 1WIHA 4QJVB 1IQ0A 4YG2A 1V5VA 1VH2A 3GTQA 3ADAC 4MEYA 5E68A 1R9TA 1O2FB 3GTJA 2R7ZC 1K83K 1K83A 5C44K 1ZBSA 4Q4ZA 4GTAA 2VUMK 1O26A 3HOYC 3S2HK 2WB1D 2VUMA 4A3KK 4P5AA 2E2HK 5JFEA 2NVXK 3HOUC 3DXJA 1I50K 5IOQA 2JA8C 1I50A 4ZH4A 4A3MK 3HOZK 4OIQA 4LR2A 4P5BA 1L0WA 1O28A 1SMYA 2YU9A 2Y3PA 4A3DK 1TWCA 3BUEA 3S1NC 1INNA 1EFWA 3AD8C 3RZOC 3AD7C 5IYDC 3GTQC 4A3LC 5C4XC 1EQRA 1R9TC 2V6SA 3I4MC 5IYCC 3GTJC 3S17K 3T02A 4C45A 1O27A 1I3QA 4A3JK 1Y1WC 3LPXA 2O5JA 2GSOA 3S14K 4OIOA 3K7AK 4BBSK 4OIRA 2ZFZA 4X6AK 4KATA 2RH6A 4A3GK 2NVYC 4G7HA 4BY1K 3GTPC 3LAJA 1I6HK 3PO2C 5L46A 3GTGC 4BXXC 1WQGA 3HOWK 1TWHK 4GTBA 1TWHA 1DCOA 2E2IA 2JA7C 2V6TA 1F7UA 1UV7A 3GTOC 1USOA 3M4OC 4YFKA 1I3QC 1TWFK 1TWFA 2WB1L 3GTMK 3GTMA 4A93C 3I4NC 2GSNA 5D4DA 4A3IK 3L4JA 4KB2A 1VGXA 4GT9A 3BP3A 1IE0A 1SFOA 3GEHA 3NUHA 2JA5C 1BS2A 4QJVA 2P5MA 3S15C 1WOOA 1EI6A 4XSXA 4A3CK 4MEXA 5IP9C 3S1QK 3M3YK 4LJZA 3PO3K 1DCHA 4QIWD 2ZUEA 1GE9A 1PJ5A 4C3IC 3T01A 2R92K 1PJ7A 2NVTK 1ZVUA 1XZPB 3H0GC 4GTCA 4A3FC 3HOUK 2A68A 1WOPA 1J6VA 3SZZA 1SFOC 4KASA 3LAPA 5IYBC 2FQOA 4KN4A 4C3JC 4BLBA 3CQZK 4J3NA 3CQZA 4LOWA 3AQOA 3AH5A 4C2MK 3JSTA 1EH1A 4AYBD 4BY7C 4LK1A 4C3HK 5TMFA 2RGRA 1O25A 2NVQK 4BBRK 1B4BA 1J98A 4OIPA 4P9SA 2E2HA 2NVXA 1TWGK 3GTLC 4LK0A 2B63K 1TWGA 2B63A 3RZOK 1JQWA 1Y1VK 5C3EC 1Y1VA 3S16C 3GTKC 5C4XK 4A3LK 3VA7A 5FLMC 2XCRB 2XCQA 5C4JK 3HOXC 1YNNA 1WCMK 5TMCA 1WCMA 1XPPA 3HOVK 3FOFA 2R93K 1TWAK 2R93A 1TWAA 4ILDA 2FQTA 4LQYA 4KM9A 4G0VA 1O2AA 3TFIA 1K83C 4QIWL 4YFNA 3A8JA 1VLOA 5IP7K 4GTEA 2VUMC 3SZYA 3S2HC 3GTGK 4BXXK 2E2HC 2E2JC 2NVXC 1YX2A 4KMAA 2PPBA 1AB4A 1I50C 1C0AA 4OINA 4FZBA 1IL2A 4A3MC 3ERED 2D6FC 4A3EK 3S2DK 3HOZC 2JA6K 2ZUFA 2JA6A 3FOEA 3N0CA 4Y7NC 2YU9C 4Y52K 1J6XA 1TWCC 4A3DC 3A8IA 3H3VD 2V6UA 4NOIA 3OEPA 3TTGA 5FJ8K 4KMHA 1ISEA 4AYBL 1RU0A 1XZPA 3AD9C 4XCHA 3S17C 1HI9A 4A3JC 4GTLA 3S14C 3FKIK 3FKIA 3K7AC 4KM8A 4A3BK 4BBSC 2WAQD 1IBAA 3RZDK 4X6AC 4A3GC 5CJ9A 2PA8D 4BY1C 4LLGA 4XLPA 1ZXOA 4G0WA 1KQ4A 1O24A 1I6HC 1WOSA 3H0GK 4KAWX 3S1RK 4GTFA 4GZYA 3TFJA 4KARA 1TWHC 2A6HA 2E2IC 4KDDA 4FM9A 2Y0SD 1ZQ1C 2KWAA 1XZQB 1O29A 2R92A 3V4GA 1TWFC 3GTMC 2CFAB 1DD5A 2R7ZK 2R7ZA 3WODA 3BP8C 3TFHA 3GEEA 3S0XA 3HOYK 1JVIA 3IPJA 3OREA 4G0UA 2XCOA 4A3CC 3S1QC 4GFQA 3M3YC 5M3FK
chains in the Genus database with same CATH topology
2JA8K 2CW0A 5C3EK 1I6HK 3PO2C 1SFOK 3HOVK 5IYBK 1TWAK 2R93K 3PO3C 4C3JK 3GTGC 4BXXC 3HOWC 4G7ZA 3HOWK 1TWHK 3S1NK 3FKIC 1K83C 4QIWL 4YFNA 4A3IC 4BY7K 2JA7C 4Q5SA 2PMZD 4A3BC 5IP7K 2VUMC 3RZDC 3S2HC 3M4OC 3GTOC 3GTQK 3GTGK 4YFKA 4BXXK 5IYDK 1I3QC 2WAQL 1TWFK 4JK1A 1R9TK 2E2HC 5IYCK 3GTJK 2E2JC 2NVXC 2WB1L 1Y1WK 1YNJA 3GTMK 2PA8L 4KMUA 3S1MC 2PPBA 4A93C 3HKZD 5M5XK 3GTLK 1I50C 3I4NC 5D4DA 4A3IK 4OINA 2A69A 5M3MK 5M5WK 4A3MC 3S16K 3H3VL 4A3EK 4KN7A 3GTKK 3EQLA 3S1RC 2JA6K 3HOZC 3S2DK 2JA5C 2NVYK 2A6EA 4QJVA 5FLMK 4Y7NC 2E2JK 3CQZC 3S15C 3GTPK 3HOXK 2YU9C 4XSXA 3S1MK 4Y52K 4A3CK 1IW7A 1TWCC 4MEXA 2O5IA 1BDFA 5IP9C 3S1QK 4A3DC 3H3VD 3M3YK 4XLNA 4NOIA 3PO2K 5FJ8K 1HQMA 5C44C 2R92C 4LJZA 2NVQC 4AYBL 2NVTC 2Y0SL 4Y7NK 3PO3K 4BBRC 4QJVB 4YG2A 2YU9K 4YFXA 4G7OA 1TWCK 4A3KC 3S17C 4MEYA 4A3JC 4QIWD 4MQ9A 5M3FK 1TWGC 3S14C 2B63C 2R7ZC 3FKIK 1K83K 3K7AC 5C44K 2R92K 1Y1VC 2JA7K 2NVTK 3I4MK 4A3BK 2WAQD 4Q4ZA 4BBSC 2VUMK 3RZDK 4X6AC 3H0GC 3HOYC 3S2HK 2WB1D 3GTOK 3M4OK 4A3GC 2PA8D 4A3KK 1I3QK 4A3FC 1I6VA 2E2HK 5C4JC 2A68A 4LLGA 2NVXK 4XLPA 4BY1C 4A93K 1WCMC 3HOUC 3DXJA 1I50K 3I4NK 2JA8C 1I6HC 4ZH4A 1SFOC 4A3MK 3HOVC 3H0GK 5IYBC 1TWAC 3S1RK 3HOZK 2R93C 2BE5A 2JA5K 4OIQA 4KN4A 4GZYA 3S15K 3CQZK 1SMYA 1TWHC 2A6HA 5IP9K 4A3DK 2E2IC 5M5YK 3S1NC 4C2MK 4AYBD 2Y0SD 4XSZA 4BY7C 4LK1A 3RZOC 4C3HK 1ZYRA 5TMFA 5IP7C 2NVQK 5IYDC 4BBRK 3GTQC 4A3LC 5C4XC 2PMZL 1R9TC 1TWFC 3I4MC 5IYCC 3GTJC 3S17K 4OIPA 1Y1WC 2E2IK 4A3JK 3GTMC 2O5JA 1TWGK 4C3IK 4LK0A 2B63K 3GTLC 2R7ZK 4OIOA 3S14K 3WODA 3K7AK 3RZOK 1Y1VK 5C3EC 3HKZL 3S16C 4BBSK 4A3EC 3GTKC 4OIRA 5C4XK 2JA6C 4A3LK 3S2DC 3HOYK 4X6AK 4A3GK 2NVYC 4G7HA 5FLMC 4A3FK 4BY1K 3GTPC 5C4JK 4Y52C 3HOXC 1YNNA 4A3CC 3S1QC 1WCMK 3HOUK 5TMCA 3M3YC 1XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 K;  2CW0 A;  5C3E K;  1I6H K;  3PO2 C;  1SFO K;  3HOV K;  5IYB K;  1TWA K;  2R93 K;  3PO3 C;  4C3J K;  3GTG C;  4BXX C;  3HOW C;  4G7Z A;  3HOW K;  1TWH K;  3S1N K;  3FKI C;  1K83 C;  4QIW L;  4YFN A;  4A3I C;  4BY7 K;  2JA7 C;  4Q5S A;  2PMZ D;  4A3B C;  5IP7 K;  2VUM C;  3RZD C;  3S2H C;  3M4O C;  3GTO C;  3GTQ K;  3GTG K;  4YFK A;  4BXX K;  5IYD K;  1I3Q C;  2WAQ L;  1TWF K;  4JK1 A;  1R9T K;  2E2H C;  5IYC K;  3GTJ K;  2E2J C;  2NVX C;  2WB1 L;  1Y1W K;  1YNJ A;  3GTM K;  2PA8 L;  4KMU A;  3S1M C;  2PPB A;  4A93 C;  3HKZ D;  5M5X K;  3GTL K;  1I50 C;  3I4N C;  5D4D A;  4A3I K;  4OIN A;  2A69 A;  5M3M K;  5M5W K;  4A3M C;  3S16 K;  3H3V L;  4A3E K;  4KN7 A;  3GTK K;  3EQL A;  3S1R C;  2JA6 K;  3HOZ C;  3S2D K;  2JA5 C;  2NVY K;  2A6E A;  4QJV A;  5FLM K;  4Y7N C;  2E2J K;  3CQZ C;  3S15 C;  3GTP K;  3HOX K;  2YU9 C;  4XSX A;  3S1M K;  4Y52 K;  4A3C K;  1IW7 A;  1TWC C;  4MEX A;  2O5I A;  1BDF A;  5IP9 C;  3S1Q K;  4A3D C;  3H3V D;  3M3Y K;  4XLN A;  4NOI A;  3PO2 K;  5FJ8 K;  1HQM A;  5C44 C;  2R92 C;  4LJZ A;  2NVQ C;  4AYB L;  2NVT C;  2Y0S L;  4Y7N K;  3PO3 K;  4BBR C;  4QJV B;  4YG2 A;  2YU9 K;  4YFX A;  4G7O A;  1TWC K;  4A3K C;  3S17 C;  4MEY A;  4A3J C;  4QIW D;  4MQ9 A;  5M3F K;  1TWG C;  3S14 C;  2B63 C;  2R7Z C;  3FKI K;  1K83 K;  3K7A C;  5C44 K;  2R92 K;  1Y1V C;  2JA7 K;  2NVT K;  3I4M K;  4A3B K;  2WAQ D;  4Q4Z A;  4BBS C;  2VUM K;  3RZD K;  4X6A C;  3H0G C;  3HOY C;  3S2H K;  2WB1 D;  3GTO K;  3M4O K;  4A3G C;  2PA8 D;  4A3K K;  1I3Q K;  4A3F C;  1I6V A;  2E2H K;  5C4J C;  2A68 A;  4LLG A;  2NVX K;  4XLP A;  4BY1 C;  4A93 K;  1WCM C;  3HOU C;  3DXJ A;  1I50 K;  3I4N K;  2JA8 C;  1I6H C;  4ZH4 A;  1SFO C;  4A3M K;  3HOV C;  3H0G K;  5IYB C;  1TWA C;  3S1R K;  3HOZ K;  2R93 C;  2BE5 A;  2JA5 K;  4OIQ A;  4KN4 A;  4GZY A;  3S15 K;  3CQZ K;  1SMY A;  1TWH C;  2A6H A;  5IP9 K;  4A3D K;  2E2I C;  5M5Y K;  3S1N C;  4C2M K;  4AYB D;  2Y0S D;  4XSZ A;  4BY7 C;  4LK1 A;  3RZO C;  4C3H K;  1ZYR A;  5TMF A;  5IP7 C;  2NVQ K;  5IYD C;  4BBR K;  3GTQ C;  4A3L C;  5C4X C;  2PMZ L;  1R9T C;  1TWF C;  3I4M C;  5IYC C;  3GTJ C;  3S17 K;  4OIP A;  1Y1W C;  2E2I K;  4A3J K;  3GTM C;  2O5J A;  1TWG K;  4C3I K;  4LK0 A;  2B63 K;  3GTL C;  2R7Z K;  4OIO A;  3S14 K;  3WOD A;  3K7A K;  3RZO K;  1Y1V K;  5C3E C;  3HKZ L;  3S16 C;  4BBS K;  4A3E C;  3GTK C;  4OIR A;  5C4X K;  2JA6 C;  4A3L K;  3S2D C;  3HOY K;  4X6A K;  4A3G K;  2NVY C;  4G7H A;  5FLM C;  4A3F K;  4BY1 K;  3GTP C;  5C4J K;  4Y52 C;  3HOX C;  1YNN A;  4A3C C;  3S1Q C;  1WCM K;  3HOU K;  5TMC A;  3M3Y C;  1XPP A; 
#chains in the Genus database with same CATH topology
 2JA8 K;  2CW0 A;  4PAB A;  5C3E K;  3PO3 C;  3S1N K;  4O2D A;  4Q5S A;  2PMZ D;  1XXA A;  3Q3Q A;  5IYD K;  3GTQ K;  4KB4 A;  3A8K A;  2GAH C;  2WAQ L;  4JK1 A;  1R9T K;  3GEI A;  3I4M K;  5IYC K;  3GTJ K;  1Y1W K;  1YNJ A;  2PA8 L;  4KMU A;  4AH6 A;  3S1M C;  1Y1W A;  3HKZ D;  2A69 A;  5M3M K;  1VRQ C;  5IOR A;  3EQL A;  3G4A A;  1WSR A;  2NVY K;  2E2J K;  2NVY A;  3CQZ C;  3GTP K;  1DCP A;  3GTP A;  1WQH A;  2PHC B;  2O5I A;  4XLN A;  4C2M C;  3PO2 K;  4C3H C;  5C44 C;  1F93 A;  2NVQ C;  2Y0S L;  4Y7N K;  4BBR C;  3L4K A;  2YU9 K;  4YFX A;  4G7O A;  1TWC K;  4A3K C;  3GTG A;  1B4A A;  3T00 A;  3N0B A;  4MQ9 A;  1TWG C;  1BJT A;  2B63 C;  3CAG A;  1XXC A;  1Y1V C;  2JA7 K;  2JA7 A;  1VJE A;  4BLA A;  3M4O K;  3GTO K;  1WQF A;  3GTO A;  1I3Q K;  1I6V A;  5JVO A;  5C4J C;  4A93 K;  1O2B A;  1WCM C;  3GSI A;  3I4N K;  5IOT A;  3GDZ A;  1J6W A;  3QX3 A;  1XZQ A;  3HOV C;  2R93 C;  1TWA C;  2BE5 A;  2P8T A;  2JA5 K;  2JA5 A;  3S15 K;  4DDQ A;  5IP9 K;  2CFA A;  1F9N A;  5M5Y K;  1WSV A;  2GAG C;  4XSZ A;  1ZYR A;  5IP7 C;  1F7V A;  1XXB A;  2PMZ L;  4WIL A;  5EGE A;  2E2I K;  4C3I K;  5IOS A;  4PAA A;  3AQP A;  3HKZ L;  4BKW A;  4A3E C;  3S2D C;  2JA6 C;  1USM A;  1EK8 A;  3H0G A;  1JOE A;  4WJ4 A;  4A3F K;  4Y52 C;  1X31 C;  1WOR A;  3HOW C;  2W7V A;  5CHP A;  3GIR A;  1SFO K;  4KC6 A;  3OPF A;  5IYB K;  3N3Y A;  4RMF A;  4C3J K;  4GTD A;  5HL8 A;  4G7Z A;  3HXA A;  3FHZ A;  2EBB A;  3FKI C;  4A3I C;  4BY7 K;  1PJ6 A;  4A3B C;  5EGH A;  3RZD C;  4WJ3 M;  5M5X K;  3GTL K;  3GTL A;  2GSU A;  5M5W K;  4M1X A;  3S16 K;  3H3V L;  4KN7 A;  3GTK K;  3S1R C;  4KMD A;  3GTK A;  2A6E A;  3G4C A;  5FLM K;  1BGW A;  1G51 A;  3HOX K;  3S1M K;  3MML B;  1IS1 A;  1IW7 A;  1BDF A;  1YCL A;  2JH3 A;  1HQM A;  2R92 C;  5TJ3 A;  2NVT C;  1WIH A;  4QJV B;  1IQ0 A;  4YG2 A;  1V5V A;  1VH2 A;  3GTQ A;  3ADA C;  4MEY A;  5E68 A;  1R9T A;  1O2F B;  3GTJ A;  2R7Z C;  1K83 K;  1K83 A;  5C44 K;  1ZBS A;  4Q4Z A;  4GTA A;  2VUM K;  1O26 A;  3HOY C;  3S2H K;  2WB1 D;  2VUM A;  4A3K K;  4P5A A;  2E2H K;  5JFE A;  2NVX K;  3HOU C;  3DXJ A;  1I50 K;  5IOQ A;  2JA8 C;  1I50 A;  4ZH4 A;  4A3M K;  3HOZ K;  4OIQ A;  4LR2 A;  4P5B A;  1L0W A;  1O28 A;  1SMY A;  2YU9 A;  2Y3P A;  4A3D K;  1TWC A;  3BUE A;  3S1N C;  1INN A;  1EFW A;  3AD8 C;  3RZO C;  3AD7 C;  5IYD C;  3GTQ C;  4A3L C;  5C4X C;  1EQR A;  1R9T C;  2V6S A;  3I4M C;  5IYC C;  3GTJ C;  3S17 K;  3T02 A;  4C45 A;  1O27 A;  1I3Q A;  4A3J K;  1Y1W C;  3LPX A;  2O5J A;  2GSO A;  3S14 K;  4OIO A;  3K7A K;  4BBS K;  4OIR A;  2ZFZ A;  4X6A K;  4KAT A;  2RH6 A;  4A3G K;  2NVY C;  4G7H A;  4BY1 K;  3GTP C;  3LAJ A;  1I6H K;  3PO2 C;  5L46 A;  3GTG C;  4BXX C;  1WQG A;  3HOW K;  1TWH K;  4GTB A;  1TWH A;  1DCO A;  2E2I A;  2JA7 C;  2V6T A;  1F7U A;  1UV7 A;  3GTO C;  1USO A;  3M4O C;  4YFK A;  1I3Q C;  1TWF K;  1TWF A;  2WB1 L;  3GTM K;  3GTM A;  4A93 C;  3I4N C;  2GSN A;  5D4D A;  4A3I K;  3L4J A;  4KB2 A;  1VGX A;  4GT9 A;  3BP3 A;  1IE0 A;  1SFO A;  3GEH A;  3NUH A;  2JA5 C;  1BS2 A;  4QJV A;  2P5M A;  3S15 C;  1WOO A;  1EI6 A;  4XSX A;  4A3C K;  4MEX A;  5IP9 C;  3S1Q K;  3M3Y K;  4LJZ A;  3PO3 K;  1DCH A;  4QIW D;  2ZUE A;  1GE9 A;  1PJ5 A;  4C3I C;  3T01 A;  2R92 K;  1PJ7 A;  2NVT K;  1ZVU A;  1XZP B;  3H0G C;  4GTC A;  4A3F C;  3HOU K;  2A68 A;  1WOP A;  1J6V A;  3SZZ A;  1SFO C;  4KAS A;  3LAP A;  5IYB C;  2FQO A;  4KN4 A;  4C3J C;  4BLB A;  3CQZ K;  4J3N A;  3CQZ A;  4LOW A;  3AQO A;  3AH5 A;  4C2M K;  3JST A;  1EH1 A;  4AYB D;  4BY7 C;  4LK1 A;  4C3H K;  5TMF A;  2RGR A;  1O25 A;  2NVQ K;  4BBR K;  1B4B A;  1J98 A;  4OIP A;  4P9S A;  2E2H A;  2NVX A;  1TWG K;  3GTL C;  4LK0 A;  2B63 K;  1TWG A;  2B63 A;  3RZO K;  1JQW A;  1Y1V K;  5C3E C;  1Y1V A;  3S16 C;  3GTK C;  5C4X K;  4A3L K;  3VA7 A;  5FLM C;  2XCR B;  2XCQ A;  5C4J K;  3HOX C;  1YNN A;  1WCM K;  5TMC A;  1WCM A;  1XPP A;  3HOV K;  3FOF A;  2R93 K;  1TWA K;  2R93 A;  1TWA A;  4ILD A;  2FQT A;  4LQY A;  4KM9 A;  4G0V A;  1O2A A;  3TFI A;  1K83 C;  4QIW L;  4YFN A;  3A8J A;  1VLO A;  5IP7 K;  4GTE A;  2VUM C;  3SZY A;  3S2H C;  3GTG K;  4BXX K;  2E2H C;  2E2J C;  2NVX C;  1YX2 A;  4KMA A;  2PPB A;  1AB4 A;  1I50 C;  1C0A A;  4OIN A;  4FZB A;  1IL2 A;  4A3M C;  3ERE D;  2D6F C;  4A3E K;  3S2D K;  3HOZ C;  2JA6 K;  2ZUF A;  2JA6 A;  3FOE A;  3N0C A;  4Y7N C;  2YU9 C;  4Y52 K;  1J6X A;  1TWC C;  4A3D C;  3A8I A;  3H3V D;  2V6U A;  4NOI A;  3OEP A;  3TTG A;  5FJ8 K;  4KMH A;  1ISE A;  4AYB L;  1RU0 A;  1XZP A;  3AD9 C;  4XCH A;  3S17 C;  1HI9 A;  4A3J C;  4GTL A;  3S14 C;  3FKI K;  3FKI A;  3K7A C;  4KM8 A;  4A3B K;  4BBS C;  2WAQ D;  1IBA A;  3RZD K;  4X6A C;  4A3G C;  5CJ9 A;  2PA8 D;  4BY1 C;  4LLG A;  4XLP A;  1ZXO A;  4G0W A;  1KQ4 A;  1O24 A;  1I6H C;  1WOS A;  3H0G K;  4KAW X;  3S1R K;  4GTF A;  4GZY A;  3TFJ A;  4KAR A;  1TWH C;  2A6H A;  2E2I C;  4KDD A;  4FM9 A;  2Y0S D;  1ZQ1 C;  2KWA A;  1XZQ B;  1O29 A;  2R92 A;  3V4G A;  1TWF C;  3GTM C;  2CFA B;  1DD5 A;  2R7Z K;  2R7Z A;  3WOD A;  3BP8 C;  3TFH A;  3GEE A;  3S0X A;  3HOY K;  1JVI A;  3IPJ A;  3ORE A;  4G0U A;  2XCO A;  4A3C C;  3S1Q C;  4GFQ A;  3M3Y C;  5M3F K; 
#chains in the Genus database with same CATH homology
 2JA8 K;  2CW0 A;  5C3E K;  1I6H K;  3PO2 C;  1SFO K;  3HOV K;  5IYB K;  1TWA K;  2R93 K;  3PO3 C;  4C3J K;  3GTG C;  4BXX C;  3HOW C;  4G7Z A;  3HOW K;  1TWH K;  3S1N K;  3FKI C;  1K83 C;  4QIW L;  4YFN A;  4A3I C;  4BY7 K;  2JA7 C;  4Q5S A;  2PMZ D;  4A3B C;  5IP7 K;  2VUM C;  3RZD C;  3S2H C;  3M4O C;  3GTO C;  3GTQ K;  3GTG K;  4YFK A;  4BXX K;  5IYD K;  1I3Q C;  2WAQ L;  1TWF K;  4JK1 A;  1R9T K;  2E2H C;  5IYC K;  3GTJ K;  2E2J C;  2NVX C;  2WB1 L;  1Y1W K;  1YNJ A;  3GTM K;  2PA8 L;  4KMU A;  3S1M C;  2PPB A;  4A93 C;  3HKZ D;  5M5X K;  3GTL K;  1I50 C;  3I4N C;  5D4D A;  4A3I K;  4OIN A;  2A69 A;  5M3M K;  5M5W K;  4A3M C;  3S16 K;  3H3V L;  4A3E K;  4KN7 A;  3GTK K;  3EQL A;  3S1R C;  2JA6 K;  3HOZ C;  3S2D K;  2JA5 C;  2NVY K;  2A6E A;  4QJV A;  5FLM K;  4Y7N C;  2E2J K;  3CQZ C;  3S15 C;  3GTP K;  3HOX K;  2YU9 C;  4XSX A;  3S1M K;  4Y52 K;  4A3C K;  1IW7 A;  1TWC C;  4MEX A;  2O5I A;  1BDF A;  5IP9 C;  3S1Q K;  4A3D C;  3H3V D;  3M3Y K;  4XLN A;  4NOI A;  3PO2 K;  5FJ8 K;  1HQM A;  5C44 C;  2R92 C;  4LJZ A;  2NVQ C;  4AYB L;  2NVT C;  2Y0S L;  4Y7N K;  3PO3 K;  4BBR C;  4QJV B;  4YG2 A;  2YU9 K;  4YFX A;  4G7O A;  1TWC K;  4A3K C;  3S17 C;  4MEY A;  4A3J C;  4QIW D;  4MQ9 A;  5M3F K;  1TWG C;  3S14 C;  2B63 C;  2R7Z C;  3FKI K;  1K83 K;  3K7A C;  5C44 K;  2R92 K;  1Y1V C;  2JA7 K;  2NVT K;  3I4M K;  4A3B K;  2WAQ D;  4Q4Z A;  4BBS C;  2VUM K;  3RZD K;  4X6A C;  3H0G C;  3HOY C;  3S2H K;  2WB1 D;  3GTO K;  3M4O K;  4A3G C;  2PA8 D;  4A3K K;  1I3Q K;  4A3F C;  1I6V A;  2E2H K;  5C4J C;  2A68 A;  4LLG A;  2NVX K;  4XLP A;  4BY1 C;  4A93 K;  1WCM C;  3HOU C;  3DXJ A;  1I50 K;  3I4N K;  2JA8 C;  1I6H C;  4ZH4 A;  1SFO C;  4A3M K;  3HOV C;  3H0G K;  5IYB C;  1TWA C;  3S1R K;  3HOZ K;  2R93 C;  2BE5 A;  2JA5 K;  4OIQ A;  4KN4 A;  4GZY A;  3S15 K;  3CQZ K;  1SMY A;  1TWH C;  2A6H A;  5IP9 K;  4A3D K;  2E2I C;  5M5Y K;  3S1N C;  4C2M K;  4AYB D;  2Y0S D;  4XSZ A;  4BY7 C;  4LK1 A;  3RZO C;  4C3H K;  1ZYR A;  5TMF A;  5IP7 C;  2NVQ K;  5IYD C;  4BBR K;  3GTQ C;  4A3L C;  5C4X C;  2PMZ L;  1R9T C;  1TWF C;  3I4M C;  5IYC C;  3GTJ C;  3S17 K;  4OIP A;  1Y1W C;  2E2I K;  4A3J K;  3GTM C;  2O5J A;  1TWG K;  4C3I K;  4LK0 A;  2B63 K;  3GTL C;  2R7Z K;  4OIO A;  3S14 K;  3WOD A;  3K7A K;  3RZO K;  1Y1V K;  5C3E C;  3HKZ L;  3S16 C;  4BBS K;  4A3E C;  3GTK C;  4OIR A;  5C4X K;  2JA6 C;  4A3L K;  3S2D C;  3HOY K;  4X6A K;  4A3G K;  2NVY C;  4G7H A;  5FLM C;  4A3F K;  4BY1 K;  3GTP C;  5C4J K;  4Y52 C;  3HOX C;  1YNN A;  4A3C C;  3S1Q C;  1WCM K;  3HOU K;  5TMC A;  3M3Y C;  1XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...