2V6TA

Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
b'ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 29
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6tA00
4C45A 1RU0A 2V6UA 1F93A 2V6SA 1USMA 3HXAA 3JSTA 2V6TA 4WILA 1DCOA 4LOWA 1DCHA 1USOA 2EBBA 1DCPA
chains in the Genus database with same CATH superfamily
4GTBA 3S1RC 2KWAA 4A3KC 3FOFA 2Y0SL 5IYBC 2W7VA 5CJ9A 2NVTK 4G7OA 2JA7A 3L4JA 2EBBA 1IS1A 2GSOA 4Q5SA 1I6VA 3AD9C 1I6HC 3GDZA 1F7VA 1VH2A 3N3YA 2NVYA 1I50A 3GTKC 1Y1VK 4P5BA 4KMDA 1TWFC 3HOWK 4MQ9A 4KDDA 4A3LK 1ISEA 3S17C 1Y1WC 2JA8C 2O5JA 5M3MK 3I4MC 4BBRC 4KM8A 1WORA 2JA7K 2E2HC 2CFAB 4KN7A 1JQWA 3TFIA 1INNA 4WJ4A 4KC6A 1WCMK 1TWHK 2NVYK 3LPXA 1I50K 3GEHA 4PABA 3S1QC 3EQLA 1XPPA 1F93A 3FKIA 4GTDA 1I3QA 2ZUFA 2Y0SD 2R7ZA 3GTQC 3T01A 1PJ6A 3IPJA 4A3EC 1KQ4A 5C44C 2NVQK 1EH1A 1EK8A 1WQHA 5IP9K 4BLBA 5M5WK 1O2AA 4BY1C 3TTGA 1PJ7A 3S16K 4KARA 3K7AK 1WOOA 1USMA 4C3HK 3T00A 2VUMA 1R9TA 3I4NK 4LR2A 3G4CA 1TWAC 1O2BA 1G51A 4O2DA 1I3QK 3HOUK 2R93A 1WOPA 4J3NA 1TWCC 4C3IK 3CQZA 2E2JC 4A3IK 4XCHA 1TWGK 3NUHA 4GTLA 3HOZC 3GTMC 5FLMC 4AH6A 1RU0A 3M3YC 5IORA 2P8TA 3TFJA 2A6EA 3M4OC 3H3VL 2VUMK 1R9TK 4A3JC 2BE5A 4FZBA 3HOXC 5IP7C 3S14C 1O27A 3HOVC 4LK1A 3S1NK 1B4AA 3GTKA 2R93C 3S15K 1WQFA 4X6AK 4YG2A 4C2MC 1VGXA 1O29A 3CQZC 5C4JK 1TWFA 4GTFA 3V4GA 3SZYA 4A3DK 1O25A 1YNNA 3S1RK 1WSRA 3S1MC 2B63C 1Y1WA 4A3KK 1WQGA 5IYBK 3BP8C 4OIQA 4XSXA 2R92C 5E68A 2E2HA 2V6UA 3MMLB 1F7UA 3FHZA 1B4BA 1SFOA 2GSUA 5D4DA 3GTLK 1EI6A 4A3GC 3BUEA 3H0GC 4BXXC 3GTPC 2WAQL 2E2IC 4GFQA 2XCRB 4P9SA 3GTKK 5FJ8K 5M3FK 2FQOA 1TWFK 1K83C 1V5VA 3H3VD 4Y7NK 3GTQA 3S17K 1Y1WK 4KM9A 2XCQA 5C4XC 3I4MK 4BBRK 1IBAA 4A3BC 1XZPA 3HKZL 5IOQA 2E2HK 1O28A 1XXCA 2JA5A 3ERED 1C0AA 4WJ3M 1J6VA 1HQMA 1VRQC 3N0BA 1EFWA 3GSIA 1GE9A 1SFOC 3HXAA 3OEPA 3S1QK 1TWAA 4WILA 2PHCB 3AH5A 3RZDC 4A3CC 1O24A 5HL8A 1Y1VC 1TWCA 3GTQK 5L46A 4A3EK 5C44K 5C3EC 4LLGA 4A3LC 5IOTA 4QJVA 3GTMA 4BY1K 4A3MC 4Y52C 2D6FC 2WAQD 4A3FC 4BLAA 4M1XA 1IL2A 1ZYRA 2JA5C 5IYCC 1WSVA 3PO3C 3T02A 1DD5A 1TWAK 3TFHA 1JOEA 1WCMC 3A8IA 1XXBA 4GTCA 4P5AA 4AYBL 2P5MA 4MEXA 3FKIK 5EGHA 3HKZD 1O2FB 2E2JK 4FM9A 4KASA 2R7ZK 5TMCA 3GTGC 3HOZK 3S2DC 3GTMK 5FLMK 3RZOC 3VA7A 3M4OK 1ZVUA 2B63A 3A8KA 2ZFZA 2RH6A 1ZXOA 2FQTA 4A3JK 3ADAC 4LOWA 3S16C 2R92A 4YFKA 2JA6C 1VLOA 3HOXK 5M5XK 1ZQ1C 3GTOC 5IYDC 3S14K 1O26A 3GTJC 3HOVK 3H0GA 3GTPA 4C3JC 2E2IA 2R93K 2A6HA 4C2MK 3CQZK 4C3IC 4BY7C 4G7HA 3A8JA 4XLPA 1K83A 5TJ3A 1TWGC 3Q3QA 3L4KA 1SMYA 3S1MK 1ZBSA 4G0WA 4OIPA 1YCLA 1USOA 4C45A 2R92K 4GTAA 4AYBD 2NVXC 3AD8C 3GIRA 4KMHA 2PMZL 5M5YK 1XZQA 4A3GK 3H0GK 4BXXK 1DCOA 2E2IK 1I6HK 2A68A 4LJZA 1UV7A 4GZYA 3LAPA 3HOYC 3OPFA 1Y1VA 4PAAA 4BBSC 1HI9A 4KMAA 1XZPB 3S2HC 4OINA 1WOSA 5C4XK 4A93C 2O5IA 2GSNA 4A3BK 2YU9C 3PO2C 2JA8K 4G0UA 3OREA 3LAJA 2CW0A 1IE0A 1YNJA 1PJ5A 4YFXA 1SFOK 3GTLC 2NVTC 1AB4A 1WCMA 4KMUA 5JVOA 4QIWL 1TWHA 4G0VA 2V6SA 3RZDK 4A3CK 1BGWA 1J6WA 3GEIA 1DCHA 4KB4A 4QJVB 4XLNA 4Y7NC 2PMZD 5C3EK 3G4AA 3GTGA 3AD7C 4KN4A 4KB2A 4A3MK 3HOWC 4Y52K 1IW7A 4A3FK 1WIHA 2JA5K 4KAWX 5IYCK 3PO3K 1J98A 2JA7C 4ZH4A 3BP3A 1VJEA 1L0WA 2JA6A 3GTOA 4NOIA 3JSTA 2CFAA 3GTJA 1YX2A 1TWHC 2NVYC 3S0XA 1I50C 2V6TA 3WODA 1TWCK 3CAGA 3GTGK 3S2DK 2WB1L 2A69A 5IOSA 1TWGA 3RZOK 4Q4ZA 2PA8L 3SZZA 2GAHC 4QIWD 3M3YK 2NVQC 3DXJA 2NVXA 5IP9C 2JA6K 4ILDA 3FOEA 4G7ZA 3QX3A 3GTOK 1IQ0A 2GAGC 5IYDK 1X31C 3K7AC 3GTJK 4C3HC 4C3JK 3I4NC 5IP7K 2Y3PA 3FKIC 4YFNA 1I3QC 4BY7K 4MEYA 3HOUC 4LK0A 1BS2A 2R7ZC 4BKWA 4KATA 5JFEA 3N0CA 4A3IC 1F9NA 5EGEA 2YU9A 4GT9A 2B63K 2NVXK 4LQYA 1XZQB 5TMFA 1EQRA 2XCOA 1JVIA 2VUMC 1R9TC 2ZUEA 2WB1D 3GTLA 3AQOA 1J6XA 3GEEA 3GTPK 2PA8D 4OIRA 3HOYK 1BDFA 3AQPA 5CHPA 4DDQA 2PPBA 4GTEA 4BBSK 3S2HK 2RGRA 2JH3A 3S1NC 1DCPA 1K83K 4A93K 1XXAA 4RMFA 4OIOA 3S15C 4X6AC 1BJTA 2YU9K 3PO2K 4XSZA 5C4JC 4A3DC 4JK1A
chains in the Genus database with same CATH topology
4C45A 1RU0A 2V6UA 1F93A 2V6SA 1USMA 3HXAA 3JSTA 2V6TA 4WILA 1DCOA 4LOWA 1DCHA 1USOA 2EBBA 1DCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C45 A;  1RU0 A;  2V6U A;  1F93 A;  2V6S A;  1USM A;  3HXA A;  3JST A;  2V6T A;  4WIL A;  1DCO A;  4LOW A;  1DCH A;  1USO A;  2EBB A;  1DCP A; 
#chains in the Genus database with same CATH topology
 4GTB A;  3S1R C;  2KWA A;  4A3K C;  3FOF A;  2Y0S L;  5IYB C;  2W7V A;  5CJ9 A;  2NVT K;  4G7O A;  2JA7 A;  3L4J A;  2EBB A;  1IS1 A;  2GSO A;  4Q5S A;  1I6V A;  3AD9 C;  1I6H C;  3GDZ A;  1F7V A;  1VH2 A;  3N3Y A;  2NVY A;  1I50 A;  3GTK C;  1Y1V K;  4P5B A;  4KMD A;  1TWF C;  3HOW K;  4MQ9 A;  4KDD A;  4A3L K;  1ISE A;  3S17 C;  1Y1W C;  2JA8 C;  2O5J A;  5M3M K;  3I4M C;  4BBR C;  4KM8 A;  1WOR A;  2JA7 K;  2E2H C;  2CFA B;  4KN7 A;  1JQW A;  3TFI A;  1INN A;  4WJ4 A;  4KC6 A;  1WCM K;  1TWH K;  2NVY K;  3LPX A;  1I50 K;  3GEH A;  4PAB A;  3S1Q C;  3EQL A;  1XPP A;  1F93 A;  3FKI A;  4GTD A;  1I3Q A;  2ZUF A;  2Y0S D;  2R7Z A;  3GTQ C;  3T01 A;  1PJ6 A;  3IPJ A;  4A3E C;  1KQ4 A;  5C44 C;  2NVQ K;  1EH1 A;  1EK8 A;  1WQH A;  5IP9 K;  4BLB A;  5M5W K;  1O2A A;  4BY1 C;  3TTG A;  1PJ7 A;  3S16 K;  4KAR A;  3K7A K;  1WOO A;  1USM A;  4C3H K;  3T00 A;  2VUM A;  1R9T A;  3I4N K;  4LR2 A;  3G4C A;  1TWA C;  1O2B A;  1G51 A;  4O2D A;  1I3Q K;  3HOU K;  2R93 A;  1WOP A;  4J3N A;  1TWC C;  4C3I K;  3CQZ A;  2E2J C;  4A3I K;  4XCH A;  1TWG K;  3NUH A;  4GTL A;  3HOZ C;  3GTM C;  5FLM C;  4AH6 A;  1RU0 A;  3M3Y C;  5IOR A;  2P8T A;  3TFJ A;  2A6E A;  3M4O C;  3H3V L;  2VUM K;  1R9T K;  4A3J C;  2BE5 A;  4FZB A;  3HOX C;  5IP7 C;  3S14 C;  1O27 A;  3HOV C;  4LK1 A;  3S1N K;  1B4A A;  3GTK A;  2R93 C;  3S15 K;  1WQF A;  4X6A K;  4YG2 A;  4C2M C;  1VGX A;  1O29 A;  3CQZ C;  5C4J K;  1TWF A;  4GTF A;  3V4G A;  3SZY A;  4A3D K;  1O25 A;  1YNN A;  3S1R K;  1WSR A;  3S1M C;  2B63 C;  1Y1W A;  4A3K K;  1WQG A;  5IYB K;  3BP8 C;  4OIQ A;  4XSX A;  2R92 C;  5E68 A;  2E2H A;  2V6U A;  3MML B;  1F7U A;  3FHZ A;  1B4B A;  1SFO A;  2GSU A;  5D4D A;  3GTL K;  1EI6 A;  4A3G C;  3BUE A;  3H0G C;  4BXX C;  3GTP C;  2WAQ L;  2E2I C;  4GFQ A;  2XCR B;  4P9S A;  3GTK K;  5FJ8 K;  5M3F K;  2FQO A;  1TWF K;  1K83 C;  1V5V A;  3H3V D;  4Y7N K;  3GTQ A;  3S17 K;  1Y1W K;  4KM9 A;  2XCQ A;  5C4X C;  3I4M K;  4BBR K;  1IBA A;  4A3B C;  1XZP A;  3HKZ L;  5IOQ A;  2E2H K;  1O28 A;  1XXC A;  2JA5 A;  3ERE D;  1C0A A;  4WJ3 M;  1J6V A;  1HQM A;  1VRQ C;  3N0B A;  1EFW A;  3GSI A;  1GE9 A;  1SFO C;  3HXA A;  3OEP A;  3S1Q K;  1TWA A;  4WIL A;  2PHC B;  3AH5 A;  3RZD C;  4A3C C;  1O24 A;  5HL8 A;  1Y1V C;  1TWC A;  3GTQ K;  5L46 A;  4A3E K;  5C44 K;  5C3E C;  4LLG A;  4A3L C;  5IOT A;  4QJV A;  3GTM A;  4BY1 K;  4A3M C;  4Y52 C;  2D6F C;  2WAQ D;  4A3F C;  4BLA A;  4M1X A;  1IL2 A;  1ZYR A;  2JA5 C;  5IYC C;  1WSV A;  3PO3 C;  3T02 A;  1DD5 A;  1TWA K;  3TFH A;  1JOE A;  1WCM C;  3A8I A;  1XXB A;  4GTC A;  4P5A A;  4AYB L;  2P5M A;  4MEX A;  3FKI K;  5EGH A;  3HKZ D;  1O2F B;  2E2J K;  4FM9 A;  4KAS A;  2R7Z K;  5TMC A;  3GTG C;  3HOZ K;  3S2D C;  3GTM K;  5FLM K;  3RZO C;  3VA7 A;  3M4O K;  1ZVU A;  2B63 A;  3A8K A;  2ZFZ A;  2RH6 A;  1ZXO A;  2FQT A;  4A3J K;  3ADA C;  4LOW A;  3S16 C;  2R92 A;  4YFK A;  2JA6 C;  1VLO A;  3HOX K;  5M5X K;  1ZQ1 C;  3GTO C;  5IYD C;  3S14 K;  1O26 A;  3GTJ C;  3HOV K;  3H0G A;  3GTP A;  4C3J C;  2E2I A;  2R93 K;  2A6H A;  4C2M K;  3CQZ K;  4C3I C;  4BY7 C;  4G7H A;  3A8J A;  4XLP A;  1K83 A;  5TJ3 A;  1TWG C;  3Q3Q A;  3L4K A;  1SMY A;  3S1M K;  1ZBS A;  4G0W A;  4OIP A;  1YCL A;  1USO A;  4C45 A;  2R92 K;  4GTA A;  4AYB D;  2NVX C;  3AD8 C;  3GIR A;  4KMH A;  2PMZ L;  5M5Y K;  1XZQ A;  4A3G K;  3H0G K;  4BXX K;  1DCO A;  2E2I K;  1I6H K;  2A68 A;  4LJZ A;  1UV7 A;  4GZY A;  3LAP A;  3HOY C;  3OPF A;  1Y1V A;  4PAA A;  4BBS C;  1HI9 A;  4KMA A;  1XZP B;  3S2H C;  4OIN A;  1WOS A;  5C4X K;  4A93 C;  2O5I A;  2GSN A;  4A3B K;  2YU9 C;  3PO2 C;  2JA8 K;  4G0U A;  3ORE A;  3LAJ A;  2CW0 A;  1IE0 A;  1YNJ A;  1PJ5 A;  4YFX A;  1SFO K;  3GTL C;  2NVT C;  1AB4 A;  1WCM A;  4KMU A;  5JVO A;  4QIW L;  1TWH A;  4G0V A;  2V6S A;  3RZD K;  4A3C K;  1BGW A;  1J6W A;  3GEI A;  1DCH A;  4KB4 A;  4QJV B;  4XLN A;  4Y7N C;  2PMZ D;  5C3E K;  3G4A A;  3GTG A;  3AD7 C;  4KN4 A;  4KB2 A;  4A3M K;  3HOW C;  4Y52 K;  1IW7 A;  4A3F K;  1WIH A;  2JA5 K;  4KAW X;  5IYC K;  3PO3 K;  1J98 A;  2JA7 C;  4ZH4 A;  3BP3 A;  1VJE A;  1L0W A;  2JA6 A;  3GTO A;  4NOI A;  3JST A;  2CFA A;  3GTJ A;  1YX2 A;  1TWH C;  2NVY C;  3S0X A;  1I50 C;  2V6T A;  3WOD A;  1TWC K;  3CAG A;  3GTG K;  3S2D K;  2WB1 L;  2A69 A;  5IOS A;  1TWG A;  3RZO K;  4Q4Z A;  2PA8 L;  3SZZ A;  2GAH C;  4QIW D;  3M3Y K;  2NVQ C;  3DXJ A;  2NVX A;  5IP9 C;  2JA6 K;  4ILD A;  3FOE A;  4G7Z A;  3QX3 A;  3GTO K;  1IQ0 A;  2GAG C;  5IYD K;  1X31 C;  3K7A C;  3GTJ K;  4C3H C;  4C3J K;  3I4N C;  5IP7 K;  2Y3P A;  3FKI C;  4YFN A;  1I3Q C;  4BY7 K;  4MEY A;  3HOU C;  4LK0 A;  1BS2 A;  2R7Z C;  4BKW A;  4KAT A;  5JFE A;  3N0C A;  4A3I C;  1F9N A;  5EGE A;  2YU9 A;  4GT9 A;  2B63 K;  2NVX K;  4LQY A;  1XZQ B;  5TMF A;  1EQR A;  2XCO A;  1JVI A;  2VUM C;  1R9T C;  2ZUE A;  2WB1 D;  3GTL A;  3AQO A;  1J6X A;  3GEE A;  3GTP K;  2PA8 D;  4OIR A;  3HOY K;  1BDF A;  3AQP A;  5CHP A;  4DDQ A;  2PPB A;  4GTE A;  4BBS K;  3S2H K;  2RGR A;  2JH3 A;  3S1N C;  1DCP A;  1K83 K;  4A93 K;  1XXA A;  4RMF A;  4OIO A;  3S15 C;  4X6A C;  1BJT A;  2YU9 K;  3PO2 K;  4XSZ A;  5C4J C;  4A3D C;  4JK1 A; 
#chains in the Genus database with same CATH homology
 4C45 A;  1RU0 A;  2V6U A;  1F93 A;  2V6S A;  1USM A;  3HXA A;  3JST A;  2V6T A;  4WIL A;  1DCO A;  4LOW A;  1DCH A;  1USO A;  2EBB A;  1DCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...