2V6TA

Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 29
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6tA00
1RU0A 1DCHA 1DCOA 1F93A 1DCPA 1USOA 2V6UA 3HXAA 2V6SA 2EBBA 4LOWA 1USMA 4C45A 3JSTA 2V6TA 4WILA
chains in the Genus database with same CATH superfamily
5L46A 1O2AA 3S2DK 3H3VL 1TWFK 4BY1K 2JA8K 3HOWC 2E2JC 1O25A 1IQ0A 5IORA 4G0UA 3N3YA 4A3EC 4Y52C 3HKZD 1Y1WA 5EGHA 3GTKC 1ZYRA 2B63C 1J6XA 1HI9A 4DDQA 4BY1C 3NUHA 3OREA 4C3IK 2FQOA 5C4XK 2JA8C 3GEIA 5CHPA 1PJ6A 4BXXC 1ISEA 2YU9A 4GTDA 3M3YC 3SZZA 2XCQA 3RZOK 4A3GC 3GTGA 3CQZK 4C3HK 4C3IC 1I50C 3TFIA 1WQHA 2EBBA 1EQRA 4KM8A 2VUMA 4WILA 3GTLC 5IOSA 3AD8C 3RZOC 3G4AA 3BP3A 1TWAK 3FKIK 3CQZC 4C3HC 3GTJA 3AQOA 3FOFA 4GTBA 2GSUA 1EH1A 1VGXA 4MEYA 4C2MK 3S16K 4A3FK 1VRQC 4A3BK 3HOUC 3A8KA 5FLMC 1DCPA 3HOYK 4PABA 1AB4A 4YG2A 1TWAC 2YU9C 1Y1VK 2PA8L 1UV7A 2ZUEA 4C2MC 4A3FC 4KARA 2E2IA 2GSNA 4BBSK 4QJVB 1SFOA 4A3LK 4YFNA 1IW7A 3OEPA 4WJ4A 1Y1VC 5IP9K 2VUMC 4KMDA 3I4NK 1F7VA 3HOZK 3AD7C 2O5JA 3S1QK 1K83K 1TWGC 4G7HA 1HQMA 3WODA 1XZQA 4G0VA 2BE5A 3TFHA 5IYBK 4A3KK 4XLPA 1YCLA 5M3MK 4JK1A 3HOZC 2JA7C 4X6AC 4KMHA 4P5AA 1K83C 1TWHK 2JA5K 4LR2A 3GTPK 3GTOC 1IE0A 3IPJA 5IYBC 1JOEA 3GSIA 4A3MC 1BJTA 4YFKA 4OIPA 2NVXK 5IYCK 2V6UA 4KM9A 2E2HK 3S1MK 1YNNA 1F7UA 3GTKA 1F9NA 2B63A 1RU0A 2CFAA 1WORA 1TWFA 5C44K 1O29A 3HOXK 4GFQA 2R93K 4KAWX 3H0GC 2E2HC 5IYDC 3HOVC 2WB1L 4OIQA 2R92C 1J6VA 5HL8A 1PJ7A 3HXAA 1I50A 4G7ZA 2R93C 4KB4A 1V5VA 1DCHA 2PA8D 3S1NK 3AH5A 2JA6K 3GTLA 3RZDC 4Y7NC 3T02A 4XSXA 1I3QK 4J3NA 4YFXA 1YX2A 3AD9C 5M5WK 5C3EK 3CQZA 3GTMK 3ERED 4FZBA 2R7ZC 4AH6A 2A69A 4A3JC 3PO3K 3S15C 2FQTA 1J98A 4RMFA 3S2DC 4LLGA 4BY7K 1TWFC 1TWAA 2GSOA 1DD5A 5C3EC 3A8IA 3T01A 4MEXA 3PO3C 2KWAA 1ZBSA 1TWCK 4BLBA 3S14K 4A3IK 4BY7C 5C4XC 1EI6A 4LK1A 2V6TA 5M3FK 1Y1VA 2GAGC 1L0WA 3I4MK 1IL2A 2WAQL 2Y3PA 1TWCC 1R9TK 1TWGA 1O26A 2NVQK 5E68A 1B4AA 4PAAA 2JH3A 2P8TA 3FOEA 4KATA 2JA7A 4KN7A 3GIRA 1Y1WK 2Y0SD 5D4DA 1R9TC 4A3CK 3FKIC 1K83A 4C45A 4Q4ZA 2WB1D 3GTOA 3S16C 4KC6A 4KDDA 4BLAA 4A3BC 2ZUFA 4C3JK 1GE9A 3HOYC 1XZPA 2A6HA 1VH2A 4MQ9A 4OINA 3H3VD 1KQ4A 3N0CA 3LAPA 1JVIA 1I6HK 3H0GA 4BBSC 4A3LC 2E2HA 1WCMK 3LAJA 4A3DK 5IP9C 2R92A 4QIWL 3PO2K 3AQPA 3I4NC 1IBAA 3HKZL 2R93A 1WOSA 3S1QC 4KN4A 5IP7K 3MMLB 1WCMC 3GEHA 4LK0A 2A6EA 4A3KC 2A68A 5M5XK 4LQYA 2D6FC 2PHCB 4ZH4A 3PO2C 1XZQB 1BDFA 1EK8A 1BS2A 2R7ZA 1WQFA 1WIHA 5M5YK 2NVYK 1TWHC 3VA7A 2WAQD 3N0BA 2JA5C 3GTPC 3TTGA 3JSTA 2NVXC 5IYCC 2ZFZA 2GAHC 3S1MC 3GTQK 2NVYC 4M1XA 1INNA 1J6WA 1O2FB 5C44C 3OPFA 3HOXC 3DXJA 1IS1A 1ZXOA 1WSRA 2CFAB 2PMZL 1WOPA 3GTQC 1TWCA 1VJEA 4XCHA 3GEEA 2E2JK 3S1NC 3A8JA 2JA6C 3CAGA 4GTEA 4LJZA 1I3QC 3Q3QA 1R9TA 3FKIA 3GTKK 3S2HK 3FHZA 3GTMC 2B63K 2W7VA 4O2DA 4QIWD 4BXXK 5IOQA 3M3YK 3BP8C 4OIOA 5FJ8K 3L4KA 3S2HC 4A3GK 1O2BA 4KMUA 5IOTA 1I50K 3L4JA 4Q5SA 4P9SA 3S14C 4A3IC 1XXBA 3GTLK 4KASA 1F93A 3SZYA 5C4JK 3S0XA 3I4MC 3S17K 2CW0A 4OIRA 1PJ5A 3HOUK 1BGWA 1VLOA 5FLMK 2NVQC 1WCMA 3S1RK 4GTCA 4A93K 1DCOA 1X31C 1USMA 1G51A 5C4JC 2XCOA 2YU9K 4GZYA 4G7OA 3S17C 4QJVA 3LPXA 1Y1WC 2PMZD 4A3CC 1TWHA 2JA5A 3S1RC 3GTPA 3GTGK 4A93C 4LOWA 5JFEA 4GT9A 2P5MA 5CJ9A 4KB2A 4C3JC 1O27A 2NVXA 4AYBL 4XLNA 2VUMK 4GTFA 3M4OK 3K7AK 2NVYA 3EQLA 3GTGC 1TWGK 1XZPB 3GTJK 1XXCA 4KMAA 1JQWA 4ILDA 4GTAA 5TJ3A 1I6HC 4GTLA 1WQGA 3M4OC 3T00A 2O5IA 3GTQA 2RH6A 2JA7K 3K7AC 4X6AK 4A3DC 2PPBA 4BKWA 1O24A 4BBRK 3GTJC 1ZVUA 3GTOK 1USOA 3ADAC 5IP7C 4A3MK 2E2IK 2XCRB 2JA6A 3TFJA 1O28A 1SFOK 3G4CA 1I3QA 3BUEA 3QX3A 5JVOA 2V6SA 5TMCA 3GTMA 1WOOA 4BBRC 5EGEA 4WJ3M 2NVTK 2RGRA 1C0AA 1WSVA 2E2IC 4G0WA 1YNJA 3H0GK 1B4BA 1XXAA 1SFOC 1I6VA 1ZQ1C 5IYDK 3HOVK 4FM9A 1EFWA 2R92K 5TMFA 2NVTC 2Y0SL 1SMYA 3RZDK 4Y7NK 3HOWK 4XSZA 4P5BA 1XPPA 4A3EK 4Y52K 3V4GA 3GDZA 4NOIA 4AYBD 2R7ZK 4A3JK 3S15K
chains in the Genus database with same CATH topology
1RU0A 1DCHA 1DCOA 1F93A 1DCPA 1USOA 2V6UA 3HXAA 2V6SA 2EBBA 4LOWA 1USMA 4C45A 3JSTA 2V6TA 4WILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU0 A;  1DCH A;  1DCO A;  1F93 A;  1DCP A;  1USO A;  2V6U A;  3HXA A;  2V6S A;  2EBB A;  4LOW A;  1USM A;  4C45 A;  3JST A;  2V6T A;  4WIL A; 
#chains in the Genus database with same CATH topology
 5L46 A;  1O2A A;  3S2D K;  3H3V L;  1TWF K;  4BY1 K;  2JA8 K;  3HOW C;  2E2J C;  1O25 A;  1IQ0 A;  5IOR A;  4G0U A;  3N3Y A;  4A3E C;  4Y52 C;  3HKZ D;  1Y1W A;  5EGH A;  3GTK C;  1ZYR A;  2B63 C;  1J6X A;  1HI9 A;  4DDQ A;  4BY1 C;  3NUH A;  3ORE A;  4C3I K;  2FQO A;  5C4X K;  2JA8 C;  3GEI A;  5CHP A;  1PJ6 A;  4BXX C;  1ISE A;  2YU9 A;  4GTD A;  3M3Y C;  3SZZ A;  2XCQ A;  3RZO K;  4A3G C;  3GTG A;  3CQZ K;  4C3H K;  4C3I C;  1I50 C;  3TFI A;  1WQH A;  2EBB A;  1EQR A;  4KM8 A;  2VUM A;  4WIL A;  3GTL C;  5IOS A;  3AD8 C;  3RZO C;  3G4A A;  3BP3 A;  1TWA K;  3FKI K;  3CQZ C;  4C3H C;  3GTJ A;  3AQO A;  3FOF A;  4GTB A;  2GSU A;  1EH1 A;  1VGX A;  4MEY A;  4C2M K;  3S16 K;  4A3F K;  1VRQ C;  4A3B K;  3HOU C;  3A8K A;  5FLM C;  1DCP A;  3HOY K;  4PAB A;  1AB4 A;  4YG2 A;  1TWA C;  2YU9 C;  1Y1V K;  2PA8 L;  1UV7 A;  2ZUE A;  4C2M C;  4A3F C;  4KAR A;  2E2I A;  2GSN A;  4BBS K;  4QJV B;  1SFO A;  4A3L K;  4YFN A;  1IW7 A;  3OEP A;  4WJ4 A;  1Y1V C;  5IP9 K;  2VUM C;  4KMD A;  3I4N K;  1F7V A;  3HOZ K;  3AD7 C;  2O5J A;  3S1Q K;  1K83 K;  1TWG C;  4G7H A;  1HQM A;  3WOD A;  1XZQ A;  4G0V A;  2BE5 A;  3TFH A;  5IYB K;  4A3K K;  4XLP A;  1YCL A;  5M3M K;  4JK1 A;  3HOZ C;  2JA7 C;  4X6A C;  4KMH A;  4P5A A;  1K83 C;  1TWH K;  2JA5 K;  4LR2 A;  3GTP K;  3GTO C;  1IE0 A;  3IPJ A;  5IYB C;  1JOE A;  3GSI A;  4A3M C;  1BJT A;  4YFK A;  4OIP A;  2NVX K;  5IYC K;  2V6U A;  4KM9 A;  2E2H K;  3S1M K;  1YNN A;  1F7U A;  3GTK A;  1F9N A;  2B63 A;  1RU0 A;  2CFA A;  1WOR A;  1TWF A;  5C44 K;  1O29 A;  3HOX K;  4GFQ A;  2R93 K;  4KAW X;  3H0G C;  2E2H C;  5IYD C;  3HOV C;  2WB1 L;  4OIQ A;  2R92 C;  1J6V A;  5HL8 A;  1PJ7 A;  3HXA A;  1I50 A;  4G7Z A;  2R93 C;  4KB4 A;  1V5V A;  1DCH A;  2PA8 D;  3S1N K;  3AH5 A;  2JA6 K;  3GTL A;  3RZD C;  4Y7N C;  3T02 A;  4XSX A;  1I3Q K;  4J3N A;  4YFX A;  1YX2 A;  3AD9 C;  5M5W K;  5C3E K;  3CQZ A;  3GTM K;  3ERE D;  4FZB A;  2R7Z C;  4AH6 A;  2A69 A;  4A3J C;  3PO3 K;  3S15 C;  2FQT A;  1J98 A;  4RMF A;  3S2D C;  4LLG A;  4BY7 K;  1TWF C;  1TWA A;  2GSO A;  1DD5 A;  5C3E C;  3A8I A;  3T01 A;  4MEX A;  3PO3 C;  2KWA A;  1ZBS A;  1TWC K;  4BLB A;  3S14 K;  4A3I K;  4BY7 C;  5C4X C;  1EI6 A;  4LK1 A;  2V6T A;  5M3F K;  1Y1V A;  2GAG C;  1L0W A;  3I4M K;  1IL2 A;  2WAQ L;  2Y3P A;  1TWC C;  1R9T K;  1TWG A;  1O26 A;  2NVQ K;  5E68 A;  1B4A A;  4PAA A;  2JH3 A;  2P8T A;  3FOE A;  4KAT A;  2JA7 A;  4KN7 A;  3GIR A;  1Y1W K;  2Y0S D;  5D4D A;  1R9T C;  4A3C K;  3FKI C;  1K83 A;  4C45 A;  4Q4Z A;  2WB1 D;  3GTO A;  3S16 C;  4KC6 A;  4KDD A;  4BLA A;  4A3B C;  2ZUF A;  4C3J K;  1GE9 A;  3HOY C;  1XZP A;  2A6H A;  1VH2 A;  4MQ9 A;  4OIN A;  3H3V D;  1KQ4 A;  3N0C A;  3LAP A;  1JVI A;  1I6H K;  3H0G A;  4BBS C;  4A3L C;  2E2H A;  1WCM K;  3LAJ A;  4A3D K;  5IP9 C;  2R92 A;  4QIW L;  3PO2 K;  3AQP A;  3I4N C;  1IBA A;  3HKZ L;  2R93 A;  1WOS A;  3S1Q C;  4KN4 A;  5IP7 K;  3MML B;  1WCM C;  3GEH A;  4LK0 A;  2A6E A;  4A3K C;  2A68 A;  5M5X K;  4LQY A;  2D6F C;  2PHC B;  4ZH4 A;  3PO2 C;  1XZQ B;  1BDF A;  1EK8 A;  1BS2 A;  2R7Z A;  1WQF A;  1WIH A;  5M5Y K;  2NVY K;  1TWH C;  3VA7 A;  2WAQ D;  3N0B A;  2JA5 C;  3GTP C;  3TTG A;  3JST A;  2NVX C;  5IYC C;  2ZFZ A;  2GAH C;  3S1M C;  3GTQ K;  2NVY C;  4M1X A;  1INN A;  1J6W A;  1O2F B;  5C44 C;  3OPF A;  3HOX C;  3DXJ A;  1IS1 A;  1ZXO A;  1WSR A;  2CFA B;  2PMZ L;  1WOP A;  3GTQ C;  1TWC A;  1VJE A;  4XCH A;  3GEE A;  2E2J K;  3S1N C;  3A8J A;  2JA6 C;  3CAG A;  4GTE A;  4LJZ A;  1I3Q C;  3Q3Q A;  1R9T A;  3FKI A;  3GTK K;  3S2H K;  3FHZ A;  3GTM C;  2B63 K;  2W7V A;  4O2D A;  4QIW D;  4BXX K;  5IOQ A;  3M3Y K;  3BP8 C;  4OIO A;  5FJ8 K;  3L4K A;  3S2H C;  4A3G K;  1O2B A;  4KMU A;  5IOT A;  1I50 K;  3L4J A;  4Q5S A;  4P9S A;  3S14 C;  4A3I C;  1XXB A;  3GTL K;  4KAS A;  1F93 A;  3SZY A;  5C4J K;  3S0X A;  3I4M C;  3S17 K;  2CW0 A;  4OIR A;  1PJ5 A;  3HOU K;  1BGW A;  1VLO A;  5FLM K;  2NVQ C;  1WCM A;  3S1R K;  4GTC A;  4A93 K;  1DCO A;  1X31 C;  1USM A;  1G51 A;  5C4J C;  2XCO A;  2YU9 K;  4GZY A;  4G7O A;  3S17 C;  4QJV A;  3LPX A;  1Y1W C;  2PMZ D;  4A3C C;  1TWH A;  2JA5 A;  3S1R C;  3GTP A;  3GTG K;  4A93 C;  4LOW A;  5JFE A;  4GT9 A;  2P5M A;  5CJ9 A;  4KB2 A;  4C3J C;  1O27 A;  2NVX A;  4AYB L;  4XLN A;  2VUM K;  4GTF A;  3M4O K;  3K7A K;  2NVY A;  3EQL A;  3GTG C;  1TWG K;  1XZP B;  3GTJ K;  1XXC A;  4KMA A;  1JQW A;  4ILD A;  4GTA A;  5TJ3 A;  1I6H C;  4GTL A;  1WQG A;  3M4O C;  3T00 A;  2O5I A;  3GTQ A;  2RH6 A;  2JA7 K;  3K7A C;  4X6A K;  4A3D C;  2PPB A;  4BKW A;  1O24 A;  4BBR K;  3GTJ C;  1ZVU A;  3GTO K;  1USO A;  3ADA C;  5IP7 C;  4A3M K;  2E2I K;  2XCR B;  2JA6 A;  3TFJ A;  1O28 A;  1SFO K;  3G4C A;  1I3Q A;  3BUE A;  3QX3 A;  5JVO A;  2V6S A;  5TMC A;  3GTM A;  1WOO A;  4BBR C;  5EGE A;  4WJ3 M;  2NVT K;  2RGR A;  1C0A A;  1WSV A;  2E2I C;  4G0W A;  1YNJ A;  3H0G K;  1B4B A;  1XXA A;  1SFO C;  1I6V A;  1ZQ1 C;  5IYD K;  3HOV K;  4FM9 A;  1EFW A;  2R92 K;  5TMF A;  2NVT C;  2Y0S L;  1SMY A;  3RZD K;  4Y7N K;  3HOW K;  4XSZ A;  4P5B A;  1XPP A;  4A3E K;  4Y52 K;  3V4G A;  3GDZ A;  4NOI A;  4AYB D;  2R7Z K;  4A3J K;  3S15 K; 
#chains in the Genus database with same CATH homology
 1RU0 A;  1DCH A;  1DCO A;  1F93 A;  1DCP A;  1USO A;  2V6U A;  3HXA A;  2V6S A;  2EBB A;  4LOW A;  1USM A;  4C45 A;  3JST A;  2V6T A;  4WIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...