2V6TA

Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 29
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6tA00
1DCHA 1USOA 3JSTA 4LOWA 4C45A 1USMA 2EBBA 1DCPA 3HXAA 1F93A 2V6TA 2V6UA 1DCOA 1RU0A 2V6SA 4WILA
chains in the Genus database with same CATH superfamily
3RZDC 3AQPA 4C2MK 4A3IC 1WSVA 2NVYK 2XCQA 1EK8A 2YU9A 4LJZA 3RZOK 1O25A 1XZPA 2A6EA 3BP8C 1J98A 1ZBSA 5IYDC 4KASA 4A3JK 3CQZC 5FLMC 3BUEA 3GTLA 3S1QK 3N3YA 1YX2A 2P8TA 3GTQA 4GTFA 5CHPA 1JVIA 3M4OK 3GTKC 2RGRA 3GTGC 1TWAK 4XLNA 3S14C 5JVOA 5TJ3A 3HOXC 2NVQC 1ZVUA 4BBRK 4C3JC 2PMZD 2GAHC 2WB1L 3GTPC 3TFJA 3PO3C 4DDQA 1I6VA 4BY7C 4BBSK 1VLOA 1L0WA 1O24A 3HOWC 1I50K 4FM9A 4AH6A 3EQLA 4KMHA 4C3HK 2NVXK 3S2DK 4A3GC 4QJVB 3FKIK 3H0GC 4KC6A 3S16C 3GTMA 5IYBK 4KB2A 1Y1WK 3GTKA 5FJ8K 1R9TA 3HOZK 2D6FC 3N0BA 1USOA 2R92C 4BKWA 4A3MK 1TWGC 4C3IK 4ILDA 1EI6A 4AYBD 2A69A 4A3CK 4OIRA 3L4KA 2E2IC 3HKZL 1O2FB 1I6HC 3BP3A 3AH5A 1WCMK 2NVYA 2PMZL 4A3EK 1WOPA 2R93C 4YFKA 3LAPA 4YFXA 1IE0A 3ERED 1XXCA 1PJ6A 5E68A 2ZFZA 3CAGA 1IL2A 4KB4A 4Q5SA 1F9NA 5CJ9A 3S2HC 1BS2A 1TWHC 4KARA 3OPFA 4KN4A 4WJ3M 4Y7NK 4XCHA 2Y0SL 2EBBA 4X6AK 2PHCB 2E2JK 5IYCC 1Y1VK 1TWAA 2R92A 5C4JK 3GTLC 5C44C 5TMFA 3GTQC 3K7AK 4GTCA 1WQHA 1J6WA 2B63K 5M5YK 3HOYC 5M5XK 4JK1A 2VUMK 3I4MC 1F93A 1O26A 4A3FC 2R7ZC 3S15C 1I50A 2NVTK 1PJ5A 2NVXA 4A3DC 5M5WK 3TTGA 1TWHA 3V4GA 2PA8D 4A93C 3FKIA 3HOVC 1JOEA 2Y3PA 1WQFA 2GSNA 1Y1WA 1USMA 4A3KC 3GDZA 2GSUA 3OREA 3S1MC 3I4NK 5IP7K 3S1RK 3TFHA 2JA6K 3GTMC 4XSZA 3Q3QA 5EGEA 3S17C 1IQ0A 1EFWA 4MEYA 2BE5A 1PJ7A 3M3YK 3FOFA 3HOUK 1R9TC 3A8JA 1XZPB 3HKZD 1VRQC 1IS1A 3PO2C 1I3QC 2JA7K 1WCMA 2R7ZA 3GTJK 5C3EC 2E2HK 1ZXOA 2JH3A 5IP9C 4YG2A 1K83K 4NOIA 4C2MC 2NVYC 2O5IA 2Y0SD 2CFAA 4RMFA 3RZOC 4MQ9A 2XCRB 2RH6A 4Y52K 1ISEA 1TWFK 4A3BK 1Y1VA 5IOSA 4ZH4A 4LQYA 4A3JC 2PA8L 3A8KA 4KM9A 3JSTA 1SFOK 3S1QC 5C4XK 1XZQA 1G51A 2JA5K 1I6HK 4M1XA 3M4OC 1IW7A 1TWAC 2B63A 1ZQ1C 1I3QA 3SZYA 2XCOA 4BBRC 1TWCK 2YU9K 3GTOK 4KMUA 4G0VA 4LLGA 5HL8A 3S0XA 1O27A 4WJ4A 2WAQD 4BBSC 4GTDA 4A3LK 4P5AA 4BXXK 3GTLK 3MMLB 2PPBA 1O2BA 1J6XA 1I50C 4C3HC 2NVXC 2JA8K 2A6HA 1WIHA 4BY1K 4BLAA 3G4AA 3S2DC 3FKIC 3GEEA 4P9SA 2JA6A 3VA7A 5IYBC 3S1NK 1Y1WC 1AB4A 1BDFA 3AQOA 4XLPA 3HOZC 3GEIA 1YCLA 2GSOA 3RZDK 1EH1A 4A3IK 4A3MC 2JA7A 1WORA 5M3FK 4C3IC 4O2DA 3GTJA 4A3CC 1VJEA 3WODA 5IYDK 2E2HA 3CQZK 5L46A 5FLMK 1K83A 1O29A 1HQMA 1WCMC 4MEXA 1WSRA 4A3EC 3GTKK 4GTBA 3FOEA 3GTGK 3LAJA 4GTLA 1X31C 2WAQL 4LOWA 1TWFA 3S14K 3HOXK 2NVQK 1WOSA 5M3MK 1DCOA 1SFOA 1O2AA 4C3JK 4Y7NC 2JA5A 4KMDA 2CW0A 4X6AC 2E2JC 4OIPA 3GTPK 3PO3K 1Y1VC 4BY7K 5C4JC 4C45A 3HOWK 4G0UA 1BGWA 3H3VD 1JQWA 1V5VA 3K7AC 1YNNA 1TWCA 2KWAA 2ZUFA 3GTOA 1ZYRA 2B63C 4G0WA 4GZYA 3N0CA 4A3GK 2V6TA 3H0GK 3S16K 2VUMC 3GEHA 4YFNA 3GSIA 4OINA 1B4BA 2ZUEA 2NVTC 2R92K 5JFEA 4QIWD 2GAGC 1J6VA 1XXBA 1C0AA 1TWGK 4LK0A 4LR2A 4P5BA 1RU0A 3AD7C 2FQTA 1INNA 1F7UA 2E2IK 5EGHA 1KQ4A 3ADAC 4QJVA 3LPXA 3I4NC 5IP7C 3S1RC 1BJTA 2JA6C 5TMCA 2R93K 3M3YC 2CFAB 3HOUC 4G7OA 4GFQA 1IBAA 2P5MA 3TFIA 4Q4ZA 3L4JA 3G4CA 3S2HK 1TWHK 4J3NA 3CQZA 3H3VL 3QX3A 2VUMA 2W7VA 1WOOA 2JA7C 3T02A 1XZQB 2V6UA 3GTJC 5IYCK 3GTGA 2E2HC 5IOQA 4OIQA 1XXAA 1K83C 4KDDA 5C44K 1EQRA 2O5JA 3GTQK 4GT9A 4LK1A 1XPPA 4Y52C 3HOYK 3OEPA 1TWFC 4XSXA 4A3BC 3GTPA 1F7VA 4QIWL 1SFOC 4KN7A 4PAAA 5C4XC 2JA5C 2A68A 3I4MK 3T00A 4A3FK 4GTAA 2R7ZK 3S15K 1UV7A 1VGXA 4A3DK 4KMAA 3HXAA 4WILA 5IORA 4A93K 3HOVK 3H0GA 3T01A 1O28A 3AD8C 3FHZA 1TWCC 3DXJA 3GIRA 2YU9C 4KAWX 4PABA 4A3KK 3GTOC 1SMYA 4FZBA 4BLBA 3S1MK 2V6SA 4A3LC 3GTMK 1DCHA 3A8IA 1HI9A 1WQGA 2FQOA 4BXXC 3S17K 5D4DA 1R9TK 1TWGA 4G7ZA 1DD5A 2JA8C 4KM8A 3NUHA 4BY1C 2WB1D 2E2IA 3AD9C 3PO2K 4OIOA 1I3QK 1GE9A 3S1NC 4GTEA 4KATA 3SZZA 5C3EK 2R93A 4G7HA 1YNJA 1DCPA 4AYBL 5IP9K 5IOTA 3IPJA 1B4AA 1VH2A
chains in the Genus database with same CATH topology
1DCHA 1USOA 3JSTA 4LOWA 4C45A 1USMA 2EBBA 1DCPA 3HXAA 1F93A 2V6TA 2V6UA 1DCOA 1RU0A 2V6SA 4WILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  1USO A;  3JST A;  4LOW A;  4C45 A;  1USM A;  2EBB A;  1DCP A;  3HXA A;  1F93 A;  2V6T A;  2V6U A;  1DCO A;  1RU0 A;  2V6S A;  4WIL A; 
#chains in the Genus database with same CATH topology
 3RZD C;  3AQP A;  4C2M K;  4A3I C;  1WSV A;  2NVY K;  2XCQ A;  1EK8 A;  2YU9 A;  4LJZ A;  3RZO K;  1O25 A;  1XZP A;  2A6E A;  3BP8 C;  1J98 A;  1ZBS A;  5IYD C;  4KAS A;  4A3J K;  3CQZ C;  5FLM C;  3BUE A;  3GTL A;  3S1Q K;  3N3Y A;  1YX2 A;  2P8T A;  3GTQ A;  4GTF A;  5CHP A;  1JVI A;  3M4O K;  3GTK C;  2RGR A;  3GTG C;  1TWA K;  4XLN A;  3S14 C;  5JVO A;  5TJ3 A;  3HOX C;  2NVQ C;  1ZVU A;  4BBR K;  4C3J C;  2PMZ D;  2GAH C;  2WB1 L;  3GTP C;  3TFJ A;  3PO3 C;  4DDQ A;  1I6V A;  4BY7 C;  4BBS K;  1VLO A;  1L0W A;  1O24 A;  3HOW C;  1I50 K;  4FM9 A;  4AH6 A;  3EQL A;  4KMH A;  4C3H K;  2NVX K;  3S2D K;  4A3G C;  4QJV B;  3FKI K;  3H0G C;  4KC6 A;  3S16 C;  3GTM A;  5IYB K;  4KB2 A;  1Y1W K;  3GTK A;  5FJ8 K;  1R9T A;  3HOZ K;  2D6F C;  3N0B A;  1USO A;  2R92 C;  4BKW A;  4A3M K;  1TWG C;  4C3I K;  4ILD A;  1EI6 A;  4AYB D;  2A69 A;  4A3C K;  4OIR A;  3L4K A;  2E2I C;  3HKZ L;  1O2F B;  1I6H C;  3BP3 A;  3AH5 A;  1WCM K;  2NVY A;  2PMZ L;  4A3E K;  1WOP A;  2R93 C;  4YFK A;  3LAP A;  4YFX A;  1IE0 A;  3ERE D;  1XXC A;  1PJ6 A;  5E68 A;  2ZFZ A;  3CAG A;  1IL2 A;  4KB4 A;  4Q5S A;  1F9N A;  5CJ9 A;  3S2H C;  1BS2 A;  1TWH C;  4KAR A;  3OPF A;  4KN4 A;  4WJ3 M;  4Y7N K;  4XCH A;  2Y0S L;  2EBB A;  4X6A K;  2PHC B;  2E2J K;  5IYC C;  1Y1V K;  1TWA A;  2R92 A;  5C4J K;  3GTL C;  5C44 C;  5TMF A;  3GTQ C;  3K7A K;  4GTC A;  1WQH A;  1J6W A;  2B63 K;  5M5Y K;  3HOY C;  5M5X K;  4JK1 A;  2VUM K;  3I4M C;  1F93 A;  1O26 A;  4A3F C;  2R7Z C;  3S15 C;  1I50 A;  2NVT K;  1PJ5 A;  2NVX A;  4A3D C;  5M5W K;  3TTG A;  1TWH A;  3V4G A;  2PA8 D;  4A93 C;  3FKI A;  3HOV C;  1JOE A;  2Y3P A;  1WQF A;  2GSN A;  1Y1W A;  1USM A;  4A3K C;  3GDZ A;  2GSU A;  3ORE A;  3S1M C;  3I4N K;  5IP7 K;  3S1R K;  3TFH A;  2JA6 K;  3GTM C;  4XSZ A;  3Q3Q A;  5EGE A;  3S17 C;  1IQ0 A;  1EFW A;  4MEY A;  2BE5 A;  1PJ7 A;  3M3Y K;  3FOF A;  3HOU K;  1R9T C;  3A8J A;  1XZP B;  3HKZ D;  1VRQ C;  1IS1 A;  3PO2 C;  1I3Q C;  2JA7 K;  1WCM A;  2R7Z A;  3GTJ K;  5C3E C;  2E2H K;  1ZXO A;  2JH3 A;  5IP9 C;  4YG2 A;  1K83 K;  4NOI A;  4C2M C;  2NVY C;  2O5I A;  2Y0S D;  2CFA A;  4RMF A;  3RZO C;  4MQ9 A;  2XCR B;  2RH6 A;  4Y52 K;  1ISE A;  1TWF K;  4A3B K;  1Y1V A;  5IOS A;  4ZH4 A;  4LQY A;  4A3J C;  2PA8 L;  3A8K A;  4KM9 A;  3JST A;  1SFO K;  3S1Q C;  5C4X K;  1XZQ A;  1G51 A;  2JA5 K;  1I6H K;  4M1X A;  3M4O C;  1IW7 A;  1TWA C;  2B63 A;  1ZQ1 C;  1I3Q A;  3SZY A;  2XCO A;  4BBR C;  1TWC K;  2YU9 K;  3GTO K;  4KMU A;  4G0V A;  4LLG A;  5HL8 A;  3S0X A;  1O27 A;  4WJ4 A;  2WAQ D;  4BBS C;  4GTD A;  4A3L K;  4P5A A;  4BXX K;  3GTL K;  3MML B;  2PPB A;  1O2B A;  1J6X A;  1I50 C;  4C3H C;  2NVX C;  2JA8 K;  2A6H A;  1WIH A;  4BY1 K;  4BLA A;  3G4A A;  3S2D C;  3FKI C;  3GEE A;  4P9S A;  2JA6 A;  3VA7 A;  5IYB C;  3S1N K;  1Y1W C;  1AB4 A;  1BDF A;  3AQO A;  4XLP A;  3HOZ C;  3GEI A;  1YCL A;  2GSO A;  3RZD K;  1EH1 A;  4A3I K;  4A3M C;  2JA7 A;  1WOR A;  5M3F K;  4C3I C;  4O2D A;  3GTJ A;  4A3C C;  1VJE A;  3WOD A;  5IYD K;  2E2H A;  3CQZ K;  5L46 A;  5FLM K;  1K83 A;  1O29 A;  1HQM A;  1WCM C;  4MEX A;  1WSR A;  4A3E C;  3GTK K;  4GTB A;  3FOE A;  3GTG K;  3LAJ A;  4GTL A;  1X31 C;  2WAQ L;  4LOW A;  1TWF A;  3S14 K;  3HOX K;  2NVQ K;  1WOS A;  5M3M K;  1DCO A;  1SFO A;  1O2A A;  4C3J K;  4Y7N C;  2JA5 A;  4KMD A;  2CW0 A;  4X6A C;  2E2J C;  4OIP A;  3GTP K;  3PO3 K;  1Y1V C;  4BY7 K;  5C4J C;  4C45 A;  3HOW K;  4G0U A;  1BGW A;  3H3V D;  1JQW A;  1V5V A;  3K7A C;  1YNN A;  1TWC A;  2KWA A;  2ZUF A;  3GTO A;  1ZYR A;  2B63 C;  4G0W A;  4GZY A;  3N0C A;  4A3G K;  2V6T A;  3H0G K;  3S16 K;  2VUM C;  3GEH A;  4YFN A;  3GSI A;  4OIN A;  1B4B A;  2ZUE A;  2NVT C;  2R92 K;  5JFE A;  4QIW D;  2GAG C;  1J6V A;  1XXB A;  1C0A A;  1TWG K;  4LK0 A;  4LR2 A;  4P5B A;  1RU0 A;  3AD7 C;  2FQT A;  1INN A;  1F7U A;  2E2I K;  5EGH A;  1KQ4 A;  3ADA C;  4QJV A;  3LPX A;  3I4N C;  5IP7 C;  3S1R C;  1BJT A;  2JA6 C;  5TMC A;  2R93 K;  3M3Y C;  2CFA B;  3HOU C;  4G7O A;  4GFQ A;  1IBA A;  2P5M A;  3TFI A;  4Q4Z A;  3L4J A;  3G4C A;  3S2H K;  1TWH K;  4J3N A;  3CQZ A;  3H3V L;  3QX3 A;  2VUM A;  2W7V A;  1WOO A;  2JA7 C;  3T02 A;  1XZQ B;  2V6U A;  3GTJ C;  5IYC K;  3GTG A;  2E2H C;  5IOQ A;  4OIQ A;  1XXA A;  1K83 C;  4KDD A;  5C44 K;  1EQR A;  2O5J A;  3GTQ K;  4GT9 A;  4LK1 A;  1XPP A;  4Y52 C;  3HOY K;  3OEP A;  1TWF C;  4XSX A;  4A3B C;  3GTP A;  1F7V A;  4QIW L;  1SFO C;  4KN7 A;  4PAA A;  5C4X C;  2JA5 C;  2A68 A;  3I4M K;  3T00 A;  4A3F K;  4GTA A;  2R7Z K;  3S15 K;  1UV7 A;  1VGX A;  4A3D K;  4KMA A;  3HXA A;  4WIL A;  5IOR A;  4A93 K;  3HOV K;  3H0G A;  3T01 A;  1O28 A;  3AD8 C;  3FHZ A;  1TWC C;  3DXJ A;  3GIR A;  2YU9 C;  4KAW X;  4PAB A;  4A3K K;  3GTO C;  1SMY A;  4FZB A;  4BLB A;  3S1M K;  2V6S A;  4A3L C;  3GTM K;  1DCH A;  3A8I A;  1HI9 A;  1WQG A;  2FQO A;  4BXX C;  3S17 K;  5D4D A;  1R9T K;  1TWG A;  4G7Z A;  1DD5 A;  2JA8 C;  4KM8 A;  3NUH A;  4BY1 C;  2WB1 D;  2E2I A;  3AD9 C;  3PO2 K;  4OIO A;  1I3Q K;  1GE9 A;  3S1N C;  4GTE A;  4KAT A;  3SZZ A;  5C3E K;  2R93 A;  4G7H A;  1YNJ A;  1DCP A;  4AYB L;  5IP9 K;  5IOT A;  3IPJ A;  1B4A A;  1VH2 A; 
#chains in the Genus database with same CATH homology
 1DCH A;  1USO A;  3JST A;  4LOW A;  4C45 A;  1USM A;  2EBB A;  1DCP A;  3HXA A;  1F93 A;  2V6T A;  2V6U A;  1DCO A;  1RU0 A;  2V6S A;  4WIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...