2V6TA

Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
total genus 29
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6tA00
2V6UA 1DCPA 3HXAA 4WILA 4C45A 4LOWA 1RU0A 3JSTA 1DCOA 1USOA 2V6SA 1F93A 1DCHA 2EBBA 1USMA 2V6TA
chains in the Genus database with same CATH superfamily
1XXAA 4QJVA 4LK0A 5C3EK 4KM9A 5IYBK 4GTLA 1XZQA 4A3DC 1UV7A 1JVIA 2R92C 4M1XA 5D4DA 3GTQK 2WB1L 1O25A 1V5VA 2PMZD 3PO3K 4OIQA 4C2MK 3I4MC 3S17K 1XXCA 2PHCB 2JA7K 1B4AA 2JA5A 1WOPA 2YU9K 2GSUA 4PAAA 5TMFA 3S1RC 4C45A 3ERED 4C3HC 3GTJK 4YFKA 2Y0SD 2R93K 1TWAA 1PJ7A 5FLMC 1ZVUA 1WCMC 5M3MK 1TWHC 5FJ8K 2NVQK 4QIWD 4A3MC 1IW7A 1YCLA 3G4AA 5IORA 2RGRA 3HOYC 1INNA 3IPJA 3HOZC 4A3DK 1IL2A 4KN4A 2A6EA 2R92K 1WQFA 3GTQC 2JA7A 1J98A 1VJEA 1ISEA 2JA5K 4KATA 3FHZA 1SFOA 3S2DC 2YU9A 2NVYA 4A3FC 1I3QC 1EI6A 3GDZA 2R93A 3TTGA 1WOOA 2Y3PA 1O27A 5C44K 1I50K 2O5IA 1F93A 2YU9C 2EBBA 2R7ZA 4KDDA 4X6AK 2D6FC 1SMYA 3S1RK 2FQTA 3GTLC 3GTJC 2NVYC 5JVOA 1I3QA 5IYDC 2NVTC 1TWHK 4GZYA 4MQ9A 2JA6K 3GEEA 4Q4ZA 3GTLA 1J6XA 3PO2K 3FKIK 4KMDA 2FQOA 1SFOK 3S1NK 2XCQA 3L4KA 1Y1VA 3M4OC 4P5BA 4KAWX 2PMZL 4KB4A 2JA5C 3GTKC 4XLNA 2E2HC 1PJ6A 1YNJA 2A6HA 2V6SA 4YFNA 3CAGA 5IOTA 2CFAB 5C44C 1J6WA 3BUEA 1O28A 3HOUK 2VUMA 3TFHA 3GTGA 3S16K 3GTLK 3OEPA 4AH6A 4FZBA 2XCOA 1VRQC 3T02A 4A93K 4BY7K 2JA6C 5IYBC 3S1NC 1O29A 4GTEA 3HKZD 3GTMA 3M4OK 1JQWA 3GTOK 3H0GA 4BBSK 2GAHC 2JH3A 1TWFK 1WCMA 3N0CA 4GTDA 4BKWA 4C2MC 3A8KA 3HOWK 4AYBD 3OPFA 3SZZA 2E2HK 2VUMK 1R9TC 3K7AC 3N3YA 5IP9C 4Y52K 3GTGK 4KM8A 4G7OA 2XCRB 2ZUFA 1IS1A 1VLOA 4OINA 3L4JA 1EH1A 3HOVC 1X31C 3BP8C 1I6HC 3S16C 5TJ3A 4OIPA 4C3HK 3T00A 4XCHA 1EFWA 3H0GK 3GTOA 2NVQC 2NVXA 1TWFA 3S15K 2P8TA 3AD8C 4XLPA 1HI9A 1WSRA 3GTJA 1ZXOA 4BBSC 5C4XK 4YG2A 1TWCA 2CFAA 1J6VA 3HOWC 5JFEA 3M3YC 2VUMC 3K7AK 5IP9K 4QJVB 1F9NA 4GTBA 4Y52C 5IYCK 1EQRA 4BBRK 1Y1VC 4BLBA 5HL8A 3AQOA 1HQMA 2NVXK 2ZFZA 1TWCC 3OREA 3QX3A 3JSTA 2NVYK 4BY1K 1WIHA 4MEXA 2E2JC 1WQGA 1K83K 5IYDK 4A3EK 2NVTK 3H0GC 1VGXA 1GE9A 1USMA 1I50A 1WOSA 3PO2C 3FKIC 3HOXC 4XSXA 1TWAC 1WORA 4OIRA 4A3IK 3S14C 5C4XC 3MMLB 4J3NA 4ZH4A 2E2IC 1TWHA 1AB4A 4AYBL 1BJTA 3Q3QA 4G7ZA 3GTKK 2JA6A 3HXAA 1XZPA 4G0UA 2B63C 3M3YK 1O24A 3FKIA 2A69A 4GT9A 5TMCA 2WAQD 1DCPA 1Y1VK 1VH2A 1K83A 3GTMC 3I4NK 2RH6A 5M5WK 3HOUC 4JK1A 2NVXC 3GEHA 1O2BA 1BS2A 1K83C 4A3LK 2GSNA 5M5YK 3GTPA 4GFQA 5E68A 4WJ3M 1DCOA 1I6VA 1DCHA 4LQYA 2A68A 1ZYRA 4Y7NC 3VA7A 1Y1WK 1XZQB 1XXBA 1KQ4A 4A3BC 3GTOC 3AQPA 4A3IC 3S14K 5IOSA 1TWFC 2PA8D 3EQLA 1IBAA 5EGEA 4LJZA 1R9TK 2GSOA 2GAGC 1F7UA 1O2FB 4BXXK 3GTGC 2WAQL 4LOWA 3G4CA 3GTMK 4ILDA 1DD5A 1JOEA 3RZDK 3HOVK 1I6HK 1Y1WA 1IQ0A 4C3JK 1WQHA 2JA8K 3S2HC 1EK8A 4KMHA 3LAJA 3RZOK 3SZYA 1B4BA 1YNNA 2Y0SL 3S15C 1ZBSA 3GSIA 1R9TA 1O2AA 4GTCA 2V6TA 3T01A 4A3BK 4KN7A 1XZPB 4G7HA 4A3JC 5IYCC 4BXXC 4XSZA 4P9SA 4BBRC 4GTFA 5M3FK 4FM9A 1TWCK 5C3EC 4YFXA 4RMFA 4OIOA 4BY1C 3S1QC 2E2JK 4C3JC 3FOFA 4NOIA 2JA8C 4A3EC 4WILA 4A3KK 4A3GC 4GTAA 3RZOC 2PPBA 4KARA 3PO3C 3A8IA 4LK1A 3HOXK 1TWAK 3LAPA 1C0AA 3N0BA 2KWAA 2E2IK 3BP3A 2ZUEA 1ZQ1C 2B63K 4A3JK 5L46A 1XPPA 2R92A 2R93C 3H3VD 3I4NC 1BDFA 4A3MK 1TWGA 3HOYK 3AD7C 3GTKA 3HOZK 5IOQA 3S1QK 1PJ5A 4KMUA 4LLGA 4A3LC 4A3KC 4A3GK 2R7ZK 2WB1D 3AD9C 4C3IC 5IP7C 3S1MK 2O5JA 4WJ4A 2E2IA 3S2DK 3CQZK 4Y7NK 4A3FK 1Y1WC 1I3QK 3TFJA 1O26A 2B63A 4P5AA 3WODA 5M5XK 1L0WA 4G0WA 2V6UA 5C4JK 3GTPK 1RU0A 3AH5A 1I50C 4DDQA 5CHPA 4Q5SA 4PABA 4X6AC 1TWGK 4KB2A 4KMAA 5EGHA 3GEIA 3H3VL 4G0VA 4A3CK 3DXJA 3FOEA 2P5MA 1USOA 1BGWA 3RZDC 2PA8L 4BLAA 1YX2A 2BE5A 3LPXA 1SFOC 1IE0A 3CQZA 3S2HK 5CJ9A 3S0XA 2R7ZC 1G51A 2CW0A 4C3IK 5IP7K 3S1MC 3I4MK 3S17C 3CQZC 2JA7C 3GTQA 4MEYA 4LR2A 5C4JC 3GTPC 3GIRA 3NUHA 4KC6A 3V4GA 1WSVA 1TWGC 3HKZL 4O2DA 3TFIA 1F7VA 5FLMK 1WCMK 4KASA 4A3CC 3ADAC 4A93C 4BY7C 3A8JA 2E2HA 4QIWL 2W7VA
chains in the Genus database with same CATH topology
2V6UA 1DCPA 3HXAA 4WILA 4C45A 4LOWA 1RU0A 3JSTA 1DCOA 1USOA 2V6SA 1F93A 1DCHA 2EBBA 1USMA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6U A;  1DCP A;  3HXA A;  4WIL A;  4C45 A;  4LOW A;  1RU0 A;  3JST A;  1DCO A;  1USO A;  2V6S A;  1F93 A;  1DCH A;  2EBB A;  1USM A;  2V6T A; 
#chains in the Genus database with same CATH topology
 1XXA A;  4QJV A;  4LK0 A;  5C3E K;  4KM9 A;  5IYB K;  4GTL A;  1XZQ A;  4A3D C;  1UV7 A;  1JVI A;  2R92 C;  4M1X A;  5D4D A;  3GTQ K;  2WB1 L;  1O25 A;  1V5V A;  2PMZ D;  3PO3 K;  4OIQ A;  4C2M K;  3I4M C;  3S17 K;  1XXC A;  2PHC B;  2JA7 K;  1B4A A;  2JA5 A;  1WOP A;  2YU9 K;  2GSU A;  4PAA A;  5TMF A;  3S1R C;  4C45 A;  3ERE D;  4C3H C;  3GTJ K;  4YFK A;  2Y0S D;  2R93 K;  1TWA A;  1PJ7 A;  5FLM C;  1ZVU A;  1WCM C;  5M3M K;  1TWH C;  5FJ8 K;  2NVQ K;  4QIW D;  4A3M C;  1IW7 A;  1YCL A;  3G4A A;  5IOR A;  2RGR A;  3HOY C;  1INN A;  3IPJ A;  3HOZ C;  4A3D K;  1IL2 A;  4KN4 A;  2A6E A;  2R92 K;  1WQF A;  3GTQ C;  2JA7 A;  1J98 A;  1VJE A;  1ISE A;  2JA5 K;  4KAT A;  3FHZ A;  1SFO A;  3S2D C;  2YU9 A;  2NVY A;  4A3F C;  1I3Q C;  1EI6 A;  3GDZ A;  2R93 A;  3TTG A;  1WOO A;  2Y3P A;  1O27 A;  5C44 K;  1I50 K;  2O5I A;  1F93 A;  2YU9 C;  2EBB A;  2R7Z A;  4KDD A;  4X6A K;  2D6F C;  1SMY A;  3S1R K;  2FQT A;  3GTL C;  3GTJ C;  2NVY C;  5JVO A;  1I3Q A;  5IYD C;  2NVT C;  1TWH K;  4GZY A;  4MQ9 A;  2JA6 K;  3GEE A;  4Q4Z A;  3GTL A;  1J6X A;  3PO2 K;  3FKI K;  4KMD A;  2FQO A;  1SFO K;  3S1N K;  2XCQ A;  3L4K A;  1Y1V A;  3M4O C;  4P5B A;  4KAW X;  2PMZ L;  4KB4 A;  2JA5 C;  3GTK C;  4XLN A;  2E2H C;  1PJ6 A;  1YNJ A;  2A6H A;  2V6S A;  4YFN A;  3CAG A;  5IOT A;  2CFA B;  5C44 C;  1J6W A;  3BUE A;  1O28 A;  3HOU K;  2VUM A;  3TFH A;  3GTG A;  3S16 K;  3GTL K;  3OEP A;  4AH6 A;  4FZB A;  2XCO A;  1VRQ C;  3T02 A;  4A93 K;  4BY7 K;  2JA6 C;  5IYB C;  3S1N C;  1O29 A;  4GTE A;  3HKZ D;  3GTM A;  3M4O K;  1JQW A;  3GTO K;  3H0G A;  4BBS K;  2GAH C;  2JH3 A;  1TWF K;  1WCM A;  3N0C A;  4GTD A;  4BKW A;  4C2M C;  3A8K A;  3HOW K;  4AYB D;  3OPF A;  3SZZ A;  2E2H K;  2VUM K;  1R9T C;  3K7A C;  3N3Y A;  5IP9 C;  4Y52 K;  3GTG K;  4KM8 A;  4G7O A;  2XCR B;  2ZUF A;  1IS1 A;  1VLO A;  4OIN A;  3L4J A;  1EH1 A;  3HOV C;  1X31 C;  3BP8 C;  1I6H C;  3S16 C;  5TJ3 A;  4OIP A;  4C3H K;  3T00 A;  4XCH A;  1EFW A;  3H0G K;  3GTO A;  2NVQ C;  2NVX A;  1TWF A;  3S15 K;  2P8T A;  3AD8 C;  4XLP A;  1HI9 A;  1WSR A;  3GTJ A;  1ZXO A;  4BBS C;  5C4X K;  4YG2 A;  1TWC A;  2CFA A;  1J6V A;  3HOW C;  5JFE A;  3M3Y C;  2VUM C;  3K7A K;  5IP9 K;  4QJV B;  1F9N A;  4GTB A;  4Y52 C;  5IYC K;  1EQR A;  4BBR K;  1Y1V C;  4BLB A;  5HL8 A;  3AQO A;  1HQM A;  2NVX K;  2ZFZ A;  1TWC C;  3ORE A;  3QX3 A;  3JST A;  2NVY K;  4BY1 K;  1WIH A;  4MEX A;  2E2J C;  1WQG A;  1K83 K;  5IYD K;  4A3E K;  2NVT K;  3H0G C;  1VGX A;  1GE9 A;  1USM A;  1I50 A;  1WOS A;  3PO2 C;  3FKI C;  3HOX C;  4XSX A;  1TWA C;  1WOR A;  4OIR A;  4A3I K;  3S14 C;  5C4X C;  3MML B;  4J3N A;  4ZH4 A;  2E2I C;  1TWH A;  1AB4 A;  4AYB L;  1BJT A;  3Q3Q A;  4G7Z A;  3GTK K;  2JA6 A;  3HXA A;  1XZP A;  4G0U A;  2B63 C;  3M3Y K;  1O24 A;  3FKI A;  2A69 A;  4GT9 A;  5TMC A;  2WAQ D;  1DCP A;  1Y1V K;  1VH2 A;  1K83 A;  3GTM C;  3I4N K;  2RH6 A;  5M5W K;  3HOU C;  4JK1 A;  2NVX C;  3GEH A;  1O2B A;  1BS2 A;  1K83 C;  4A3L K;  2GSN A;  5M5Y K;  3GTP A;  4GFQ A;  5E68 A;  4WJ3 M;  1DCO A;  1I6V A;  1DCH A;  4LQY A;  2A68 A;  1ZYR A;  4Y7N C;  3VA7 A;  1Y1W K;  1XZQ B;  1XXB A;  1KQ4 A;  4A3B C;  3GTO C;  3AQP A;  4A3I C;  3S14 K;  5IOS A;  1TWF C;  2PA8 D;  3EQL A;  1IBA A;  5EGE A;  4LJZ A;  1R9T K;  2GSO A;  2GAG C;  1F7U A;  1O2F B;  4BXX K;  3GTG C;  2WAQ L;  4LOW A;  3G4C A;  3GTM K;  4ILD A;  1DD5 A;  1JOE A;  3RZD K;  3HOV K;  1I6H K;  1Y1W A;  1IQ0 A;  4C3J K;  1WQH A;  2JA8 K;  3S2H C;  1EK8 A;  4KMH A;  3LAJ A;  3RZO K;  3SZY A;  1B4B A;  1YNN A;  2Y0S L;  3S15 C;  1ZBS A;  3GSI A;  1R9T A;  1O2A A;  4GTC A;  2V6T A;  3T01 A;  4A3B K;  4KN7 A;  1XZP B;  4G7H A;  4A3J C;  5IYC C;  4BXX C;  4XSZ A;  4P9S A;  4BBR C;  4GTF A;  5M3F K;  4FM9 A;  1TWC K;  5C3E C;  4YFX A;  4RMF A;  4OIO A;  4BY1 C;  3S1Q C;  2E2J K;  4C3J C;  3FOF A;  4NOI A;  2JA8 C;  4A3E C;  4WIL A;  4A3K K;  4A3G C;  4GTA A;  3RZO C;  2PPB A;  4KAR A;  3PO3 C;  3A8I A;  4LK1 A;  3HOX K;  1TWA K;  3LAP A;  1C0A A;  3N0B A;  2KWA A;  2E2I K;  3BP3 A;  2ZUE A;  1ZQ1 C;  2B63 K;  4A3J K;  5L46 A;  1XPP A;  2R92 A;  2R93 C;  3H3V D;  3I4N C;  1BDF A;  4A3M K;  1TWG A;  3HOY K;  3AD7 C;  3GTK A;  3HOZ K;  5IOQ A;  3S1Q K;  1PJ5 A;  4KMU A;  4LLG A;  4A3L C;  4A3K C;  4A3G K;  2R7Z K;  2WB1 D;  3AD9 C;  4C3I C;  5IP7 C;  3S1M K;  2O5J A;  4WJ4 A;  2E2I A;  3S2D K;  3CQZ K;  4Y7N K;  4A3F K;  1Y1W C;  1I3Q K;  3TFJ A;  1O26 A;  2B63 A;  4P5A A;  3WOD A;  5M5X K;  1L0W A;  4G0W A;  2V6U A;  5C4J K;  3GTP K;  1RU0 A;  3AH5 A;  1I50 C;  4DDQ A;  5CHP A;  4Q5S A;  4PAB A;  4X6A C;  1TWG K;  4KB2 A;  4KMA A;  5EGH A;  3GEI A;  3H3V L;  4G0V A;  4A3C K;  3DXJ A;  3FOE A;  2P5M A;  1USO A;  1BGW A;  3RZD C;  2PA8 L;  4BLA A;  1YX2 A;  2BE5 A;  3LPX A;  1SFO C;  1IE0 A;  3CQZ A;  3S2H K;  5CJ9 A;  3S0X A;  2R7Z C;  1G51 A;  2CW0 A;  4C3I K;  5IP7 K;  3S1M C;  3I4M K;  3S17 C;  3CQZ C;  2JA7 C;  3GTQ A;  4MEY A;  4LR2 A;  5C4J C;  3GTP C;  3GIR A;  3NUH A;  4KC6 A;  3V4G A;  1WSV A;  1TWG C;  3HKZ L;  4O2D A;  3TFI A;  1F7V A;  5FLM K;  1WCM K;  4KAS A;  4A3C C;  3ADA C;  4A93 C;  4BY7 C;  3A8J A;  2E2H A;  4QIW L;  2W7V A; 
#chains in the Genus database with same CATH homology
 2V6U A;  1DCP A;  3HXA A;  4WIL A;  4C45 A;  4LOW A;  1RU0 A;  3JST A;  1DCO A;  1USO A;  2V6S A;  1F93 A;  1DCH A;  2EBB A;  1USM A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...