2V6TA

Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
total genus 29
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6tA00
4WILA 1DCPA 3JSTA 1USMA 4LOWA 4C45A 1DCHA 1USOA 2EBBA 2V6SA 1DCOA 3HXAA 1RU0A 1F93A 2V6UA 2V6TA
chains in the Genus database with same CATH superfamily
3HOWK 1WSVA 4Y52K 4GFQA 2W7VA 4GTFA 1IQ0A 4KAWX 2E2JC 2E2IC 2NVXC 1O2FB 4YFNA 2R7ZA 3T02A 3L4JA 3A8JA 3RZOK 3I4MC 1Y1WC 4A3CK 1XXCA 3I4NK 4KARA 1WSRA 3GTKK 3AQOA 2GAGC 4C3JC 1I50C 3HOXK 1O2BA 3HOYC 3GTJK 5C4JC 3HKZD 5M5WK 4LJZA 3S1MC 1O24A 2R92A 1K83C 3H0GK 5IYCC 1PJ6A 1O25A 1J6XA 3HOVK 2GSNA 3S14C 4A3GC 4DDQA 1R9TA 2VUMK 4LK0A 4KDDA 5IP7K 5M3MK 3N3YA 1WQGA 2PHCB 5FLMC 4A3MC 1TWGC 2R92K 1B4BA 1F9NA 1WCMA 4GTBA 5C4XC 3TFIA 3HOWC 3GTQC 2JA7C 1F93A 2NVTC 3HOUK 2PA8D 4A3IK 4A93C 3FKIA 2NVXK 3V4GA 4C3HC 3GTLA 3GTMC 3GTKA 3AD9C 4P5BA 4BBSC 2WAQD 1DCPA 4WJ4A 3I4NC 2R93C 4BY7K 4BY1C 5IP9K 5C3EC 5C44C 2CW0A 4LOWA 3QX3A 3GTQA 3S1MK 1WCMC 1WIHA 2JA6C 5M5YK 2NVYC 5M5XK 4A3JC 4PABA 3S17C 3BP3A 2GSUA 3G4CA 2VUMC 1I3QA 1TWCA 4P5AA 3GTGC 3S16C 5IP7C 4KC6A 1AB4A 5IOTA 3A8KA 5EGHA 1VH2A 3PO3C 4OIPA 2NVTK 4GTDA 2FQTA 3GTOC 1PJ5A 1ZQ1C 3GTLK 3AQPA 3GTMK 1Y1WA 5CHPA 1O2AA 3GTOA 3WODA 4KN4A 4BXXK 3TFHA 5JVOA 3S1RK 1JVIA 4AYBD 2E2IA 1WOSA 5M3FK 1TWFA 5C44K 2NVQC 3S2HC 2WB1D 2XCQA 4XSZA 3BUEA 4G0VA 2E2JK 1ISEA 3AD8C 2NVYK 2XCOA 4LR2A 5JFEA 4XLNA 2E2HC 4KN7A 3I4MK 4O2DA 4BLBA 5TJ3A 4A3EK 3S16K 4G7OA 2P5MA 3S2DK 4J3NA 2JA5K 3HOYK 4GTEA 2CFAB 4GTAA 4WILA 2B63K 5C4JK 4GZYA 1TWFK 1WOOA 2PA8L 4GTCA 4ZH4A 2R7ZK 4X6AK 1BGWA 1WORA 3HOZK 3GTLC 5CJ9A 3S14K 2BE5A 5HL8A 2V6TA 2PPBA 1USOA 5E68A 4BXXC 4A3LC 3GTPK 3A8IA 5C4XK 2GSOA 2Y0SD 2JA7K 5IYDC 4KM8A 1C0AA 3EQLA 3FKIC 4C45A 1EFWA 3AH5A 3GEHA 4KMDA 1XZQA 5TMFA 2R93K 4A3EC 4MQ9A 1I50A 1KQ4A 4WJ3M 2O5JA 2GAHC 3FHZA 1XPPA 3RZDC 1TWFC 2P8TA 3S0XA 2JA6K 2R7ZC 4X6AC 1K83A 2V6SA 1Y1VK 4A3JK 4JK1A 4OIOA 1YX2A 1VLOA 4M1XA 3LAJA 1XXAA 5FLMK 1TWGK 3GEEA 1TWCC 1JOEA 1X31C 1VJEA 4A3BC 2NVYA 3GTGA 2JA6A 4KMAA 5IYBK 1YCLA 3T01A 3LPXA 4KMUA 2VUMA 4G0WA 1YNNA 1JQWA 4QJVA 4BY1K 1XZQB 1G51A 1IS1A 4YFKA 4KASA 4Y52C 4Y7NC 1HQMA 4OIQA 2NVQK 3S2HK 2RH6A 1L0WA 3RZOC 1Y1WK 5L46A 3GTMA 4A3CC 2YU9A 2E2HK 3HXAA 4KB2A 1WOPA 2JA7A 3JSTA 3M3YC 2D6FC 4C3JK 1F7UA 3CQZA 2RGRA 4XSXA 2WAQL 3S2DC 3PO3K 3H3VL 4A3GK 1R9TC 1J6WA 5IYCK 5TMCA 1TWHK 4G7ZA 1SFOK 4BLAA 3HOVC 3HOZC 2R92C 4MEXA 3GSIA 3SZYA 1I6HC 4KATA 4KB4A 2E2HA 4QIWL 4XLPA 2KWAA 1WQFA 4A3KK 3K7AK 3G4AA 4A3LK 4C3HK 4QJVB 3HOUC 3IPJA 5EGEA 4A3IC 2ZUEA 4A93K 2A68A 1O26A 3GTPA 4LQYA 4FZBA 1O27A 2JA8K 2B63A 3HKZL 4BY7C 3CQZK 4NOIA 2PMZD 4Q4ZA 1I3QC 1DCOA 3M3YK 1SFOA 1WCMK 4G0UA 3BP8C 1YNJA 1RU0A 3S15K 1WQHA 2JA5A 3ADAC 3RZDK 2EBBA 5IOQA 4A3FK 4PAAA 1SMYA 3GTGK 1I50K 2JH3A 3HOXC 2A6HA 4G7HA 3K7AC 3H0GC 3S1QK 1IBAA 4FM9A 3GEIA 4A3DC 1O28A 2A6EA 1XZPA 1Y1VA 2FQOA 2R93A 5IORA 4AYBL 1ZXOA 1DD5A 5IYBC 1TWHA 3GTQK 3S1NC 1V5VA 3N0CA 2PMZL 3S1RC 5FJ8K 3FOFA 4YG2A 3H3VD 3T00A 4BBSK 1TWGA 3GIRA 3L4KA 3ERED 1INNA 1TWAC 3NUHA 1ZBSA 1EI6A 1BS2A 4YFXA 1K83K 4QIWD 4BBRK 2CFAA 3CAGA 2YU9K 1DCHA 1UV7A 2JA5C 2B63C 2NVXA 2V6UA 4P9SA 4GTLA 1R9TK 4A3DK 3GDZA 4MEYA 1F7VA 3M4OK 1SFOC 4XCHA 2WB1L 1B4AA 3MMLB 1J98A 4GT9A 1ZYRA 3S1NK 1TWAA 1IE0A 4A3KC 4KMHA 3GTPC 4C2MC 3OPFA 1EH1A 3FKIK 4Y7NK 4ILDA 4C3IC 5IYDK 1VRQC 4LLGA 2A69A 3PO2C 2O5IA 2JA8C 3TFJA 2Y3PA 1USMA 1ZVUA 5IP9C 5C3EK 1TWAK 1PJ7A 3CQZC 5D4DA 2XCRB 1I3QK 1XXBA 2E2IK 4Q5SA 3SZZA 3FOEA 4BBRC 1EQRA 3S17K 4AH6A 1EK8A 3TTGA 2YU9C 1IW7A 1Y1VC 1BDFA 3S15C 5IOSA 3GTJA 1TWHC 3N0BA 3GTKC 1IL2A 3M4OC 2ZFZA 3H0GA 4A3FC 2Y0SL 4RMFA 1I6HK 3GTJC 3OREA 4KM9A 3VA7A 3OEPA 3GTOK 3Q3QA 1I6VA 1TWCK 4LK1A 4BKWA 3AD7C 4C2MK 3S1QC 1J6VA 4OINA 1VGXA 4A3BK 4C3IK 1BJTA 3LAPA 3PO2K 1HI9A 1GE9A 2ZUFA 1XZPB 4A3MK 1O29A 3DXJA 4OIRA
chains in the Genus database with same CATH topology
4WILA 1DCPA 3JSTA 1USMA 4LOWA 4C45A 1DCHA 1USOA 2EBBA 2V6SA 1DCOA 3HXAA 1RU0A 1F93A 2V6UA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIL A;  1DCP A;  3JST A;  1USM A;  4LOW A;  4C45 A;  1DCH A;  1USO A;  2EBB A;  2V6S A;  1DCO A;  3HXA A;  1RU0 A;  1F93 A;  2V6U A;  2V6T A; 
#chains in the Genus database with same CATH topology
 3HOW K;  1WSV A;  4Y52 K;  4GFQ A;  2W7V A;  4GTF A;  1IQ0 A;  4KAW X;  2E2J C;  2E2I C;  2NVX C;  1O2F B;  4YFN A;  2R7Z A;  3T02 A;  3L4J A;  3A8J A;  3RZO K;  3I4M C;  1Y1W C;  4A3C K;  1XXC A;  3I4N K;  4KAR A;  1WSR A;  3GTK K;  3AQO A;  2GAG C;  4C3J C;  1I50 C;  3HOX K;  1O2B A;  3HOY C;  3GTJ K;  5C4J C;  3HKZ D;  5M5W K;  4LJZ A;  3S1M C;  1O24 A;  2R92 A;  1K83 C;  3H0G K;  5IYC C;  1PJ6 A;  1O25 A;  1J6X A;  3HOV K;  2GSN A;  3S14 C;  4A3G C;  4DDQ A;  1R9T A;  2VUM K;  4LK0 A;  4KDD A;  5IP7 K;  5M3M K;  3N3Y A;  1WQG A;  2PHC B;  5FLM C;  4A3M C;  1TWG C;  2R92 K;  1B4B A;  1F9N A;  1WCM A;  4GTB A;  5C4X C;  3TFI A;  3HOW C;  3GTQ C;  2JA7 C;  1F93 A;  2NVT C;  3HOU K;  2PA8 D;  4A3I K;  4A93 C;  3FKI A;  2NVX K;  3V4G A;  4C3H C;  3GTL A;  3GTM C;  3GTK A;  3AD9 C;  4P5B A;  4BBS C;  2WAQ D;  1DCP A;  4WJ4 A;  3I4N C;  2R93 C;  4BY7 K;  4BY1 C;  5IP9 K;  5C3E C;  5C44 C;  2CW0 A;  4LOW A;  3QX3 A;  3GTQ A;  3S1M K;  1WCM C;  1WIH A;  2JA6 C;  5M5Y K;  2NVY C;  5M5X K;  4A3J C;  4PAB A;  3S17 C;  3BP3 A;  2GSU A;  3G4C A;  2VUM C;  1I3Q A;  1TWC A;  4P5A A;  3GTG C;  3S16 C;  5IP7 C;  4KC6 A;  1AB4 A;  5IOT A;  3A8K A;  5EGH A;  1VH2 A;  3PO3 C;  4OIP A;  2NVT K;  4GTD A;  2FQT A;  3GTO C;  1PJ5 A;  1ZQ1 C;  3GTL K;  3AQP A;  3GTM K;  1Y1W A;  5CHP A;  1O2A A;  3GTO A;  3WOD A;  4KN4 A;  4BXX K;  3TFH A;  5JVO A;  3S1R K;  1JVI A;  4AYB D;  2E2I A;  1WOS A;  5M3F K;  1TWF A;  5C44 K;  2NVQ C;  3S2H C;  2WB1 D;  2XCQ A;  4XSZ A;  3BUE A;  4G0V A;  2E2J K;  1ISE A;  3AD8 C;  2NVY K;  2XCO A;  4LR2 A;  5JFE A;  4XLN A;  2E2H C;  4KN7 A;  3I4M K;  4O2D A;  4BLB A;  5TJ3 A;  4A3E K;  3S16 K;  4G7O A;  2P5M A;  3S2D K;  4J3N A;  2JA5 K;  3HOY K;  4GTE A;  2CFA B;  4GTA A;  4WIL A;  2B63 K;  5C4J K;  4GZY A;  1TWF K;  1WOO A;  2PA8 L;  4GTC A;  4ZH4 A;  2R7Z K;  4X6A K;  1BGW A;  1WOR A;  3HOZ K;  3GTL C;  5CJ9 A;  3S14 K;  2BE5 A;  5HL8 A;  2V6T A;  2PPB A;  1USO A;  5E68 A;  4BXX C;  4A3L C;  3GTP K;  3A8I A;  5C4X K;  2GSO A;  2Y0S D;  2JA7 K;  5IYD C;  4KM8 A;  1C0A A;  3EQL A;  3FKI C;  4C45 A;  1EFW A;  3AH5 A;  3GEH A;  4KMD A;  1XZQ A;  5TMF A;  2R93 K;  4A3E C;  4MQ9 A;  1I50 A;  1KQ4 A;  4WJ3 M;  2O5J A;  2GAH C;  3FHZ A;  1XPP A;  3RZD C;  1TWF C;  2P8T A;  3S0X A;  2JA6 K;  2R7Z C;  4X6A C;  1K83 A;  2V6S A;  1Y1V K;  4A3J K;  4JK1 A;  4OIO A;  1YX2 A;  1VLO A;  4M1X A;  3LAJ A;  1XXA A;  5FLM K;  1TWG K;  3GEE A;  1TWC C;  1JOE A;  1X31 C;  1VJE A;  4A3B C;  2NVY A;  3GTG A;  2JA6 A;  4KMA A;  5IYB K;  1YCL A;  3T01 A;  3LPX A;  4KMU A;  2VUM A;  4G0W A;  1YNN A;  1JQW A;  4QJV A;  4BY1 K;  1XZQ B;  1G51 A;  1IS1 A;  4YFK A;  4KAS A;  4Y52 C;  4Y7N C;  1HQM A;  4OIQ A;  2NVQ K;  3S2H K;  2RH6 A;  1L0W A;  3RZO C;  1Y1W K;  5L46 A;  3GTM A;  4A3C C;  2YU9 A;  2E2H K;  3HXA A;  4KB2 A;  1WOP A;  2JA7 A;  3JST A;  3M3Y C;  2D6F C;  4C3J K;  1F7U A;  3CQZ A;  2RGR A;  4XSX A;  2WAQ L;  3S2D C;  3PO3 K;  3H3V L;  4A3G K;  1R9T C;  1J6W A;  5IYC K;  5TMC A;  1TWH K;  4G7Z A;  1SFO K;  4BLA A;  3HOV C;  3HOZ C;  2R92 C;  4MEX A;  3GSI A;  3SZY A;  1I6H C;  4KAT A;  4KB4 A;  2E2H A;  4QIW L;  4XLP A;  2KWA A;  1WQF A;  4A3K K;  3K7A K;  3G4A A;  4A3L K;  4C3H K;  4QJV B;  3HOU C;  3IPJ A;  5EGE A;  4A3I C;  2ZUE A;  4A93 K;  2A68 A;  1O26 A;  3GTP A;  4LQY A;  4FZB A;  1O27 A;  2JA8 K;  2B63 A;  3HKZ L;  4BY7 C;  3CQZ K;  4NOI A;  2PMZ D;  4Q4Z A;  1I3Q C;  1DCO A;  3M3Y K;  1SFO A;  1WCM K;  4G0U A;  3BP8 C;  1YNJ A;  1RU0 A;  3S15 K;  1WQH A;  2JA5 A;  3ADA C;  3RZD K;  2EBB A;  5IOQ A;  4A3F K;  4PAA A;  1SMY A;  3GTG K;  1I50 K;  2JH3 A;  3HOX C;  2A6H A;  4G7H A;  3K7A C;  3H0G C;  3S1Q K;  1IBA A;  4FM9 A;  3GEI A;  4A3D C;  1O28 A;  2A6E A;  1XZP A;  1Y1V A;  2FQO A;  2R93 A;  5IOR A;  4AYB L;  1ZXO A;  1DD5 A;  5IYB C;  1TWH A;  3GTQ K;  3S1N C;  1V5V A;  3N0C A;  2PMZ L;  3S1R C;  5FJ8 K;  3FOF A;  4YG2 A;  3H3V D;  3T00 A;  4BBS K;  1TWG A;  3GIR A;  3L4K A;  3ERE D;  1INN A;  1TWA C;  3NUH A;  1ZBS A;  1EI6 A;  1BS2 A;  4YFX A;  1K83 K;  4QIW D;  4BBR K;  2CFA A;  3CAG A;  2YU9 K;  1DCH A;  1UV7 A;  2JA5 C;  2B63 C;  2NVX A;  2V6U A;  4P9S A;  4GTL A;  1R9T K;  4A3D K;  3GDZ A;  4MEY A;  1F7V A;  3M4O K;  1SFO C;  4XCH A;  2WB1 L;  1B4A A;  3MML B;  1J98 A;  4GT9 A;  1ZYR A;  3S1N K;  1TWA A;  1IE0 A;  4A3K C;  4KMH A;  3GTP C;  4C2M C;  3OPF A;  1EH1 A;  3FKI K;  4Y7N K;  4ILD A;  4C3I C;  5IYD K;  1VRQ C;  4LLG A;  2A69 A;  3PO2 C;  2O5I A;  2JA8 C;  3TFJ A;  2Y3P A;  1USM A;  1ZVU A;  5IP9 C;  5C3E K;  1TWA K;  1PJ7 A;  3CQZ C;  5D4D A;  2XCR B;  1I3Q K;  1XXB A;  2E2I K;  4Q5S A;  3SZZ A;  3FOE A;  4BBR C;  1EQR A;  3S17 K;  4AH6 A;  1EK8 A;  3TTG A;  2YU9 C;  1IW7 A;  1Y1V C;  1BDF A;  3S15 C;  5IOS A;  3GTJ A;  1TWH C;  3N0B A;  3GTK C;  1IL2 A;  3M4O C;  2ZFZ A;  3H0G A;  4A3F C;  2Y0S L;  4RMF A;  1I6H K;  3GTJ C;  3ORE A;  4KM9 A;  3VA7 A;  3OEP A;  3GTO K;  3Q3Q A;  1I6V A;  1TWC K;  4LK1 A;  4BKW A;  3AD7 C;  4C2M K;  3S1Q C;  1J6V A;  4OIN A;  1VGX A;  4A3B K;  4C3I K;  1BJT A;  3LAP A;  3PO2 K;  1HI9 A;  1GE9 A;  2ZUF A;  1XZP B;  4A3M K;  1O29 A;  3DXJ A;  4OIR A; 
#chains in the Genus database with same CATH homology
 4WIL A;  1DCP A;  3JST A;  1USM A;  4LOW A;  4C45 A;  1DCH A;  1USO A;  2EBB A;  2V6S A;  1DCO A;  3HXA A;  1RU0 A;  1F93 A;  2V6U A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...