4GTDA

T. maritima fdts (e144r mutant) with fad and dump
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 74
structure length 210
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtdA00
5IOTA 3G4AA 2CFAB 4GTCA 4P5AA 1O28A 1O26A 3N0CA 4GTBA 5IORA 3AH5A 4GTFA 3N3YA 1O29A 1O25A 5IOQA 4P5BA 1O2BA 1O2AA 1O24A 3N0BA 4FZBA 4KATA 4GTLA 4GTEA 5JFEA 3G4CA 5CHPA 4GTDA 4KARA 4KASA 2CFAA 1KQ4A 5IOSA 1O27A 4GT9A 4GTAA
chains in the Genus database with same CATH superfamily
4LQYA 3GEEA 4QIWL 4GTBA 3I4MC 1EI6A 1TWCK 5TMCA 3S2DK 5IYBK 3HXAA 4A3MK 4Y7NK 4A3GK 4Q4ZA 2NVYA 3S16K 2ZFZA 4A3JK 2NVXK 1J6XA 1EH1A 4XLNA 3HOYC 4KARA 5EGHA 4A3BK 1EQRA 5EGEA 3JSTA 2NVXA 3GTKA 2FQTA 4P5AA 1F7UA 4KN4A 1O29A 5C4JC 3I4MK 1GE9A 3MMLB 4BY7K 2A68A 5CJ9A 1Y1WK 1G51A 1WSRA 1TWCC 1UV7A 4YFXA 2FQOA 3H0GK 5C44C 1TWGA 1R9TA 4A3IK 4A93C 3HOZK 5M5XK 2NVTC 2BE5A 2VUMA 3DXJA 3K7AK 4C45A 4GTAA 2R92K 2CFAB 3S2DC 1JOEA 4LK0A 1YNJA 3PO2C 1TWGK 3HOUC 1ZXOA 3H0GA 3RZOK 5TMFA 2GAHC 4BBSK 5C44K 3HOYK 1TWAA 4G0UA 3S1NK 1K83K 3BP8C 3BUEA 2JA6C 1USMA 3AD9C 3S17C 4GZYA 3G4CA 2R7ZA 4KMHA 4BY7C 4JK1A 3M3YK 4A3CK 1IBAA 3TFHA 3VA7A 1IE0A 1F7VA 1TWAK 4QIWD 3OPFA 3GEIA 3BP3A 4BBRK 2JA8C 4KDDA 3LPXA 4QJVA 4O2DA 1WCMC 4BBSC 4OIQA 2V6SA 1Y1VK 3S16C 3GTPK 2ZUEA 1O2FB 4KN7A 5M3FK 3FOFA 3Q3QA 3SZYA 3GEHA 3H3VD 3S1QK 1VGXA 2V6UA 4GTEA 3S14C 2NVTK 3S15C 1I6HK 1ZYRA 4A3MC 4QJVB 2PA8L 4KMUA 3T00A 5IOSA 2PMZD 4LOWA 1WCMA 4GFQA 1ZVUA 1HI9A 3PO3K 4OIOA 2JA6A 4A3EK 4P9SA 3S14K 3S1RK 3LAJA 4KB2A 1YCLA 4C3JC 3I4NC 3GTKK 1XPPA 2GSUA 2R93C 4Y52C 4C2MC 2Y3PA 4A3KK 4KM8A 2B63K 4GTDA 2PPBA 4BY1C 3GTQA 3HOWC 4XSZA 3GTOA 4A3BC 2WAQL 1O27A 4Y52K 3FHZA 2CW0A 3S2HC 3G4AA 3GTLK 4A3KC 4A3FK 1PJ5A 2NVYC 1VJEA 4C2MK 3GTLC 3PO3C 2XCRB 1I3QA 3FOEA 2GSOA 5JVOA 3GTMA 1O2BA 3N0BA 2WAQD 3S15K 1I6HC 2GSNA 3PO2K 1XXAA 2JA5A 1SFOK 3S1MC 1JQWA 1EK8A 2R93A 3GTOC 4LJZA 4C3IC 2XCQA 5IYDK 2D6FC 3AD7C 5M5YK 3OREA 4G0WA 2JA5K 2VUMK 2GAGC 4BKWA 2YU9A 3L4JA 4KAWX 4G7OA 3HOWK 1O2AA 4OINA 1V5VA 3GDZA 3GTKC 1WOOA 1F93A 4A3CC 4G7HA 1J98A 2E2HC 1K83A 2PA8D 1PJ6A 1TWFA 3K7AC 4Q5SA 1O24A 3HOXK 3I4NK 5IYCC 3M3YC 4LLGA 1YNNA 2R92A 1I50A 2A69A 4A3EC 1TWHA 3AQOA 2ZUFA 2NVQC 3HOVK 3GTPA 2A6EA 1WSVA 1HQMA 4OIPA 1VH2A 1Y1VA 2JA7K 4PABA 2KWAA 4KM9A 4DDQA 3FKIK 5IOTA 3GTGK 4AYBL 3H0GC 2O5IA 4ILDA 1Y1WA 3AH5A 1ZBSA 4BBRC 1TWAC 3L4KA 3RZDC 1TWFC 3TFIA 4NOIA 1AB4A 1DD5A 4BXXC 4FZBA 2E2JK 1I50K 2P5MA 4A93K 1J6VA 3T02A 5IP7K 4C3HC 3QX3A 1I6VA 4KASA 4A3LC 2E2IA 1IW7A 2JA8K 4BY1K 4A3GC 3OEPA 3RZDK 4A3DK 5IORA 1X31C 2R92C 2R7ZK 3A8KA 4MQ9A 1BS2A 1DCHA 3GTMC 3CQZK 3S1RC 3HKZL 1R9TC 4MEXA 4A3IC 3RZOC 4AH6A 2JA7C 1DCOA 1XZPB 2NVQK 3S1NC 3GTGC 5JFEA 2VUMC 1Y1WC 1WQGA 3EQLA 2E2JC 1KQ4A 3SZZA 5TJ3A 1WOSA 1TWGC 4WJ3M 4GT9A 3HOZC 5FLMK 4OIRA 2EBBA 4GTFA 1JVIA 1XXBA 1SFOA 1XXCA 4AYBD 5FJ8K 4GTLA 5HL8A 4A3JC 2NVYK 3T01A 2V6TA 4A3FC 5C4XC 1I3QK 1WIHA 5IP9C 2R7ZC 5D4DA 3GTJK 2YU9C 4A3LK 2RGRA 4PAAA 4YFKA 1O26A 1YX2A 3M4OC 3GTGA 1K83C 2O5JA 5IP7C 3TFJA 2B63C 1O25A 3CQZA 2NVXC 4P5BA 4KMDA 3TTGA 1RU0A 1L0WA 2WB1D 3GTQK 3HOUK 4KC6A 3A8IA 3IPJA 2JA5C 4G7ZA 4YG2A 5L46A 1I50C 5M3MK 1C0AA 3GIRA 1TWCA 5C3EK 4Y7NC 2E2HA 3FKIC 1TWFK 4M1XA 3AQPA 1VRQC 4FM9A 1F9NA 1J6WA 1WQFA 3V4GA 1TWHK 5IOQA 3GTMK 1XZQA 2P8TA 5IYCK 3H3VL 3HOVC 5C4JK 3GTQC 3WODA 1Y1VC 2Y0SD 4A3DC 1ISEA 1IL2A 2PMZL 1EFWA 4MEYA 2E2IC 1XZPA 3S0XA 4X6AK 3GTJC 2YU9K 4XLPA 1BDFA 1XZQB 5C4XK 3N0CA 4LR2A 1SMYA 4J3NA 3S17K 1IS1A 4KMAA 1USOA 3FKIA 3S2HK 1WOPA 5IYBC 3LAPA 4ZH4A 1PJ7A 1WORA 2XCOA 2JA7A 1DCPA 5C3EC 5CHPA 2W7VA 5E68A 2JH3A 4WILA 4G0VA 1ZQ1C 5IYDC 4WJ4A 4XSXA 1INNA 3GTJA 3GSIA 3GTLA 4XCHA 4RMFA 3S1QC 5M5WK 1BGWA 1BJTA 4C3IK 3HOXC 3GTOK 2A6HA 4LK1A 4BLBA 1WCMK 1B4BA 1SFOC 3S1MK 3CAGA 5IP9K 4YFNA 3M4OK 2E2HK 3ADAC 1B4AA 3ERED 2R93K 2CFAA 4C3JK 3GTPC 4GTCA 1WQHA 1O28A 4C3HK 3N3YA 2PHCB 2B63A 2Y0SL 3HKZD 3A8JA 2E2IK 4X6AC 2RH6A 4KATA 1I3QC 1IQ0A 4BXXK 1VLOA 5FLMC 2WB1L 2JA6K 3NUHA 4BLAA 3AD8C 1R9TK 3CQZC 1TWHC 4KB4A
chains in the Genus database with same CATH topology
5IOTA 4LQYA 1WCMA 1F9NA 1ZVUA 4GFQA 4GTBA 1WQFA 4ILDA 2JA6A 1Y1WA 3AH5A 3V4GA 1ZBSA 5IOQA 3LAJA 4KB2A 4C3JC 3L4KA 1AB4A 1DD5A 2GSUA 4FZBA 2NVYA 4C2MC 2Y3PA 2ZFZA 2P5MA 1EH1A 1ISEA 4KM8A 4C3HC 4GTDA 3QX3A 4KARA 5EGHA 3GTQA 4KASA 2E2IA 3S0XA 3GTOA 5EGEA 1O27A 3FHZA 2NVXA 3GTKA 3G4AA 3OEPA 4P5AA 3N0CA 4LR2A 4J3NA 5IORA 1O29A 1IS1A 4KMAA 1I3QA 2XCRB 1GE9A 3FOEA 2GSOA 3FKIA 3MMLB 5JVOA 3GTMA 3LAPA 1O2BA 3N0BA 5CJ9A 2XCOA 2JA7A 5JFEA 1TWGA 2GSNA 5CHPA 1R9TA 1WQGA 1XXAA 2JH3A 2JA5A 4G0VA 1EK8A 2R93A 3GTJA 1KQ4A 5TJ3A 4C3IC 2VUMA 2XCQA 4GT9A 4GTAA 3GTLA 2CFAB 3OREA 4G0WA 1BGWA 4GTFA 1BJTA 1XXBA 1ZXOA 4BKWA 2YU9A 3H0GA 4BLBA 3L4JA 1B4BA 4KAWX 1SFOA 1XXCA 3CAGA 1O2AA 1TWAA 4GTLA 4G0UA 3BUEA 3G4CA 2R7ZA 1B4AA 4KMHA 3ERED 2CFAA 3VA7A 1WIHA 3OPFA 4KDDA 3LPXA 4GTCA 2RGRA 1WQHA 1O28A 1O26A 3GTGA 1K83A 3N3YA 2PHCB 1O25A 3CQZA 2B63A 4P5BA 4KMDA 1TWFA 2RH6A 1O24A 4KATA 3FOFA 4KC6A 3Q3QA 2R92A 1I50A 4GTEA 1TWHA 3AQOA 1TWCA 3NUHA 2E2HA 3GTPA 4BLAA 1Y1VA 4M1XA 3AQPA 2KWAA 4KM9A 5IOSA 4FM9A 4KB4A 4DDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOT A;  3G4A A;  2CFA B;  4GTC A;  4P5A A;  1O28 A;  1O26 A;  3N0C A;  4GTB A;  5IOR A;  3AH5 A;  4GTF A;  3N3Y A;  1O29 A;  1O25 A;  5IOQ A;  4P5B A;  1O2B A;  1O2A A;  1O24 A;  3N0B A;  4FZB A;  4KAT A;  4GTL A;  4GTE A;  5JFE A;  3G4C A;  5CHP A;  4GTD A;  4KAR A;  4KAS A;  2CFA A;  1KQ4 A;  5IOS A;  1O27 A;  4GT9 A;  4GTA A; 
#chains in the Genus database with same CATH topology
 4LQY A;  3GEE A;  4QIW L;  4GTB A;  3I4M C;  1EI6 A;  1TWC K;  5TMC A;  3S2D K;  5IYB K;  3HXA A;  4A3M K;  4Y7N K;  4A3G K;  4Q4Z A;  2NVY A;  3S16 K;  2ZFZ A;  4A3J K;  2NVX K;  1J6X A;  1EH1 A;  4XLN A;  3HOY C;  4KAR A;  5EGH A;  4A3B K;  1EQR A;  5EGE A;  3JST A;  2NVX A;  3GTK A;  2FQT A;  4P5A A;  1F7U A;  4KN4 A;  1O29 A;  5C4J C;  3I4M K;  1GE9 A;  3MML B;  4BY7 K;  2A68 A;  5CJ9 A;  1Y1W K;  1G51 A;  1WSR A;  1TWC C;  1UV7 A;  4YFX A;  2FQO A;  3H0G K;  5C44 C;  1TWG A;  1R9T A;  4A3I K;  4A93 C;  3HOZ K;  5M5X K;  2NVT C;  2BE5 A;  2VUM A;  3DXJ A;  3K7A K;  4C45 A;  4GTA A;  2R92 K;  2CFA B;  3S2D C;  1JOE A;  4LK0 A;  1YNJ A;  3PO2 C;  1TWG K;  3HOU C;  1ZXO A;  3H0G A;  3RZO K;  5TMF A;  2GAH C;  4BBS K;  5C44 K;  3HOY K;  1TWA A;  4G0U A;  3S1N K;  1K83 K;  3BP8 C;  3BUE A;  2JA6 C;  1USM A;  3AD9 C;  3S17 C;  4GZY A;  3G4C A;  2R7Z A;  4KMH A;  4BY7 C;  4JK1 A;  3M3Y K;  4A3C K;  1IBA A;  3TFH A;  3VA7 A;  1IE0 A;  1F7V A;  1TWA K;  4QIW D;  3OPF A;  3GEI A;  3BP3 A;  4BBR K;  2JA8 C;  4KDD A;  3LPX A;  4QJV A;  4O2D A;  1WCM C;  4BBS C;  4OIQ A;  2V6S A;  1Y1V K;  3S16 C;  3GTP K;  2ZUE A;  1O2F B;  4KN7 A;  5M3F K;  3FOF A;  3Q3Q A;  3SZY A;  3GEH A;  3H3V D;  3S1Q K;  1VGX A;  2V6U A;  4GTE A;  3S14 C;  2NVT K;  3S15 C;  1I6H K;  1ZYR A;  4A3M C;  4QJV B;  2PA8 L;  4KMU A;  3T00 A;  5IOS A;  2PMZ D;  4LOW A;  1WCM A;  4GFQ A;  1ZVU A;  1HI9 A;  3PO3 K;  4OIO A;  2JA6 A;  4A3E K;  4P9S A;  3S14 K;  3S1R K;  3LAJ A;  4KB2 A;  1YCL A;  4C3J C;  3I4N C;  3GTK K;  1XPP A;  2GSU A;  2R93 C;  4Y52 C;  4C2M C;  2Y3P A;  4A3K K;  4KM8 A;  2B63 K;  4GTD A;  2PPB A;  4BY1 C;  3GTQ A;  3HOW C;  4XSZ A;  3GTO A;  4A3B C;  2WAQ L;  1O27 A;  4Y52 K;  3FHZ A;  2CW0 A;  3S2H C;  3G4A A;  3GTL K;  4A3K C;  4A3F K;  1PJ5 A;  2NVY C;  1VJE A;  4C2M K;  3GTL C;  3PO3 C;  2XCR B;  1I3Q A;  3FOE A;  2GSO A;  5JVO A;  3GTM A;  1O2B A;  3N0B A;  2WAQ D;  3S15 K;  1I6H C;  2GSN A;  3PO2 K;  1XXA A;  2JA5 A;  1SFO K;  3S1M C;  1JQW A;  1EK8 A;  2R93 A;  3GTO C;  4LJZ A;  4C3I C;  2XCQ A;  5IYD K;  2D6F C;  3AD7 C;  5M5Y K;  3ORE A;  4G0W A;  2JA5 K;  2VUM K;  2GAG C;  4BKW A;  2YU9 A;  3L4J A;  4KAW X;  4G7O A;  3HOW K;  1O2A A;  4OIN A;  1V5V A;  3GDZ A;  3GTK C;  1WOO A;  1F93 A;  4A3C C;  4G7H A;  1J98 A;  2E2H C;  1K83 A;  2PA8 D;  1PJ6 A;  1TWF A;  3K7A C;  4Q5S A;  1O24 A;  3HOX K;  3I4N K;  5IYC C;  3M3Y C;  4LLG A;  1YNN A;  2R92 A;  1I50 A;  2A69 A;  4A3E C;  1TWH A;  3AQO A;  2ZUF A;  2NVQ C;  3HOV K;  3GTP A;  2A6E A;  1WSV A;  1HQM A;  4OIP A;  1VH2 A;  1Y1V A;  2JA7 K;  4PAB A;  2KWA A;  4KM9 A;  4DDQ A;  3FKI K;  5IOT A;  3GTG K;  4AYB L;  3H0G C;  2O5I A;  4ILD A;  1Y1W A;  3AH5 A;  1ZBS A;  4BBR C;  1TWA C;  3L4K A;  3RZD C;  1TWF C;  3TFI A;  4NOI A;  1AB4 A;  1DD5 A;  4BXX C;  4FZB A;  2E2J K;  1I50 K;  2P5M A;  4A93 K;  1J6V A;  3T02 A;  5IP7 K;  4C3H C;  3QX3 A;  1I6V A;  4KAS A;  4A3L C;  2E2I A;  1IW7 A;  2JA8 K;  4BY1 K;  4A3G C;  3OEP A;  3RZD K;  4A3D K;  5IOR A;  1X31 C;  2R92 C;  2R7Z K;  3A8K A;  4MQ9 A;  1BS2 A;  1DCH A;  3GTM C;  3CQZ K;  3S1R C;  3HKZ L;  1R9T C;  4MEX A;  4A3I C;  3RZO C;  4AH6 A;  2JA7 C;  1DCO A;  1XZP B;  2NVQ K;  3S1N C;  3GTG C;  5JFE A;  2VUM C;  1Y1W C;  1WQG A;  3EQL A;  2E2J C;  1KQ4 A;  3SZZ A;  5TJ3 A;  1WOS A;  1TWG C;  4WJ3 M;  4GT9 A;  3HOZ C;  5FLM K;  4OIR A;  2EBB A;  4GTF A;  1JVI A;  1XXB A;  1SFO A;  1XXC A;  4AYB D;  5FJ8 K;  4GTL A;  5HL8 A;  4A3J C;  2NVY K;  3T01 A;  2V6T A;  4A3F C;  5C4X C;  1I3Q K;  1WIH A;  5IP9 C;  2R7Z C;  5D4D A;  3GTJ K;  2YU9 C;  4A3L K;  2RGR A;  4PAA A;  4YFK A;  1O26 A;  1YX2 A;  3M4O C;  3GTG A;  1K83 C;  2O5J A;  5IP7 C;  3TFJ A;  2B63 C;  1O25 A;  3CQZ A;  2NVX C;  4P5B A;  4KMD A;  3TTG A;  1RU0 A;  1L0W A;  2WB1 D;  3GTQ K;  3HOU K;  4KC6 A;  3A8I A;  3IPJ A;  2JA5 C;  4G7Z A;  4YG2 A;  5L46 A;  1I50 C;  5M3M K;  1C0A A;  3GIR A;  1TWC A;  5C3E K;  4Y7N C;  2E2H A;  3FKI C;  1TWF K;  4M1X A;  3AQP A;  1VRQ C;  4FM9 A;  1F9N A;  1J6W A;  1WQF A;  3V4G A;  1TWH K;  5IOQ A;  3GTM K;  1XZQ A;  2P8T A;  5IYC K;  3H3V L;  3HOV C;  5C4J K;  3GTQ C;  3WOD A;  1Y1V C;  2Y0S D;  4A3D C;  1ISE A;  1IL2 A;  2PMZ L;  1EFW A;  4MEY A;  2E2I C;  1XZP A;  3S0X A;  4X6A K;  3GTJ C;  2YU9 K;  4XLP A;  1BDF A;  1XZQ B;  5C4X K;  3N0C A;  4LR2 A;  1SMY A;  4J3N A;  3S17 K;  1IS1 A;  4KMA A;  1USO A;  3FKI A;  3S2H K;  1WOP A;  5IYB C;  3LAP A;  4ZH4 A;  1PJ7 A;  1WOR A;  2XCO A;  2JA7 A;  1DCP A;  5C3E C;  5CHP A;  2W7V A;  5E68 A;  2JH3 A;  4WIL A;  4G0V A;  1ZQ1 C;  5IYD C;  4WJ4 A;  4XSX A;  1INN A;  3GTJ A;  3GSI A;  3GTL A;  4XCH A;  4RMF A;  3S1Q C;  5M5W K;  1BGW A;  1BJT A;  4C3I K;  3HOX C;  3GTO K;  2A6H A;  4LK1 A;  4BLB A;  1WCM K;  1B4B A;  1SFO C;  3S1M K;  3CAG A;  5IP9 K;  4YFN A;  3M4O K;  2E2H K;  3ADA C;  1B4A A;  3ERE D;  2R93 K;  2CFA A;  4C3J K;  3GTP C;  4GTC A;  1WQH A;  1O28 A;  4C3H K;  3N3Y A;  2PHC B;  2B63 A;  2Y0S L;  3HKZ D;  3A8J A;  2E2I K;  4X6A C;  2RH6 A;  4KAT A;  1I3Q C;  1IQ0 A;  4BXX K;  1VLO A;  5FLM C;  2WB1 L;  2JA6 K;  3NUH A;  4BLA A;  3AD8 C;  1R9T K;  3CQZ C;  1TWH C;  4KB4 A; 
#chains in the Genus database with same CATH homology
 5IOT A;  4LQY A;  1WCM A;  1F9N A;  1ZVU A;  4GFQ A;  4GTB A;  1WQF A;  4ILD A;  2JA6 A;  1Y1W A;  3AH5 A;  3V4G A;  1ZBS A;  5IOQ A;  3LAJ A;  4KB2 A;  4C3J C;  3L4K A;  1AB4 A;  1DD5 A;  2GSU A;  4FZB A;  2NVY A;  4C2M C;  2Y3P A;  2ZFZ A;  2P5M A;  1EH1 A;  1ISE A;  4KM8 A;  4C3H C;  4GTD A;  3QX3 A;  4KAR A;  5EGH A;  3GTQ A;  4KAS A;  2E2I A;  3S0X A;  3GTO A;  5EGE A;  1O27 A;  3FHZ A;  2NVX A;  3GTK A;  3G4A A;  3OEP A;  4P5A A;  3N0C A;  4LR2 A;  4J3N A;  5IOR A;  1O29 A;  1IS1 A;  4KMA A;  1I3Q A;  2XCR B;  1GE9 A;  3FOE A;  2GSO A;  3FKI A;  3MML B;  5JVO A;  3GTM A;  3LAP A;  1O2B A;  3N0B A;  5CJ9 A;  2XCO A;  2JA7 A;  5JFE A;  1TWG A;  2GSN A;  5CHP A;  1R9T A;  1WQG A;  1XXA A;  2JH3 A;  2JA5 A;  4G0V A;  1EK8 A;  2R93 A;  3GTJ A;  1KQ4 A;  5TJ3 A;  4C3I C;  2VUM A;  2XCQ A;  4GT9 A;  4GTA A;  3GTL A;  2CFA B;  3ORE A;  4G0W A;  1BGW A;  4GTF A;  1BJT A;  1XXB A;  1ZXO A;  4BKW A;  2YU9 A;  3H0G A;  4BLB A;  3L4J A;  1B4B A;  4KAW X;  1SFO A;  1XXC A;  3CAG A;  1O2A A;  1TWA A;  4GTL A;  4G0U A;  3BUE A;  3G4C A;  2R7Z A;  1B4A A;  4KMH A;  3ERE D;  2CFA A;  3VA7 A;  1WIH A;  3OPF A;  4KDD A;  3LPX A;  4GTC A;  2RGR A;  1WQH A;  1O28 A;  1O26 A;  3GTG A;  1K83 A;  3N3Y A;  2PHC B;  1O25 A;  3CQZ A;  2B63 A;  4P5B A;  4KMD A;  1TWF A;  2RH6 A;  1O24 A;  4KAT A;  3FOF A;  4KC6 A;  3Q3Q A;  2R92 A;  1I50 A;  4GTE A;  1TWH A;  3AQO A;  1TWC A;  3NUH A;  2E2H A;  3GTP A;  4BLA A;  1Y1V A;  4M1X A;  3AQP A;  2KWA A;  4KM9 A;  5IOS A;  4FM9 A;  4KB4 A;  4DDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...