4GTDA

T. maritima fdts (e144r mutant) with fad and dump
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 210
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtdA00
5IOQA 5IOTA 1O28A 3N0BA 5IOSA 4KARA 4GTEA 4P5BA 4GTAA 4GTBA 5JFEA 4GTLA 3N3YA 4KATA 1O24A 4GTCA 4GTFA 4GTDA 4P5AA 5IORA 2CFAB 1O26A 3G4AA 3G4CA 4FZBA 4KASA 5CHPA 3AH5A 2CFAA 1KQ4A 4GT9A 1O29A 1O2BA 1O25A 3N0CA 1O2AA 1O27A
chains in the Genus database with same CATH superfamily
5IOQA 4OIQA 2E2IC 3A8KA 3PO2C 2E2IA 1TWGC 2PMZD 1BJTA 1XZQB 4KAWX 2D6FC 4GZYA 1TWGA 2GAGC 2Y3PA 4MEXA 1WQGA 3TFIA 1J6XA 2GSNA 4A3JK 1G51A 1INNA 2VUMK 4Y52K 1IBAA 4C45A 4J3NA 4BBRC 3N0BA 4BY7C 5M3MK 3DXJA 1I6HC 2NVYK 2JA5C 2B63C 4ZH4A 5IORA 1J6VA 2JH3A 3RZDK 4XSZA 3GTJC 1O26A 2YU9K 2JA5A 2JA6K 4P9SA 2WB1L 3HOYK 3GTJA 2R93K 3SZZA 4A3EK 1TWFK 3WODA 1WQHA 4XLNA 1F93A 1VGXA 3AD7C 3M4OC 3HOVK 3I4NK 3GTLC 1HI9A 3GTPC 3FHZA 3S1RC 2PA8L 4G0VA 3GTLA 5C4JK 3HOUC 3GTPA 3OEPA 1HQMA 4KMDA 3HOWK 4A3BC 1Y1VC 3M3YK 3S0XA 2BE5A 3MMLB 1Y1VA 1IL2A 1EFWA 1L0WA 1TWAC 1XXCA 5IYBC 3EQLA 1F9NA 4ILDA 3HOZK 3FKIC 1TWAA 4BY1K 3BP8C 3GTQK 3S1NC 4JK1A 3GEIA 4A3CC 4NOIA 1WSVA 3SZYA 1TWHC 4KMHA 3FKIA 2NVQK 3CQZK 4KN7A 1TWHA 4XLPA 3L4KA 3S2HK 2XCQA 2R7ZC 3I4MK 2EBBA 2O5IA 4G0UA 2NVXK 5IP7C 5C3EK 2P5MA 2WAQL 2V6TA 2R7ZA 1JVIA 4O2DA 1DCPA 3N0CA 3S16C 4Y7NK 2Y0SD 4A3FK 3GTOK 3GTGC 4A3DC 2E2IK 4KB4A 3FOFA 4A3LK 1WOSA 4DDQA 4A3KC 4KARA 3PO3C 3GTGA 1Y1WK 4GTLA 1TWGK 1SFOK 3H0GC 1USOA 3RZOK 3H0GA 5C4XK 1XXBA 3OREA 3IPJA 4PABA 4LK1A 4KM8A 2V6SA 1TWCK 2ZUEA 4A93C 3HOXC 1IS1A 5IYDC 3S2DC 4BXXK 1ZYRA 4OIPA 2B63K 4GTCA 4X6AK 1J98A 1XZQA 5TJ3A 1IW7A 5IYCC 3BUEA 3S14K 3TFHA 3GSIA 3AD8C 4AYBL 5M5YK 1I3QK 1WCMK 3S15K 1O27A 2E2HC 3GDZA 5TMFA 4C3IC 2JA8K 5TMCA 5IP9K 1YNJA 4Q4ZA 1B4BA 3GTKK 3JSTA 3V4GA 2E2HA 2PMZL 4KDDA 4YFKA 4KC6A 3S1RK 3S1QK 1I50K 3GIRA 4KATA 2PHCB 1K83C 3GTMC 2O5JA 4C2MK 1EK8A 1R9TC 2GSUA 1K83A 5CHPA 3GTMA 1PJ6A 1UV7A 1R9TA 4A3MK 3S1MC 5M3FK 3K7AK 3OPFA 3A8JA 4MQ9A 4G0WA 1ZVUA 1WOOA 1F7VA 3HKZD 2CFAB 4XCHA 3H3VD 5FLMK 4A3JC 1WQFA 2GSOA 4AH6A 2NVTK 2VUMC 3LAPA 1O29A 4Y52C 2VUMA 2E2JK 1XZPB 3S17K 4A3IK 3AQOA 1V5VA 2JA7K 2KWAA 4GTEA 1VH2A 4GTAA 4RMFA 5C44K 2NVYC 5JFEA 4LJZA 2R92K 3RZDC 2NVYA 5E68A 2YU9C 4Q5SA 2JA6C 1GE9A 2V6UA 3Q3QA 1PJ7A 2A69A 4OINA 3LPXA 3HOYC 4C3JK 2YU9A 2R93C 4MEYA 2JA6A 4A3EC 1TWFC 3AH5A 4A3GK 1KQ4A 3GEEA 1WOPA 1F7UA 5HL8A 4QJVB 2R93A 3CAGA 4YG2A 3TTGA 1TWFA 2P8TA 5M5XK 4M1XA 4P5AA 3HOVC 3I4NC 1ZXOA 4C3HK 1ISEA 4G7OA 4BBSK 4P5BA 1C0AA 5C4JC 3PO2K 1YCLA 1DCHA 1I6VA 3HOWC 3M3YC 3G4AA 3G4CA 2FQOA 2ZFZA 4LK0A 4LLGA 3AQPA 2XCOA 4LR2A 3HXAA 2Y0SL 4KM9A 3HOZC 1PJ5A 1XXAA 4BY1C 3GTQC 4BBRK 2NVQC 3CQZC 4GTBA 3GTQA 1ZBSA 4BY7K 3L4JA 3T02A 3S2HC 3CQZA 1EQRA 1I6HK 1AB4A 4GTFA 3I4MC 4GTDA 2JA5K 2NVXC 5C3EC 3GTJK 4G7ZA 2NVXA 4Y7NC 4A3FC 3GEHA 3GTOC 1O2AA 2FQTA 5CJ9A 4A3LC 3GTOA 1YX2A 3M4OK 3TFJA 1VLOA 1Y1WC 1WORA 3GTLK 1SFOC 3GTPK 1SMYA 1Y1WA 4GFQA 3RZOC 1YNNA 1SFOA 1O24A 5C4XC 3HOUK 3VA7A 5L46A 3A8IA 1TWCC 2WB1D 4KASA 2ZUFA 4A3BK 1Y1VK 1TWCA 1O2FB 1DCOA 4KN4A 5IOTA 3BP3A 1O28A 1TWAK 1EI6A 4BXXC 5IYBK 2A6HA 1WIHA 5M5WK 3FKIK 2PA8D 2A68A 3N3YA 4LOWA 3ERED 3S1NK 4A3CK 1VRQC 4X6AC 1TWHK 4KMUA 1USMA 2RH6A 4WILA 2B63A 3QX3A 1B4AA 3S14C 2R7ZK 1IQ0A 1IE0A 4LQYA 1I3QC 1ZQ1C 3NUHA 1WCMC 2CFAA 5IP7K 4PAAA 4GT9A 3S15C 1O25A 1I3QA 2JA8C 5IP9C 1WCMA 4FM9A 3GTKC 3S16K 2XCRB 1XZPA 3GTGK 3S1QC 3GTKA 4A3DK 1I50C 1BS2A 4A3KK 1BDFA 3PO3K 1I50A 1WSRA 3HKZL 3H0GK 4C2MC 5EGHA 3H3VL 4OIRA 1BGWA 2WAQD 2GAHC 4A3MC 3T01A 2A6EA 3K7AC 1JOEA 3LAJA 4A93K 1RU0A 2CW0A 5FJ8K 3HOXK 4QIWD 4QJVA 5IYDK 3S2DK 1EH1A 4WJ4A 5EGEA 4KB2A 5FLMC 4XSXA 4BLBA 2NVTC 2PPBA 4FZBA 2RGRA 2E2JC 5IYCK 4OIOA 3S17C 1O2BA 4A3IC 5D4DA 1VJEA 4BKWA 1XPPA 3ADAC 1J6WA 4QIWL 3FOEA 1DD5A 2JA7C 5JVOA 4YFXA 2E2HK 4C3IK 1X31C 5IOSA 5C44C 2W7VA 2JA7A 2R92C 4BLAA 4KMAA 4YFNA 3T00A 2R92A 4WJ3M 4C3JC 1K83K 4A3GC 3GTMK 1R9TK 4AYBD 3S1MK 4G7HA 1JQWA 3AD9C 4C3HC 4BBSC
chains in the Genus database with same CATH topology
5IOQA 3AQOA 5IOTA 1O28A 4KB4A 3FOFA 2KWAA 4DDQA 4KARA 4GTEA 1WIHA 2E2IA 4GTAA 3GTGA 1BJTA 5JFEA 4GTLA 3N3YA 3ERED 4KAWX 1TWGA 2NVYA 2Y3PA 2RH6A 2B63A 1GE9A 3H0GA 3Q3QA 1WQGA 3QX3A 1B4AA 1XXBA 3LPXA 3OREA 2GSNA 2YU9A 4LQYA 4KM8A 2JA6A 3AH5A 3NUHA 2CFAA 1KQ4A 4GT9A 1O25A 2R93A 3CAGA 1I3QA 1TWFA 1WCMA 4M1XA 4P5AA 4FM9A 1IS1A 1ZXOA 2XCRB 4J3NA 1ISEA 3N0BA 4P5BA 3GTKA 1I50A 4GTCA 5IORA 4C2MC 5EGHA 2JH3A 1BGWA 1O26A 3G4AA 2JA5A 3G4CA 5TJ3A 3BUEA 2ZFZA 3GTJA 3AQPA 2XCOA 4LR2A 3LAJA 1WQHA 1O27A 4KM9A 1XXAA 4C3IC 1B4BA 3V4GA 2E2HA 3FHZA 3GTQA 4GTBA 1ZBSA 4KDDA 1EH1A 4KC6A 4G0VA 3GTLA 3L4JA 3GTPA 4KATA 5EGEA 3CQZA 4KB2A 1AB4A 4GTFA 2PHCB 3OEPA 4GTDA 4BLBA 4KMDA 1EK8A 2GSUA 1K83A 2NVXA 4FZBA 5CHPA 2RGRA 3S0XA 3GTMA 3MMLB 1R9TA 1O2BA 1Y1VA 1O2AA 5CJ9A 4BKWA 1XXCA 3OPFA 3FOEA 1DD5A 5JVOA 3GTOA 1F9NA 4ILDA 1TWAA 5IOSA 2JA7A 4G0WA 4KMHA 3FKIA 4KMAA 4BLAA 1ZVUA 1Y1WA 4GFQA 1SFOA 1O24A 2R92A 1TWHA 3L4KA 2CFAB 4C3JC 2XCQA 3VA7A 1WQFA 2GSOA 4G0UA 3LAPA 2P5MA 4KASA 2R7ZA 1O29A 1TWCA 2VUMA 3N0CA 4C3HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOQ A;  5IOT A;  1O28 A;  3N0B A;  5IOS A;  4KAR A;  4GTE A;  4P5B A;  4GTA A;  4GTB A;  5JFE A;  4GTL A;  3N3Y A;  4KAT A;  1O24 A;  4GTC A;  4GTF A;  4GTD A;  4P5A A;  5IOR A;  2CFA B;  1O26 A;  3G4A A;  3G4C A;  4FZB A;  4KAS A;  5CHP A;  3AH5 A;  2CFA A;  1KQ4 A;  4GT9 A;  1O29 A;  1O2B A;  1O25 A;  3N0C A;  1O2A A;  1O27 A; 
#chains in the Genus database with same CATH topology
 5IOQ A;  4OIQ A;  2E2I C;  3A8K A;  3PO2 C;  2E2I A;  1TWG C;  2PMZ D;  1BJT A;  1XZQ B;  4KAW X;  2D6F C;  4GZY A;  1TWG A;  2GAG C;  2Y3P A;  4MEX A;  1WQG A;  3TFI A;  1J6X A;  2GSN A;  4A3J K;  1G51 A;  1INN A;  2VUM K;  4Y52 K;  1IBA A;  4C45 A;  4J3N A;  4BBR C;  3N0B A;  4BY7 C;  5M3M K;  3DXJ A;  1I6H C;  2NVY K;  2JA5 C;  2B63 C;  4ZH4 A;  5IOR A;  1J6V A;  2JH3 A;  3RZD K;  4XSZ A;  3GTJ C;  1O26 A;  2YU9 K;  2JA5 A;  2JA6 K;  4P9S A;  2WB1 L;  3HOY K;  3GTJ A;  2R93 K;  3SZZ A;  4A3E K;  1TWF K;  3WOD A;  1WQH A;  4XLN A;  1F93 A;  1VGX A;  3AD7 C;  3M4O C;  3HOV K;  3I4N K;  3GTL C;  1HI9 A;  3GTP C;  3FHZ A;  3S1R C;  2PA8 L;  4G0V A;  3GTL A;  5C4J K;  3HOU C;  3GTP A;  3OEP A;  1HQM A;  4KMD A;  3HOW K;  4A3B C;  1Y1V C;  3M3Y K;  3S0X A;  2BE5 A;  3MML B;  1Y1V A;  1IL2 A;  1EFW A;  1L0W A;  1TWA C;  1XXC A;  5IYB C;  3EQL A;  1F9N A;  4ILD A;  3HOZ K;  3FKI C;  1TWA A;  4BY1 K;  3BP8 C;  3GTQ K;  3S1N C;  4JK1 A;  3GEI A;  4A3C C;  4NOI A;  1WSV A;  3SZY A;  1TWH C;  4KMH A;  3FKI A;  2NVQ K;  3CQZ K;  4KN7 A;  1TWH A;  4XLP A;  3L4K A;  3S2H K;  2XCQ A;  2R7Z C;  3I4M K;  2EBB A;  2O5I A;  4G0U A;  2NVX K;  5IP7 C;  5C3E K;  2P5M A;  2WAQ L;  2V6T A;  2R7Z A;  1JVI A;  4O2D A;  1DCP A;  3N0C A;  3S16 C;  4Y7N K;  2Y0S D;  4A3F K;  3GTO K;  3GTG C;  4A3D C;  2E2I K;  4KB4 A;  3FOF A;  4A3L K;  1WOS A;  4DDQ A;  4A3K C;  4KAR A;  3PO3 C;  3GTG A;  1Y1W K;  4GTL A;  1TWG K;  1SFO K;  3H0G C;  1USO A;  3RZO K;  3H0G A;  5C4X K;  1XXB A;  3ORE A;  3IPJ A;  4PAB A;  4LK1 A;  4KM8 A;  2V6S A;  1TWC K;  2ZUE A;  4A93 C;  3HOX C;  1IS1 A;  5IYD C;  3S2D C;  4BXX K;  1ZYR A;  4OIP A;  2B63 K;  4GTC A;  4X6A K;  1J98 A;  1XZQ A;  5TJ3 A;  1IW7 A;  5IYC C;  3BUE A;  3S14 K;  3TFH A;  3GSI A;  3AD8 C;  4AYB L;  5M5Y K;  1I3Q K;  1WCM K;  3S15 K;  1O27 A;  2E2H C;  3GDZ A;  5TMF A;  4C3I C;  2JA8 K;  5TMC A;  5IP9 K;  1YNJ A;  4Q4Z A;  1B4B A;  3GTK K;  3JST A;  3V4G A;  2E2H A;  2PMZ L;  4KDD A;  4YFK A;  4KC6 A;  3S1R K;  3S1Q K;  1I50 K;  3GIR A;  4KAT A;  2PHC B;  1K83 C;  3GTM C;  2O5J A;  4C2M K;  1EK8 A;  1R9T C;  2GSU A;  1K83 A;  5CHP A;  3GTM A;  1PJ6 A;  1UV7 A;  1R9T A;  4A3M K;  3S1M C;  5M3F K;  3K7A K;  3OPF A;  3A8J A;  4MQ9 A;  4G0W A;  1ZVU A;  1WOO A;  1F7V A;  3HKZ D;  2CFA B;  4XCH A;  3H3V D;  5FLM K;  4A3J C;  1WQF A;  2GSO A;  4AH6 A;  2NVT K;  2VUM C;  3LAP A;  1O29 A;  4Y52 C;  2VUM A;  2E2J K;  1XZP B;  3S17 K;  4A3I K;  3AQO A;  1V5V A;  2JA7 K;  2KWA A;  4GTE A;  1VH2 A;  4GTA A;  4RMF A;  5C44 K;  2NVY C;  5JFE A;  4LJZ A;  2R92 K;  3RZD C;  2NVY A;  5E68 A;  2YU9 C;  4Q5S A;  2JA6 C;  1GE9 A;  2V6U A;  3Q3Q A;  1PJ7 A;  2A69 A;  4OIN A;  3LPX A;  3HOY C;  4C3J K;  2YU9 A;  2R93 C;  4MEY A;  2JA6 A;  4A3E C;  1TWF C;  3AH5 A;  4A3G K;  1KQ4 A;  3GEE A;  1WOP A;  1F7U A;  5HL8 A;  4QJV B;  2R93 A;  3CAG A;  4YG2 A;  3TTG A;  1TWF A;  2P8T A;  5M5X K;  4M1X A;  4P5A A;  3HOV C;  3I4N C;  1ZXO A;  4C3H K;  1ISE A;  4G7O A;  4BBS K;  4P5B A;  1C0A A;  5C4J C;  3PO2 K;  1YCL A;  1DCH A;  1I6V A;  3HOW C;  3M3Y C;  3G4A A;  3G4C A;  2FQO A;  2ZFZ A;  4LK0 A;  4LLG A;  3AQP A;  2XCO A;  4LR2 A;  3HXA A;  2Y0S L;  4KM9 A;  3HOZ C;  1PJ5 A;  1XXA A;  4BY1 C;  3GTQ C;  4BBR K;  2NVQ C;  3CQZ C;  4GTB A;  3GTQ A;  1ZBS A;  4BY7 K;  3L4J A;  3T02 A;  3S2H C;  3CQZ A;  1EQR A;  1I6H K;  1AB4 A;  4GTF A;  3I4M C;  4GTD A;  2JA5 K;  2NVX C;  5C3E C;  3GTJ K;  4G7Z A;  2NVX A;  4Y7N C;  4A3F C;  3GEH A;  3GTO C;  1O2A A;  2FQT A;  5CJ9 A;  4A3L C;  3GTO A;  1YX2 A;  3M4O K;  3TFJ A;  1VLO A;  1Y1W C;  1WOR A;  3GTL K;  1SFO C;  3GTP K;  1SMY A;  1Y1W A;  4GFQ A;  3RZO C;  1YNN A;  1SFO A;  1O24 A;  5C4X C;  3HOU K;  3VA7 A;  5L46 A;  3A8I A;  1TWC C;  2WB1 D;  4KAS A;  2ZUF A;  4A3B K;  1Y1V K;  1TWC A;  1O2F B;  1DCO A;  4KN4 A;  5IOT A;  3BP3 A;  1O28 A;  1TWA K;  1EI6 A;  4BXX C;  5IYB K;  2A6H A;  1WIH A;  5M5W K;  3FKI K;  2PA8 D;  2A68 A;  3N3Y A;  4LOW A;  3ERE D;  3S1N K;  4A3C K;  1VRQ C;  4X6A C;  1TWH K;  4KMU A;  1USM A;  2RH6 A;  4WIL A;  2B63 A;  3QX3 A;  1B4A A;  3S14 C;  2R7Z K;  1IQ0 A;  1IE0 A;  4LQY A;  1I3Q C;  1ZQ1 C;  3NUH A;  1WCM C;  2CFA A;  5IP7 K;  4PAA A;  4GT9 A;  3S15 C;  1O25 A;  1I3Q A;  2JA8 C;  5IP9 C;  1WCM A;  4FM9 A;  3GTK C;  3S16 K;  2XCR B;  1XZP A;  3GTG K;  3S1Q C;  3GTK A;  4A3D K;  1I50 C;  1BS2 A;  4A3K K;  1BDF A;  3PO3 K;  1I50 A;  1WSR A;  3HKZ L;  3H0G K;  4C2M C;  5EGH A;  3H3V L;  4OIR A;  1BGW A;  2WAQ D;  2GAH C;  4A3M C;  3T01 A;  2A6E A;  3K7A C;  1JOE A;  3LAJ A;  4A93 K;  1RU0 A;  2CW0 A;  5FJ8 K;  3HOX K;  4QIW D;  4QJV A;  5IYD K;  3S2D K;  1EH1 A;  4WJ4 A;  5EGE A;  4KB2 A;  5FLM C;  4XSX A;  4BLB A;  2NVT C;  2PPB A;  4FZB A;  2RGR A;  2E2J C;  5IYC K;  4OIO A;  3S17 C;  1O2B A;  4A3I C;  5D4D A;  1VJE A;  4BKW A;  1XPP A;  3ADA C;  1J6W A;  4QIW L;  3FOE A;  1DD5 A;  2JA7 C;  5JVO A;  4YFX A;  2E2H K;  4C3I K;  1X31 C;  5IOS A;  5C44 C;  2W7V A;  2JA7 A;  2R92 C;  4BLA A;  4KMA A;  4YFN A;  3T00 A;  2R92 A;  4WJ3 M;  4C3J C;  1K83 K;  4A3G C;  3GTM K;  1R9T K;  4AYB D;  3S1M K;  4G7H A;  1JQW A;  3AD9 C;  4C3H C;  4BBS C; 
#chains in the Genus database with same CATH homology
 5IOQ A;  3AQO A;  5IOT A;  1O28 A;  4KB4 A;  3FOF A;  2KWA A;  4DDQ A;  4KAR A;  4GTE A;  1WIH A;  2E2I A;  4GTA A;  3GTG A;  1BJT A;  5JFE A;  4GTL A;  3N3Y A;  3ERE D;  4KAW X;  1TWG A;  2NVY A;  2Y3P A;  2RH6 A;  2B63 A;  1GE9 A;  3H0G A;  3Q3Q A;  1WQG A;  3QX3 A;  1B4A A;  1XXB A;  3LPX A;  3ORE A;  2GSN A;  2YU9 A;  4LQY A;  4KM8 A;  2JA6 A;  3AH5 A;  3NUH A;  2CFA A;  1KQ4 A;  4GT9 A;  1O25 A;  2R93 A;  3CAG A;  1I3Q A;  1TWF A;  1WCM A;  4M1X A;  4P5A A;  4FM9 A;  1IS1 A;  1ZXO A;  2XCR B;  4J3N A;  1ISE A;  3N0B A;  4P5B A;  3GTK A;  1I50 A;  4GTC A;  5IOR A;  4C2M C;  5EGH A;  2JH3 A;  1BGW A;  1O26 A;  3G4A A;  2JA5 A;  3G4C A;  5TJ3 A;  3BUE A;  2ZFZ A;  3GTJ A;  3AQP A;  2XCO A;  4LR2 A;  3LAJ A;  1WQH A;  1O27 A;  4KM9 A;  1XXA A;  4C3I C;  1B4B A;  3V4G A;  2E2H A;  3FHZ A;  3GTQ A;  4GTB A;  1ZBS A;  4KDD A;  1EH1 A;  4KC6 A;  4G0V A;  3GTL A;  3L4J A;  3GTP A;  4KAT A;  5EGE A;  3CQZ A;  4KB2 A;  1AB4 A;  4GTF A;  2PHC B;  3OEP A;  4GTD A;  4BLB A;  4KMD A;  1EK8 A;  2GSU A;  1K83 A;  2NVX A;  4FZB A;  5CHP A;  2RGR A;  3S0X A;  3GTM A;  3MML B;  1R9T A;  1O2B A;  1Y1V A;  1O2A A;  5CJ9 A;  4BKW A;  1XXC A;  3OPF A;  3FOE A;  1DD5 A;  5JVO A;  3GTO A;  1F9N A;  4ILD A;  1TWA A;  5IOS A;  2JA7 A;  4G0W A;  4KMH A;  3FKI A;  4KMA A;  4BLA A;  1ZVU A;  1Y1W A;  4GFQ A;  1SFO A;  1O24 A;  2R92 A;  1TWH A;  3L4K A;  2CFA B;  4C3J C;  2XCQ A;  3VA7 A;  1WQF A;  2GSO A;  4G0U A;  3LAP A;  2P5M A;  4KAS A;  2R7Z A;  1O29 A;  1TWC A;  2VUM A;  3N0C A;  4C3H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...