4GTDA

T. maritima fdts (e144r mutant) with fad and dump
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 74
structure length 210
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtdA00
1O2AA 4GTEA 4GT9A 3AH5A 4GTFA 4KATA 4GTAA 3G4CA 3N3YA 4GTCA 1O25A 1O26A 1KQ4A 5IOSA 4GTBA 1O2BA 5IOTA 1O24A 4FZBA 3G4AA 3N0CA 4GTLA 5IOQA 5JFEA 2CFAA 3N0BA 1O29A 5CHPA 2CFAB 4P5AA 4KASA 1O28A 1O27A 5IORA 4P5BA 4KARA 4GTDA
chains in the Genus database with same CATH superfamily
1ZBSA 3GTPK 2NVYC 2EBBA 3HOUK 4BBSC 4C3HK 4KN7A 2D6FC 3BP3A 4AH6A 5M3MK 4OIRA 5TMFA 3S17K 4XSXA 2NVXC 3S2DK 4AYBL 1SMYA 4A3JC 4P5AA 4QIWL 3S1QK 4Q5SA 5TJ3A 4YFKA 1I6HK 3V4GA 4MEXA 2PPBA 3L4JA 1BGWA 3S1NC 4XCHA 4OIPA 4A3FK 4KMUA 5FLMC 3GTGA 2R7ZC 1I50C 4BBSK 5C3EC 3OREA 1Y1WC 4XLPA 4M1XA 1EK8A 4KM9A 2NVXK 3JSTA 4A93K 4KM8A 1XXCA 1VH2A 3GTOC 3OEPA 3GIRA 3S1RC 4RMFA 4G7OA 3M3YK 1O2FB 3HOWC 3S1NK 1PJ6A 4GTFA 4KC6A 3TFJA 2JA6C 5FLMK 3G4CA 1TWAA 3S1MC 1WSVA 3GTMA 1I50K 1VRQC 1Y1VA 3BP8C 3S2HC 1TWHC 5C3EK 1Y1WK 2PA8L 4WJ4A 3GTJA 4KMDA 3IPJA 3HOZC 1K83A 4BLAA 3QX3A 1ZYRA 1TWFC 1YNJA 3S1RK 5CJ9A 3CQZK 3A8IA 4A3IC 2B63C 2O5IA 3GTLC 1O2AA 5C4XK 4GTAA 2E2IC 1INNA 3S1MK 4C3IC 1TWHK 1UV7A 3RZDC 1SFOA 2R93C 5EGHA 3WODA 1TWGK 1L0WA 2XCQA 4LOWA 1TWFK 2PMZL 4QJVB 1ZQ1C 3GTKK 3S14C 5M5WK 3PO2C 1WOPA 4J3NA 4Q4ZA 4KMHA 4A3IK 4BY1K 2JA5C 3GTLK 1WQGA 4YFXA 1EI6A 2JA8K 3GEIA 3HOUC 1RU0A 4C3HC 1IBAA 3GEEA 3ERED 2Y3PA 1R9TC 3RZDK 3S2DC 1VGXA 1TWCA 1JVIA 1USMA 2JH3A 4OINA 4Y7NK 4WJ3M 3LAPA 5M5YK 3L4KA 1BS2A 3PO2K 2E2HA 4KDDA 4A3GC 2JA7C 4A3EK 2VUMA 4A3FC 3I4MK 3M4OK 1O2BA 1IS1A 3OPFA 1WSRA 4PAAA 1BJTA 1R9TK 3FHZA 1ZXOA 3PO3C 4LK0A 4A93C 2CFAB 4KN4A 4KAWX 1WCMC 4KASA 4YG2A 3GTGK 3RZOK 1EFWA 2R92A 1XZPB 3M3YC 4A3GK 4FM9A 4C3JK 2JA7K 3GTQA 1I3QA 2ZUEA 1K83C 1BDFA 2CW0A 5M5XK 1WORA 3H3VD 4LQYA 3H0GA 2PHCB 4OIQA 4MQ9A 2A68A 4G0WA 5JVOA 5D4DA 1EQRA 3G4AA 2A6EA 3GTPA 2YU9A 2WB1D 4X6AK 3PO3K 1XZQB 1I6VA 1WCMK 1AB4A 3GTMK 4A3KC 1Y1VK 1IQ0A 4A3DK 3CQZC 3GEHA 2NVQC 3AD8C 3GTJK 5C4XC 3HOXC 4MEYA 5C4JC 1B4AA 1K83K 1YX2A 3FKIC 4YFNA 1PJ7A 2ZFZA 2RGRA 3BUEA 2NVYA 3A8KA 3DXJA 3GDZA 1IL2A 1TWGC 4Y52C 5L46A 2W7VA 2FQTA 2KWAA 4A3KK 3GTKC 5IORA 2NVXA 2NVQK 3HOYK 1SFOK 4BY1C 1WOSA 3S0XA 4C45A 2JA8C 4PABA 5C4JK 3HOXK 1PJ5A 3I4NK 3AD7C 3TFHA 4GTBA 3S16C 3FKIK 2GSOA 1VJEA 5TMCA 1V5VA 4GTLA 3CAGA 5CHPA 1F7UA 1ISEA 2R7ZA 1XXBA 1I50A 4Y7NC 4Y52K 2Y0SD 1GE9A 3FOEA 1Y1WA 4LLGA 1EH1A 2RH6A 2WAQD 4P5BA 4GTEA 4A3EC 3GTOA 1TWCK 1DCPA 3T00A 3I4MC 4KB2A 1O26A 3M4OC 4OIOA 4XLNA 3S16K 3N0CA 2GAHC 2E2HK 2JA6A 2VUMK 4DDQA 5FJ8K 1XPPA 3GTGC 3RZOC 1G51A 4LK1A 1B4BA 4JK1A 5IYDC 3H3VL 4C3JC 1J6VA 3K7AC 1KQ4A 1DCOA 2V6SA 1JOEA 1YCLA 5IYBK 5IOTA 2WB1L 2B63A 5JFEA 4BKWA 3GTLA 5E68A 3N0BA 4A3CC 5IP9K 4X6AC 3GTQK 2E2IA 1O28A 1VLOA 1TWAC 4ILDA 5C44K 3GTMC 5HL8A 1Y1VC 4A3BK 4A3DC 2R93A 4G7HA 4KARA 4O2DA 2YU9K 5IYDK 1IE0A 3AH5A 3GTJC 5IYCK 4G0UA 1HI9A 4BXXK 3K7AK 3N3YA 1O25A 3HKZD 1F7VA 2JA5A 4A3CK 1DD5A 3S15K 4BBRC 2GSNA 1WQHA 4GZYA 4QJVA 1TWAK 3A8JA 3ADAC 3HXAA 1R9TA 4A3LC 4BLBA 1USOA 1J98A 3HOYC 1SFOC 4LJZA 2NVYK 3MMLB 3I4NC 3VA7A 4ZH4A 4A3MC 2BE5A 2JA7A 2P8TA 4A3JK 1JQWA 3T02A 2ZUFA 2Y0SL 3LAJA 4BBRK 3Q3QA 4AYBD 2A69A 1XXAA 1ZVUA 4QIWD 3GSIA 2WAQL 2V6TA 1O27A 3TFIA 2P5MA 4A3LK 4GFQA 4GTDA 4GT9A 1WCMA 1TWCC 1J6WA 2R7ZK 4GTCA 2XCOA 4WILA 5IP7C 1O24A 1F93A 4A3MK 2E2HC 4G0VA 2CFAA 1IW7A 2XCRB 1O29A 3AQPA 2VUMC 3GTOK 3HOVC 1XZPA 1F9NA 1X31C 3HOWK 5EGEA 2E2JC 5M3FK 4KATA 1WQFA 2JA6K 1WIHA 4BY7C 1DCHA 3S2HK 5IP7K 2FQOA 2R92C 3AD9C 4XSZA 3CQZA 3LPXA 4FZBA 4KMAA 5IYBC 2GSUA 2O5JA 1XZQA 5IP9C 2NVTC 3HOZK 3GTQC 2PA8D 3FOFA 1I3QC 3FKIA 4G7ZA 3NUHA 3H0GC 5C44C 3HOVK 1TWHA 1C0AA 4C2MC 4A3BC 1YNNA 2B63K 4NOIA 3SZYA 3GTPC 2YU9C 2E2JK 1TWGA 2E2IK 5IYCC 1WOOA 4BXXC 1J6XA 5IOSA 1TWFA 3GTKA 4C3IK 3SZZA 3HKZL 4BY7K 2R92K 3S17C 3EQLA 5IOQA 2R93K 1HQMA 3TTGA 3T01A 4KB4A 3S1QC 3AQOA 2GAGC 2V6UA 3S15C 2NVTK 2A6HA 1I6HC 1I3QK 4LR2A 3S14K 3H0GK 2PMZD 4C2MK 4P9SA 2JA5K
chains in the Genus database with same CATH topology
1WQGA 1ZBSA 3MMLB 3S0XA 4C3HC 4GTBA 3VA7A 2GSOA 3ERED 2Y3PA 4GTLA 2JA7A 3CAGA 1TWCA 5CHPA 4P5AA 2JH3A 3LAJA 1ISEA 3Q3QA 1XXBA 5TJ3A 1I50A 3LAPA 2R7ZA 1XXAA 1ZVUA 3FOEA 1GE9A 3V4GA 3L4KA 3L4JA 1O27A 1Y1WA 2P5MA 1EH1A 2E2HA 2RH6A 4KDDA 4P5BA 1BGWA 4GFQA 4GTDA 2VUMA 4GTEA 4GT9A 3GTOA 1WCMA 3GTGA 4GTCA 4KB2A 1O26A 2XCOA 1O2BA 1IS1A 1O24A 3N0CA 3OREA 3OPFA 4M1XA 1EK8A 1BJTA 4KM9A 4G0VA 2CFAA 2XCRB 3FHZA 1ZXOA 2JA6A 1O29A 4KM8A 1XXCA 2CFAB 3AQPA 4DDQA 4KAWX 4KASA 3OEPA 2R92A 1F9NA 1B4BA 5EGEA 4FM9A 4C3JC 3GTQA 4GTFA 1WQFA 4KC6A 4KATA 1I3QA 3G4CA 1TWAA 1WIHA 4LQYA 3H0GA 2PHCB 3GTMA 1KQ4A 1Y1VA 4G0WA 5JVOA 5IOTA 3CQZA 3LPXA 4FZBA 3G4AA 4KMAA 2B63A 5JFEA 4BKWA 3GTLA 2GSUA 3GTPA 2YU9A 3N0BA 3GTJA 4KMDA 2E2IA 1K83A 3FOFA 1O28A 4BLAA 3QX3A 1AB4A 3FKIA 4ILDA 3NUHA 1TWHA 5CJ9A 4C2MC 2R93A 4KARA 1O2AA 3AH5A 1TWGA 4GTAA 4G0UA 1B4AA 3N3YA 1O25A 5IOSA 1TWFA 3GTKA 2ZFZA 4C3IC 2RGRA 3BUEA 5IOQA 1SFOA 2JA5A 2NVYA 4KB4A 5EGHA 1DD5A 3AQOA 2GSNA 1WQHA 4LR2A 2XCQA 2KWAA 5IORA 2NVXA 1R9TA 4J3NA 4BLBA 4KMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2A A;  4GTE A;  4GT9 A;  3AH5 A;  4GTF A;  4KAT A;  4GTA A;  3G4C A;  3N3Y A;  4GTC A;  1O25 A;  1O26 A;  1KQ4 A;  5IOS A;  4GTB A;  1O2B A;  5IOT A;  1O24 A;  4FZB A;  3G4A A;  3N0C A;  4GTL A;  5IOQ A;  5JFE A;  2CFA A;  3N0B A;  1O29 A;  5CHP A;  2CFA B;  4P5A A;  4KAS A;  1O28 A;  1O27 A;  5IOR A;  4P5B A;  4KAR A;  4GTD A; 
#chains in the Genus database with same CATH topology
 1ZBS A;  3GTP K;  2NVY C;  2EBB A;  3HOU K;  4BBS C;  4C3H K;  4KN7 A;  2D6F C;  3BP3 A;  4AH6 A;  5M3M K;  4OIR A;  5TMF A;  3S17 K;  4XSX A;  2NVX C;  3S2D K;  4AYB L;  1SMY A;  4A3J C;  4P5A A;  4QIW L;  3S1Q K;  4Q5S A;  5TJ3 A;  4YFK A;  1I6H K;  3V4G A;  4MEX A;  2PPB A;  3L4J A;  1BGW A;  3S1N C;  4XCH A;  4OIP A;  4A3F K;  4KMU A;  5FLM C;  3GTG A;  2R7Z C;  1I50 C;  4BBS K;  5C3E C;  3ORE A;  1Y1W C;  4XLP A;  4M1X A;  1EK8 A;  4KM9 A;  2NVX K;  3JST A;  4A93 K;  4KM8 A;  1XXC A;  1VH2 A;  3GTO C;  3OEP A;  3GIR A;  3S1R C;  4RMF A;  4G7O A;  3M3Y K;  1O2F B;  3HOW C;  3S1N K;  1PJ6 A;  4GTF A;  4KC6 A;  3TFJ A;  2JA6 C;  5FLM K;  3G4C A;  1TWA A;  3S1M C;  1WSV A;  3GTM A;  1I50 K;  1VRQ C;  1Y1V A;  3BP8 C;  3S2H C;  1TWH C;  5C3E K;  1Y1W K;  2PA8 L;  4WJ4 A;  3GTJ A;  4KMD A;  3IPJ A;  3HOZ C;  1K83 A;  4BLA A;  3QX3 A;  1ZYR A;  1TWF C;  1YNJ A;  3S1R K;  5CJ9 A;  3CQZ K;  3A8I A;  4A3I C;  2B63 C;  2O5I A;  3GTL C;  1O2A A;  5C4X K;  4GTA A;  2E2I C;  1INN A;  3S1M K;  4C3I C;  1TWH K;  1UV7 A;  3RZD C;  1SFO A;  2R93 C;  5EGH A;  3WOD A;  1TWG K;  1L0W A;  2XCQ A;  4LOW A;  1TWF K;  2PMZ L;  4QJV B;  1ZQ1 C;  3GTK K;  3S14 C;  5M5W K;  3PO2 C;  1WOP A;  4J3N A;  4Q4Z A;  4KMH A;  4A3I K;  4BY1 K;  2JA5 C;  3GTL K;  1WQG A;  4YFX A;  1EI6 A;  2JA8 K;  3GEI A;  3HOU C;  1RU0 A;  4C3H C;  1IBA A;  3GEE A;  3ERE D;  2Y3P A;  1R9T C;  3RZD K;  3S2D C;  1VGX A;  1TWC A;  1JVI A;  1USM A;  2JH3 A;  4OIN A;  4Y7N K;  4WJ3 M;  3LAP A;  5M5Y K;  3L4K A;  1BS2 A;  3PO2 K;  2E2H A;  4KDD A;  4A3G C;  2JA7 C;  4A3E K;  2VUM A;  4A3F C;  3I4M K;  3M4O K;  1O2B A;  1IS1 A;  3OPF A;  1WSR A;  4PAA A;  1BJT A;  1R9T K;  3FHZ A;  1ZXO A;  3PO3 C;  4LK0 A;  4A93 C;  2CFA B;  4KN4 A;  4KAW X;  1WCM C;  4KAS A;  4YG2 A;  3GTG K;  3RZO K;  1EFW A;  2R92 A;  1XZP B;  3M3Y C;  4A3G K;  4FM9 A;  4C3J K;  2JA7 K;  3GTQ A;  1I3Q A;  2ZUE A;  1K83 C;  1BDF A;  2CW0 A;  5M5X K;  1WOR A;  3H3V D;  4LQY A;  3H0G A;  2PHC B;  4OIQ A;  4MQ9 A;  2A68 A;  4G0W A;  5JVO A;  5D4D A;  1EQR A;  3G4A A;  2A6E A;  3GTP A;  2YU9 A;  2WB1 D;  4X6A K;  3PO3 K;  1XZQ B;  1I6V A;  1WCM K;  1AB4 A;  3GTM K;  4A3K C;  1Y1V K;  1IQ0 A;  4A3D K;  3CQZ C;  3GEH A;  2NVQ C;  3AD8 C;  3GTJ K;  5C4X C;  3HOX C;  4MEY A;  5C4J C;  1B4A A;  1K83 K;  1YX2 A;  3FKI C;  4YFN A;  1PJ7 A;  2ZFZ A;  2RGR A;  3BUE A;  2NVY A;  3A8K A;  3DXJ A;  3GDZ A;  1IL2 A;  1TWG C;  4Y52 C;  5L46 A;  2W7V A;  2FQT A;  2KWA A;  4A3K K;  3GTK C;  5IOR A;  2NVX A;  2NVQ K;  3HOY K;  1SFO K;  4BY1 C;  1WOS A;  3S0X A;  4C45 A;  2JA8 C;  4PAB A;  5C4J K;  3HOX K;  1PJ5 A;  3I4N K;  3AD7 C;  3TFH A;  4GTB A;  3S16 C;  3FKI K;  2GSO A;  1VJE A;  5TMC A;  1V5V A;  4GTL A;  3CAG A;  5CHP A;  1F7U A;  1ISE A;  2R7Z A;  1XXB A;  1I50 A;  4Y7N C;  4Y52 K;  2Y0S D;  1GE9 A;  3FOE A;  1Y1W A;  4LLG A;  1EH1 A;  2RH6 A;  2WAQ D;  4P5B A;  4GTE A;  4A3E C;  3GTO A;  1TWC K;  1DCP A;  3T00 A;  3I4M C;  4KB2 A;  1O26 A;  3M4O C;  4OIO A;  4XLN A;  3S16 K;  3N0C A;  2GAH C;  2E2H K;  2JA6 A;  2VUM K;  4DDQ A;  5FJ8 K;  1XPP A;  3GTG C;  3RZO C;  1G51 A;  4LK1 A;  1B4B A;  4JK1 A;  5IYD C;  3H3V L;  4C3J C;  1J6V A;  3K7A C;  1KQ4 A;  1DCO A;  2V6S A;  1JOE A;  1YCL A;  5IYB K;  5IOT A;  2WB1 L;  2B63 A;  5JFE A;  4BKW A;  3GTL A;  5E68 A;  3N0B A;  4A3C C;  5IP9 K;  4X6A C;  3GTQ K;  2E2I A;  1O28 A;  1VLO A;  1TWA C;  4ILD A;  5C44 K;  3GTM C;  5HL8 A;  1Y1V C;  4A3B K;  4A3D C;  2R93 A;  4G7H A;  4KAR A;  4O2D A;  2YU9 K;  5IYD K;  1IE0 A;  3AH5 A;  3GTJ C;  5IYC K;  4G0U A;  1HI9 A;  4BXX K;  3K7A K;  3N3Y A;  1O25 A;  3HKZ D;  1F7V A;  2JA5 A;  4A3C K;  1DD5 A;  3S15 K;  4BBR C;  2GSN A;  1WQH A;  4GZY A;  4QJV A;  1TWA K;  3A8J A;  3ADA C;  3HXA A;  1R9T A;  4A3L C;  4BLB A;  1USO A;  1J98 A;  3HOY C;  1SFO C;  4LJZ A;  2NVY K;  3MML B;  3I4N C;  3VA7 A;  4ZH4 A;  4A3M C;  2BE5 A;  2JA7 A;  2P8T A;  4A3J K;  1JQW A;  3T02 A;  2ZUF A;  2Y0S L;  3LAJ A;  4BBR K;  3Q3Q A;  4AYB D;  2A69 A;  1XXA A;  1ZVU A;  4QIW D;  3GSI A;  2WAQ L;  2V6T A;  1O27 A;  3TFI A;  2P5M A;  4A3L K;  4GFQ A;  4GTD A;  4GT9 A;  1WCM A;  1TWC C;  1J6W A;  2R7Z K;  4GTC A;  2XCO A;  4WIL A;  5IP7 C;  1O24 A;  1F93 A;  4A3M K;  2E2H C;  4G0V A;  2CFA A;  1IW7 A;  2XCR B;  1O29 A;  3AQP A;  2VUM C;  3GTO K;  3HOV C;  1XZP A;  1F9N A;  1X31 C;  3HOW K;  5EGE A;  2E2J C;  5M3F K;  4KAT A;  1WQF A;  2JA6 K;  1WIH A;  4BY7 C;  1DCH A;  3S2H K;  5IP7 K;  2FQO A;  2R92 C;  3AD9 C;  4XSZ A;  3CQZ A;  3LPX A;  4FZB A;  4KMA A;  5IYB C;  2GSU A;  2O5J A;  1XZQ A;  5IP9 C;  2NVT C;  3HOZ K;  3GTQ C;  2PA8 D;  3FOF A;  1I3Q C;  3FKI A;  4G7Z A;  3NUH A;  3H0G C;  5C44 C;  3HOV K;  1TWH A;  1C0A A;  4C2M C;  4A3B C;  1YNN A;  2B63 K;  4NOI A;  3SZY A;  3GTP C;  2YU9 C;  2E2J K;  1TWG A;  2E2I K;  5IYC C;  1WOO A;  4BXX C;  1J6X A;  5IOS A;  1TWF A;  3GTK A;  4C3I K;  3SZZ A;  3HKZ L;  4BY7 K;  2R92 K;  3S17 C;  3EQL A;  5IOQ A;  2R93 K;  1HQM A;  3TTG A;  3T01 A;  4KB4 A;  3S1Q C;  3AQO A;  2GAG C;  2V6U A;  3S15 C;  2NVT K;  2A6H A;  1I6H C;  1I3Q K;  4LR2 A;  3S14 K;  3H0G K;  2PMZ D;  4C2M K;  4P9S A;  2JA5 K; 
#chains in the Genus database with same CATH homology
 1WQG A;  1ZBS A;  3MML B;  3S0X A;  4C3H C;  4GTB A;  3VA7 A;  2GSO A;  3ERE D;  2Y3P A;  4GTL A;  2JA7 A;  3CAG A;  1TWC A;  5CHP A;  4P5A A;  2JH3 A;  3LAJ A;  1ISE A;  3Q3Q A;  1XXB A;  5TJ3 A;  1I50 A;  3LAP A;  2R7Z A;  1XXA A;  1ZVU A;  3FOE A;  1GE9 A;  3V4G A;  3L4K A;  3L4J A;  1O27 A;  1Y1W A;  2P5M A;  1EH1 A;  2E2H A;  2RH6 A;  4KDD A;  4P5B A;  1BGW A;  4GFQ A;  4GTD A;  2VUM A;  4GTE A;  4GT9 A;  3GTO A;  1WCM A;  3GTG A;  4GTC A;  4KB2 A;  1O26 A;  2XCO A;  1O2B A;  1IS1 A;  1O24 A;  3N0C A;  3ORE A;  3OPF A;  4M1X A;  1EK8 A;  1BJT A;  4KM9 A;  4G0V A;  2CFA A;  2XCR B;  3FHZ A;  1ZXO A;  2JA6 A;  1O29 A;  4KM8 A;  1XXC A;  2CFA B;  3AQP A;  4DDQ A;  4KAW X;  4KAS A;  3OEP A;  2R92 A;  1F9N A;  1B4B A;  5EGE A;  4FM9 A;  4C3J C;  3GTQ A;  4GTF A;  1WQF A;  4KC6 A;  4KAT A;  1I3Q A;  3G4C A;  1TWA A;  1WIH A;  4LQY A;  3H0G A;  2PHC B;  3GTM A;  1KQ4 A;  1Y1V A;  4G0W A;  5JVO A;  5IOT A;  3CQZ A;  3LPX A;  4FZB A;  3G4A A;  4KMA A;  2B63 A;  5JFE A;  4BKW A;  3GTL A;  2GSU A;  3GTP A;  2YU9 A;  3N0B A;  3GTJ A;  4KMD A;  2E2I A;  1K83 A;  3FOF A;  1O28 A;  4BLA A;  3QX3 A;  1AB4 A;  3FKI A;  4ILD A;  3NUH A;  1TWH A;  5CJ9 A;  4C2M C;  2R93 A;  4KAR A;  1O2A A;  3AH5 A;  1TWG A;  4GTA A;  4G0U A;  1B4A A;  3N3Y A;  1O25 A;  5IOS A;  1TWF A;  3GTK A;  2ZFZ A;  4C3I C;  2RGR A;  3BUE A;  5IOQ A;  1SFO A;  2JA5 A;  2NVY A;  4KB4 A;  5EGH A;  1DD5 A;  3AQO A;  2GSN A;  1WQH A;  4LR2 A;  2XCQ A;  2KWA A;  5IOR A;  2NVX A;  1R9T A;  4J3N A;  4BLB A;  4KMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...