4GTDA

T. maritima fdts (e144r mutant) with fad and dump
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 210
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtdA00
4KARA 5IOSA 4GTEA 5IOTA 5CHPA 4FZBA 1O2BA 4GTAA 4KASA 3N0CA 4P5BA 3N3YA 1O29A 1O2AA 5IORA 3G4AA 3G4CA 1O25A 1O26A 4GT9A 3N0BA 1KQ4A 1O24A 2CFAA 4GTCA 4GTDA 2CFAB 4KATA 4GTBA 5JFEA 1O27A 3AH5A 5IOQA 1O28A 4GTFA 4GTLA 4P5AA
chains in the Genus database with same CATH superfamily
3GTGA 3GTGC 4KASA 5TMCA 1VLOA 3PO2C 2Y3PA 3HOVC 1TWHA 1TWAC 1TWHC 1I3QA 1I3QC 5M5XK 5IYCK 4BY1C 3GEEA 4A3KK 2YU9A 2YU9C 3S16K 2R92K 4Q5SA 3VA7A 3GTMC 2R7ZA 1I50A 2R7ZC 4Y7NC 3GTPA 2A68A 3GTPC 4A93K 3K7AK 1IQ0A 4Y52C 3RZDC 3FOEA 1K83C 4FZBA 1O2BA 3GIRA 2PHCB 1EFWA 1I6VA 1WQGA 1TWGK 2D6FC 4LOWA 2ZUEA 4KMAA 5C4XC 4A3LK 2V6SA 3HOWC 3GTKK 4A3GK 5JVOA 3A8KA 3Q3QA 3AD8C 3HOXC 3WODA 1J6WA 2E2JC 4BXXK 4A3DC 4KN4A 4GTAA 1JVIA 2FQOA 3FKIA 3AQPA 2Y0SL 1WOPA 3S14C 2A69A 3S1QK 3BP3A 2JA6A 2JA6C 4G7HA 4MEXA 4OIRA 3JSTA 2B63K 1AB4A 1ZQ1C 5IP7C 5JFEA 3AH5A 1Y1WK 2JA5A 3M3YC 2JA5C 2O5JA 3S1RK 1WQHA 3DXJA 3HKZD 4BKWA 3RZOK 5IOTA 5IP9C 3S15C 1INNA 3GEHA 1F93A 1O29A 3M4OK 2NVXK 2VUMA 2VUMC 2NVTC 2CW0A 5C44K 3V4GA 3CQZA 1R9TK 3AQOA 1O2FB 4AYBD 3FHZA 5FLMC 4A3EC 2E2IC 2JA7A 2GSUA 3S2DK 2JA7C 1JOEA 1YNJA 3I4MC 2XCOA 4WILA 4X6AK 3L4JA 1SFOA 5M3MK 1SFOC 1UV7A 1IW7A 1L0WA 1WCMK 1JQWA 1VRQC 2WAQD 1YCLA 2R93A 2R93C 1PJ6A 4KB2A 1Y1VK 3S2HK 3HOZC 5C3EK 3PO3C 4GFQA 1BJTA 4RMFA 1VJEA 3OREA 2E2HA 2E2HC 1TWFC 3PO2K 3HOVK 1XPPA 3GTOC 2RH6A 1TWAK 1TWHK 2ZFZA 4G0WA 1TWCA 3N0CA 4BY1K 4GZYA 2P5MA 4O2DA 1I6HK 4LK0A 4YFKA 4BLBA 3AD7C 3GTMK 2EBBA 3MMLB 2R7ZK 4Y7NK 3GTPK 4GT9A 3GTJK 4Y52K 1USMA 4A3JC 3S1MC 3RZDK 4BBRC 1K83K 4JK1A 1J98A 4C3IC 3A8JA 4GTLA 1I50C 1BGWA 3HKZL 1V5VA 3ERED 5EGHA 4C3JC 3HOWK 2NVYK 4P5BA 1SMYA 4OINA 3QX3A 2RGRA 1PJ7A 3HOXK 2JA8K 3NUHA 4QJVB 3EQLA 2ZUFA 4AYBL 4G0UA 4GTCA 3H3VD 4A3IK 3TTGA 4A3DK 5M5WK 4BY7K 4A3MC 5HL8A 4MEYA 4GTFA 4KMHA 2PMZD 5M3FK 4J3NA 4C3HC 1DCHA 3S0XA 3S14K 1B4BA 3TFHA 3S17C 3T01A 1J6VA 2A6HA 5IYBC 3FKIC 2WAQL 3H0GK 5IP7K 4QJVA 1XZQB 4C2MC 4OIOA 2BE5A 5TJ3A 2JA5K 1IL2A 2WB1D 3BP8C 1TWGA 1TWGC 4A3BC 4LLGA 4XSXA 5IP9K 3S15K 4A3LC 3GDZA 1VH2A 4YFNA 1J6XA 1GE9A 3S1NC 2GSOA 5TMFA 4GTEA 1DCPA 4WJ4A 1B4AA 3TFJA 4G0VA 1XXBA 5IORA 1BDFA 4A3EK 2E2IK 3SZYA 2JA7K 3I4MK 3HOUC 4GTDA 3CQZC 3GTOA 5IOQA 4KM8A 1HQMA 4WJ3M 5CJ9A 4YFXA 3CAGA 4PAAA 3LPXA 2GAHC 1Y1WA 3GTQK 1Y1VC 1Y1WC 3HOZK 3PO3K 3G4AA 1DD5A 3OEPA 1EH1A 4A3CC 4ILDA 2E2HK 5C4JC 2FQTA 1TWFK 2V6UA 2JH3A 5IYDC 1F7VA 3GTOK 3H3VL 1WORA 3GSIA 4A3FC 2NVXA 1BS2A 1G51A 2NVXC 1XXCA 3GTGK 1HI9A 2PMZL 5C44C 5IOSA 4KN7A 5M5YK 4KC6A 2NVQC 3GTLA 3GTLC 1I3QK 2P8TA 1TWCC 3N3YA 4A3JK 3AD9C 3IPJA 3S1MK 2YU9K 2KWAA 4P9SA 4C45A 1XZPB 4PABA 1I50K 2WB1L 3OPFA 1WCMA 5E68A 1ISEA 1KQ4A 1WCMC 4OIPA 2CFAB 4C3JK 4KATA 1Y1VA 1WOOA 3HOYC 4BLAA 4KARA 5C3EC 4YG2A 1ZXOA 1WOSA 3TFIA 5C4XK 3I4NC 4BBSC 4G7ZA 1TWAA 1O2AA 2W7VA 1XZPA 1O25A 4A3MK 2PA8D 2GAGC 3LAJA 4C3HK 4KB4A 1WSRA 3ADAC 1EI6A 4DDQA 2CFAA 4MQ9A 1I6HC 3GTMA 4Q4ZA 1VGXA 3S17K 2E2JK 5FJ8K 3GTJA 4KMDA 3GTJC 5IYBK 3FKIK 5IYCC 5L46A 4A3KC 3SZZA 2R92A 3LAPA 4C2MK 1K83A 2R92C 3S16C 5CHPA 1F7UA 1WSVA 1XXAA 4A93C 2JA6K 3K7AC 4A3BK 1WQFA 3L4KA 4KM9A 1O26A 2NVYA 1IS1A 2NVYC 3S1NK 3M3YK 1O24A 5EGEA 2GSNA 4FM9A 1ZVUA 2JA8C 4ZH4A 4QIWD 3GTKA 4NOIA 1F9NA 3GTKC 4A3GC 4A3IC 3BUEA 4KDDA 2A6EA 4BY7C 4AH6A 2VUMK 3HOUK 2NVTK 2XCQA 3FOFA 3CQZK 3G4CA 1XZQA 3T00A 4LK1A 5FLMK 1RU0A 4XLNA 4BXXC 3H0GA 3H0GC 4M1XA 1USOA 3S1QC 1SFOK 1EK8A 4P5AA 1DCOA 1X31C 2PPBA 4A3CK 2B63A 2B63C 5C4JK 2R93K 1C0AA 5IYDK 1PJ5A 1ZBSA 1ZYRA 3GEIA 4A3FK 1WIHA 3S1RC 2PA8L 2V6TA 3RZOC 4LR2A 4KMUA 1IBAA 1IE0A 1EQRA 5D4DA 2NVQK 3M4OC 3GTLK 2E2IA 4OIQA 4GTBA 4G7OA 1TWCK 1R9TA 3A8IA 1R9TC 4KAWX 3S2DC 1YX2A 4LJZA 4X6AC 4BBRK 2Y0SD 3GTQA 3HOYK 3GTQC 4C3IK 2O5IA 3N0BA 4BBSK 2XCRB 3I4NK 4XSZA 4XCHA 1O27A 3T02A 1TWFA 4QIWL 1O28A 1YNNA 4XLPA 3HXAA 4LQYA 3S2HC
chains in the Genus database with same CATH topology
2XCOA 4GTEA 3GTGA 3LAPA 3L4JA 1K83A 2R92A 5CHPA 1SFOA 1B4AA 4G0VA 4KASA 1XXAA 1XXBA 5IORA 1WQFA 2Y3PA 3L4KA 1TWHA 4KM9A 1O26A 1I3QA 2NVYA 2R93A 1IS1A 4KB2A 1O24A 5EGEA 2YU9A 4GFQA 1BJTA 4GTDA 2GSNA 3OREA 4FM9A 2E2HA 1ZVUA 5IOQA 3VA7A 4KM8A 2R7ZA 1I50A 3GTPA 5CJ9A 3GTKA 3CAGA 1F9NA 2RH6A 2ZFZA 3LPXA 3BUEA 4G0WA 1TWCA 4KDDA 1Y1WA 3FOEA 4FZBA 1O2BA 2PHCB 3N0CA 1WQGA 2P5MA 2XCQA 3G4AA 3FOFA 1DD5A 3OEPA 1EH1A 4BLBA 3G4CA 4ILDA 4KMAA 3MMLB 4GT9A 2JH3A 3H0GA 5JVOA 4M1XA 2NVXA 1XXCA 3Q3QA 4C3IC 1EK8A 4GTLA 4P5AA 1BGWA 5IOSA 2B63A 3ERED 4KC6A 3GTLA 5EGHA 4C3JC 4GTAA 1ZBSA 4P5BA 3FKIA 3N3YA 1WIHA 3AQPA 3QX3A 2RGRA 2KWAA 3NUHA 4LR2A 3OPFA 1WCMA 2JA6A 1ISEA 1KQ4A 4G0UA 4GTCA 1AB4A 2E2IA 2CFAB 4KATA 4GTBA 5JFEA 1Y1VA 3AH5A 4GTFA 4KMHA 2JA5A 4J3NA 4C3HC 3S0XA 4BLAA 4KARA 1R9TA 1WQHA 1ZXOA 4BKWA 1B4BA 5IOTA 4KAWX 1O29A 1TWAA 1O2AA 1O25A 2VUMA 3GTQA 4C2MC 3LAJA 3N0BA 4KB4A 5TJ3A 3V4GA 1TWGA 4DDQA 3CQZA 2CFAA 3AQOA 3GTMA 2XCRB 3FHZA 1O27A 1TWFA 2JA7A 1GE9A 2GSUA 3GTJA 1O28A 4KMDA 2GSOA 3GTOA 4LQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAR A;  5IOS A;  4GTE A;  5IOT A;  5CHP A;  4FZB A;  1O2B A;  4GTA A;  4KAS A;  3N0C A;  4P5B A;  3N3Y A;  1O29 A;  1O2A A;  5IOR A;  3G4A A;  3G4C A;  1O25 A;  1O26 A;  4GT9 A;  3N0B A;  1KQ4 A;  1O24 A;  2CFA A;  4GTC A;  4GTD A;  2CFA B;  4KAT A;  4GTB A;  5JFE A;  1O27 A;  3AH5 A;  5IOQ A;  1O28 A;  4GTF A;  4GTL A;  4P5A A; 
#chains in the Genus database with same CATH topology
 3GTG A;  3GTG C;  4KAS A;  5TMC A;  1VLO A;  3PO2 C;  2Y3P A;  3HOV C;  1TWH A;  1TWA C;  1TWH C;  1I3Q A;  1I3Q C;  5M5X K;  5IYC K;  4BY1 C;  3GEE A;  4A3K K;  2YU9 A;  2YU9 C;  3S16 K;  2R92 K;  4Q5S A;  3VA7 A;  3GTM C;  2R7Z A;  1I50 A;  2R7Z C;  4Y7N C;  3GTP A;  2A68 A;  3GTP C;  4A93 K;  3K7A K;  1IQ0 A;  4Y52 C;  3RZD C;  3FOE A;  1K83 C;  4FZB A;  1O2B A;  3GIR A;  2PHC B;  1EFW A;  1I6V A;  1WQG A;  1TWG K;  2D6F C;  4LOW A;  2ZUE A;  4KMA A;  5C4X C;  4A3L K;  2V6S A;  3HOW C;  3GTK K;  4A3G K;  5JVO A;  3A8K A;  3Q3Q A;  3AD8 C;  3HOX C;  3WOD A;  1J6W A;  2E2J C;  4BXX K;  4A3D C;  4KN4 A;  4GTA A;  1JVI A;  2FQO A;  3FKI A;  3AQP A;  2Y0S L;  1WOP A;  3S14 C;  2A69 A;  3S1Q K;  3BP3 A;  2JA6 A;  2JA6 C;  4G7H A;  4MEX A;  4OIR A;  3JST A;  2B63 K;  1AB4 A;  1ZQ1 C;  5IP7 C;  5JFE A;  3AH5 A;  1Y1W K;  2JA5 A;  3M3Y C;  2JA5 C;  2O5J A;  3S1R K;  1WQH A;  3DXJ A;  3HKZ D;  4BKW A;  3RZO K;  5IOT A;  5IP9 C;  3S15 C;  1INN A;  3GEH A;  1F93 A;  1O29 A;  3M4O K;  2NVX K;  2VUM A;  2VUM C;  2NVT C;  2CW0 A;  5C44 K;  3V4G A;  3CQZ A;  1R9T K;  3AQO A;  1O2F B;  4AYB D;  3FHZ A;  5FLM C;  4A3E C;  2E2I C;  2JA7 A;  2GSU A;  3S2D K;  2JA7 C;  1JOE A;  1YNJ A;  3I4M C;  2XCO A;  4WIL A;  4X6A K;  3L4J A;  1SFO A;  5M3M K;  1SFO C;  1UV7 A;  1IW7 A;  1L0W A;  1WCM K;  1JQW A;  1VRQ C;  2WAQ D;  1YCL A;  2R93 A;  2R93 C;  1PJ6 A;  4KB2 A;  1Y1V K;  3S2H K;  3HOZ C;  5C3E K;  3PO3 C;  4GFQ A;  1BJT A;  4RMF A;  1VJE A;  3ORE A;  2E2H A;  2E2H C;  1TWF C;  3PO2 K;  3HOV K;  1XPP A;  3GTO C;  2RH6 A;  1TWA K;  1TWH K;  2ZFZ A;  4G0W A;  1TWC A;  3N0C A;  4BY1 K;  4GZY A;  2P5M A;  4O2D A;  1I6H K;  4LK0 A;  4YFK A;  4BLB A;  3AD7 C;  3GTM K;  2EBB A;  3MML B;  2R7Z K;  4Y7N K;  3GTP K;  4GT9 A;  3GTJ K;  4Y52 K;  1USM A;  4A3J C;  3S1M C;  3RZD K;  4BBR C;  1K83 K;  4JK1 A;  1J98 A;  4C3I C;  3A8J A;  4GTL A;  1I50 C;  1BGW A;  3HKZ L;  1V5V A;  3ERE D;  5EGH A;  4C3J C;  3HOW K;  2NVY K;  4P5B A;  1SMY A;  4OIN A;  3QX3 A;  2RGR A;  1PJ7 A;  3HOX K;  2JA8 K;  3NUH A;  4QJV B;  3EQL A;  2ZUF A;  4AYB L;  4G0U A;  4GTC A;  3H3V D;  4A3I K;  3TTG A;  4A3D K;  5M5W K;  4BY7 K;  4A3M C;  5HL8 A;  4MEY A;  4GTF A;  4KMH A;  2PMZ D;  5M3F K;  4J3N A;  4C3H C;  1DCH A;  3S0X A;  3S14 K;  1B4B A;  3TFH A;  3S17 C;  3T01 A;  1J6V A;  2A6H A;  5IYB C;  3FKI C;  2WAQ L;  3H0G K;  5IP7 K;  4QJV A;  1XZQ B;  4C2M C;  4OIO A;  2BE5 A;  5TJ3 A;  2JA5 K;  1IL2 A;  2WB1 D;  3BP8 C;  1TWG A;  1TWG C;  4A3B C;  4LLG A;  4XSX A;  5IP9 K;  3S15 K;  4A3L C;  3GDZ A;  1VH2 A;  4YFN A;  1J6X A;  1GE9 A;  3S1N C;  2GSO A;  5TMF A;  4GTE A;  1DCP A;  4WJ4 A;  1B4A A;  3TFJ A;  4G0V A;  1XXB A;  5IOR A;  1BDF A;  4A3E K;  2E2I K;  3SZY A;  2JA7 K;  3I4M K;  3HOU C;  4GTD A;  3CQZ C;  3GTO A;  5IOQ A;  4KM8 A;  1HQM A;  4WJ3 M;  5CJ9 A;  4YFX A;  3CAG A;  4PAA A;  3LPX A;  2GAH C;  1Y1W A;  3GTQ K;  1Y1V C;  1Y1W C;  3HOZ K;  3PO3 K;  3G4A A;  1DD5 A;  3OEP A;  1EH1 A;  4A3C C;  4ILD A;  2E2H K;  5C4J C;  2FQT A;  1TWF K;  2V6U A;  2JH3 A;  5IYD C;  1F7V A;  3GTO K;  3H3V L;  1WOR A;  3GSI A;  4A3F C;  2NVX A;  1BS2 A;  1G51 A;  2NVX C;  1XXC A;  3GTG K;  1HI9 A;  2PMZ L;  5C44 C;  5IOS A;  4KN7 A;  5M5Y K;  4KC6 A;  2NVQ C;  3GTL A;  3GTL C;  1I3Q K;  2P8T A;  1TWC C;  3N3Y A;  4A3J K;  3AD9 C;  3IPJ A;  3S1M K;  2YU9 K;  2KWA A;  4P9S A;  4C45 A;  1XZP B;  4PAB A;  1I50 K;  2WB1 L;  3OPF A;  1WCM A;  5E68 A;  1ISE A;  1KQ4 A;  1WCM C;  4OIP A;  2CFA B;  4C3J K;  4KAT A;  1Y1V A;  1WOO A;  3HOY C;  4BLA A;  4KAR A;  5C3E C;  4YG2 A;  1ZXO A;  1WOS A;  3TFI A;  5C4X K;  3I4N C;  4BBS C;  4G7Z A;  1TWA A;  1O2A A;  2W7V A;  1XZP A;  1O25 A;  4A3M K;  2PA8 D;  2GAG C;  3LAJ A;  4C3H K;  4KB4 A;  1WSR A;  3ADA C;  1EI6 A;  4DDQ A;  2CFA A;  4MQ9 A;  1I6H C;  3GTM A;  4Q4Z A;  1VGX A;  3S17 K;  2E2J K;  5FJ8 K;  3GTJ A;  4KMD A;  3GTJ C;  5IYB K;  3FKI K;  5IYC C;  5L46 A;  4A3K C;  3SZZ A;  2R92 A;  3LAP A;  4C2M K;  1K83 A;  2R92 C;  3S16 C;  5CHP A;  1F7U A;  1WSV A;  1XXA A;  4A93 C;  2JA6 K;  3K7A C;  4A3B K;  1WQF A;  3L4K A;  4KM9 A;  1O26 A;  2NVY A;  1IS1 A;  2NVY C;  3S1N K;  3M3Y K;  1O24 A;  5EGE A;  2GSN A;  4FM9 A;  1ZVU A;  2JA8 C;  4ZH4 A;  4QIW D;  3GTK A;  4NOI A;  1F9N A;  3GTK C;  4A3G C;  4A3I C;  3BUE A;  4KDD A;  2A6E A;  4BY7 C;  4AH6 A;  2VUM K;  3HOU K;  2NVT K;  2XCQ A;  3FOF A;  3CQZ K;  3G4C A;  1XZQ A;  3T00 A;  4LK1 A;  5FLM K;  1RU0 A;  4XLN A;  4BXX C;  3H0G A;  3H0G C;  4M1X A;  1USO A;  3S1Q C;  1SFO K;  1EK8 A;  4P5A A;  1DCO A;  1X31 C;  2PPB A;  4A3C K;  2B63 A;  2B63 C;  5C4J K;  2R93 K;  1C0A A;  5IYD K;  1PJ5 A;  1ZBS A;  1ZYR A;  3GEI A;  4A3F K;  1WIH A;  3S1R C;  2PA8 L;  2V6T A;  3RZO C;  4LR2 A;  4KMU A;  1IBA A;  1IE0 A;  1EQR A;  5D4D A;  2NVQ K;  3M4O C;  3GTL K;  2E2I A;  4OIQ A;  4GTB A;  4G7O A;  1TWC K;  1R9T A;  3A8I A;  1R9T C;  4KAW X;  3S2D C;  1YX2 A;  4LJZ A;  4X6A C;  4BBR K;  2Y0S D;  3GTQ A;  3HOY K;  3GTQ C;  4C3I K;  2O5I A;  3N0B A;  4BBS K;  2XCR B;  3I4N K;  4XSZ A;  4XCH A;  1O27 A;  3T02 A;  1TWF A;  4QIW L;  1O28 A;  1YNN A;  4XLP A;  3HXA A;  4LQY A;  3S2H C; 
#chains in the Genus database with same CATH homology
 2XCO A;  4GTE A;  3GTG A;  3LAP A;  3L4J A;  1K83 A;  2R92 A;  5CHP A;  1SFO A;  1B4A A;  4G0V A;  4KAS A;  1XXA A;  1XXB A;  5IOR A;  1WQF A;  2Y3P A;  3L4K A;  1TWH A;  4KM9 A;  1O26 A;  1I3Q A;  2NVY A;  2R93 A;  1IS1 A;  4KB2 A;  1O24 A;  5EGE A;  2YU9 A;  4GFQ A;  1BJT A;  4GTD A;  2GSN A;  3ORE A;  4FM9 A;  2E2H A;  1ZVU A;  5IOQ A;  3VA7 A;  4KM8 A;  2R7Z A;  1I50 A;  3GTP A;  5CJ9 A;  3GTK A;  3CAG A;  1F9N A;  2RH6 A;  2ZFZ A;  3LPX A;  3BUE A;  4G0W A;  1TWC A;  4KDD A;  1Y1W A;  3FOE A;  4FZB A;  1O2B A;  2PHC B;  3N0C A;  1WQG A;  2P5M A;  2XCQ A;  3G4A A;  3FOF A;  1DD5 A;  3OEP A;  1EH1 A;  4BLB A;  3G4C A;  4ILD A;  4KMA A;  3MML B;  4GT9 A;  2JH3 A;  3H0G A;  5JVO A;  4M1X A;  2NVX A;  1XXC A;  3Q3Q A;  4C3I C;  1EK8 A;  4GTL A;  4P5A A;  1BGW A;  5IOS A;  2B63 A;  3ERE D;  4KC6 A;  3GTL A;  5EGH A;  4C3J C;  4GTA A;  1ZBS A;  4P5B A;  3FKI A;  3N3Y A;  1WIH A;  3AQP A;  3QX3 A;  2RGR A;  2KWA A;  3NUH A;  4LR2 A;  3OPF A;  1WCM A;  2JA6 A;  1ISE A;  1KQ4 A;  4G0U A;  4GTC A;  1AB4 A;  2E2I A;  2CFA B;  4KAT A;  4GTB A;  5JFE A;  1Y1V A;  3AH5 A;  4GTF A;  4KMH A;  2JA5 A;  4J3N A;  4C3H C;  3S0X A;  4BLA A;  4KAR A;  1R9T A;  1WQH A;  1ZXO A;  4BKW A;  1B4B A;  5IOT A;  4KAW X;  1O29 A;  1TWA A;  1O2A A;  1O25 A;  2VUM A;  3GTQ A;  4C2M C;  3LAJ A;  3N0B A;  4KB4 A;  5TJ3 A;  3V4G A;  1TWG A;  4DDQ A;  3CQZ A;  2CFA A;  3AQO A;  3GTM A;  2XCR B;  3FHZ A;  1O27 A;  1TWF A;  2JA7 A;  1GE9 A;  2GSU A;  3GTJ A;  1O28 A;  4KMD A;  2GSO A;  3GTO A;  4LQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...