4A3LK

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3lK00
3GTOK 5M3MK 4Y52C 1TWFK 1Y1VC 2A69A 2PMZL 5FLMC 4A3JK 3HOVC 3I4NK 1ZYRA 1SMYA 4G7OA 3M4OC 4C3HK 3GTPC 2JA8C 3PO2K 1I6VA 3DXJA 3FKIC 3PO3C 2JA6K 4MEXA 4XSXA 1K83K 2E2JC 4Y7NC 4A3FK 3H0GK 2E2HK 2NVXC 4A3BK 3K7AC 4LK0A 5M5WK 1TWHC 2O5IA 1I50K 1K83C 4G7ZA 3S2HK 4A3BC 3CQZK 3K7AK 4G7HA 3HOXC 3HKZD 4MEYA 5FJ8K 1Y1WK 4A3KC 3HOZK 2O5JA 1YNJA 2YU9C 2R93C 5C4XK 2A68A 3GTJC 5IP9K 5C44K 1TWGC 2Y0SD 4X6AK 3S1MK 2WB1L 1XPPA 4A3EC 4XLPA 4YFXA 1YNNA 1TWGK 1R9TC 5IYDK 2R92K 3GTMC 3GTOC 2VUMK 4A3LK 4BXXK 4BY7C 4QJVB 4ZH4A 5FLMK 3GTPK 4C3IK 3S1NK 4XSZA 3S2DK 4MQ9A 4A3FC 4XLNA 4A93K 4LK1A 5M5YK 2NVQK 3S14C 5C4JC 3GTKK 3HOWC 4C3JK 2NVYK 4A3GK 4QIWL 3HKZL 2NVTK 3GTLC 2NVYC 4A3CK 1SFOC 4NOIA 2B63K 4KN7A 3GTQK 2R7ZK 4A3GC 4YFKA 2PA8D 5IP9C 5C44C 5C4XC 3S16K 1TWAC 4BBRK 2WAQD 2E2IC 4Q4ZA 1I6HK 5IYDC 1R9TK 3H3VD 3I4NC 4GZYA 1TWFC 2CW0A 3I4MC 1BDFA 2A6HA 3S15C 1I6HC 2JA7K 4A3IK 4OIPA 3GTMK 5IYBK 2PMZD 3RZDC 2JA5C 2PPBA 3PO3K 1I3QK 5IYCC 4A3DK 3RZOK 3HOUC 5IYBC 3S2DC 1TWHK 4AYBL 4LLGA 1I50C 2NVXK 1HQMA 4BY1K 3S17K 3S2HC 4BBSK 5TMFA 4KMUA 4QJVA 5C3EK 3HOWK 4OIRA 4Q5SA 5IP7C 2A6EA 2NVQC 3S1QK 3HOZC 3GTJK 3H3VL 3HOYC 2YU9K 5IP7K 3WODA 3S1MC 3S1QC 4JK1A 5TMCA 3GTGC 2R7ZC 4Y52K 3HOYK 2BE5A 4YG2A 4A3JC 4A3EK 3HOVK 1Y1VK 3GTGK 2R93K 2Y0SL 2E2IK 3S16C 3M3YC 4A3LC 4BBRC 2R92C 3EQLA 4QIWD 2JA8K 3M4OK 4LJZA 2VUMC 4BXXC 1IW7A 4KN4A 3FKIK 3S15K 4C2MK 3M3YK 2JA7C 4OIOA 4OIQA 3PO2C 1TWCK 3I4MK 4Y7NK 2E2HC 5M3FK 4A3IC 2JA6C 3S1NC 2E2JK 4OINA 2WAQL 1TWCC 3H0GC 5D4DA 3RZDK 2JA5K 3RZOC 1WCMK 2WB1D 1I3QC 5IYCK 4A3MK 4A3DC 3S14K 4BY7K 5C4JK 4AYBD 4A3KK 3GTKC 3HOUK 3CQZC 4A93C 3HOXK 1WCMC 4A3MC 3S1RC 4BBSC 1Y1WC 2PA8L 4YFNA 4BY1C 5C3EC 3S17C 3GTLK 4A3CC 1SFOK 2B63C 5M5XK 3GTQC 3S1RK 2NVTC 4X6AC 1TWAK
chains in the Genus database with same CATH superfamily
2ZUFA 4XCHA 2ZFZA 2A69A 4A3JK 3HOVC 3I4NK 1WORA 3M4OC 1XZQA 1I6VA 2XCQA 4GTLA 2PHCB 4G0VA 1I50K 4A3BC 3CQZA 3GEIA 3GTLA 3Q3QA 4LQYA 1SFOA 2V6TA 5JFEA 5C44K 2Y0SD 3S1MK 4WJ3M 3L4JA 5IYDK 1BJTA 4KMAA 1O25A 3GTMC 3GTOC 4BY7C 1ISEA 5FLMK 1BGWA 2VUMA 3S2DK 1IQ0A 3LAJA 4C3JC 4BKWA 4A93K 2V6UA 2FQTA 3HOWC 4ILDA 2RGRA 1F7VA 3HKZL 4A3CK 3T00A 2Y3PA 3GTQK 2PA8D 1C0AA 3S16K 2P8TA 2R7ZA 5IYDC 3I4NC 1INNA 1O29A 5IOQA 1VH2A 3RZDC 2JA5C 4A3DK 3SZZA 3RZOK 3AD7C 3VA7A 4AYBL 1I50C 1J6VA 1PJ5A 2EBBA 5C3EK 3HOWK 2NVQC 4KATA 3GTJK 3V4GA 3S1MC 3MMLB 4Y52K 2CFAA 1O24A 2V6SA 2RH6A 2R92C 4PABA 2VUMC 3CAGA 1IW7A 3S15K 1TWCK 3I4MK 4C3IC 3S1NC 3GDZA 2XCRB 4G0WA 3ERED 4KARA 5IYCK 4LOWA 3GTQA 4A3MC 3SZYA 4A3CC 2B63C 3GTJA 3S1RK 1JQWA 3GTGA 1B4BA 2PMZL 1TWAA 3A8JA 4GTCA 1ZYRA 1SMYA 3FKIA 3IPJA 4C3HK 3GTPC 1DD5A 1I50A 2JA6K 3GEEA 4XSXA 4A3BK 2E2JC 2E2HK 3H0GA 1TWCA 3T02A 1TWHC 1K83C 2YU9A 1ZVUA 2W7VA 4MEYA 5FJ8K 4A3KC 2O5JA 1X31C 5C4XK 1HI9A 4P5BA 4A3EC 4XLPA 1TWGK 1PJ7A 2R92K 2VUMK 4ZH4A 2CFAB 2GAHC 3GTPK 3N0BA 5IOTA 1YCLA 1WQFA 1IL2A 1WOPA 4LK1A 2GSOA 5C4JC 4KDDA 2NVYC 4A3GC 4NOIA 4RMFA 2R7ZK 1WOSA 4YFKA 1EH1A 5IP9C 3LAPA 1TWAC 4Q4ZA 3H3VD 3GTPA 1O27A 2CW0A 3S15C 2A6HA 1I6HC 2JA7K 4A3IK 3GTMK 5IYBK 1I3QK 1K83A 5E68A 1XXBA 1TWHK 2JA5A 5L46A 2NVXK 4BY1K 5TJ3A 4QJVA 4OIRA 2A6EA 3HOZC 3HOYC 2YU9K 5IP7K 3WODA 2ZUEA 1L0WA 3GTGC 5JVOA 4YG2A 4A3JC 4P9SA 3HOVK 1TWGA 3BP8C 4GTAA 4QIWD 4G7OA 4BXXC 1G51A 2R93C 4KN4A 3M3YK 2JA7C 4OIOA 1IE0A 2R92A 4DDQA 4Y7NK 4GTFA 2JA6C 3GTKA 2E2JK 2WAQL 4A3MK 5C4JK 3HOUK 4GTDA 3TFJA 3CQZC 1WCMC 1Y1WC 2PA8L 1J6WA 5EGEA 4YFNA 3FOEA 3S17C 3GTQC 1J98A 2NVTC 1O2FB 1DCOA 1TWAK 1WSRA 4KMDA 1USMA 1IBAA 4KASA 4Y52C 3QX3A 1PJ6A 1V5VA 5FLMC 3TFHA 2FQOA 3GEHA 1EFWA 1XZPA 2D6FC 1TWFA 2JA8C 2NVXA 3DXJA 3FKIC 3LPXA 3PO3C 1K83K 3G4CA 4WJ4A 2P5MA 4LK0A 5M5WK 4G7ZA 3AH5A 3CQZK 3K7AK 4G7HA 1Y1WK 3HOZK 1YNJA 2YU9C 4M1XA 3GIRA 5IP9K 2NVYA 1TWGC 4X6AK 1XPPA 4YFXA 1Y1VA 1R9TC 3TTGA 4BXXK 4A3LK 3JSTA 1VGXA 4QJVB 3FHZA 1DCHA 1WQGA 4C3IK 3S1NK 1ZXOA 4GTEA 1WCMA 4MQ9A 3N0CA 4A3FC 4FZBA 5M5YK 2NVQK 3S14C 3GTKK 4C3JK 2NVYK 4A3GK 1JVIA 2NVTK 3GTLC 5IOSA 1SFOC 4GFQA 4KN7A 1DCPA 1O26A 2E2IA 1GE9A 4KB2A 5C4XC 4BBRK 1O2BA 1ZQ1C 1R9TK 4KM9A 4GZYA 1TWFC 3I4MC 1EI6A 1AB4A 4KC6A 4OIPA 2R93A 1F9NA 2XCOA 2JH3A 2KWAA 1F93A 2JA6A 4LLGA 4KMHA 5TMFA 4KMUA 4PAAA 3G4AA 4Q5SA 5IP7C 5CJ9A 1Y1WA 4GT9A 1XXCA 1R9TA 3S1QC 4JK1A 5TMCA 1XZQB 2BE5A 3AD9C 1Y1VK 2R93K 2Y0SL 2E2IK 3S16C 3M3YC 4A3LC 4C3HC 3EQLA 1VRQC 4C2MK 3PO2C 1KQ4A 4AH6A 5M3FK 2GSNA 4A3IC 3H0GC 1TWCC 1TWHA 3RZDK 2JA5K 1WCMK 2WB1D 1I3QC 1RU0A 4A3DC 3GTKC 1WOOA 4A93C 3S1RC 1IS1A 1XZPB 3GTLK 3AQPA 2GSUA 5M5XK 4GTBA 4KM8A 4X6AC 1VLOA 3GTOK 5M3MK 1TWFK 1Y1VC 3S0XA 1J6XA 1BS2A 1ZBSA 1JOEA 3OREA 3PO2K 4C45A 4MEXA 4Y7NC 4A3FK 3H0GK 2NVXC 3K7AC 3AQOA 2O5IA 3S2HK 4KAWX 3HOXC 3HKZD 2A68A 4KB4A 3GTJC 4P5AA 2WB1L 3OPFA 3GTOA 1YNNA 1F7UA 3HXAA 1EQRA 4XSZA 3BUEA 2E2HA 3A8IA 4O2DA 4XLNA 1YX2A 5CHPA 1O28A 3AD8C 4QIWL 2B63K 1XXAA 1B4AA 5C44C 4FM9A 2WAQD 2E2IC 1I6HK 1WSVA 1BDFA 2JA7A 4BLAA 4BLBA 2PMZD 2PPBA 3PO3K 5IYCC 4J3NA 3HOUC 5IYBC 3S2DC 3ADAC 3NUHA 3FOFA 3S2HC 1HQMA 3S17K 1I3QA 4BBSK 3A8KA 3GSIA 4G0UA 3N3YA 1UV7A 3S1QK 1VJEA 3H3VL 3TFIA 2R7ZC 3L4KA 3HOYK 5HL8A 4A3EK 4WILA 3GTGK 4C2MC 1WIHA 2GAGC 4BBRC 5EGHA 2JA8K 3M4OK 4LJZA 4BY7K 3FKIK 4OIQA 3GTMA 2E2HC 1EK8A 4OINA 3OEPA 5D4DA 3RZOC 1WQHA 3T01A 4LR2A 3S14K 4AYBD 4A3KK 2B63A 5IORA 3HOXK 1USOA 4BBSC 1O2AA 4BY1C 3BP3A 5C3EC 1SFOK
chains in the Genus database with same CATH topology
3GTOK 5M3MK 4Y52C 1TWFK 1Y1VC 2A69A 2PMZL 5FLMC 4A3JK 3HOVC 3I4NK 1ZYRA 1SMYA 4G7OA 3M4OC 4C3HK 3GTPC 2JA8C 3PO2K 1I6VA 3DXJA 3FKIC 3PO3C 2JA6K 4MEXA 4XSXA 1K83K 2E2JC 4Y7NC 4A3FK 3H0GK 2E2HK 2NVXC 4A3BK 3K7AC 4LK0A 5M5WK 1TWHC 2O5IA 1I50K 1K83C 4G7ZA 3S2HK 4A3BC 3CQZK 3K7AK 4G7HA 3HOXC 3HKZD 4MEYA 5FJ8K 1Y1WK 4A3KC 3HOZK 2O5JA 1YNJA 2YU9C 2R93C 5C4XK 2A68A 3GTJC 5IP9K 5C44K 1TWGC 2Y0SD 4X6AK 3S1MK 2WB1L 1XPPA 4A3EC 4XLPA 4YFXA 1YNNA 1TWGK 1R9TC 5IYDK 2R92K 3GTMC 3GTOC 2VUMK 4A3LK 4BXXK 4BY7C 4QJVB 4ZH4A 5FLMK 3GTPK 4C3IK 3S1NK 4XSZA 3S2DK 4MQ9A 4A3FC 4XLNA 4A93K 4LK1A 5M5YK 2NVQK 3S14C 5C4JC 3GTKK 3HOWC 4C3JK 2NVYK 4A3GK 4QIWL 3HKZL 2NVTK 3GTLC 2NVYC 4A3CK 1SFOC 4NOIA 2B63K 4KN7A 3GTQK 2R7ZK 4A3GC 4YFKA 2PA8D 5IP9C 5C44C 5C4XC 3S16K 1TWAC 4BBRK 2WAQD 2E2IC 4Q4ZA 1I6HK 5IYDC 1R9TK 3H3VD 3I4NC 4GZYA 1TWFC 2CW0A 3I4MC 1BDFA 2A6HA 3S15C 1I6HC 2JA7K 4A3IK 4OIPA 3GTMK 5IYBK 2PMZD 3RZDC 2JA5C 2PPBA 3PO3K 1I3QK 5IYCC 4A3DK 3RZOK 3HOUC 5IYBC 3S2DC 1TWHK 4AYBL 4LLGA 1I50C 2NVXK 1HQMA 4BY1K 3S17K 3S2HC 4BBSK 5TMFA 4KMUA 4QJVA 5C3EK 3HOWK 4OIRA 4Q5SA 5IP7C 2A6EA 2NVQC 3S1QK 3HOZC 3GTJK 3H3VL 3HOYC 2YU9K 5IP7K 3WODA 3S1MC 3S1QC 4JK1A 5TMCA 3GTGC 2R7ZC 4Y52K 3HOYK 2BE5A 4YG2A 4A3JC 4A3EK 3HOVK 1Y1VK 3GTGK 2R93K 2Y0SL 2E2IK 3S16C 3M3YC 4A3LC 4BBRC 2R92C 3EQLA 4QIWD 2JA8K 3M4OK 4LJZA 2VUMC 4BXXC 1IW7A 4KN4A 3FKIK 3S15K 4C2MK 3M3YK 2JA7C 4OIOA 4OIQA 3PO2C 1TWCK 3I4MK 4Y7NK 2E2HC 5M3FK 4A3IC 2JA6C 3S1NC 2E2JK 4OINA 2WAQL 1TWCC 3H0GC 5D4DA 3RZDK 2JA5K 3RZOC 1WCMK 2WB1D 1I3QC 5IYCK 4A3MK 4A3DC 3S14K 4BY7K 5C4JK 4AYBD 4A3KK 3GTKC 3HOUK 3CQZC 4A93C 3HOXK 1WCMC 4A3MC 3S1RC 4BBSC 1Y1WC 2PA8L 4YFNA 4BY1C 5C3EC 3S17C 3GTLK 4A3CC 1SFOK 2B63C 5M5XK 3GTQC 3S1RK 2NVTC 4X6AC 1TWAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO K;  5M3M K;  4Y52 C;  1TWF K;  1Y1V C;  2A69 A;  2PMZ L;  5FLM C;  4A3J K;  3HOV C;  3I4N K;  1ZYR A;  1SMY A;  4G7O A;  3M4O C;  4C3H K;  3GTP C;  2JA8 C;  3PO2 K;  1I6V A;  3DXJ A;  3FKI C;  3PO3 C;  2JA6 K;  4MEX A;  4XSX A;  1K83 K;  2E2J C;  4Y7N C;  4A3F K;  3H0G K;  2E2H K;  2NVX C;  4A3B K;  3K7A C;  4LK0 A;  5M5W K;  1TWH C;  2O5I A;  1I50 K;  1K83 C;  4G7Z A;  3S2H K;  4A3B C;  3CQZ K;  3K7A K;  4G7H A;  3HOX C;  3HKZ D;  4MEY A;  5FJ8 K;  1Y1W K;  4A3K C;  3HOZ K;  2O5J A;  1YNJ A;  2YU9 C;  2R93 C;  5C4X K;  2A68 A;  3GTJ C;  5IP9 K;  5C44 K;  1TWG C;  2Y0S D;  4X6A K;  3S1M K;  2WB1 L;  1XPP A;  4A3E C;  4XLP A;  4YFX A;  1YNN A;  1TWG K;  1R9T C;  5IYD K;  2R92 K;  3GTM C;  3GTO C;  2VUM K;  4A3L K;  4BXX K;  4BY7 C;  4QJV B;  4ZH4 A;  5FLM K;  3GTP K;  4C3I K;  3S1N K;  4XSZ A;  3S2D K;  4MQ9 A;  4A3F C;  4XLN A;  4A93 K;  4LK1 A;  5M5Y K;  2NVQ K;  3S14 C;  5C4J C;  3GTK K;  3HOW C;  4C3J K;  2NVY K;  4A3G K;  4QIW L;  3HKZ L;  2NVT K;  3GTL C;  2NVY C;  4A3C K;  1SFO C;  4NOI A;  2B63 K;  4KN7 A;  3GTQ K;  2R7Z K;  4A3G C;  4YFK A;  2PA8 D;  5IP9 C;  5C44 C;  5C4X C;  3S16 K;  1TWA C;  4BBR K;  2WAQ D;  2E2I C;  4Q4Z A;  1I6H K;  5IYD C;  1R9T K;  3H3V D;  3I4N C;  4GZY A;  1TWF C;  2CW0 A;  3I4M C;  1BDF A;  2A6H A;  3S15 C;  1I6H C;  2JA7 K;  4A3I K;  4OIP A;  3GTM K;  5IYB K;  2PMZ D;  3RZD C;  2JA5 C;  2PPB A;  3PO3 K;  1I3Q K;  5IYC C;  4A3D K;  3RZO K;  3HOU C;  5IYB C;  3S2D C;  1TWH K;  4AYB L;  4LLG A;  1I50 C;  2NVX K;  1HQM A;  4BY1 K;  3S17 K;  3S2H C;  4BBS K;  5TMF A;  4KMU A;  4QJV A;  5C3E K;  3HOW K;  4OIR A;  4Q5S A;  5IP7 C;  2A6E A;  2NVQ C;  3S1Q K;  3HOZ C;  3GTJ K;  3H3V L;  3HOY C;  2YU9 K;  5IP7 K;  3WOD A;  3S1M C;  3S1Q C;  4JK1 A;  5TMC A;  3GTG C;  2R7Z C;  4Y52 K;  3HOY K;  2BE5 A;  4YG2 A;  4A3J C;  4A3E K;  3HOV K;  1Y1V K;  3GTG K;  2R93 K;  2Y0S L;  2E2I K;  3S16 C;  3M3Y C;  4A3L C;  4BBR C;  2R92 C;  3EQL A;  4QIW D;  2JA8 K;  3M4O K;  4LJZ A;  2VUM C;  4BXX C;  1IW7 A;  4KN4 A;  3FKI K;  3S15 K;  4C2M K;  3M3Y K;  2JA7 C;  4OIO A;  4OIQ A;  3PO2 C;  1TWC K;  3I4M K;  4Y7N K;  2E2H C;  5M3F K;  4A3I C;  2JA6 C;  3S1N C;  2E2J K;  4OIN A;  2WAQ L;  1TWC C;  3H0G C;  5D4D A;  3RZD K;  2JA5 K;  3RZO C;  1WCM K;  2WB1 D;  1I3Q C;  5IYC K;  4A3M K;  4A3D C;  3S14 K;  4BY7 K;  5C4J K;  4AYB D;  4A3K K;  3GTK C;  3HOU K;  3CQZ C;  4A93 C;  3HOX K;  1WCM C;  4A3M C;  3S1R C;  4BBS C;  1Y1W C;  2PA8 L;  4YFN A;  4BY1 C;  5C3E C;  3S17 C;  3GTL K;  4A3C C;  1SFO K;  2B63 C;  5M5X K;  3GTQ C;  3S1R K;  2NVT C;  4X6A C;  1TWA K; 
#chains in the Genus database with same CATH topology
 2ZUF A;  4XCH A;  2ZFZ A;  2A69 A;  4A3J K;  3HOV C;  3I4N K;  1WOR A;  3M4O C;  1XZQ A;  1I6V A;  2XCQ A;  4GTL A;  2PHC B;  4G0V A;  1I50 K;  4A3B C;  3CQZ A;  3GEI A;  3GTL A;  3Q3Q A;  4LQY A;  1SFO A;  2V6T A;  5JFE A;  5C44 K;  2Y0S D;  3S1M K;  4WJ3 M;  3L4J A;  5IYD K;  1BJT A;  4KMA A;  1O25 A;  3GTM C;  3GTO C;  4BY7 C;  1ISE A;  5FLM K;  1BGW A;  2VUM A;  3S2D K;  1IQ0 A;  3LAJ A;  4C3J C;  4BKW A;  4A93 K;  2V6U A;  2FQT A;  3HOW C;  4ILD A;  2RGR A;  1F7V A;  3HKZ L;  4A3C K;  3T00 A;  2Y3P A;  3GTQ K;  2PA8 D;  1C0A A;  3S16 K;  2P8T A;  2R7Z A;  5IYD C;  3I4N C;  1INN A;  1O29 A;  5IOQ A;  1VH2 A;  3RZD C;  2JA5 C;  4A3D K;  3SZZ A;  3RZO K;  3AD7 C;  3VA7 A;  4AYB L;  1I50 C;  1J6V A;  1PJ5 A;  2EBB A;  5C3E K;  3HOW K;  2NVQ C;  4KAT A;  3GTJ K;  3V4G A;  3S1M C;  3MML B;  4Y52 K;  2CFA A;  1O24 A;  2V6S A;  2RH6 A;  2R92 C;  4PAB A;  2VUM C;  3CAG A;  1IW7 A;  3S15 K;  1TWC K;  3I4M K;  4C3I C;  3S1N C;  3GDZ A;  2XCR B;  4G0W A;  3ERE D;  4KAR A;  5IYC K;  4LOW A;  3GTQ A;  4A3M C;  3SZY A;  4A3C C;  2B63 C;  3GTJ A;  3S1R K;  1JQW A;  3GTG A;  1B4B A;  2PMZ L;  1TWA A;  3A8J A;  4GTC A;  1ZYR A;  1SMY A;  3FKI A;  3IPJ A;  4C3H K;  3GTP C;  1DD5 A;  1I50 A;  2JA6 K;  3GEE A;  4XSX A;  4A3B K;  2E2J C;  2E2H K;  3H0G A;  1TWC A;  3T02 A;  1TWH C;  1K83 C;  2YU9 A;  1ZVU A;  2W7V A;  4MEY A;  5FJ8 K;  4A3K C;  2O5J A;  1X31 C;  5C4X K;  1HI9 A;  4P5B A;  4A3E C;  4XLP A;  1TWG K;  1PJ7 A;  2R92 K;  2VUM K;  4ZH4 A;  2CFA B;  2GAH C;  3GTP K;  3N0B A;  5IOT A;  1YCL A;  1WQF A;  1IL2 A;  1WOP A;  4LK1 A;  2GSO A;  5C4J C;  4KDD A;  2NVY C;  4A3G C;  4NOI A;  4RMF A;  2R7Z K;  1WOS A;  4YFK A;  1EH1 A;  5IP9 C;  3LAP A;  1TWA C;  4Q4Z A;  3H3V D;  3GTP A;  1O27 A;  2CW0 A;  3S15 C;  2A6H A;  1I6H C;  2JA7 K;  4A3I K;  3GTM K;  5IYB K;  1I3Q K;  1K83 A;  5E68 A;  1XXB A;  1TWH K;  2JA5 A;  5L46 A;  2NVX K;  4BY1 K;  5TJ3 A;  4QJV A;  4OIR A;  2A6E A;  3HOZ C;  3HOY C;  2YU9 K;  5IP7 K;  3WOD A;  2ZUE A;  1L0W A;  3GTG C;  5JVO A;  4YG2 A;  4A3J C;  4P9S A;  3HOV K;  1TWG A;  3BP8 C;  4GTA A;  4QIW D;  4G7O A;  4BXX C;  1G51 A;  2R93 C;  4KN4 A;  3M3Y K;  2JA7 C;  4OIO A;  1IE0 A;  2R92 A;  4DDQ A;  4Y7N K;  4GTF A;  2JA6 C;  3GTK A;  2E2J K;  2WAQ L;  4A3M K;  5C4J K;  3HOU K;  4GTD A;  3TFJ A;  3CQZ C;  1WCM C;  1Y1W C;  2PA8 L;  1J6W A;  5EGE A;  4YFN A;  3FOE A;  3S17 C;  3GTQ C;  1J98 A;  2NVT C;  1O2F B;  1DCO A;  1TWA K;  1WSR A;  4KMD A;  1USM A;  1IBA A;  4KAS A;  4Y52 C;  3QX3 A;  1PJ6 A;  1V5V A;  5FLM C;  3TFH A;  2FQO A;  3GEH A;  1EFW A;  1XZP A;  2D6F C;  1TWF A;  2JA8 C;  2NVX A;  3DXJ A;  3FKI C;  3LPX A;  3PO3 C;  1K83 K;  3G4C A;  4WJ4 A;  2P5M A;  4LK0 A;  5M5W K;  4G7Z A;  3AH5 A;  3CQZ K;  3K7A K;  4G7H A;  1Y1W K;  3HOZ K;  1YNJ A;  2YU9 C;  4M1X A;  3GIR A;  5IP9 K;  2NVY A;  1TWG C;  4X6A K;  1XPP A;  4YFX A;  1Y1V A;  1R9T C;  3TTG A;  4BXX K;  4A3L K;  3JST A;  1VGX A;  4QJV B;  3FHZ A;  1DCH A;  1WQG A;  4C3I K;  3S1N K;  1ZXO A;  4GTE A;  1WCM A;  4MQ9 A;  3N0C A;  4A3F C;  4FZB A;  5M5Y K;  2NVQ K;  3S14 C;  3GTK K;  4C3J K;  2NVY K;  4A3G K;  1JVI A;  2NVT K;  3GTL C;  5IOS A;  1SFO C;  4GFQ A;  4KN7 A;  1DCP A;  1O26 A;  2E2I A;  1GE9 A;  4KB2 A;  5C4X C;  4BBR K;  1O2B A;  1ZQ1 C;  1R9T K;  4KM9 A;  4GZY A;  1TWF C;  3I4M C;  1EI6 A;  1AB4 A;  4KC6 A;  4OIP A;  2R93 A;  1F9N A;  2XCO A;  2JH3 A;  2KWA A;  1F93 A;  2JA6 A;  4LLG A;  4KMH A;  5TMF A;  4KMU A;  4PAA A;  3G4A A;  4Q5S A;  5IP7 C;  5CJ9 A;  1Y1W A;  4GT9 A;  1XXC A;  1R9T A;  3S1Q C;  4JK1 A;  5TMC A;  1XZQ B;  2BE5 A;  3AD9 C;  1Y1V K;  2R93 K;  2Y0S L;  2E2I K;  3S16 C;  3M3Y C;  4A3L C;  4C3H C;  3EQL A;  1VRQ C;  4C2M K;  3PO2 C;  1KQ4 A;  4AH6 A;  5M3F K;  2GSN A;  4A3I C;  3H0G C;  1TWC C;  1TWH A;  3RZD K;  2JA5 K;  1WCM K;  2WB1 D;  1I3Q C;  1RU0 A;  4A3D C;  3GTK C;  1WOO A;  4A93 C;  3S1R C;  1IS1 A;  1XZP B;  3GTL K;  3AQP A;  2GSU A;  5M5X K;  4GTB A;  4KM8 A;  4X6A C;  1VLO A;  3GTO K;  5M3M K;  1TWF K;  1Y1V C;  3S0X A;  1J6X A;  1BS2 A;  1ZBS A;  1JOE A;  3ORE A;  3PO2 K;  4C45 A;  4MEX A;  4Y7N C;  4A3F K;  3H0G K;  2NVX C;  3K7A C;  3AQO A;  2O5I A;  3S2H K;  4KAW X;  3HOX C;  3HKZ D;  2A68 A;  4KB4 A;  3GTJ C;  4P5A A;  2WB1 L;  3OPF A;  3GTO A;  1YNN A;  1F7U A;  3HXA A;  1EQR A;  4XSZ A;  3BUE A;  2E2H A;  3A8I A;  4O2D A;  4XLN A;  1YX2 A;  5CHP A;  1O28 A;  3AD8 C;  4QIW L;  2B63 K;  1XXA A;  1B4A A;  5C44 C;  4FM9 A;  2WAQ D;  2E2I C;  1I6H K;  1WSV A;  1BDF A;  2JA7 A;  4BLA A;  4BLB A;  2PMZ D;  2PPB A;  3PO3 K;  5IYC C;  4J3N A;  3HOU C;  5IYB C;  3S2D C;  3ADA C;  3NUH A;  3FOF A;  3S2H C;  1HQM A;  3S17 K;  1I3Q A;  4BBS K;  3A8K A;  3GSI A;  4G0U A;  3N3Y A;  1UV7 A;  3S1Q K;  1VJE A;  3H3V L;  3TFI A;  2R7Z C;  3L4K A;  3HOY K;  5HL8 A;  4A3E K;  4WIL A;  3GTG K;  4C2M C;  1WIH A;  2GAG C;  4BBR C;  5EGH A;  2JA8 K;  3M4O K;  4LJZ A;  4BY7 K;  3FKI K;  4OIQ A;  3GTM A;  2E2H C;  1EK8 A;  4OIN A;  3OEP A;  5D4D A;  3RZO C;  1WQH A;  3T01 A;  4LR2 A;  3S14 K;  4AYB D;  4A3K K;  2B63 A;  5IOR A;  3HOX K;  1USO A;  4BBS C;  1O2A A;  4BY1 C;  3BP3 A;  5C3E C;  1SFO K; 
#chains in the Genus database with same CATH homology
 3GTO K;  5M3M K;  4Y52 C;  1TWF K;  1Y1V C;  2A69 A;  2PMZ L;  5FLM C;  4A3J K;  3HOV C;  3I4N K;  1ZYR A;  1SMY A;  4G7O A;  3M4O C;  4C3H K;  3GTP C;  2JA8 C;  3PO2 K;  1I6V A;  3DXJ A;  3FKI C;  3PO3 C;  2JA6 K;  4MEX A;  4XSX A;  1K83 K;  2E2J C;  4Y7N C;  4A3F K;  3H0G K;  2E2H K;  2NVX C;  4A3B K;  3K7A C;  4LK0 A;  5M5W K;  1TWH C;  2O5I A;  1I50 K;  1K83 C;  4G7Z A;  3S2H K;  4A3B C;  3CQZ K;  3K7A K;  4G7H A;  3HOX C;  3HKZ D;  4MEY A;  5FJ8 K;  1Y1W K;  4A3K C;  3HOZ K;  2O5J A;  1YNJ A;  2YU9 C;  2R93 C;  5C4X K;  2A68 A;  3GTJ C;  5IP9 K;  5C44 K;  1TWG C;  2Y0S D;  4X6A K;  3S1M K;  2WB1 L;  1XPP A;  4A3E C;  4XLP A;  4YFX A;  1YNN A;  1TWG K;  1R9T C;  5IYD K;  2R92 K;  3GTM C;  3GTO C;  2VUM K;  4A3L K;  4BXX K;  4BY7 C;  4QJV B;  4ZH4 A;  5FLM K;  3GTP K;  4C3I K;  3S1N K;  4XSZ A;  3S2D K;  4MQ9 A;  4A3F C;  4XLN A;  4A93 K;  4LK1 A;  5M5Y K;  2NVQ K;  3S14 C;  5C4J C;  3GTK K;  3HOW C;  4C3J K;  2NVY K;  4A3G K;  4QIW L;  3HKZ L;  2NVT K;  3GTL C;  2NVY C;  4A3C K;  1SFO C;  4NOI A;  2B63 K;  4KN7 A;  3GTQ K;  2R7Z K;  4A3G C;  4YFK A;  2PA8 D;  5IP9 C;  5C44 C;  5C4X C;  3S16 K;  1TWA C;  4BBR K;  2WAQ D;  2E2I C;  4Q4Z A;  1I6H K;  5IYD C;  1R9T K;  3H3V D;  3I4N C;  4GZY A;  1TWF C;  2CW0 A;  3I4M C;  1BDF A;  2A6H A;  3S15 C;  1I6H C;  2JA7 K;  4A3I K;  4OIP A;  3GTM K;  5IYB K;  2PMZ D;  3RZD C;  2JA5 C;  2PPB A;  3PO3 K;  1I3Q K;  5IYC C;  4A3D K;  3RZO K;  3HOU C;  5IYB C;  3S2D C;  1TWH K;  4AYB L;  4LLG A;  1I50 C;  2NVX K;  1HQM A;  4BY1 K;  3S17 K;  3S2H C;  4BBS K;  5TMF A;  4KMU A;  4QJV A;  5C3E K;  3HOW K;  4OIR A;  4Q5S A;  5IP7 C;  2A6E A;  2NVQ C;  3S1Q K;  3HOZ C;  3GTJ K;  3H3V L;  3HOY C;  2YU9 K;  5IP7 K;  3WOD A;  3S1M C;  3S1Q C;  4JK1 A;  5TMC A;  3GTG C;  2R7Z C;  4Y52 K;  3HOY K;  2BE5 A;  4YG2 A;  4A3J C;  4A3E K;  3HOV K;  1Y1V K;  3GTG K;  2R93 K;  2Y0S L;  2E2I K;  3S16 C;  3M3Y C;  4A3L C;  4BBR C;  2R92 C;  3EQL A;  4QIW D;  2JA8 K;  3M4O K;  4LJZ A;  2VUM C;  4BXX C;  1IW7 A;  4KN4 A;  3FKI K;  3S15 K;  4C2M K;  3M3Y K;  2JA7 C;  4OIO A;  4OIQ A;  3PO2 C;  1TWC K;  3I4M K;  4Y7N K;  2E2H C;  5M3F K;  4A3I C;  2JA6 C;  3S1N C;  2E2J K;  4OIN A;  2WAQ L;  1TWC C;  3H0G C;  5D4D A;  3RZD K;  2JA5 K;  3RZO C;  1WCM K;  2WB1 D;  1I3Q C;  5IYC K;  4A3M K;  4A3D C;  3S14 K;  4BY7 K;  5C4J K;  4AYB D;  4A3K K;  3GTK C;  3HOU K;  3CQZ C;  4A93 C;  3HOX K;  1WCM C;  4A3M C;  3S1R C;  4BBS C;  1Y1W C;  2PA8 L;  4YFN A;  4BY1 C;  5C3E C;  3S17 C;  3GTL K;  4A3C C;  1SFO K;  2B63 C;  5M5X K;  3GTQ C;  3S1R K;  2NVT C;  4X6A C;  1TWA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...