4A3LK

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3lK00
2A6HA 2Y0SL 3K7AK 4MEYA 4NOIA 5FJ8K 1BDFA 1SMYA 4XLNA 3S1QK 1Y1VK 3M3YK 3GTKK 4Y7NK 1SFOC 2E2JC 4QJVA 4YFNA 2VUMK 3GTPC 5IYBK 3S14C 4A3CC 4Q5SA 5M5XK 3HOWC 5IYCC 4GZYA 3S1MC 2R7ZC 3GTMC 3GTGC 4YFXA 4A3FC 1K83C 2NVYC 2JA5K 3GTLC 2WB1L 2A69A 3S15C 4QJVB 5C44K 5IP7K 2O5IA 5M3MK 5FLMK 4AYBD 5TMFA 2NVXC 4YFKA 4LLGA 4A3IC 2R93K 1TWCK 4JK1A 5C3EC 2JA7K 2Y0SD 4XSZA 4ZH4A 3RZDK 4LK1A 4BBRK 5IYDC 4OIQA 3RZOK 1I6HK 4G7ZA 5C4XC 4A3DC 1HQMA 1YNJA 4G7HA 3S2DK 2NVTK 5IP9C 3HOVC 4XSXA 3HOYK 1TWHK 4QIWL 3S17C 3H0GK 1TWFC 1I3QK 1ZYRA 3HOXK 2WB1D 4BY1C 2B63C 2CW0A 3HOUK 3HOZC 3PO2C 4A3JC 4OINA 2NVQK 3S16C 4A3LK 1I50K 2E2JK 2WAQL 2O5JA 4A3MC 4A3EK 2PMZL 4A3CK 3S1NK 3I4NC 5M3FK 4BY7K 1R9TC 3GTGK 3GTMK 1WCMC 4KN4A 4A3FK 1K83K 2NVYK 3K7AC 2JA6K 3GTOK 3GTLK 2R7ZK 3PO3C 3M4OK 1Y1VC 2PA8D 3M3YC 3GTKC 4Y7NC 3GTJK 3CQZK 2R92C 3H3VL 2VUMC 4A3BK 5IYBC 4X6AC 4G7OA 2A68A 4C2MK 2NVXK 3HKZL 2JA8K 1TWGK 4A3KK 5D4DA 4A3IK 4A93C 4Y52C 4LJZA 4BXXC 4A3GC 2E2HK 3GTQK 3FKIK 5C44C 5C4JK 5IP7C 1Y1WC 1TWAK 3I4MK 2WAQD 4OIPA 2PMZD 1YNNA 4A3DK 2R93C 4BBSK 2E2IC 1SFOK 2PPBA 2JA7C 3GTPK 3S14K 2B63K 4BBSC 3RZDC 3S1RC 4BY1K 3HOWK 3S16K 5IYCK 4MEXA 2YU9C 3HOZK 3PO2K 3RZOC 3S2HC 1I6HC 3H3VD 3S1MK 3S2DC 2NVTC 4KMUA 3I4NK 3S15K 4C3HK 4LK0A 3H0GC 3I4MC 3HOXC 1I3QC 1WCMK 3HOUC 4BXXK 4A3GK 4A3LC 4YG2A 2NVQC 1I50C 2JA5C 5TMCA 4QIWD 2R92K 3S1QC 4A3EC 4X6AK 5C3EK 3DXJA 3S1NC 4OIRA 5M5YK 1XPPA 5IYDK 2BE5A 4C3IK 4A93K 2JA6C 4BY7C 3GTOC 5FLMC 4Y52K 5C4XK 2A6EA 3M4OC 3GTJC 4XLPA 3CQZC 5M5WK 3HOVK 4MQ9A 5IP9K 1TWCC 3WODA 4C3JK 4A3BC 1Y1WK 4KN7A 3S17K 1IW7A 1TWFK 4BBRC 2JA8C 3PO3K 1TWGC 4Q4ZA 4A3KC 4A3JK 2E2IK 2E2HC 4OIOA 3EQLA 4AYBL 4A3MK 3GTQC 2PA8L 3FKIC 3HKZD 3S1RK 1TWHC 5C4JC 3HOYC 2YU9K 1I6VA 3S2HK 1TWAC 1R9TK
chains in the Genus database with same CATH superfamily
1BDFA 1Y1VK 3M3YK 1SFOC 4C45A 2CFAA 4QJVA 1PJ5A 3LAPA 5IYBK 3AD9C 2FQTA 2R7ZC 3S1MC 4A3FC 1K83C 2JA5K 4GTLA 2GAGC 2A69A 1WIHA 3S15C 4C3HC 2O5IA 3ERED 5FLMK 1WOPA 4LLGA 4A3IC 1IQ0A 2YU9A 2JA7K 5IYDC 1USMA 1Y1VA 4P9SA 4KATA 4C3IC 2FQOA 2XCRB 4KM8A 3HOVC 3OREA 3H0GK 3TFIA 1WQGA 2V6SA 2JA5A 2CW0A 1IE0A 1J98A 4KMDA 1R9TC 2R7ZK 1WCMC 4A3FK 1K83K 3Q3QA 1C0AA 2JA7A 4KB2A 3BP8C 3N0BA 3H3VL 4A3BK 1O25A 3HKZL 2JA8K 1TWGK 4A3KK 4A3IK 4LJZA 2ZFZA 3H0GA 4KARA 5C44C 5IOSA 3AQPA 1EFWA 3T00A 2E2IC 1RU0A 2R7ZA 1K83A 3GEHA 1DCHA 3HOWK 5IYCK 3RZOC 3S2DC 2NVTC 1TWGA 1YCLA 1I3QC 1WCMK 4LOWA 1ZXOA 5IOQA 1B4BA 4YG2A 2NVQC 1XXBA 4QIWD 4A3EC 5C3EK 4OIRA 4GTFA 2BE5A 3CQZC 4FZBA 3WODA 4C3JK 4KN7A 1DD5A 4BLBA 1WOSA 2E2IK 2E2HC 1WCMA 4OIOA 2A6HA 3S1QK 5FJ8K 4YFNA 1XXAA 4YFXA 3GTLC 2WB1L 3NUHA 4QJVB 5IP7K 2E2IA 4GTEA 1VH2A 3V4GA 2NVXC 5TMFA 5CJ9A 4P5BA 4AH6A 2R93K 2Y0SD 4XSZA 4ZH4A 3RZDK 4LK1A 1O2FB 4G0UA 4GTBA 1XZPA 1I6HK 1O27A 1YX2A 3GIRA 1BS2A 5C4XC 1I3QA 4XSXA 3GEEA 4QIWL 1TWFC 2B63C 3HOUK 4BY1C 3PO3C 1V5VA 2KWAA 3BP3A 2P8TA 1X31C 4GTDA 2O5JA 1DCOA 4PABA 2R93A 2PHCB 3K7AC 2JA6K 4BY7K 3GTLK 3GTKC 4Y7NC 3GTJK 3L4JA 3T02A 3FOEA 1J6VA 2RH6A 2VUMC 3GDZA 2NVXK 3GTQK 3FKIK 1TWAK 2WAQD 4OIPA 2PMZD 3T01A 2P5MA 1O26A 1VLOA 1SFOK 4O2DA 4BBSC 2B63K 2JA6A 1G51A 3GTLA 4BY1K 1EH1A 3GTJA 3S1MK 1IL2A 4KMAA 4M1XA 2NVXA 3S15K 4C3HK 2GSOA 4LK0A 3HXAA 3HOXC 4A3LC 3GTQA 3FKIA 1I50C 1TWAA 3DXJA 3S1NC 5CHPA 5TJ3A 3CAGA 4KMHA 1J6WA 5IYDK 1PJ6A 2ZUFA 4C3IK 1SFOA 3GTOC 3M4OC 2A6EA 4G0WA 2B63A 3HOVK 4MQ9A 1TWCC 4BBRC 4Q4ZA 2EBBA 1F93A 2GAHC 1F7VA 4BBSK 3HOYC 5C4JC 3I4MC 1R9TK 4NOIA 4MEYA 5IORA 4XLNA 4LR2A 1HI9A 1PJ7A 3SZZA 3GTPC 4KDDA 3S14C 5JFEA 5M5XK 4A3CC 3TFJA 3L4KA 1XZQB 3N0CA 1VJEA 5C44K 4AYBD 4KASA 1TWCK 4JK1A 1R9TA 3OPFA 4BBRK 2V6TA 3RZOK 3AH5A 4G7ZA 4P5AA 3S2DK 2RGRA 2NVTK 5IP9C 3HOYK 1JOEA 5JVOA 3S17C 2GSNA 3IPJA 1I3QK 1ZYRA 3S16C 1L0WA 4A3JC 2NVQK 2XCOA 4A3MC 4A3EK 4A3CK 5M3FK 2CFAB 1WOOA 1USOA 1TWCA 4KN4A 4BXXC 3OEPA 1Y1VC 4DDQA 3M3YC 2Y3PA 3CQZK 5IYBC 1O28A 3FHZA 4G7OA 1F7UA 4X6AC 2A68A 1O2BA 5IOTA 4Y52C 1EQRA 2E2HK 3ADAC 4KC6A 1WQHA 1GE9A 1Y1WC 1YNNA 4LQYA 1IBAA 3S0XA 3TTGA 2JA7C 1INNA 3S16K 3S2HC 3CQZA 3H3VD 3SZYA 5EGEA 3JSTA 3H0GC 1ZQ1C 4BXXK 2E2HA 3AD8C 5TMCA 4X6AK 4KB4A 4GTAA 3A8JA 1ZVUA 4ILDA 4Y52K 5C4XK 3N3YA 1VGXA 2D6FC 4XLPA 5M5WK 4A3BC 4BLAA 1Y1WK 3MMLB 4WILA 1TWFK 2JA8C 3PO3K 1TWGC 4A3KC 4GFQA 3LPXA 4J3NA 1TWHC 4G0VA 3S2HK 4BKWA 1J6XA 4WJ3M 2Y0SL 3K7AK 1SMYA 1UV7A 1IS1A 3GTKK 4Y7NK 2E2JC 2VUMK 4Q5SA 3HOWC 5IYCC 4GZYA 5L46A 3GTGC 3GTMC 2NVYC 1Y1WA 1TWFA 1BGWA 2V6UA 1WQFA 5M3MK 4C2MC 3BUEA 3A8IA 4YFKA 1DCPA 5C3EC 4OIQA 1JQWA 3GTKA 2VUMA 4A3DC 1O24A 4GTCA 1HQMA 1YNJA 4G7HA 3VA7A 4C3JC 1TWHK 4PAAA 1AB4A 3HOXK 5E68A 1O29A 2WB1D 4FM9A 3HOZC 3PO2C 4OINA 3AQOA 4A3LK 1EK8A 1I50K 2E2JK 2WAQL 1JVIA 2PMZL 3S1NK 2GSUA 3I4NC 3GTGK 3GTMK 4A3GC 4WJ4A 2NVYK 3S1QC 3GTOK 3M4OK 2PA8D 4XCHA 2R92C 1EI6A 5HL8A 1KQ4A 1O2AA 4C2MK 4KM9A 5D4DA 1TWHA 4A93C 3LAJA 1BJTA 2W7VA 5C4JK 5IP7C 3I4MK 1I50A 4A3DK 1XXCA 2R93C 1XZPB 2PPBA 3GTGA 3GTMA 3GEIA 2ZUEA 3GTPK 2NVYA 3AD7C 3S14K 4GT9A 3RZDC 3S1RC 3GTOA 3HOZK 4MEXA 2YU9C 3QX3A 4KAWX 3PO2K 1I6HC 1VRQC 2JH3A 1ISEA 1WORA 1WSRA 5EGHA 4KMUA 3I4NK 3G4CA 3HOUC 4A3GK 1B4AA 1XZQA 1ZBSA 2JA5C 2R92K 5M5YK 1XPPA 3A8KA 4A93K 2JA6C 4BY7C 5FLMC 3GSIA 3GTPA 3GTJC 4RMFA 5IP9K 3FOFA 3S17K 1IW7A 1WSVA 4A3JK 3TFHA 3EQLA 4AYBL 4A3MK 3GTQC 2PA8L 1F9NA 3FKIC 3G4AA 3HKZD 3S1RK 2YU9K 1I6VA 1TWAC 2XCQA 2R92A
chains in the Genus database with same CATH topology
2A6HA 2Y0SL 3K7AK 4MEYA 4NOIA 5FJ8K 1BDFA 1SMYA 4XLNA 3S1QK 1Y1VK 3M3YK 3GTKK 4Y7NK 1SFOC 2E2JC 4QJVA 4YFNA 2VUMK 3GTPC 5IYBK 3S14C 4A3CC 4Q5SA 5M5XK 3HOWC 5IYCC 4GZYA 3S1MC 2R7ZC 3GTMC 3GTGC 4YFXA 4A3FC 1K83C 2NVYC 2JA5K 3GTLC 2WB1L 2A69A 3S15C 4QJVB 5C44K 5IP7K 2O5IA 5M3MK 5FLMK 4AYBD 5TMFA 2NVXC 4YFKA 4LLGA 4A3IC 2R93K 1TWCK 4JK1A 5C3EC 2JA7K 2Y0SD 4XSZA 4ZH4A 3RZDK 4LK1A 4BBRK 5IYDC 4OIQA 3RZOK 1I6HK 4G7ZA 5C4XC 4A3DC 1HQMA 1YNJA 4G7HA 3S2DK 2NVTK 5IP9C 3HOVC 4XSXA 3HOYK 1TWHK 4QIWL 3S17C 3H0GK 1TWFC 1I3QK 1ZYRA 3HOXK 2WB1D 4BY1C 2B63C 2CW0A 3HOUK 3HOZC 3PO2C 4A3JC 4OINA 2NVQK 3S16C 4A3LK 1I50K 2E2JK 2WAQL 2O5JA 4A3MC 4A3EK 2PMZL 4A3CK 3S1NK 3I4NC 5M3FK 4BY7K 1R9TC 3GTGK 3GTMK 1WCMC 4KN4A 4A3FK 1K83K 2NVYK 3K7AC 2JA6K 3GTOK 3GTLK 2R7ZK 3PO3C 3M4OK 1Y1VC 2PA8D 3M3YC 3GTKC 4Y7NC 3GTJK 3CQZK 2R92C 3H3VL 2VUMC 4A3BK 5IYBC 4X6AC 4G7OA 2A68A 4C2MK 2NVXK 3HKZL 2JA8K 1TWGK 4A3KK 5D4DA 4A3IK 4A93C 4Y52C 4LJZA 4BXXC 4A3GC 2E2HK 3GTQK 3FKIK 5C44C 5C4JK 5IP7C 1Y1WC 1TWAK 3I4MK 2WAQD 4OIPA 2PMZD 1YNNA 4A3DK 2R93C 4BBSK 2E2IC 1SFOK 2PPBA 2JA7C 3GTPK 3S14K 2B63K 4BBSC 3RZDC 3S1RC 4BY1K 3HOWK 3S16K 5IYCK 4MEXA 2YU9C 3HOZK 3PO2K 3RZOC 3S2HC 1I6HC 3H3VD 3S1MK 3S2DC 2NVTC 4KMUA 3I4NK 3S15K 4C3HK 4LK0A 3H0GC 3I4MC 3HOXC 1I3QC 1WCMK 3HOUC 4BXXK 4A3GK 4A3LC 4YG2A 2NVQC 1I50C 2JA5C 5TMCA 4QIWD 2R92K 3S1QC 4A3EC 4X6AK 5C3EK 3DXJA 3S1NC 4OIRA 5M5YK 1XPPA 5IYDK 2BE5A 4C3IK 4A93K 2JA6C 4BY7C 3GTOC 5FLMC 4Y52K 5C4XK 2A6EA 3M4OC 3GTJC 4XLPA 3CQZC 5M5WK 3HOVK 4MQ9A 5IP9K 1TWCC 3WODA 4C3JK 4A3BC 1Y1WK 4KN7A 3S17K 1IW7A 1TWFK 4BBRC 2JA8C 3PO3K 1TWGC 4Q4ZA 4A3KC 4A3JK 2E2IK 2E2HC 4OIOA 3EQLA 4AYBL 4A3MK 3GTQC 2PA8L 3FKIC 3HKZD 3S1RK 1TWHC 5C4JC 3HOYC 2YU9K 1I6VA 3S2HK 1TWAC 1R9TK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H A;  2Y0S L;  3K7A K;  4MEY A;  4NOI A;  5FJ8 K;  1BDF A;  1SMY A;  4XLN A;  3S1Q K;  1Y1V K;  3M3Y K;  3GTK K;  4Y7N K;  1SFO C;  2E2J C;  4QJV A;  4YFN A;  2VUM K;  3GTP C;  5IYB K;  3S14 C;  4A3C C;  4Q5S A;  5M5X K;  3HOW C;  5IYC C;  4GZY A;  3S1M C;  2R7Z C;  3GTM C;  3GTG C;  4YFX A;  4A3F C;  1K83 C;  2NVY C;  2JA5 K;  3GTL C;  2WB1 L;  2A69 A;  3S15 C;  4QJV B;  5C44 K;  5IP7 K;  2O5I A;  5M3M K;  5FLM K;  4AYB D;  5TMF A;  2NVX C;  4YFK A;  4LLG A;  4A3I C;  2R93 K;  1TWC K;  4JK1 A;  5C3E C;  2JA7 K;  2Y0S D;  4XSZ A;  4ZH4 A;  3RZD K;  4LK1 A;  4BBR K;  5IYD C;  4OIQ A;  3RZO K;  1I6H K;  4G7Z A;  5C4X C;  4A3D C;  1HQM A;  1YNJ A;  4G7H A;  3S2D K;  2NVT K;  5IP9 C;  3HOV C;  4XSX A;  3HOY K;  1TWH K;  4QIW L;  3S17 C;  3H0G K;  1TWF C;  1I3Q K;  1ZYR A;  3HOX K;  2WB1 D;  4BY1 C;  2B63 C;  2CW0 A;  3HOU K;  3HOZ C;  3PO2 C;  4A3J C;  4OIN A;  2NVQ K;  3S16 C;  4A3L K;  1I50 K;  2E2J K;  2WAQ L;  2O5J A;  4A3M C;  4A3E K;  2PMZ L;  4A3C K;  3S1N K;  3I4N C;  5M3F K;  4BY7 K;  1R9T C;  3GTG K;  3GTM K;  1WCM C;  4KN4 A;  4A3F K;  1K83 K;  2NVY K;  3K7A C;  2JA6 K;  3GTO K;  3GTL K;  2R7Z K;  3PO3 C;  3M4O K;  1Y1V C;  2PA8 D;  3M3Y C;  3GTK C;  4Y7N C;  3GTJ K;  3CQZ K;  2R92 C;  3H3V L;  2VUM C;  4A3B K;  5IYB C;  4X6A C;  4G7O A;  2A68 A;  4C2M K;  2NVX K;  3HKZ L;  2JA8 K;  1TWG K;  4A3K K;  5D4D A;  4A3I K;  4A93 C;  4Y52 C;  4LJZ A;  4BXX C;  4A3G C;  2E2H K;  3GTQ K;  3FKI K;  5C44 C;  5C4J K;  5IP7 C;  1Y1W C;  1TWA K;  3I4M K;  2WAQ D;  4OIP A;  2PMZ D;  1YNN A;  4A3D K;  2R93 C;  4BBS K;  2E2I C;  1SFO K;  2PPB A;  2JA7 C;  3GTP K;  3S14 K;  2B63 K;  4BBS C;  3RZD C;  3S1R C;  4BY1 K;  3HOW K;  3S16 K;  5IYC K;  4MEX A;  2YU9 C;  3HOZ K;  3PO2 K;  3RZO C;  3S2H C;  1I6H C;  3H3V D;  3S1M K;  3S2D C;  2NVT C;  4KMU A;  3I4N K;  3S15 K;  4C3H K;  4LK0 A;  3H0G C;  3I4M C;  3HOX C;  1I3Q C;  1WCM K;  3HOU C;  4BXX K;  4A3G K;  4A3L C;  4YG2 A;  2NVQ C;  1I50 C;  2JA5 C;  5TMC A;  4QIW D;  2R92 K;  3S1Q C;  4A3E C;  4X6A K;  5C3E K;  3DXJ A;  3S1N C;  4OIR A;  5M5Y K;  1XPP A;  5IYD K;  2BE5 A;  4C3I K;  4A93 K;  2JA6 C;  4BY7 C;  3GTO C;  5FLM C;  4Y52 K;  5C4X K;  2A6E A;  3M4O C;  3GTJ C;  4XLP A;  3CQZ C;  5M5W K;  3HOV K;  4MQ9 A;  5IP9 K;  1TWC C;  3WOD A;  4C3J K;  4A3B C;  1Y1W K;  4KN7 A;  3S17 K;  1IW7 A;  1TWF K;  4BBR C;  2JA8 C;  3PO3 K;  1TWG C;  4Q4Z A;  4A3K C;  4A3J K;  2E2I K;  2E2H C;  4OIO A;  3EQL A;  4AYB L;  4A3M K;  3GTQ C;  2PA8 L;  3FKI C;  3HKZ D;  3S1R K;  1TWH C;  5C4J C;  3HOY C;  2YU9 K;  1I6V A;  3S2H K;  1TWA C;  1R9T K; 
#chains in the Genus database with same CATH topology
 1BDF A;  1Y1V K;  3M3Y K;  1SFO C;  4C45 A;  2CFA A;  4QJV A;  1PJ5 A;  3LAP A;  5IYB K;  3AD9 C;  2FQT A;  2R7Z C;  3S1M C;  4A3F C;  1K83 C;  2JA5 K;  4GTL A;  2GAG C;  2A69 A;  1WIH A;  3S15 C;  4C3H C;  2O5I A;  3ERE D;  5FLM K;  1WOP A;  4LLG A;  4A3I C;  1IQ0 A;  2YU9 A;  2JA7 K;  5IYD C;  1USM A;  1Y1V A;  4P9S A;  4KAT A;  4C3I C;  2FQO A;  2XCR B;  4KM8 A;  3HOV C;  3ORE A;  3H0G K;  3TFI A;  1WQG A;  2V6S A;  2JA5 A;  2CW0 A;  1IE0 A;  1J98 A;  4KMD A;  1R9T C;  2R7Z K;  1WCM C;  4A3F K;  1K83 K;  3Q3Q A;  1C0A A;  2JA7 A;  4KB2 A;  3BP8 C;  3N0B A;  3H3V L;  4A3B K;  1O25 A;  3HKZ L;  2JA8 K;  1TWG K;  4A3K K;  4A3I K;  4LJZ A;  2ZFZ A;  3H0G A;  4KAR A;  5C44 C;  5IOS A;  3AQP A;  1EFW A;  3T00 A;  2E2I C;  1RU0 A;  2R7Z A;  1K83 A;  3GEH A;  1DCH A;  3HOW K;  5IYC K;  3RZO C;  3S2D C;  2NVT C;  1TWG A;  1YCL A;  1I3Q C;  1WCM K;  4LOW A;  1ZXO A;  5IOQ A;  1B4B A;  4YG2 A;  2NVQ C;  1XXB A;  4QIW D;  4A3E C;  5C3E K;  4OIR A;  4GTF A;  2BE5 A;  3CQZ C;  4FZB A;  3WOD A;  4C3J K;  4KN7 A;  1DD5 A;  4BLB A;  1WOS A;  2E2I K;  2E2H C;  1WCM A;  4OIO A;  2A6H A;  3S1Q K;  5FJ8 K;  4YFN A;  1XXA A;  4YFX A;  3GTL C;  2WB1 L;  3NUH A;  4QJV B;  5IP7 K;  2E2I A;  4GTE A;  1VH2 A;  3V4G A;  2NVX C;  5TMF A;  5CJ9 A;  4P5B A;  4AH6 A;  2R93 K;  2Y0S D;  4XSZ A;  4ZH4 A;  3RZD K;  4LK1 A;  1O2F B;  4G0U A;  4GTB A;  1XZP A;  1I6H K;  1O27 A;  1YX2 A;  3GIR A;  1BS2 A;  5C4X C;  1I3Q A;  4XSX A;  3GEE A;  4QIW L;  1TWF C;  2B63 C;  3HOU K;  4BY1 C;  3PO3 C;  1V5V A;  2KWA A;  3BP3 A;  2P8T A;  1X31 C;  4GTD A;  2O5J A;  1DCO A;  4PAB A;  2R93 A;  2PHC B;  3K7A C;  2JA6 K;  4BY7 K;  3GTL K;  3GTK C;  4Y7N C;  3GTJ K;  3L4J A;  3T02 A;  3FOE A;  1J6V A;  2RH6 A;  2VUM C;  3GDZ A;  2NVX K;  3GTQ K;  3FKI K;  1TWA K;  2WAQ D;  4OIP A;  2PMZ D;  3T01 A;  2P5M A;  1O26 A;  1VLO A;  1SFO K;  4O2D A;  4BBS C;  2B63 K;  2JA6 A;  1G51 A;  3GTL A;  4BY1 K;  1EH1 A;  3GTJ A;  3S1M K;  1IL2 A;  4KMA A;  4M1X A;  2NVX A;  3S15 K;  4C3H K;  2GSO A;  4LK0 A;  3HXA A;  3HOX C;  4A3L C;  3GTQ A;  3FKI A;  1I50 C;  1TWA A;  3DXJ A;  3S1N C;  5CHP A;  5TJ3 A;  3CAG A;  4KMH A;  1J6W A;  5IYD K;  1PJ6 A;  2ZUF A;  4C3I K;  1SFO A;  3GTO C;  3M4O C;  2A6E A;  4G0W A;  2B63 A;  3HOV K;  4MQ9 A;  1TWC C;  4BBR C;  4Q4Z A;  2EBB A;  1F93 A;  2GAH C;  1F7V A;  4BBS K;  3HOY C;  5C4J C;  3I4M C;  1R9T K;  4NOI A;  4MEY A;  5IOR A;  4XLN A;  4LR2 A;  1HI9 A;  1PJ7 A;  3SZZ A;  3GTP C;  4KDD A;  3S14 C;  5JFE A;  5M5X K;  4A3C C;  3TFJ A;  3L4K A;  1XZQ B;  3N0C A;  1VJE A;  5C44 K;  4AYB D;  4KAS A;  1TWC K;  4JK1 A;  1R9T A;  3OPF A;  4BBR K;  2V6T A;  3RZO K;  3AH5 A;  4G7Z A;  4P5A A;  3S2D K;  2RGR A;  2NVT K;  5IP9 C;  3HOY K;  1JOE A;  5JVO A;  3S17 C;  2GSN A;  3IPJ A;  1I3Q K;  1ZYR A;  3S16 C;  1L0W A;  4A3J C;  2NVQ K;  2XCO A;  4A3M C;  4A3E K;  4A3C K;  5M3F K;  2CFA B;  1WOO A;  1USO A;  1TWC A;  4KN4 A;  4BXX C;  3OEP A;  1Y1V C;  4DDQ A;  3M3Y C;  2Y3P A;  3CQZ K;  5IYB C;  1O28 A;  3FHZ A;  4G7O A;  1F7U A;  4X6A C;  2A68 A;  1O2B A;  5IOT A;  4Y52 C;  1EQR A;  2E2H K;  3ADA C;  4KC6 A;  1WQH A;  1GE9 A;  1Y1W C;  1YNN A;  4LQY A;  1IBA A;  3S0X A;  3TTG A;  2JA7 C;  1INN A;  3S16 K;  3S2H C;  3CQZ A;  3H3V D;  3SZY A;  5EGE A;  3JST A;  3H0G C;  1ZQ1 C;  4BXX K;  2E2H A;  3AD8 C;  5TMC A;  4X6A K;  4KB4 A;  4GTA A;  3A8J A;  1ZVU A;  4ILD A;  4Y52 K;  5C4X K;  3N3Y A;  1VGX A;  2D6F C;  4XLP A;  5M5W K;  4A3B C;  4BLA A;  1Y1W K;  3MML B;  4WIL A;  1TWF K;  2JA8 C;  3PO3 K;  1TWG C;  4A3K C;  4GFQ A;  3LPX A;  4J3N A;  1TWH C;  4G0V A;  3S2H K;  4BKW A;  1J6X A;  4WJ3 M;  2Y0S L;  3K7A K;  1SMY A;  1UV7 A;  1IS1 A;  3GTK K;  4Y7N K;  2E2J C;  2VUM K;  4Q5S A;  3HOW C;  5IYC C;  4GZY A;  5L46 A;  3GTG C;  3GTM C;  2NVY C;  1Y1W A;  1TWF A;  1BGW A;  2V6U A;  1WQF A;  5M3M K;  4C2M C;  3BUE A;  3A8I A;  4YFK A;  1DCP A;  5C3E C;  4OIQ A;  1JQW A;  3GTK A;  2VUM A;  4A3D C;  1O24 A;  4GTC A;  1HQM A;  1YNJ A;  4G7H A;  3VA7 A;  4C3J C;  1TWH K;  4PAA A;  1AB4 A;  3HOX K;  5E68 A;  1O29 A;  2WB1 D;  4FM9 A;  3HOZ C;  3PO2 C;  4OIN A;  3AQO A;  4A3L K;  1EK8 A;  1I50 K;  2E2J K;  2WAQ L;  1JVI A;  2PMZ L;  3S1N K;  2GSU A;  3I4N C;  3GTG K;  3GTM K;  4A3G C;  4WJ4 A;  2NVY K;  3S1Q C;  3GTO K;  3M4O K;  2PA8 D;  4XCH A;  2R92 C;  1EI6 A;  5HL8 A;  1KQ4 A;  1O2A A;  4C2M K;  4KM9 A;  5D4D A;  1TWH A;  4A93 C;  3LAJ A;  1BJT A;  2W7V A;  5C4J K;  5IP7 C;  3I4M K;  1I50 A;  4A3D K;  1XXC A;  2R93 C;  1XZP B;  2PPB A;  3GTG A;  3GTM A;  3GEI A;  2ZUE A;  3GTP K;  2NVY A;  3AD7 C;  3S14 K;  4GT9 A;  3RZD C;  3S1R C;  3GTO A;  3HOZ K;  4MEX A;  2YU9 C;  3QX3 A;  4KAW X;  3PO2 K;  1I6H C;  1VRQ C;  2JH3 A;  1ISE A;  1WOR A;  1WSR A;  5EGH A;  4KMU A;  3I4N K;  3G4C A;  3HOU C;  4A3G K;  1B4A A;  1XZQ A;  1ZBS A;  2JA5 C;  2R92 K;  5M5Y K;  1XPP A;  3A8K A;  4A93 K;  2JA6 C;  4BY7 C;  5FLM C;  3GSI A;  3GTP A;  3GTJ C;  4RMF A;  5IP9 K;  3FOF A;  3S17 K;  1IW7 A;  1WSV A;  4A3J K;  3TFH A;  3EQL A;  4AYB L;  4A3M K;  3GTQ C;  2PA8 L;  1F9N A;  3FKI C;  3G4A A;  3HKZ D;  3S1R K;  2YU9 K;  1I6V A;  1TWA C;  2XCQ A;  2R92 A; 
#chains in the Genus database with same CATH homology
 2A6H A;  2Y0S L;  3K7A K;  4MEY A;  4NOI A;  5FJ8 K;  1BDF A;  1SMY A;  4XLN A;  3S1Q K;  1Y1V K;  3M3Y K;  3GTK K;  4Y7N K;  1SFO C;  2E2J C;  4QJV A;  4YFN A;  2VUM K;  3GTP C;  5IYB K;  3S14 C;  4A3C C;  4Q5S A;  5M5X K;  3HOW C;  5IYC C;  4GZY A;  3S1M C;  2R7Z C;  3GTM C;  3GTG C;  4YFX A;  4A3F C;  1K83 C;  2NVY C;  2JA5 K;  3GTL C;  2WB1 L;  2A69 A;  3S15 C;  4QJV B;  5C44 K;  5IP7 K;  2O5I A;  5M3M K;  5FLM K;  4AYB D;  5TMF A;  2NVX C;  4YFK A;  4LLG A;  4A3I C;  2R93 K;  1TWC K;  4JK1 A;  5C3E C;  2JA7 K;  2Y0S D;  4XSZ A;  4ZH4 A;  3RZD K;  4LK1 A;  4BBR K;  5IYD C;  4OIQ A;  3RZO K;  1I6H K;  4G7Z A;  5C4X C;  4A3D C;  1HQM A;  1YNJ A;  4G7H A;  3S2D K;  2NVT K;  5IP9 C;  3HOV C;  4XSX A;  3HOY K;  1TWH K;  4QIW L;  3S17 C;  3H0G K;  1TWF C;  1I3Q K;  1ZYR A;  3HOX K;  2WB1 D;  4BY1 C;  2B63 C;  2CW0 A;  3HOU K;  3HOZ C;  3PO2 C;  4A3J C;  4OIN A;  2NVQ K;  3S16 C;  4A3L K;  1I50 K;  2E2J K;  2WAQ L;  2O5J A;  4A3M C;  4A3E K;  2PMZ L;  4A3C K;  3S1N K;  3I4N C;  5M3F K;  4BY7 K;  1R9T C;  3GTG K;  3GTM K;  1WCM C;  4KN4 A;  4A3F K;  1K83 K;  2NVY K;  3K7A C;  2JA6 K;  3GTO K;  3GTL K;  2R7Z K;  3PO3 C;  3M4O K;  1Y1V C;  2PA8 D;  3M3Y C;  3GTK C;  4Y7N C;  3GTJ K;  3CQZ K;  2R92 C;  3H3V L;  2VUM C;  4A3B K;  5IYB C;  4X6A C;  4G7O A;  2A68 A;  4C2M K;  2NVX K;  3HKZ L;  2JA8 K;  1TWG K;  4A3K K;  5D4D A;  4A3I K;  4A93 C;  4Y52 C;  4LJZ A;  4BXX C;  4A3G C;  2E2H K;  3GTQ K;  3FKI K;  5C44 C;  5C4J K;  5IP7 C;  1Y1W C;  1TWA K;  3I4M K;  2WAQ D;  4OIP A;  2PMZ D;  1YNN A;  4A3D K;  2R93 C;  4BBS K;  2E2I C;  1SFO K;  2PPB A;  2JA7 C;  3GTP K;  3S14 K;  2B63 K;  4BBS C;  3RZD C;  3S1R C;  4BY1 K;  3HOW K;  3S16 K;  5IYC K;  4MEX A;  2YU9 C;  3HOZ K;  3PO2 K;  3RZO C;  3S2H C;  1I6H C;  3H3V D;  3S1M K;  3S2D C;  2NVT C;  4KMU A;  3I4N K;  3S15 K;  4C3H K;  4LK0 A;  3H0G C;  3I4M C;  3HOX C;  1I3Q C;  1WCM K;  3HOU C;  4BXX K;  4A3G K;  4A3L C;  4YG2 A;  2NVQ C;  1I50 C;  2JA5 C;  5TMC A;  4QIW D;  2R92 K;  3S1Q C;  4A3E C;  4X6A K;  5C3E K;  3DXJ A;  3S1N C;  4OIR A;  5M5Y K;  1XPP A;  5IYD K;  2BE5 A;  4C3I K;  4A93 K;  2JA6 C;  4BY7 C;  3GTO C;  5FLM C;  4Y52 K;  5C4X K;  2A6E A;  3M4O C;  3GTJ C;  4XLP A;  3CQZ C;  5M5W K;  3HOV K;  4MQ9 A;  5IP9 K;  1TWC C;  3WOD A;  4C3J K;  4A3B C;  1Y1W K;  4KN7 A;  3S17 K;  1IW7 A;  1TWF K;  4BBR C;  2JA8 C;  3PO3 K;  1TWG C;  4Q4Z A;  4A3K C;  4A3J K;  2E2I K;  2E2H C;  4OIO A;  3EQL A;  4AYB L;  4A3M K;  3GTQ C;  2PA8 L;  3FKI C;  3HKZ D;  3S1R K;  1TWH C;  5C4J C;  3HOY C;  2YU9 K;  1I6V A;  3S2H K;  1TWA C;  1R9T K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...