3M3YK

Rna polymerase ii elongation complex c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m3yK00
3S16K 5C44K 3S1QK 5M5XK 4Q4ZA 3S16C 5C44C 3I4MK 1WCMK 1YNJA 4Y7NK 3GTMK 4A3CK 4A3BK 1I50K 2O5IA 4A3CC 3H0GK 1I50C 2JA8K 4C3JK 4Y52C 2NVXC 3H0GC 2JA8C 4G7OA 4A3KK 3GTGK 3S15K 5C4XK 3RZDK 2E2IK 2NVYK 2A68A 3RZDC 3S15C 5C4XC 2NVYC 1Y1WK 2JA6K 3HOWC 1TWHK 1K83K 3S1MC 2PMZD 1Y1WC 2JA6C 4BY1K 1K83C 1TWHC 4A3MK 4A3IK 1HQMA 4A3MC 4BY1C 4A3EK 3H3VL 4A3DK 4A3IC 4LLGA 2JA7K 4A3EC 4A3DC 2JA7C 1SMYA 5IYDC 4G7ZA 3S2DK 5C3EC 2PA8D 3GTLK 5M5YK 3S2DC 5TMFA 4X6AK 3GTLC 4X6AC 3EQLA 3S17C 4BXXK 4XLPA 3GTQC 1I6HC 2WB1L 4BXXC 2NVXK 4Y52K 3CQZK 4OIOA 2A6HA 2PA8L 5M5WK 1TWAK 3CQZC 4OIRA 3HOUK 1ZYRA 4KMUA 1TWAC 4OIPA 4A3JK 2R93C 3HOUC 4A3JC 4YFKA 3HKZD 2NVTK 4QJVA 3HOXC 2NVTC 3HOWK 2Y0SD 1I6VA 3S1MK 3M3YC 1IW7A 3FKIK 4QJVB 3PO2K 4JK1A 4OINA 3FKIC 1Y1VC 4C2MK 3PO2C 3HKZL 1XPPA 4LJZA 3S1RK 4KN7A 3RZOC 2JA5K 1R9TK 2Y0SL 3S1RC 1YNNA 1TWCC 4A3FK 5IYDK 1R9TC 3GTPK 5C3EK 4YFXA 4A3FC 2PMZL 5M3MK 2VUMK 3GTPC 5D4DA 3GTOC 2VUMC 5IYCK 2A6EA 3WODA 3S17K 4OIQA 5IYCC 3M4OK 3GTQK 2A69A 5M3FK 1I6HK 4BY7K 3M4OC 1SFOK 2B63K 3HOZK 4BY7C 4ZH4A 4LK0A 1SFOC 2B63C 3HOZC 4LK1A 3HOYK 3PO3K 4NOIA 3HOVK 2R93K 3HOYC 3PO3C 3HOVC 3S2HC 1TWGK 5IP9K 3HOXK 3S1NK 1TWGC 4A3LK 5IP9C 3S1NC 3M3YK 4A3LC 4A3GK 4C3HK 5IYBC 4A3GC 1Y1VK 4G7HA 4BBSC 2R92C 3GTKK 3RZOK 1I3QK 4BBRC 2O5JA 3GTJK 4KN4A 3GTKC 1I3QC 1TWCK 4Q5SA 3I4NK 2CW0A 3GTJC 1TWFK 3S1QC 3I4NC 4C3IK 3K7AK 1TWFC 2WAQD 5C4JK 2E2JK 1WCMC 2BE5A 3K7AC 4Y7NC 4MEYA 4XSZA 4XLNA 5C4JC 4MEXA 2E2JC 2JA5C 2YU9K 3GTMC 3S14K 3S14C 4A3BC 2YU9C 4AYBD 4XSXA 2WAQL 4A3KC 3GTGC 3H3VD 3S2HK 4QIWD 5FJ8K 2NVQK 1BDFA 2E2IC 5TMCA 2R7ZC 2PPBA 5IP7K 2NVQC 4AYBL 3I4MC 5IP7C 2E2HK 2E2HC 5FLMK 5IYBK 4GZYA 5FLMC 4QIWL 4A93K 4BBSK 4A93C 2R7ZK 4MQ9A 2R92K 3GTOK 2WB1D 4YFNA 3DXJA 4BBRK 4YG2A
chains in the Genus database with same CATH superfamily
2GAHC 1J6VA 5M5XK 3I4MK 1WOOA 3GTMK 4KB4A 1F9NA 1VH2A 1J6WA 3CQZA 4G7OA 3GEHA 3S15K 2XCRB 1EQRA 3S15C 4G0VA 1O2AA 4KM8A 2NVYA 2JA6K 1TWHK 3S1MC 2JA6C 1TWHC 4A3MK 1VRQC 3FKIA 4A3IK 4A3MC 4G0UA 3H3VL 4A3DK 4A3IC 3LAJA 1BGWA 4A3DC 1SMYA 1R9TA 3GTPA 2VUMA 4X6AK 2W7VA 4X6AC 3S17C 2PHCB 4Y52K 3CQZK 3CQZC 4OIRA 2R93C 3L4KA 2GAGC 3HKZD 4QJVA 1BS2A 3M3YC 3FKIK 3FKIC 1GE9A 4FZBA 3RZOC 3GTKA 1I3QA 1R9TK 1R9TC 3GTPK 5C3EK 2VUMK 3GTPC 3GTOC 2VUMC 2JA5A 4OIQA 1BJTA 3M4OK 3M4OC 3GEEA 1O2BA 4BKWA 4LK0A 1DCHA 2JH3A 1B4AA 2D6FC 3HXAA 3S2HC 1ZBSA 5IP9K 3S1NK 1F93A 4A3LK 5IP9C 3S1NC 4A3LC 4C3HK 1O28A 1DCPA 4C3HC 4AH6A 1JVIA 1V5VA 1XZPB 3GTKK 1I3QK 4BBRC 4Q5SA 3GTKC 1I3QC 3N3YA 3N0CA 1XZQA 2JA5K 4XLNA 2JA5C 5EGEA 4A3BC 4KAWX 4A3KC 3SZZA 2NVQK 2E2IC 2PPBA 3G4CA 2NVQC 4AYBL 1VJEA 1Y1WA 1K83A 5FLMK 5EGHA 5FLMC 4QIWL 1VGXA 4BBSK 1DCOA 1PJ7A 3S16K 3S1QK 4P5BA 4LR2A 3S16C 4KB2A 4Y7NK 1C0AA 2O5IA 2NVXC 5E68A 4KARA 3A8KA 5C4XK 2GSUA 4GTCA 2A68A 5C4XC 1Y1WK 1WQGA 3HOWC 1K83K 2P5MA 2PMZD 1Y1WC 4BY1K 1K83C 1HQMA 4BY1C 2EBBA 4GFQA 2ZFZA 4LQYA 1WQFA 3S2DK 3TFHA 3S2DC 5IOSA 4P9SA 1WSRA 3EQLA 1SFOA 1XXBA 3AD8C 3TFJA 2R93A 4O2DA 2NVTK 1TWGA 2NVTC 3FOEA 3S1MK 3A8JA 1IS1A 3PO2K 3PO2C 1XPPA 4RMFA 3S1RK 3BP8C 3S1RC 1TWCC 3T02A 2PMZL 5M3MK 2RH6A 3LPXA 5D4DA 3GTOA 5IYCK 2A6EA 3S17K 5IYCC 2V6TA 1SFOK 3AH5A 3HOZK 1SFOC 3HOZC 4LK1A 3T00A 3HOYK 2R93K 3HOYC 1WORA 3Q3QA 1TWGK 1VLOA 1TWGC 3M3YK 1XZPA 5CJ9A 2R92C 2R7ZA 3RZOK 2O5JA 4KN4A 1PJ6A 3I4NK 3I4NC 2E2JK 3GTOK 1WCMC 2BE5A 4MEYA 2E2JC 1I50A 4AYBD 4XSXA 1EH1A 1UV7A 3GTGC 3OEPA 3S2HK 4QIWD 1BDFA 1O25A 2E2IA 5IP7K 5IP7C 4GTAA 4KC6A 5JFEA 1O2FB 3CAGA 2R7ZK 4XCHA 3DXJA 4BBRK 2R7ZC 5C44K 4KM9A 1G51A 5C44C 5JVOA 3L4JA 3GTLA 1WOPA 3GIRA 4A3CK 4A3BK 1I50K 1PJ5A 4A3CC 1I50C 5TJ3A 1ZQ1C 2NVXA 1TWAA 4A3KK 1WSVA 3RZDK 2E2IK 3RZDC 2KWAA 1EI6A 4LOWA 1WQHA 4C2MC 4KMHA 3BP3A 4WJ4A 5IYDC 1XXAA 3OREA 1X31C 2FQOA 3VA7A 3GTLK 5M5YK 3GTLC 1JQWA 4BLAA 4XLPA 3GTQC 1I6HC 1IQ0A 3FHZA 2NVXK 4OIOA 2A6HA 2PA8L 1TWAK 3HOUK 4KMUA 1TWAC 4OIPA 3HOUC 4PABA 4YFKA 3HOXC 1L0WA 3TFIA 3HOWK 4GTLA 2ZUEA 1IL2A 4JK1A 1Y1VC 4KN7A 3AQPA 4KASA 3G4AA 2Y0SL 1YNNA 3GTJA 1TWCA 4YFXA 4C3IC 4WJ3M 3WODA 2A69A 2YU9A 4M1XA 4ZH4A 3LAPA 1IE0A 1WOSA 3A8IA 3GSIA 5IYBC 1ISEA 2CFAB 1O27A 4KDDA 2R92A 1HI9A 3GTJK 1TWCK 2CW0A 3GTJC 5IOQA 2P8TA 5C4JK 3I4MC 3AQOA 3AD7C 4MEXA 1WCMA 5C4JC 3GTMC 2V6SA 2YU9K 2YU9C 3H0GA 4G0WA 3AD9C 2WAQL 3GTGA 5IORA 5FJ8K 3QX3A 2V6UA 4KMAA 4GT9A 3NUHA 4GZYA 1XXCA 4A93K 4A93C 3ADAC 3SZYA 4J3NA 2R92K 2JA7A 2WB1D 4YFNA 3OPFA 2GSNA 3GEIA 2ZUFA 4DDQA 4Q4ZA 3TTGA 1WCMK 1YNJA 1USMA 1O24A 1AB4A 1RU0A 3H0GK 4C3JK 2JA8K 4Y52C 3H0GC 2JA8C 1ZVUA 4C3JC 3GTGK 4KMDA 3GDZA 1J6XA 2NVYK 2NVYC 4ILDA 3JSTA 4A3EK 4LLGA 3IPJA 2JA7K 4A3EC 4GTFA 2JA7C 1F7UA 4G7ZA 1B4BA 5C3EC 2PA8D 3BUEA 5TMFA 1USOA 4KATA 3N0BA 4BXXK 2WB1L 3GTQA 4BXXC 2B63A 5M5WK 5HL8A 1ZYRA 4A3JK 4GTEA 4A3JC 1F7VA 2XCQA 2Y0SD 1I6VA 1IW7A 3T01A 1DD5A 1EK8A 4QJVB 4OINA 4C2MK 1Y1VA 3HKZL 4LJZA 1IBAA 4A3FK 5IYDK 3FOFA 4A3FC 1TWFA 4GTDA 2XCOA 5L46A 4P5AA 3GTQK 1I6HK 5M3FK 4BY7K 2FQTA 2B63K 4BY7C 2B63C 2GSOA 3PO3K 4NOIA 3HOVK 1JOEA 1O26A 3PO3C 3HOVC 3HOXK 4PAAA 1YX2A 2CFAA 2E2HA 1WIHA 4A3GK 4A3GC 1Y1VK 5CHPA 4G7HA 4BBSC 1ZXOA 3MMLB 1EFWA 4BLBA 4WILA 1TWFK 3S1QC 4C3IK 3K7AK 4C45A 1TWFC 2WAQD 3K7AC 4Y7NC 4FM9A 4XSZA 3ERED 3S14K 3GTMA 3S14C 1INNA 1XZQB 1O29A 5IOTA 3H3VD 1KQ4A 4GTBA 5TMCA 2E2HK 2JA6A 3S0XA 1TWHA 2E2HC 5IYBK 2RGRA 2Y3PA 1J98A 3V4GA 4MQ9A 1YCLA 4YG2A
chains in the Genus database with same CATH topology
3S16K 5C44K 3S1QK 5M5XK 4Q4ZA 3S16C 5C44C 3I4MK 1WCMK 1YNJA 4Y7NK 3GTMK 4A3CK 4A3BK 1I50K 2O5IA 4A3CC 3H0GK 1I50C 2JA8K 4C3JK 4Y52C 2NVXC 3H0GC 2JA8C 4G7OA 4A3KK 3GTGK 3S15K 5C4XK 3RZDK 2E2IK 2NVYK 2A68A 3RZDC 3S15C 5C4XC 2NVYC 1Y1WK 2JA6K 3HOWC 1TWHK 1K83K 3S1MC 2PMZD 1Y1WC 2JA6C 4BY1K 1K83C 1TWHC 4A3MK 4A3IK 1HQMA 4A3MC 4BY1C 4A3EK 3H3VL 4A3DK 4A3IC 4LLGA 2JA7K 4A3EC 4A3DC 2JA7C 1SMYA 5IYDC 4G7ZA 3S2DK 5C3EC 2PA8D 3GTLK 5M5YK 3S2DC 5TMFA 4X6AK 3GTLC 4X6AC 3EQLA 3S17C 4BXXK 4XLPA 3GTQC 1I6HC 2WB1L 4BXXC 2NVXK 4Y52K 3CQZK 4OIOA 2A6HA 2PA8L 5M5WK 1TWAK 3CQZC 4OIRA 3HOUK 1ZYRA 4KMUA 1TWAC 4OIPA 4A3JK 2R93C 3HOUC 4A3JC 4YFKA 3HKZD 2NVTK 4QJVA 3HOXC 2NVTC 3HOWK 2Y0SD 1I6VA 3S1MK 3M3YC 1IW7A 3FKIK 4QJVB 3PO2K 4JK1A 4OINA 3FKIC 1Y1VC 4C2MK 3PO2C 3HKZL 1XPPA 4LJZA 3S1RK 4KN7A 3RZOC 2JA5K 1R9TK 2Y0SL 3S1RC 1YNNA 1TWCC 4A3FK 5IYDK 1R9TC 3GTPK 5C3EK 4YFXA 4A3FC 2PMZL 5M3MK 2VUMK 3GTPC 5D4DA 3GTOC 2VUMC 5IYCK 2A6EA 3WODA 3S17K 4OIQA 5IYCC 3M4OK 3GTQK 2A69A 5M3FK 1I6HK 4BY7K 3M4OC 1SFOK 2B63K 3HOZK 4BY7C 4ZH4A 4LK0A 1SFOC 2B63C 3HOZC 4LK1A 3HOYK 3PO3K 4NOIA 3HOVK 2R93K 3HOYC 3PO3C 3HOVC 3S2HC 1TWGK 5IP9K 3HOXK 3S1NK 1TWGC 4A3LK 5IP9C 3S1NC 3M3YK 4A3LC 4A3GK 4C3HK 5IYBC 4A3GC 1Y1VK 4G7HA 4BBSC 2R92C 3GTKK 3RZOK 1I3QK 4BBRC 2O5JA 3GTJK 4KN4A 3GTKC 1I3QC 1TWCK 4Q5SA 3I4NK 2CW0A 3GTJC 1TWFK 3S1QC 3I4NC 4C3IK 3K7AK 1TWFC 2WAQD 5C4JK 2E2JK 1WCMC 2BE5A 3K7AC 4Y7NC 4MEYA 4XSZA 4XLNA 5C4JC 4MEXA 2E2JC 2JA5C 2YU9K 3GTMC 3S14K 3S14C 4A3BC 2YU9C 4AYBD 4XSXA 2WAQL 4A3KC 3GTGC 3H3VD 3S2HK 4QIWD 5FJ8K 2NVQK 1BDFA 2E2IC 5TMCA 2R7ZC 2PPBA 5IP7K 2NVQC 4AYBL 3I4MC 5IP7C 2E2HK 2E2HC 5FLMK 5IYBK 4GZYA 5FLMC 4QIWL 4A93K 4BBSK 4A93C 2R7ZK 4MQ9A 2R92K 3GTOK 2WB1D 4YFNA 3DXJA 4BBRK 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 K;  5C44 K;  3S1Q K;  5M5X K;  4Q4Z A;  3S16 C;  5C44 C;  3I4M K;  1WCM K;  1YNJ A;  4Y7N K;  3GTM K;  4A3C K;  4A3B K;  1I50 K;  2O5I A;  4A3C C;  3H0G K;  1I50 C;  2JA8 K;  4C3J K;  4Y52 C;  2NVX C;  3H0G C;  2JA8 C;  4G7O A;  4A3K K;  3GTG K;  3S15 K;  5C4X K;  3RZD K;  2E2I K;  2NVY K;  2A68 A;  3RZD C;  3S15 C;  5C4X C;  2NVY C;  1Y1W K;  2JA6 K;  3HOW C;  1TWH K;  1K83 K;  3S1M C;  2PMZ D;  1Y1W C;  2JA6 C;  4BY1 K;  1K83 C;  1TWH C;  4A3M K;  4A3I K;  1HQM A;  4A3M C;  4BY1 C;  4A3E K;  3H3V L;  4A3D K;  4A3I C;  4LLG A;  2JA7 K;  4A3E C;  4A3D C;  2JA7 C;  1SMY A;  5IYD C;  4G7Z A;  3S2D K;  5C3E C;  2PA8 D;  3GTL K;  5M5Y K;  3S2D C;  5TMF A;  4X6A K;  3GTL C;  4X6A C;  3EQL A;  3S17 C;  4BXX K;  4XLP A;  3GTQ C;  1I6H C;  2WB1 L;  4BXX C;  2NVX K;  4Y52 K;  3CQZ K;  4OIO A;  2A6H A;  2PA8 L;  5M5W K;  1TWA K;  3CQZ C;  4OIR A;  3HOU K;  1ZYR A;  4KMU A;  1TWA C;  4OIP A;  4A3J K;  2R93 C;  3HOU C;  4A3J C;  4YFK A;  3HKZ D;  2NVT K;  4QJV A;  3HOX C;  2NVT C;  3HOW K;  2Y0S D;  1I6V A;  3S1M K;  3M3Y C;  1IW7 A;  3FKI K;  4QJV B;  3PO2 K;  4JK1 A;  4OIN A;  3FKI C;  1Y1V C;  4C2M K;  3PO2 C;  3HKZ L;  1XPP A;  4LJZ A;  3S1R K;  4KN7 A;  3RZO C;  2JA5 K;  1R9T K;  2Y0S L;  3S1R C;  1YNN A;  1TWC C;  4A3F K;  5IYD K;  1R9T C;  3GTP K;  5C3E K;  4YFX A;  4A3F C;  2PMZ L;  5M3M K;  2VUM K;  3GTP C;  5D4D A;  3GTO C;  2VUM C;  5IYC K;  2A6E A;  3WOD A;  3S17 K;  4OIQ A;  5IYC C;  3M4O K;  3GTQ K;  2A69 A;  5M3F K;  1I6H K;  4BY7 K;  3M4O C;  1SFO K;  2B63 K;  3HOZ K;  4BY7 C;  4ZH4 A;  4LK0 A;  1SFO C;  2B63 C;  3HOZ C;  4LK1 A;  3HOY K;  3PO3 K;  4NOI A;  3HOV K;  2R93 K;  3HOY C;  3PO3 C;  3HOV C;  3S2H C;  1TWG K;  5IP9 K;  3HOX K;  3S1N K;  1TWG C;  4A3L K;  5IP9 C;  3S1N C;  3M3Y K;  4A3L C;  4A3G K;  4C3H K;  5IYB C;  4A3G C;  1Y1V K;  4G7H A;  4BBS C;  2R92 C;  3GTK K;  3RZO K;  1I3Q K;  4BBR C;  2O5J A;  3GTJ K;  4KN4 A;  3GTK C;  1I3Q C;  1TWC K;  4Q5S A;  3I4N K;  2CW0 A;  3GTJ C;  1TWF K;  3S1Q C;  3I4N C;  4C3I K;  3K7A K;  1TWF C;  2WAQ D;  5C4J K;  2E2J K;  1WCM C;  2BE5 A;  3K7A C;  4Y7N C;  4MEY A;  4XSZ A;  4XLN A;  5C4J C;  4MEX A;  2E2J C;  2JA5 C;  2YU9 K;  3GTM C;  3S14 K;  3S14 C;  4A3B C;  2YU9 C;  4AYB D;  4XSX A;  2WAQ L;  4A3K C;  3GTG C;  3H3V D;  3S2H K;  4QIW D;  5FJ8 K;  2NVQ K;  1BDF A;  2E2I C;  5TMC A;  2R7Z C;  2PPB A;  5IP7 K;  2NVQ C;  4AYB L;  3I4M C;  5IP7 C;  2E2H K;  2E2H C;  5FLM K;  5IYB K;  4GZY A;  5FLM C;  4QIW L;  4A93 K;  4BBS K;  4A93 C;  2R7Z K;  4MQ9 A;  2R92 K;  3GTO K;  2WB1 D;  4YFN A;  3DXJ A;  4BBR K;  4YG2 A; 
#chains in the Genus database with same CATH topology
 2GAH C;  1J6V A;  5M5X K;  3I4M K;  1WOO A;  3GTM K;  4KB4 A;  1F9N A;  1VH2 A;  1J6W A;  3CQZ A;  4G7O A;  3GEH A;  3S15 K;  2XCR B;  1EQR A;  3S15 C;  4G0V A;  1O2A A;  4KM8 A;  2NVY A;  2JA6 K;  1TWH K;  3S1M C;  2JA6 C;  1TWH C;  4A3M K;  1VRQ C;  3FKI A;  4A3I K;  4A3M C;  4G0U A;  3H3V L;  4A3D K;  4A3I C;  3LAJ A;  1BGW A;  4A3D C;  1SMY A;  1R9T A;  3GTP A;  2VUM A;  4X6A K;  2W7V A;  4X6A C;  3S17 C;  2PHC B;  4Y52 K;  3CQZ K;  3CQZ C;  4OIR A;  2R93 C;  3L4K A;  2GAG C;  3HKZ D;  4QJV A;  1BS2 A;  3M3Y C;  3FKI K;  3FKI C;  1GE9 A;  4FZB A;  3RZO C;  3GTK A;  1I3Q A;  1R9T K;  1R9T C;  3GTP K;  5C3E K;  2VUM K;  3GTP C;  3GTO C;  2VUM C;  2JA5 A;  4OIQ A;  1BJT A;  3M4O K;  3M4O C;  3GEE A;  1O2B A;  4BKW A;  4LK0 A;  1DCH A;  2JH3 A;  1B4A A;  2D6F C;  3HXA A;  3S2H C;  1ZBS A;  5IP9 K;  3S1N K;  1F93 A;  4A3L K;  5IP9 C;  3S1N C;  4A3L C;  4C3H K;  1O28 A;  1DCP A;  4C3H C;  4AH6 A;  1JVI A;  1V5V A;  1XZP B;  3GTK K;  1I3Q K;  4BBR C;  4Q5S A;  3GTK C;  1I3Q C;  3N3Y A;  3N0C A;  1XZQ A;  2JA5 K;  4XLN A;  2JA5 C;  5EGE A;  4A3B C;  4KAW X;  4A3K C;  3SZZ A;  2NVQ K;  2E2I C;  2PPB A;  3G4C A;  2NVQ C;  4AYB L;  1VJE A;  1Y1W A;  1K83 A;  5FLM K;  5EGH A;  5FLM C;  4QIW L;  1VGX A;  4BBS K;  1DCO A;  1PJ7 A;  3S16 K;  3S1Q K;  4P5B A;  4LR2 A;  3S16 C;  4KB2 A;  4Y7N K;  1C0A A;  2O5I A;  2NVX C;  5E68 A;  4KAR A;  3A8K A;  5C4X K;  2GSU A;  4GTC A;  2A68 A;  5C4X C;  1Y1W K;  1WQG A;  3HOW C;  1K83 K;  2P5M A;  2PMZ D;  1Y1W C;  4BY1 K;  1K83 C;  1HQM A;  4BY1 C;  2EBB A;  4GFQ A;  2ZFZ A;  4LQY A;  1WQF A;  3S2D K;  3TFH A;  3S2D C;  5IOS A;  4P9S A;  1WSR A;  3EQL A;  1SFO A;  1XXB A;  3AD8 C;  3TFJ A;  2R93 A;  4O2D A;  2NVT K;  1TWG A;  2NVT C;  3FOE A;  3S1M K;  3A8J A;  1IS1 A;  3PO2 K;  3PO2 C;  1XPP A;  4RMF A;  3S1R K;  3BP8 C;  3S1R C;  1TWC C;  3T02 A;  2PMZ L;  5M3M K;  2RH6 A;  3LPX A;  5D4D A;  3GTO A;  5IYC K;  2A6E A;  3S17 K;  5IYC C;  2V6T A;  1SFO K;  3AH5 A;  3HOZ K;  1SFO C;  3HOZ C;  4LK1 A;  3T00 A;  3HOY K;  2R93 K;  3HOY C;  1WOR A;  3Q3Q A;  1TWG K;  1VLO A;  1TWG C;  3M3Y K;  1XZP A;  5CJ9 A;  2R92 C;  2R7Z A;  3RZO K;  2O5J A;  4KN4 A;  1PJ6 A;  3I4N K;  3I4N C;  2E2J K;  3GTO K;  1WCM C;  2BE5 A;  4MEY A;  2E2J C;  1I50 A;  4AYB D;  4XSX A;  1EH1 A;  1UV7 A;  3GTG C;  3OEP A;  3S2H K;  4QIW D;  1BDF A;  1O25 A;  2E2I A;  5IP7 K;  5IP7 C;  4GTA A;  4KC6 A;  5JFE A;  1O2F B;  3CAG A;  2R7Z K;  4XCH A;  3DXJ A;  4BBR K;  2R7Z C;  5C44 K;  4KM9 A;  1G51 A;  5C44 C;  5JVO A;  3L4J A;  3GTL A;  1WOP A;  3GIR A;  4A3C K;  4A3B K;  1I50 K;  1PJ5 A;  4A3C C;  1I50 C;  5TJ3 A;  1ZQ1 C;  2NVX A;  1TWA A;  4A3K K;  1WSV A;  3RZD K;  2E2I K;  3RZD C;  2KWA A;  1EI6 A;  4LOW A;  1WQH A;  4C2M C;  4KMH A;  3BP3 A;  4WJ4 A;  5IYD C;  1XXA A;  3ORE A;  1X31 C;  2FQO A;  3VA7 A;  3GTL K;  5M5Y K;  3GTL C;  1JQW A;  4BLA A;  4XLP A;  3GTQ C;  1I6H C;  1IQ0 A;  3FHZ A;  2NVX K;  4OIO A;  2A6H A;  2PA8 L;  1TWA K;  3HOU K;  4KMU A;  1TWA C;  4OIP A;  3HOU C;  4PAB A;  4YFK A;  3HOX C;  1L0W A;  3TFI A;  3HOW K;  4GTL A;  2ZUE A;  1IL2 A;  4JK1 A;  1Y1V C;  4KN7 A;  3AQP A;  4KAS A;  3G4A A;  2Y0S L;  1YNN A;  3GTJ A;  1TWC A;  4YFX A;  4C3I C;  4WJ3 M;  3WOD A;  2A69 A;  2YU9 A;  4M1X A;  4ZH4 A;  3LAP A;  1IE0 A;  1WOS A;  3A8I A;  3GSI A;  5IYB C;  1ISE A;  2CFA B;  1O27 A;  4KDD A;  2R92 A;  1HI9 A;  3GTJ K;  1TWC K;  2CW0 A;  3GTJ C;  5IOQ A;  2P8T A;  5C4J K;  3I4M C;  3AQO A;  3AD7 C;  4MEX A;  1WCM A;  5C4J C;  3GTM C;  2V6S A;  2YU9 K;  2YU9 C;  3H0G A;  4G0W A;  3AD9 C;  2WAQ L;  3GTG A;  5IOR A;  5FJ8 K;  3QX3 A;  2V6U A;  4KMA A;  4GT9 A;  3NUH A;  4GZY A;  1XXC A;  4A93 K;  4A93 C;  3ADA C;  3SZY A;  4J3N A;  2R92 K;  2JA7 A;  2WB1 D;  4YFN A;  3OPF A;  2GSN A;  3GEI A;  2ZUF A;  4DDQ A;  4Q4Z A;  3TTG A;  1WCM K;  1YNJ A;  1USM A;  1O24 A;  1AB4 A;  1RU0 A;  3H0G K;  4C3J K;  2JA8 K;  4Y52 C;  3H0G C;  2JA8 C;  1ZVU A;  4C3J C;  3GTG K;  4KMD A;  3GDZ A;  1J6X A;  2NVY K;  2NVY C;  4ILD A;  3JST A;  4A3E K;  4LLG A;  3IPJ A;  2JA7 K;  4A3E C;  4GTF A;  2JA7 C;  1F7U A;  4G7Z A;  1B4B A;  5C3E C;  2PA8 D;  3BUE A;  5TMF A;  1USO A;  4KAT A;  3N0B A;  4BXX K;  2WB1 L;  3GTQ A;  4BXX C;  2B63 A;  5M5W K;  5HL8 A;  1ZYR A;  4A3J K;  4GTE A;  4A3J C;  1F7V A;  2XCQ A;  2Y0S D;  1I6V A;  1IW7 A;  3T01 A;  1DD5 A;  1EK8 A;  4QJV B;  4OIN A;  4C2M K;  1Y1V A;  3HKZ L;  4LJZ A;  1IBA A;  4A3F K;  5IYD K;  3FOF A;  4A3F C;  1TWF A;  4GTD A;  2XCO A;  5L46 A;  4P5A A;  3GTQ K;  1I6H K;  5M3F K;  4BY7 K;  2FQT A;  2B63 K;  4BY7 C;  2B63 C;  2GSO A;  3PO3 K;  4NOI A;  3HOV K;  1JOE A;  1O26 A;  3PO3 C;  3HOV C;  3HOX K;  4PAA A;  1YX2 A;  2CFA A;  2E2H A;  1WIH A;  4A3G K;  4A3G C;  1Y1V K;  5CHP A;  4G7H A;  4BBS C;  1ZXO A;  3MML B;  1EFW A;  4BLB A;  4WIL A;  1TWF K;  3S1Q C;  4C3I K;  3K7A K;  4C45 A;  1TWF C;  2WAQ D;  3K7A C;  4Y7N C;  4FM9 A;  4XSZ A;  3ERE D;  3S14 K;  3GTM A;  3S14 C;  1INN A;  1XZQ B;  1O29 A;  5IOT A;  3H3V D;  1KQ4 A;  4GTB A;  5TMC A;  2E2H K;  2JA6 A;  3S0X A;  1TWH A;  2E2H C;  5IYB K;  2RGR A;  2Y3P A;  1J98 A;  3V4G A;  4MQ9 A;  1YCL A;  4YG2 A; 
#chains in the Genus database with same CATH homology
 3S16 K;  5C44 K;  3S1Q K;  5M5X K;  4Q4Z A;  3S16 C;  5C44 C;  3I4M K;  1WCM K;  1YNJ A;  4Y7N K;  3GTM K;  4A3C K;  4A3B K;  1I50 K;  2O5I A;  4A3C C;  3H0G K;  1I50 C;  2JA8 K;  4C3J K;  4Y52 C;  2NVX C;  3H0G C;  2JA8 C;  4G7O A;  4A3K K;  3GTG K;  3S15 K;  5C4X K;  3RZD K;  2E2I K;  2NVY K;  2A68 A;  3RZD C;  3S15 C;  5C4X C;  2NVY C;  1Y1W K;  2JA6 K;  3HOW C;  1TWH K;  1K83 K;  3S1M C;  2PMZ D;  1Y1W C;  2JA6 C;  4BY1 K;  1K83 C;  1TWH C;  4A3M K;  4A3I K;  1HQM A;  4A3M C;  4BY1 C;  4A3E K;  3H3V L;  4A3D K;  4A3I C;  4LLG A;  2JA7 K;  4A3E C;  4A3D C;  2JA7 C;  1SMY A;  5IYD C;  4G7Z A;  3S2D K;  5C3E C;  2PA8 D;  3GTL K;  5M5Y K;  3S2D C;  5TMF A;  4X6A K;  3GTL C;  4X6A C;  3EQL A;  3S17 C;  4BXX K;  4XLP A;  3GTQ C;  1I6H C;  2WB1 L;  4BXX C;  2NVX K;  4Y52 K;  3CQZ K;  4OIO A;  2A6H A;  2PA8 L;  5M5W K;  1TWA K;  3CQZ C;  4OIR A;  3HOU K;  1ZYR A;  4KMU A;  1TWA C;  4OIP A;  4A3J K;  2R93 C;  3HOU C;  4A3J C;  4YFK A;  3HKZ D;  2NVT K;  4QJV A;  3HOX C;  2NVT C;  3HOW K;  2Y0S D;  1I6V A;  3S1M K;  3M3Y C;  1IW7 A;  3FKI K;  4QJV B;  3PO2 K;  4JK1 A;  4OIN A;  3FKI C;  1Y1V C;  4C2M K;  3PO2 C;  3HKZ L;  1XPP A;  4LJZ A;  3S1R K;  4KN7 A;  3RZO C;  2JA5 K;  1R9T K;  2Y0S L;  3S1R C;  1YNN A;  1TWC C;  4A3F K;  5IYD K;  1R9T C;  3GTP K;  5C3E K;  4YFX A;  4A3F C;  2PMZ L;  5M3M K;  2VUM K;  3GTP C;  5D4D A;  3GTO C;  2VUM C;  5IYC K;  2A6E A;  3WOD A;  3S17 K;  4OIQ A;  5IYC C;  3M4O K;  3GTQ K;  2A69 A;  5M3F K;  1I6H K;  4BY7 K;  3M4O C;  1SFO K;  2B63 K;  3HOZ K;  4BY7 C;  4ZH4 A;  4LK0 A;  1SFO C;  2B63 C;  3HOZ C;  4LK1 A;  3HOY K;  3PO3 K;  4NOI A;  3HOV K;  2R93 K;  3HOY C;  3PO3 C;  3HOV C;  3S2H C;  1TWG K;  5IP9 K;  3HOX K;  3S1N K;  1TWG C;  4A3L K;  5IP9 C;  3S1N C;  3M3Y K;  4A3L C;  4A3G K;  4C3H K;  5IYB C;  4A3G C;  1Y1V K;  4G7H A;  4BBS C;  2R92 C;  3GTK K;  3RZO K;  1I3Q K;  4BBR C;  2O5J A;  3GTJ K;  4KN4 A;  3GTK C;  1I3Q C;  1TWC K;  4Q5S A;  3I4N K;  2CW0 A;  3GTJ C;  1TWF K;  3S1Q C;  3I4N C;  4C3I K;  3K7A K;  1TWF C;  2WAQ D;  5C4J K;  2E2J K;  1WCM C;  2BE5 A;  3K7A C;  4Y7N C;  4MEY A;  4XSZ A;  4XLN A;  5C4J C;  4MEX A;  2E2J C;  2JA5 C;  2YU9 K;  3GTM C;  3S14 K;  3S14 C;  4A3B C;  2YU9 C;  4AYB D;  4XSX A;  2WAQ L;  4A3K C;  3GTG C;  3H3V D;  3S2H K;  4QIW D;  5FJ8 K;  2NVQ K;  1BDF A;  2E2I C;  5TMC A;  2R7Z C;  2PPB A;  5IP7 K;  2NVQ C;  4AYB L;  3I4M C;  5IP7 C;  2E2H K;  2E2H C;  5FLM K;  5IYB K;  4GZY A;  5FLM C;  4QIW L;  4A93 K;  4BBS K;  4A93 C;  2R7Z K;  4MQ9 A;  2R92 K;  3GTO K;  2WB1 D;  4YFN A;  3DXJ A;  4BBR K;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...