3M3YK

Rna polymerase ii elongation complex c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m3yK00
3GTLC 4A3BC 2JA8K 3CQZC 3GTKC 4BY7K 1K83C 1SFOK 4A3GK 5C4JC 2YU9C 2A68A 2JA5C 4MQ9A 2R92C 4A3EC 4A3MK 5C4JK 4A3IK 1TWFC 3I4MC 1TWGC 4X6AC 1WCMC 2A6HA 4LK0A 5C3EK 4QIWD 3I4NC 2Y0SD 1I3QK 3HOZK 3S2DK 3HOVK 4X6AK 3HOUC 1TWCK 2WB1L 1Y1WC 3M4OC 5M3FK 4A3MC 1YNNA 4A3DK 2BE5A 3GTKK 2R7ZK 3M3YK 3HOUK 1YNJA 3S1RC 2O5JA 3HKZD 4OIRA 3DXJA 5IP9K 5FLMK 3PO2C 3RZOC 4MEXA 3GTJC 4BY1C 2JA5K 3RZDK 4A3DC 4OIPA 1I50C 3S1NK 5IP7K 2WAQD 4MEYA 1I3QC 4C3JK 1TWGK 1I6HC 5C4XK 3CQZK 4BY7C 2Y0SL 4OINA 4A3LC 5TMFA 4KN4A 5IYDK 4AYBD 4YFKA 3HOYC 4LJZA 4ZH4A 4A3KK 4Q5SA 1Y1VC 4C3HK 4A3EK 4XSXA 5IYBC 4A3FK 1R9TC 4A93C 3S14C 5IP9C 3RZOK 2JA6K 2NVYC 5IYCK 4A3JK 3GTPK 4GZYA 3HOXC 2JA7K 4A3BK 3FKIK 3H0GC 1BDFA 4OIQA 3PO3C 4G7HA 3S17K 4YFXA 4BXXK 4BBSC 3K7AK 2A6EA 3GTQK 1TWHK 3HOZC 4BBRK 3GTOK 4KMUA 2A69A 5M5XK 2NVTC 4BBSK 1WCMK 2O5IA 2VUMC 2NVQC 4XLPA 4BBRC 3S16C 2R93C 4A3IC 3I4MK 3S14K 3S1QK 4Y52C 3S1MK 1I50K 1Y1VK 4LK1A 3S1NC 3WODA 3M4OK 1TWHC 4C2MK 5C44C 4A3CK 3GTJK 4YG2A 1TWAC 4XLNA 3HKZL 2E2JK 4QJVA 2E2IK 2JA8C 3HOXK 2JA7C 4Y7NC 3GTMC 3S16K 3PO3K 4G7OA 2R7ZC 4KN7A 3GTGC 3M3YC 2E2HK 1XPPA 4JK1A 4QJVB 4G7ZA 5C44K 4A3CC 4A93K 2NVQK 3HOVC 3PO2K 3GTGK 2E2IC 2YU9K 3H3VD 4OIOA 3S1QC 2PA8D 2E2HC 2CW0A 4Q4ZA 1I6HK 2PMZD 2B63C 3S15C 3S2HC 3K7AC 4QIWL 5M3MK 3GTMK 4Y52K 5IYBK 4XSZA 5M5YK 2WB1D 1TWAK 2E2JC 2NVTK 2PA8L 4YFNA 5IYCC 1HQMA 2VUMK 3GTQC 2PMZL 5FJ8K 5FLMC 5C3EC 3EQLA 3HOWK 4LLGA 2JA6C 4NOIA 4C3IK 3RZDC 2B63K 3GTPC 5C4XC 1SMYA 5IYDC 3FKIC 1TWFK 2PPBA 3H3VL 1ZYRA 2WAQL 5TMCA 1IW7A 4BY1K 2R92K 4Y7NK 1R9TK 3I4NK 3S2DC 5IP7C 1K83K 1I6VA 1SFOC 2NVYK 2NVXK 4A3KC 3GTOC 1TWCC 1Y1WK 3GTLK 4A3FC 5M5WK 3H0GK 3S15K 4AYBL 3S2HK 3S1MC 4A3LK 4BXXC 5D4DA 2NVXC 4A3GC 3S17C 2R93K 4A3JC 3HOWC 3HOYK 3S1RK
chains in the Genus database with same CATH superfamily
1TWGA 3AD8C 4GTCA 1VJEA 1BGWA 2JA5C 4MQ9A 2GSOA 4A3MK 1WQFA 3AQPA 3CQZA 4QIWD 2ZFZA 4RMFA 3SZYA 4BLAA 1J6VA 1Y1WC 1TWFA 4A3MC 1YNNA 1O24A 3A8IA 3N3YA 4LR2A 1XZQA 1WOSA 3GIRA 4OIPA 5CHPA 3RZDK 1Y1VA 1G51A 4KC6A 5C4XK 4LQYA 3FOFA 2Y0SL 5IOSA 4A3LC 1IQ0A 4LJZA 1IBAA 4A3EK 4A3FK 1F93A 1DCOA 3S14C 3RZOK 4P5BA 1YCLA 2ZUFA 4A3BK 4PAAA 1WOOA 4C3IC 4G7HA 4LOWA 2XCOA 5IORA 2NVYA 2A6EA 3GEHA 1TWHK 2XCRB 1WCMK 2VUMC 2R93C 4G0UA 3S1QK 3S1NC 1TWHC 1I50A 3GTJK 1EH1A 2E2JK 2E2IK 4Y7NC 3GTMC 2XCQA 1EQRA 4JK1A 4QJVB 4WJ3M 2NVQK 1AB4A 3Q3QA 3IPJA 4FM9A 2E2IC 4P5AA 3H3VD 3GTGA 3H0GA 3AD7C 4KM8A 1F7VA 1IE0A 2B63C 3K7AC 5M3MK 5IYBK 4GFQA 2CFAA 5M5YK 4YFNA 5IYCC 4GTBA 1XXCA 2PMZL 4KAWX 2B63K 5IYDC 3FKIC 1TWFK 4G0WA 2WAQL 1IW7A 3LAPA 1SFOC 2NVXK 3GTOC 2R7ZA 1TWCC 3L4KA 3GTLK 3S1MC 3H0GK 4A3LK 5D4DA 2NVXC 4BXXC 4A3JC 3S1RK 3GTLC 1SFOK 2R92C 4A3EC 4A3IK 1WIHA 3I4MC 1TWGC 3HOYK 3CAGA 3S2DK 3HOVK 3BUEA 3M4OC 4A3DK 2R7ZK 3M3YK 1YNJA 2O5JA 3HKZD 3AD9C 1UV7A 1JQWA 4KB4A 4G0VA 3RZOC 5FLMK 3PO2C 4AH6A 3GTJC 4A3DC 1XZPA 2EBBA 3S1NK 5IP7K 2WAQD 1O29A 4BY7C 2FQOA 5TMFA 1ZVUA 2PHCB 4P9SA 4A3KK 4Q5SA 1Y1VC 4XSXA 1R9TC 5IP9C 2RGRA 2JA6K 3GTPK 4GTAA 4XCHA 3HOXC 3BP8C 4OIQA 4FZBA 3S17K 4YFXA 3K7AK 3HOZC 3AQOA 1EFWA 2NVQC 3T00A 4XLPA 1PJ7A 1O28A 1I50K 4C3HC 4LK1A 3AH5A 3HKZL 2VUMA 1EK8A 2JA7C 4M1XA 2P8TA 1ISEA 4DDQA 4GTFA 2V6TA 3QX3A 3GTQA 4Q4ZA 4KM9A 3TFJA 3A8JA 3T01A 3S2HC 1EI6A 2D6FC 2WB1D 1TWAK 2NVTK 1YX2A 2PA8L 1HQMA 5FJ8K 3EQLA 2B63A 1L0WA 3RZDC 1SMYA 2PPBA 3T02A 3H3VL 5TMCA 2R92K 4KMAA 5IP7C 1K83K 2NVYK 3GTKA 5IOTA 3OEPA 1Y1WK 2YU9A 4A3FC 4Y52K 3S15K 4WJ4A 4A3GC 3S0XA 3PO3K 2R93K 4A3BC 2JA8K 1SFOA 4BY7K 3GTOA 1K83C 4A3GK 5C4JC 2A68A 2FQTA 1JVIA 5C4JK 1BJTA 1WCMC 1XXAA 5HL8A 2JH3A 5C3EK 3I4NC 1IS1A 1VRQC 3HOZK 2R92A 1GE9A 3FOEA 1C0AA 2WB1L 5M3FK 3GTKK 1JOEA 1J6WA 4OIRA 3DXJA 2R93A 5IP9K 1V5VA 3ADAC 3HXAA 3TFIA 5L46A 1O25A 2JA5K 1I50C 1TWHA 4MEYA 1I3QC 1VH2A 1I6HC 3OPFA 3CQZK 4OINA 5IYDK 1WQHA 4ZH4A 3JSTA 5IYBC 3TTGA 5IYCK 1BS2A 2GAGC 5JFEA 3H0GC 1BDFA 2W7VA 3OREA 4BXXK 4WILA 4BBSC 4GTEA 1Y1WA 4C2MC 2NVTC 4BBSK 1TWAA 1F9NA 3G4CA 3S16C 4A3IC 3I4MK 4KARA 3S1MK 1J98A 4J3NA 4C2MK 2GSNA 5EGEA 1RU0A 4XLNA 4QJVA 3S16K 4G7OA 2R7ZC 3M3YC 4GTDA 1XPPA 4G7ZA 2E2HA 5EGHA 4A93K 2P5MA 1USMA 3PO2K 3GTLA 1PJ6A 4OIOA 4KMDA 4KASA 1WSRA 2KWAA 1F7UA 2CW0A 2V6SA 2PMZD 1ZXOA 4GTLA 4GT9A 4XSZA 2E2JC 1ZQ1C 3GTQC 5FLMC 3G4AA 5C3EC 1WOPA 4LLGA 2CFAB 2JA6C 4C3IK 3GTPC 5C4XC 4KATA 1ZYRA 3GEEA 3S2DC 1PJ5A 3GSIA 1I6VA 3V4GA 4A3KC 1O27A 2JA5A 4AYBL 3HOWC 3CQZC 3GTKC 2YU9C 1INNA 1TWFC 2Y3PA 4X6AC 2A6HA 4LK0A 1DCHA 4BKWA 2Y0SD 1I3QK 3NUHA 1WSVA 4X6AK 3HOUC 1TWCK 4KDDA 1O2BA 2BE5A 3FKIA 3HOUK 3S1RC 1IL2A 4MEXA 3L4JA 5TJ3A 4BY1C 4C3JK 1TWGK 4BLBA 3GDZA 1XZQB 4KN4A 3TFHA 4AYBD 1WORA 4YFKA 3HOYC 4C3HK 1O2AA 1I3QA 1O2FB 4A93C 2NVYC 1XXBA 4A3JK 4GZYA 2JA7K 3ERED 3FKIK 5JVOA 1VLOA 3PO3C 3A8KA 3BP3A 1ZBSA 3MMLB 3GTQK 1KQ4A 4BBRK 3GTOK 1VGXA 4KMUA 2A69A 5M5XK 4KMHA 2O5IA 2ZUEA 4BBRC 3GTMA 3S14K 3LPXA 5IOQA 3GTJA 2GSUA 4Y52C 1Y1VK 3WODA 3M4OK 5C44C 4A3CK 4YG2A 1TWAC 3LAJA 3N0CA 2JA8C 3HOXK 2E2IA 3FHZA 1HI9A 4KN7A 3GTGC 2E2HK 5C44K 4A3CC 1DCPA 3SZZA 1R9TA 3HOVC 3GTGK 2YU9K 3S1QC 1DD5A 1XZPB 1B4AA 2V6UA 1K83A 2PA8D 2E2HC 3GEIA 1I6HK 3S15C 4QIWL 1USOA 3GTMK 3VA7A 1WCMA 1B4BA 2VUMK 5E68A 3HOWK 4NOIA 4KB2A 1O26A 1TWCA 5CJ9A 4PABA 1X31C 3N0BA 4ILDA 4BY1K 2NVXA 4Y7NK 2JA7A 1R9TK 3I4NK 2RH6A 3GTPA 2JA6A 1WQGA 2GAHC 4C3JC 5M5WK 3S2HK 4C45A 3S17C 4O2DA 1J6XA
chains in the Genus database with same CATH topology
3GTLC 4A3BC 2JA8K 3CQZC 3GTKC 4BY7K 1K83C 1SFOK 4A3GK 5C4JC 2YU9C 2A68A 2JA5C 4MQ9A 2R92C 4A3EC 4A3MK 5C4JK 4A3IK 1TWFC 3I4MC 1TWGC 4X6AC 1WCMC 2A6HA 4LK0A 5C3EK 4QIWD 3I4NC 2Y0SD 1I3QK 3HOZK 3S2DK 3HOVK 4X6AK 3HOUC 1TWCK 2WB1L 1Y1WC 3M4OC 5M3FK 4A3MC 1YNNA 4A3DK 2BE5A 3GTKK 2R7ZK 3M3YK 3HOUK 1YNJA 3S1RC 2O5JA 3HKZD 4OIRA 3DXJA 5IP9K 5FLMK 3PO2C 3RZOC 4MEXA 3GTJC 4BY1C 2JA5K 3RZDK 4A3DC 4OIPA 1I50C 3S1NK 5IP7K 2WAQD 4MEYA 1I3QC 4C3JK 1TWGK 1I6HC 5C4XK 3CQZK 4BY7C 2Y0SL 4OINA 4A3LC 5TMFA 4KN4A 5IYDK 4AYBD 4YFKA 3HOYC 4LJZA 4ZH4A 4A3KK 4Q5SA 1Y1VC 4C3HK 4A3EK 4XSXA 5IYBC 4A3FK 1R9TC 4A93C 3S14C 5IP9C 3RZOK 2JA6K 2NVYC 5IYCK 4A3JK 3GTPK 4GZYA 3HOXC 2JA7K 4A3BK 3FKIK 3H0GC 1BDFA 4OIQA 3PO3C 4G7HA 3S17K 4YFXA 4BXXK 4BBSC 3K7AK 2A6EA 3GTQK 1TWHK 3HOZC 4BBRK 3GTOK 4KMUA 2A69A 5M5XK 2NVTC 4BBSK 1WCMK 2O5IA 2VUMC 2NVQC 4XLPA 4BBRC 3S16C 2R93C 4A3IC 3I4MK 3S14K 3S1QK 4Y52C 3S1MK 1I50K 1Y1VK 4LK1A 3S1NC 3WODA 3M4OK 1TWHC 4C2MK 5C44C 4A3CK 3GTJK 4YG2A 1TWAC 4XLNA 3HKZL 2E2JK 4QJVA 2E2IK 2JA8C 3HOXK 2JA7C 4Y7NC 3GTMC 3S16K 3PO3K 4G7OA 2R7ZC 4KN7A 3GTGC 3M3YC 2E2HK 1XPPA 4JK1A 4QJVB 4G7ZA 5C44K 4A3CC 4A93K 2NVQK 3HOVC 3PO2K 3GTGK 2E2IC 2YU9K 3H3VD 4OIOA 3S1QC 2PA8D 2E2HC 2CW0A 4Q4ZA 1I6HK 2PMZD 2B63C 3S15C 3S2HC 3K7AC 4QIWL 5M3MK 3GTMK 4Y52K 5IYBK 4XSZA 5M5YK 2WB1D 1TWAK 2E2JC 2NVTK 2PA8L 4YFNA 5IYCC 1HQMA 2VUMK 3GTQC 2PMZL 5FJ8K 5FLMC 5C3EC 3EQLA 3HOWK 4LLGA 2JA6C 4NOIA 4C3IK 3RZDC 2B63K 3GTPC 5C4XC 1SMYA 5IYDC 3FKIC 1TWFK 2PPBA 3H3VL 1ZYRA 2WAQL 5TMCA 1IW7A 4BY1K 2R92K 4Y7NK 1R9TK 3I4NK 3S2DC 5IP7C 1K83K 1I6VA 1SFOC 2NVYK 2NVXK 4A3KC 3GTOC 1TWCC 1Y1WK 3GTLK 4A3FC 5M5WK 3H0GK 3S15K 4AYBL 3S2HK 3S1MC 4A3LK 4BXXC 5D4DA 2NVXC 4A3GC 3S17C 2R93K 4A3JC 3HOWC 3HOYK 3S1RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL C;  4A3B C;  2JA8 K;  3CQZ C;  3GTK C;  4BY7 K;  1K83 C;  1SFO K;  4A3G K;  5C4J C;  2YU9 C;  2A68 A;  2JA5 C;  4MQ9 A;  2R92 C;  4A3E C;  4A3M K;  5C4J K;  4A3I K;  1TWF C;  3I4M C;  1TWG C;  4X6A C;  1WCM C;  2A6H A;  4LK0 A;  5C3E K;  4QIW D;  3I4N C;  2Y0S D;  1I3Q K;  3HOZ K;  3S2D K;  3HOV K;  4X6A K;  3HOU C;  1TWC K;  2WB1 L;  1Y1W C;  3M4O C;  5M3F K;  4A3M C;  1YNN A;  4A3D K;  2BE5 A;  3GTK K;  2R7Z K;  3M3Y K;  3HOU K;  1YNJ A;  3S1R C;  2O5J A;  3HKZ D;  4OIR A;  3DXJ A;  5IP9 K;  5FLM K;  3PO2 C;  3RZO C;  4MEX A;  3GTJ C;  4BY1 C;  2JA5 K;  3RZD K;  4A3D C;  4OIP A;  1I50 C;  3S1N K;  5IP7 K;  2WAQ D;  4MEY A;  1I3Q C;  4C3J K;  1TWG K;  1I6H C;  5C4X K;  3CQZ K;  4BY7 C;  2Y0S L;  4OIN A;  4A3L C;  5TMF A;  4KN4 A;  5IYD K;  4AYB D;  4YFK A;  3HOY C;  4LJZ A;  4ZH4 A;  4A3K K;  4Q5S A;  1Y1V C;  4C3H K;  4A3E K;  4XSX A;  5IYB C;  4A3F K;  1R9T C;  4A93 C;  3S14 C;  5IP9 C;  3RZO K;  2JA6 K;  2NVY C;  5IYC K;  4A3J K;  3GTP K;  4GZY A;  3HOX C;  2JA7 K;  4A3B K;  3FKI K;  3H0G C;  1BDF A;  4OIQ A;  3PO3 C;  4G7H A;  3S17 K;  4YFX A;  4BXX K;  4BBS C;  3K7A K;  2A6E A;  3GTQ K;  1TWH K;  3HOZ C;  4BBR K;  3GTO K;  4KMU A;  2A69 A;  5M5X K;  2NVT C;  4BBS K;  1WCM K;  2O5I A;  2VUM C;  2NVQ C;  4XLP A;  4BBR C;  3S16 C;  2R93 C;  4A3I C;  3I4M K;  3S14 K;  3S1Q K;  4Y52 C;  3S1M K;  1I50 K;  1Y1V K;  4LK1 A;  3S1N C;  3WOD A;  3M4O K;  1TWH C;  4C2M K;  5C44 C;  4A3C K;  3GTJ K;  4YG2 A;  1TWA C;  4XLN A;  3HKZ L;  2E2J K;  4QJV A;  2E2I K;  2JA8 C;  3HOX K;  2JA7 C;  4Y7N C;  3GTM C;  3S16 K;  3PO3 K;  4G7O A;  2R7Z C;  4KN7 A;  3GTG C;  3M3Y C;  2E2H K;  1XPP A;  4JK1 A;  4QJV B;  4G7Z A;  5C44 K;  4A3C C;  4A93 K;  2NVQ K;  3HOV C;  3PO2 K;  3GTG K;  2E2I C;  2YU9 K;  3H3V D;  4OIO A;  3S1Q C;  2PA8 D;  2E2H C;  2CW0 A;  4Q4Z A;  1I6H K;  2PMZ D;  2B63 C;  3S15 C;  3S2H C;  3K7A C;  4QIW L;  5M3M K;  3GTM K;  4Y52 K;  5IYB K;  4XSZ A;  5M5Y K;  2WB1 D;  1TWA K;  2E2J C;  2NVT K;  2PA8 L;  4YFN A;  5IYC C;  1HQM A;  2VUM K;  3GTQ C;  2PMZ L;  5FJ8 K;  5FLM C;  5C3E C;  3EQL A;  3HOW K;  4LLG A;  2JA6 C;  4NOI A;  4C3I K;  3RZD C;  2B63 K;  3GTP C;  5C4X C;  1SMY A;  5IYD C;  3FKI C;  1TWF K;  2PPB A;  3H3V L;  1ZYR A;  2WAQ L;  5TMC A;  1IW7 A;  4BY1 K;  2R92 K;  4Y7N K;  1R9T K;  3I4N K;  3S2D C;  5IP7 C;  1K83 K;  1I6V A;  1SFO C;  2NVY K;  2NVX K;  4A3K C;  3GTO C;  1TWC C;  1Y1W K;  3GTL K;  4A3F C;  5M5W K;  3H0G K;  3S15 K;  4AYB L;  3S2H K;  3S1M C;  4A3L K;  4BXX C;  5D4D A;  2NVX C;  4A3G C;  3S17 C;  2R93 K;  4A3J C;  3HOW C;  3HOY K;  3S1R K; 
#chains in the Genus database with same CATH topology
 1TWG A;  3AD8 C;  4GTC A;  1VJE A;  1BGW A;  2JA5 C;  4MQ9 A;  2GSO A;  4A3M K;  1WQF A;  3AQP A;  3CQZ A;  4QIW D;  2ZFZ A;  4RMF A;  3SZY A;  4BLA A;  1J6V A;  1Y1W C;  1TWF A;  4A3M C;  1YNN A;  1O24 A;  3A8I A;  3N3Y A;  4LR2 A;  1XZQ A;  1WOS A;  3GIR A;  4OIP A;  5CHP A;  3RZD K;  1Y1V A;  1G51 A;  4KC6 A;  5C4X K;  4LQY A;  3FOF A;  2Y0S L;  5IOS A;  4A3L C;  1IQ0 A;  4LJZ A;  1IBA A;  4A3E K;  4A3F K;  1F93 A;  1DCO A;  3S14 C;  3RZO K;  4P5B A;  1YCL A;  2ZUF A;  4A3B K;  4PAA A;  1WOO A;  4C3I C;  4G7H A;  4LOW A;  2XCO A;  5IOR A;  2NVY A;  2A6E A;  3GEH A;  1TWH K;  2XCR B;  1WCM K;  2VUM C;  2R93 C;  4G0U A;  3S1Q K;  3S1N C;  1TWH C;  1I50 A;  3GTJ K;  1EH1 A;  2E2J K;  2E2I K;  4Y7N C;  3GTM C;  2XCQ A;  1EQR A;  4JK1 A;  4QJV B;  4WJ3 M;  2NVQ K;  1AB4 A;  3Q3Q A;  3IPJ A;  4FM9 A;  2E2I C;  4P5A A;  3H3V D;  3GTG A;  3H0G A;  3AD7 C;  4KM8 A;  1F7V A;  1IE0 A;  2B63 C;  3K7A C;  5M3M K;  5IYB K;  4GFQ A;  2CFA A;  5M5Y K;  4YFN A;  5IYC C;  4GTB A;  1XXC A;  2PMZ L;  4KAW X;  2B63 K;  5IYD C;  3FKI C;  1TWF K;  4G0W A;  2WAQ L;  1IW7 A;  3LAP A;  1SFO C;  2NVX K;  3GTO C;  2R7Z A;  1TWC C;  3L4K A;  3GTL K;  3S1M C;  3H0G K;  4A3L K;  5D4D A;  2NVX C;  4BXX C;  4A3J C;  3S1R K;  3GTL C;  1SFO K;  2R92 C;  4A3E C;  4A3I K;  1WIH A;  3I4M C;  1TWG C;  3HOY K;  3CAG A;  3S2D K;  3HOV K;  3BUE A;  3M4O C;  4A3D K;  2R7Z K;  3M3Y K;  1YNJ A;  2O5J A;  3HKZ D;  3AD9 C;  1UV7 A;  1JQW A;  4KB4 A;  4G0V A;  3RZO C;  5FLM K;  3PO2 C;  4AH6 A;  3GTJ C;  4A3D C;  1XZP A;  2EBB A;  3S1N K;  5IP7 K;  2WAQ D;  1O29 A;  4BY7 C;  2FQO A;  5TMF A;  1ZVU A;  2PHC B;  4P9S A;  4A3K K;  4Q5S A;  1Y1V C;  4XSX A;  1R9T C;  5IP9 C;  2RGR A;  2JA6 K;  3GTP K;  4GTA A;  4XCH A;  3HOX C;  3BP8 C;  4OIQ A;  4FZB A;  3S17 K;  4YFX A;  3K7A K;  3HOZ C;  3AQO A;  1EFW A;  2NVQ C;  3T00 A;  4XLP A;  1PJ7 A;  1O28 A;  1I50 K;  4C3H C;  4LK1 A;  3AH5 A;  3HKZ L;  2VUM A;  1EK8 A;  2JA7 C;  4M1X A;  2P8T A;  1ISE A;  4DDQ A;  4GTF A;  2V6T A;  3QX3 A;  3GTQ A;  4Q4Z A;  4KM9 A;  3TFJ A;  3A8J A;  3T01 A;  3S2H C;  1EI6 A;  2D6F C;  2WB1 D;  1TWA K;  2NVT K;  1YX2 A;  2PA8 L;  1HQM A;  5FJ8 K;  3EQL A;  2B63 A;  1L0W A;  3RZD C;  1SMY A;  2PPB A;  3T02 A;  3H3V L;  5TMC A;  2R92 K;  4KMA A;  5IP7 C;  1K83 K;  2NVY K;  3GTK A;  5IOT A;  3OEP A;  1Y1W K;  2YU9 A;  4A3F C;  4Y52 K;  3S15 K;  4WJ4 A;  4A3G C;  3S0X A;  3PO3 K;  2R93 K;  4A3B C;  2JA8 K;  1SFO A;  4BY7 K;  3GTO A;  1K83 C;  4A3G K;  5C4J C;  2A68 A;  2FQT A;  1JVI A;  5C4J K;  1BJT A;  1WCM C;  1XXA A;  5HL8 A;  2JH3 A;  5C3E K;  3I4N C;  1IS1 A;  1VRQ C;  3HOZ K;  2R92 A;  1GE9 A;  3FOE A;  1C0A A;  2WB1 L;  5M3F K;  3GTK K;  1JOE A;  1J6W A;  4OIR A;  3DXJ A;  2R93 A;  5IP9 K;  1V5V A;  3ADA C;  3HXA A;  3TFI A;  5L46 A;  1O25 A;  2JA5 K;  1I50 C;  1TWH A;  4MEY A;  1I3Q C;  1VH2 A;  1I6H C;  3OPF A;  3CQZ K;  4OIN A;  5IYD K;  1WQH A;  4ZH4 A;  3JST A;  5IYB C;  3TTG A;  5IYC K;  1BS2 A;  2GAG C;  5JFE A;  3H0G C;  1BDF A;  2W7V A;  3ORE A;  4BXX K;  4WIL A;  4BBS C;  4GTE A;  1Y1W A;  4C2M C;  2NVT C;  4BBS K;  1TWA A;  1F9N A;  3G4C A;  3S16 C;  4A3I C;  3I4M K;  4KAR A;  3S1M K;  1J98 A;  4J3N A;  4C2M K;  2GSN A;  5EGE A;  1RU0 A;  4XLN A;  4QJV A;  3S16 K;  4G7O A;  2R7Z C;  3M3Y C;  4GTD A;  1XPP A;  4G7Z A;  2E2H A;  5EGH A;  4A93 K;  2P5M A;  1USM A;  3PO2 K;  3GTL A;  1PJ6 A;  4OIO A;  4KMD A;  4KAS A;  1WSR A;  2KWA A;  1F7U A;  2CW0 A;  2V6S A;  2PMZ D;  1ZXO A;  4GTL A;  4GT9 A;  4XSZ A;  2E2J C;  1ZQ1 C;  3GTQ C;  5FLM C;  3G4A A;  5C3E C;  1WOP A;  4LLG A;  2CFA B;  2JA6 C;  4C3I K;  3GTP C;  5C4X C;  4KAT A;  1ZYR A;  3GEE A;  3S2D C;  1PJ5 A;  3GSI A;  1I6V A;  3V4G A;  4A3K C;  1O27 A;  2JA5 A;  4AYB L;  3HOW C;  3CQZ C;  3GTK C;  2YU9 C;  1INN A;  1TWF C;  2Y3P A;  4X6A C;  2A6H A;  4LK0 A;  1DCH A;  4BKW A;  2Y0S D;  1I3Q K;  3NUH A;  1WSV A;  4X6A K;  3HOU C;  1TWC K;  4KDD A;  1O2B A;  2BE5 A;  3FKI A;  3HOU K;  3S1R C;  1IL2 A;  4MEX A;  3L4J A;  5TJ3 A;  4BY1 C;  4C3J K;  1TWG K;  4BLB A;  3GDZ A;  1XZQ B;  4KN4 A;  3TFH A;  4AYB D;  1WOR A;  4YFK A;  3HOY C;  4C3H K;  1O2A A;  1I3Q A;  1O2F B;  4A93 C;  2NVY C;  1XXB A;  4A3J K;  4GZY A;  2JA7 K;  3ERE D;  3FKI K;  5JVO A;  1VLO A;  3PO3 C;  3A8K A;  3BP3 A;  1ZBS A;  3MML B;  3GTQ K;  1KQ4 A;  4BBR K;  3GTO K;  1VGX A;  4KMU A;  2A69 A;  5M5X K;  4KMH A;  2O5I A;  2ZUE A;  4BBR C;  3GTM A;  3S14 K;  3LPX A;  5IOQ A;  3GTJ A;  2GSU A;  4Y52 C;  1Y1V K;  3WOD A;  3M4O K;  5C44 C;  4A3C K;  4YG2 A;  1TWA C;  3LAJ A;  3N0C A;  2JA8 C;  3HOX K;  2E2I A;  3FHZ A;  1HI9 A;  4KN7 A;  3GTG C;  2E2H K;  5C44 K;  4A3C C;  1DCP A;  3SZZ A;  1R9T A;  3HOV C;  3GTG K;  2YU9 K;  3S1Q C;  1DD5 A;  1XZP B;  1B4A A;  2V6U A;  1K83 A;  2PA8 D;  2E2H C;  3GEI A;  1I6H K;  3S15 C;  4QIW L;  1USO A;  3GTM K;  3VA7 A;  1WCM A;  1B4B A;  2VUM K;  5E68 A;  3HOW K;  4NOI A;  4KB2 A;  1O26 A;  1TWC A;  5CJ9 A;  4PAB A;  1X31 C;  3N0B A;  4ILD A;  4BY1 K;  2NVX A;  4Y7N K;  2JA7 A;  1R9T K;  3I4N K;  2RH6 A;  3GTP A;  2JA6 A;  1WQG A;  2GAH C;  4C3J C;  5M5W K;  3S2H K;  4C45 A;  3S17 C;  4O2D A;  1J6X A; 
#chains in the Genus database with same CATH homology
 3GTL C;  4A3B C;  2JA8 K;  3CQZ C;  3GTK C;  4BY7 K;  1K83 C;  1SFO K;  4A3G K;  5C4J C;  2YU9 C;  2A68 A;  2JA5 C;  4MQ9 A;  2R92 C;  4A3E C;  4A3M K;  5C4J K;  4A3I K;  1TWF C;  3I4M C;  1TWG C;  4X6A C;  1WCM C;  2A6H A;  4LK0 A;  5C3E K;  4QIW D;  3I4N C;  2Y0S D;  1I3Q K;  3HOZ K;  3S2D K;  3HOV K;  4X6A K;  3HOU C;  1TWC K;  2WB1 L;  1Y1W C;  3M4O C;  5M3F K;  4A3M C;  1YNN A;  4A3D K;  2BE5 A;  3GTK K;  2R7Z K;  3M3Y K;  3HOU K;  1YNJ A;  3S1R C;  2O5J A;  3HKZ D;  4OIR A;  3DXJ A;  5IP9 K;  5FLM K;  3PO2 C;  3RZO C;  4MEX A;  3GTJ C;  4BY1 C;  2JA5 K;  3RZD K;  4A3D C;  4OIP A;  1I50 C;  3S1N K;  5IP7 K;  2WAQ D;  4MEY A;  1I3Q C;  4C3J K;  1TWG K;  1I6H C;  5C4X K;  3CQZ K;  4BY7 C;  2Y0S L;  4OIN A;  4A3L C;  5TMF A;  4KN4 A;  5IYD K;  4AYB D;  4YFK A;  3HOY C;  4LJZ A;  4ZH4 A;  4A3K K;  4Q5S A;  1Y1V C;  4C3H K;  4A3E K;  4XSX A;  5IYB C;  4A3F K;  1R9T C;  4A93 C;  3S14 C;  5IP9 C;  3RZO K;  2JA6 K;  2NVY C;  5IYC K;  4A3J K;  3GTP K;  4GZY A;  3HOX C;  2JA7 K;  4A3B K;  3FKI K;  3H0G C;  1BDF A;  4OIQ A;  3PO3 C;  4G7H A;  3S17 K;  4YFX A;  4BXX K;  4BBS C;  3K7A K;  2A6E A;  3GTQ K;  1TWH K;  3HOZ C;  4BBR K;  3GTO K;  4KMU A;  2A69 A;  5M5X K;  2NVT C;  4BBS K;  1WCM K;  2O5I A;  2VUM C;  2NVQ C;  4XLP A;  4BBR C;  3S16 C;  2R93 C;  4A3I C;  3I4M K;  3S14 K;  3S1Q K;  4Y52 C;  3S1M K;  1I50 K;  1Y1V K;  4LK1 A;  3S1N C;  3WOD A;  3M4O K;  1TWH C;  4C2M K;  5C44 C;  4A3C K;  3GTJ K;  4YG2 A;  1TWA C;  4XLN A;  3HKZ L;  2E2J K;  4QJV A;  2E2I K;  2JA8 C;  3HOX K;  2JA7 C;  4Y7N C;  3GTM C;  3S16 K;  3PO3 K;  4G7O A;  2R7Z C;  4KN7 A;  3GTG C;  3M3Y C;  2E2H K;  1XPP A;  4JK1 A;  4QJV B;  4G7Z A;  5C44 K;  4A3C C;  4A93 K;  2NVQ K;  3HOV C;  3PO2 K;  3GTG K;  2E2I C;  2YU9 K;  3H3V D;  4OIO A;  3S1Q C;  2PA8 D;  2E2H C;  2CW0 A;  4Q4Z A;  1I6H K;  2PMZ D;  2B63 C;  3S15 C;  3S2H C;  3K7A C;  4QIW L;  5M3M K;  3GTM K;  4Y52 K;  5IYB K;  4XSZ A;  5M5Y K;  2WB1 D;  1TWA K;  2E2J C;  2NVT K;  2PA8 L;  4YFN A;  5IYC C;  1HQM A;  2VUM K;  3GTQ C;  2PMZ L;  5FJ8 K;  5FLM C;  5C3E C;  3EQL A;  3HOW K;  4LLG A;  2JA6 C;  4NOI A;  4C3I K;  3RZD C;  2B63 K;  3GTP C;  5C4X C;  1SMY A;  5IYD C;  3FKI C;  1TWF K;  2PPB A;  3H3V L;  1ZYR A;  2WAQ L;  5TMC A;  1IW7 A;  4BY1 K;  2R92 K;  4Y7N K;  1R9T K;  3I4N K;  3S2D C;  5IP7 C;  1K83 K;  1I6V A;  1SFO C;  2NVY K;  2NVX K;  4A3K C;  3GTO C;  1TWC C;  1Y1W K;  3GTL K;  4A3F C;  5M5W K;  3H0G K;  3S15 K;  4AYB L;  3S2H K;  3S1M C;  4A3L K;  4BXX C;  5D4D A;  2NVX C;  4A3G C;  3S17 C;  2R93 K;  4A3J C;  3HOW C;  3HOY K;  3S1R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...