3M3YK

Rna polymerase ii elongation complex c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m3yK00
1Y1VK 4OIRA 2WB1D 3GTOC 1Y1WK 4OIOA 3HOZC 2R93K 4JK1A 2JA6C 4Y7NC 4A3JK 3HOWK 1TWCK 3S16K 4LJZA 2A69A 4A3EC 5C3EC 4A3JC 3S15C 4C3JK 4A3LC 2PPBA 5IYCK 3S14K 1SFOC 2NVXC 4LK1A 5C44K 4A3EK 3S15K 5FLMC 5M3MK 3S17K 3M3YK 4A3FC 2NVTK 4QIWD 4Y52C 2A6EA 1I6HK 5IYCC 4G7OA 3HKZL 3S1QK 3GTKK 4Y52K 4KMUA 3HOUC 3GTJK 2NVXK 1I50C 2R92K 1Y1VC 4Q4ZA 5FLMK 3S2DK 4A3IK 3GTOK 2E2HC 4KN7A 3HOZK 3M4OK 3H0GK 1R9TC 4A3GK 4XSXA 1I50K 1TWAC 4X6AC 4BBRK 2BE5A 2R7ZK 1TWCC 4QJVA 5C4JC 4A3MK 2E2IC 1XPPA 4BBSC 4OIQA 1TWAK 4AYBL 4XLPA 1YNJA 3S1RC 3S16C 3CQZK 1TWGK 1HQMA 4QJVB 3RZDC 3GTMK 3PO2C 3S1MK 4A3BC 4X6AK 2JA6K 1TWFK 5IYBK 5FJ8K 3GTGK 2NVYC 3I4NK 3S1RK 4ZH4A 3RZOC 1TWHC 3HOVK 2PA8L 5IYDK 3GTQK 4LK0A 4GZYA 4XSZA 2WAQD 2B63K 2VUMK 2WB1L 2YU9C 3I4MK 3HOWC 1SFOK 4A3CK 4YFNA 2JA8K 4A3MC 2E2IK 2WAQL 3S1NK 5IYDC 3EQLA 2YU9K 3HKZD 3I4MC 2NVTC 4A93C 3GTJC 5D4DA 1I3QK 3PO3K 3H0GC 2O5IA 1TWFC 3K7AC 5M5YK 5IYBC 4NOIA 5C44C 3GTLC 3S14C 1YNNA 4A3DC 2NVQC 4A3KC 2VUMC 1I6VA 3CQZC 2A6HA 3RZDK 1I3QC 2E2JK 3GTMC 4C2MK 4G7ZA 3HOXC 4A3FK 3GTPC 3H3VD 4BXXC 3GTKC 4A3KK 3FKIC 2JA7C 3S2HC 2Y0SD 2JA5C 2PMZL 1R9TK 1SMYA 3GTGC 4MEXA 3RZOK 4BXXK 4A3GC 3K7AK 2E2JC 4C3IK 5C4JK 3HOXK 4C3HK 4KN4A 4LLGA 5C4XK 5M5XK 3HOYK 4QIWL 1ZYRA 3S2HK 4XLNA 4A3IC 3M4OC 3PO3C 1IW7A 1BDFA 1K83K 3FKIK 5IP7K 4BY1C 4BY7C 3H3VL 4MQ9A 4A3DK 2R93C 1WCMK 2NVYK 4A3CC 5M3FK 4A3LK 5TMCA 2E2HK 3PO2K 4A3BK 2PMZD 2B63C 2R92C 1WCMC 2CW0A 2PA8D 2O5JA 4A93K 1TWHK 2JA7K 3HOVC 5IP7C 4BY1K 4BY7K 3M3YC 3DXJA 3GTQC 5TMFA 4BBRC 2R7ZC 1K83C 1TWGC 2A68A 3S17C 3S1MC 4AYBD 5M5WK 4OIPA 2JA5K 3S1QC 3S1NC 3S2DC 2NVQK 4BBSK 2JA8C 5IP9C 1Y1WC 5C3EK 4Q5SA 1I6HC 4G7HA 4YG2A 3HOYC 5C4XC 2Y0SL 3GTLK 3GTPK 4OINA 4MEYA 3I4NC 5IP9K 4YFKA 3WODA 4YFXA 3HOUK 4Y7NK
chains in the Genus database with same CATH superfamily
4OIRA 2WB1D 3SZYA 4OIOA 4LQYA 1O26A 4Y7NC 3HOWK 4O2DA 5L46A 2RGRA 3ERED 5C3EC 3AD7C 5HL8A 1IL2A 5JVOA 2NVXC 5FLMC 2GSUA 2NVTK 1WQGA 1J6VA 4Y52C 4G0WA 1JVIA 2A6EA 3LAJA 4Y52K 4XCHA 4FZBA 4KB4A 1O2BA 3T02A 1F9NA 4BBRK 4QJVA 4P9SA 3RZDC 3PO2C 2EBBA 2JA6K 1TWFK 3S1RK 4ZH4A 2PA8L 4XSZA 3A8KA 2YU9C 3HOWC 1DD5A 3S1NK 2YU9K 3TFHA 1I3QK 5IYBC 3T01A 3Q3QA 3GTMC 2A6HA 3HOXC 4A3KK 1JQWA 3FKIC 1IQ0A 1GE9A 3TFJA 3GTGC 3RZOK 5C4JK 4KN4A 4LLGA 3HOYK 4QIWL 1WOSA 4XLNA 3AQOA 1XZPB 2Y3PA 4KDDA 4BLAA 5IP7K 3H3VL 4A3LK 3BP8C 5IOTA 2PMZD 2CW0A 2O5JA 2NVXA 3HOVC 1EI6A 4BY1K 3M3YC 3GTQC 1ISEA 1K83C 1WOOA 5M5WK 4BKWA 3S1NC 4Q5SA 4KMHA 2NVYA 3GTLK 2CFAA 4YFXA 3S16C 1IE0A 3HOUK 3GTOC 1Y1WK 5IOSA 2JA6C 1TWGA 1F93A 3A8IA 4G0UA 4A3JC 3S15C 1C0AA 4A3LC 1DCPA 3AD8C 1J98A 4ILDA 4LK1A 3S15K 1J6WA 3NUHA 2B63A 3M3YK 3L4KA 4G7OA 3GTKK 1YCLA 4KMUA 4AH6A 3GTJK 3CAGA 5EGHA 2R92K 2GAHC 3H0GK 1R9TC 4A3GK 4XSXA 1I50K 1TWAC 2JH3A 3G4CA 2JA5A 3ADAC 1J6XA 3TFIA 5C4JC 2E2IC 1XPPA 4BBSC 1TWAK 4XLPA 3S1RC 1L0WA 3S1MK 1V5VA 1IBAA 5IORA 5IYBK 1DCOA 1TWHC 1ZXOA 1F7UA 1TWFA 3H0GA 1VGXA 2WB1L 4A3CK 2R7ZA 4KARA 4A3MC 5IYDC 1WCMA 3HKZD 1KQ4A 5M5YK 3GTLC 3S14C 1YNNA 1G51A 4A3KC 2VUMC 3CQZC 2E2JK 4C2MK 4A3FK 3GTPC 4BXXC 3GTKC 1PJ5A 1USMA 3BUEA 2JA7C 1TWCA 4DDQA 4BXXK 2P8TA 1ZVUA 3K7AK 3LPXA 4GTDA 4C3IK 4GTFA 2ZFZA 1Y1VA 1XXAA 5C4XK 4GTEA 1WSVA 1WQFA 1ZYRA 3S2HK 1BJTA 4FM9A 1O2AA 4A3IC 1WORA 3PO3C 1IW7A 1BDFA 1K83K 2GSOA 4BY1C 2R93C 2V6TA 1VRQC 4A3BK 3GTJA 2R92C 2W7VA 2PA8D 1SFOA 4GTCA 1ZQ1C 4P5AA 4WJ4A 2A68A 3S1MC 1WIHA 4AYBD 3S1QC 4BBSK 2NVQK 2JA8C 1Y1WC 5C3EK 1I6HC 4G7HA 3HOYC 4LOWA 1Y1VK 3HOZC 4GTBA 1VLOA 2FQTA 1WOPA 4A3JK 2KWAA 1BGWA 4LJZA 3LAPA 4C3JK 2PPBA 3N0CA 1XZQB 3AH5A 3S17K 4C2MC 4A3FC 4QIWD 5CJ9A 4KATA 3S0XA 2FQOA 5IYCC 3TTGA 3HKZL 3GEIA 1UV7A 4C3IC 4KAWX 2NVXK 1XZPA 1I50C 1INNA 3S2DK 4A3IK 3GTOK 2E2HC 3OPFA 1WQHA 3BP3A 4X6AC 2V6SA 1EFWA 1YX2A 3AQPA 4X6AK 1YNJA 3GTMK 3JSTA 4QJVB 1I3QA 4A3BC 1PJ6A 5FJ8K 4LR2A 1O2FB 3HOVK 5IYDK 1EK8A 1Y1WA 3GTQK 4LK0A 3FOFA 2WAQD 1B4AA 2VUMK 4KC6A 3I4MK 5E68A 1XZQA 1SFOK 1AB4A 1O27A 3EQLA 3I4MC 2NVTC 3GTJC 5D4DA 3V4GA 2O5IA 3K7AC 2ZUFA 4PAAA 4A3DC 2NVQC 2XCQA 3RZDK 1I3QC 4BLBA 4M1XA 3H3VD 3S2HC 2CFAB 1VJEA 3G4AA 2PMZL 3GEHA 2E2HA 3HOXK 4C3HK 4RMFA 1RU0A 1I50A 5M5XK 2JA7A 1O25A 3M4OC 3CQZA 4KASA 3FKIK 1DCHA 1EH1A 4P5BA 3GEEA 2GSNA 2NVYK 3GTLA 5TMCA 1O24A 2E2HK 1USOA 4KM9A 1F7VA 1WCMC 4A93K 2JA7K 4BY7K 3DXJA 2RH6A 5TMFA 2R7ZC 3OEPA 5IP9C 5C4XC 2Y0SL 3HXAA 4OINA 3I4NC 5IP9K 2R93K 4JK1A 3FOEA 1TWAA 1TWCK 1R9TA 4KM8A 2V6UA 3S16K 2A69A 4A3EC 5IYCK 4KB2A 1EQRA 3S14K 1SFOC 3OREA 2R92A 5C44K 4A3EK 1XXBA 5M3MK 3GIRA 3N0BA 1I6HK 2R93A 3T00A 3S1QK 3A8JA 5TJ3A 3HOUC 3IPJA 4J3NA 1X31C 4GT9A 1Y1VC 4Q4ZA 5FLMK 3N3YA 3M4OK 3HOZK 4KN7A 2R7ZK 2BE5A 1TWCC 4C3JC 2JA6A 4A3MK 3GTOA 4OIQA 3GTKA 4AYBL 4GZYA 3GTPA 3CQZK 1TWGK 1HQMA 1JOEA 2VUMA 3GTGK 3I4NK 2NVYC 3RZOC 4WJ3M 4KMAA 2B63K 3AD9C 5EGEA 1WSRA 3MMLB 1K83A 1O28A 4YFNA 3GDZA 1B4BA 2JA8K 3GTQA 2E2IK 2WAQL 2XCRB 2GAGC 4C45A 4A93C 4KMDA 3PO3K 3H0GC 1TWFC 4NOIA 5C44C 1TWHA 5JFEA 1I6VA 2D6FC 4G7ZA 1VH2A 2E2IA 2Y0SD 4PABA 2JA5C 1R9TK 1SMYA 4A3GC 4MEXA 3VA7A 2E2JC 2P5MA 5IOQA 1ZBSA 4GTAA 1IS1A 3GTGA 3L4JA 3FKIA 4GFQA 1HI9A 3GSIA 4GTLA 3GTMA 4BY7C 4MQ9A 3QX3A 4A3DK 1O29A 1WCMK 4A3CC 5M3FK 3PO2K 1XXCA 2B63C 4G0VA 2XCOA 1TWHK 2ZUEA 5IP7C 3SZZA 4BBRC 1BS2A 2YU9A 1PJ7A 1TWGC 3FHZA 3S17C 4OIPA 2JA5K 3S2DC 4YG2A 4WILA 2PHCB 3GTPK 4C3HC 4MEYA 5CHPA 4YFKA 3WODA 4Y7NK
chains in the Genus database with same CATH topology
1Y1VK 4OIRA 2WB1D 3GTOC 1Y1WK 4OIOA 3HOZC 2R93K 4JK1A 2JA6C 4Y7NC 4A3JK 3HOWK 1TWCK 3S16K 4LJZA 2A69A 4A3EC 5C3EC 4A3JC 3S15C 4C3JK 4A3LC 2PPBA 5IYCK 3S14K 1SFOC 2NVXC 4LK1A 5C44K 4A3EK 3S15K 5FLMC 5M3MK 3S17K 3M3YK 4A3FC 2NVTK 4QIWD 4Y52C 2A6EA 1I6HK 5IYCC 4G7OA 3HKZL 3S1QK 3GTKK 4Y52K 4KMUA 3HOUC 3GTJK 2NVXK 1I50C 2R92K 1Y1VC 4Q4ZA 5FLMK 3S2DK 4A3IK 3GTOK 2E2HC 4KN7A 3HOZK 3M4OK 3H0GK 1R9TC 4A3GK 4XSXA 1I50K 1TWAC 4X6AC 4BBRK 2BE5A 2R7ZK 1TWCC 4QJVA 5C4JC 4A3MK 2E2IC 1XPPA 4BBSC 4OIQA 1TWAK 4AYBL 4XLPA 1YNJA 3S1RC 3S16C 3CQZK 1TWGK 1HQMA 4QJVB 3RZDC 3GTMK 3PO2C 3S1MK 4A3BC 4X6AK 2JA6K 1TWFK 5IYBK 5FJ8K 3GTGK 2NVYC 3I4NK 3S1RK 4ZH4A 3RZOC 1TWHC 3HOVK 2PA8L 5IYDK 3GTQK 4LK0A 4GZYA 4XSZA 2WAQD 2B63K 2VUMK 2WB1L 2YU9C 3I4MK 3HOWC 1SFOK 4A3CK 4YFNA 2JA8K 4A3MC 2E2IK 2WAQL 3S1NK 5IYDC 3EQLA 2YU9K 3HKZD 3I4MC 2NVTC 4A93C 3GTJC 5D4DA 1I3QK 3PO3K 3H0GC 2O5IA 1TWFC 3K7AC 5M5YK 5IYBC 4NOIA 5C44C 3GTLC 3S14C 1YNNA 4A3DC 2NVQC 4A3KC 2VUMC 1I6VA 3CQZC 2A6HA 3RZDK 1I3QC 2E2JK 3GTMC 4C2MK 4G7ZA 3HOXC 4A3FK 3GTPC 3H3VD 4BXXC 3GTKC 4A3KK 3FKIC 2JA7C 3S2HC 2Y0SD 2JA5C 2PMZL 1R9TK 1SMYA 3GTGC 4MEXA 3RZOK 4BXXK 4A3GC 3K7AK 2E2JC 4C3IK 5C4JK 3HOXK 4C3HK 4KN4A 4LLGA 5C4XK 5M5XK 3HOYK 4QIWL 1ZYRA 3S2HK 4XLNA 4A3IC 3M4OC 3PO3C 1IW7A 1BDFA 1K83K 3FKIK 5IP7K 4BY1C 4BY7C 3H3VL 4MQ9A 4A3DK 2R93C 1WCMK 2NVYK 4A3CC 5M3FK 4A3LK 5TMCA 2E2HK 3PO2K 4A3BK 2PMZD 2B63C 2R92C 1WCMC 2CW0A 2PA8D 2O5JA 4A93K 1TWHK 2JA7K 3HOVC 5IP7C 4BY1K 4BY7K 3M3YC 3DXJA 3GTQC 5TMFA 4BBRC 2R7ZC 1K83C 1TWGC 2A68A 3S17C 3S1MC 4AYBD 5M5WK 4OIPA 2JA5K 3S1QC 3S1NC 3S2DC 2NVQK 4BBSK 2JA8C 5IP9C 1Y1WC 5C3EK 4Q5SA 1I6HC 4G7HA 4YG2A 3HOYC 5C4XC 2Y0SL 3GTLK 3GTPK 4OINA 4MEYA 3I4NC 5IP9K 4YFKA 3WODA 4YFXA 3HOUK 4Y7NK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V K;  4OIR A;  2WB1 D;  3GTO C;  1Y1W K;  4OIO A;  3HOZ C;  2R93 K;  4JK1 A;  2JA6 C;  4Y7N C;  4A3J K;  3HOW K;  1TWC K;  3S16 K;  4LJZ A;  2A69 A;  4A3E C;  5C3E C;  4A3J C;  3S15 C;  4C3J K;  4A3L C;  2PPB A;  5IYC K;  3S14 K;  1SFO C;  2NVX C;  4LK1 A;  5C44 K;  4A3E K;  3S15 K;  5FLM C;  5M3M K;  3S17 K;  3M3Y K;  4A3F C;  2NVT K;  4QIW D;  4Y52 C;  2A6E A;  1I6H K;  5IYC C;  4G7O A;  3HKZ L;  3S1Q K;  3GTK K;  4Y52 K;  4KMU A;  3HOU C;  3GTJ K;  2NVX K;  1I50 C;  2R92 K;  1Y1V C;  4Q4Z A;  5FLM K;  3S2D K;  4A3I K;  3GTO K;  2E2H C;  4KN7 A;  3HOZ K;  3M4O K;  3H0G K;  1R9T C;  4A3G K;  4XSX A;  1I50 K;  1TWA C;  4X6A C;  4BBR K;  2BE5 A;  2R7Z K;  1TWC C;  4QJV A;  5C4J C;  4A3M K;  2E2I C;  1XPP A;  4BBS C;  4OIQ A;  1TWA K;  4AYB L;  4XLP A;  1YNJ A;  3S1R C;  3S16 C;  3CQZ K;  1TWG K;  1HQM A;  4QJV B;  3RZD C;  3GTM K;  3PO2 C;  3S1M K;  4A3B C;  4X6A K;  2JA6 K;  1TWF K;  5IYB K;  5FJ8 K;  3GTG K;  2NVY C;  3I4N K;  3S1R K;  4ZH4 A;  3RZO C;  1TWH C;  3HOV K;  2PA8 L;  5IYD K;  3GTQ K;  4LK0 A;  4GZY A;  4XSZ A;  2WAQ D;  2B63 K;  2VUM K;  2WB1 L;  2YU9 C;  3I4M K;  3HOW C;  1SFO K;  4A3C K;  4YFN A;  2JA8 K;  4A3M C;  2E2I K;  2WAQ L;  3S1N K;  5IYD C;  3EQL A;  2YU9 K;  3HKZ D;  3I4M C;  2NVT C;  4A93 C;  3GTJ C;  5D4D A;  1I3Q K;  3PO3 K;  3H0G C;  2O5I A;  1TWF C;  3K7A C;  5M5Y K;  5IYB C;  4NOI A;  5C44 C;  3GTL C;  3S14 C;  1YNN A;  4A3D C;  2NVQ C;  4A3K C;  2VUM C;  1I6V A;  3CQZ C;  2A6H A;  3RZD K;  1I3Q C;  2E2J K;  3GTM C;  4C2M K;  4G7Z A;  3HOX C;  4A3F K;  3GTP C;  3H3V D;  4BXX C;  3GTK C;  4A3K K;  3FKI C;  2JA7 C;  3S2H C;  2Y0S D;  2JA5 C;  2PMZ L;  1R9T K;  1SMY A;  3GTG C;  4MEX A;  3RZO K;  4BXX K;  4A3G C;  3K7A K;  2E2J C;  4C3I K;  5C4J K;  3HOX K;  4C3H K;  4KN4 A;  4LLG A;  5C4X K;  5M5X K;  3HOY K;  4QIW L;  1ZYR A;  3S2H K;  4XLN A;  4A3I C;  3M4O C;  3PO3 C;  1IW7 A;  1BDF A;  1K83 K;  3FKI K;  5IP7 K;  4BY1 C;  4BY7 C;  3H3V L;  4MQ9 A;  4A3D K;  2R93 C;  1WCM K;  2NVY K;  4A3C C;  5M3F K;  4A3L K;  5TMC A;  2E2H K;  3PO2 K;  4A3B K;  2PMZ D;  2B63 C;  2R92 C;  1WCM C;  2CW0 A;  2PA8 D;  2O5J A;  4A93 K;  1TWH K;  2JA7 K;  3HOV C;  5IP7 C;  4BY1 K;  4BY7 K;  3M3Y C;  3DXJ A;  3GTQ C;  5TMF A;  4BBR C;  2R7Z C;  1K83 C;  1TWG C;  2A68 A;  3S17 C;  3S1M C;  4AYB D;  5M5W K;  4OIP A;  2JA5 K;  3S1Q C;  3S1N C;  3S2D C;  2NVQ K;  4BBS K;  2JA8 C;  5IP9 C;  1Y1W C;  5C3E K;  4Q5S A;  1I6H C;  4G7H A;  4YG2 A;  3HOY C;  5C4X C;  2Y0S L;  3GTL K;  3GTP K;  4OIN A;  4MEY A;  3I4N C;  5IP9 K;  4YFK A;  3WOD A;  4YFX A;  3HOU K;  4Y7N K; 
#chains in the Genus database with same CATH topology
 4OIR A;  2WB1 D;  3SZY A;  4OIO A;  4LQY A;  1O26 A;  4Y7N C;  3HOW K;  4O2D A;  5L46 A;  2RGR A;  3ERE D;  5C3E C;  3AD7 C;  5HL8 A;  1IL2 A;  5JVO A;  2NVX C;  5FLM C;  2GSU A;  2NVT K;  1WQG A;  1J6V A;  4Y52 C;  4G0W A;  1JVI A;  2A6E A;  3LAJ A;  4Y52 K;  4XCH A;  4FZB A;  4KB4 A;  1O2B A;  3T02 A;  1F9N A;  4BBR K;  4QJV A;  4P9S A;  3RZD C;  3PO2 C;  2EBB A;  2JA6 K;  1TWF K;  3S1R K;  4ZH4 A;  2PA8 L;  4XSZ A;  3A8K A;  2YU9 C;  3HOW C;  1DD5 A;  3S1N K;  2YU9 K;  3TFH A;  1I3Q K;  5IYB C;  3T01 A;  3Q3Q A;  3GTM C;  2A6H A;  3HOX C;  4A3K K;  1JQW A;  3FKI C;  1IQ0 A;  1GE9 A;  3TFJ A;  3GTG C;  3RZO K;  5C4J K;  4KN4 A;  4LLG A;  3HOY K;  4QIW L;  1WOS A;  4XLN A;  3AQO A;  1XZP B;  2Y3P A;  4KDD A;  4BLA A;  5IP7 K;  3H3V L;  4A3L K;  3BP8 C;  5IOT A;  2PMZ D;  2CW0 A;  2O5J A;  2NVX A;  3HOV C;  1EI6 A;  4BY1 K;  3M3Y C;  3GTQ C;  1ISE A;  1K83 C;  1WOO A;  5M5W K;  4BKW A;  3S1N C;  4Q5S A;  4KMH A;  2NVY A;  3GTL K;  2CFA A;  4YFX A;  3S16 C;  1IE0 A;  3HOU K;  3GTO C;  1Y1W K;  5IOS A;  2JA6 C;  1TWG A;  1F93 A;  3A8I A;  4G0U A;  4A3J C;  3S15 C;  1C0A A;  4A3L C;  1DCP A;  3AD8 C;  1J98 A;  4ILD A;  4LK1 A;  3S15 K;  1J6W A;  3NUH A;  2B63 A;  3M3Y K;  3L4K A;  4G7O A;  3GTK K;  1YCL A;  4KMU A;  4AH6 A;  3GTJ K;  3CAG A;  5EGH A;  2R92 K;  2GAH C;  3H0G K;  1R9T C;  4A3G K;  4XSX A;  1I50 K;  1TWA C;  2JH3 A;  3G4C A;  2JA5 A;  3ADA C;  1J6X A;  3TFI A;  5C4J C;  2E2I C;  1XPP A;  4BBS C;  1TWA K;  4XLP A;  3S1R C;  1L0W A;  3S1M K;  1V5V A;  1IBA A;  5IOR A;  5IYB K;  1DCO A;  1TWH C;  1ZXO A;  1F7U A;  1TWF A;  3H0G A;  1VGX A;  2WB1 L;  4A3C K;  2R7Z A;  4KAR A;  4A3M C;  5IYD C;  1WCM A;  3HKZ D;  1KQ4 A;  5M5Y K;  3GTL C;  3S14 C;  1YNN A;  1G51 A;  4A3K C;  2VUM C;  3CQZ C;  2E2J K;  4C2M K;  4A3F K;  3GTP C;  4BXX C;  3GTK C;  1PJ5 A;  1USM A;  3BUE A;  2JA7 C;  1TWC A;  4DDQ A;  4BXX K;  2P8T A;  1ZVU A;  3K7A K;  3LPX A;  4GTD A;  4C3I K;  4GTF A;  2ZFZ A;  1Y1V A;  1XXA A;  5C4X K;  4GTE A;  1WSV A;  1WQF A;  1ZYR A;  3S2H K;  1BJT A;  4FM9 A;  1O2A A;  4A3I C;  1WOR A;  3PO3 C;  1IW7 A;  1BDF A;  1K83 K;  2GSO A;  4BY1 C;  2R93 C;  2V6T A;  1VRQ C;  4A3B K;  3GTJ A;  2R92 C;  2W7V A;  2PA8 D;  1SFO A;  4GTC A;  1ZQ1 C;  4P5A A;  4WJ4 A;  2A68 A;  3S1M C;  1WIH A;  4AYB D;  3S1Q C;  4BBS K;  2NVQ K;  2JA8 C;  1Y1W C;  5C3E K;  1I6H C;  4G7H A;  3HOY C;  4LOW A;  1Y1V K;  3HOZ C;  4GTB A;  1VLO A;  2FQT A;  1WOP A;  4A3J K;  2KWA A;  1BGW A;  4LJZ A;  3LAP A;  4C3J K;  2PPB A;  3N0C A;  1XZQ B;  3AH5 A;  3S17 K;  4C2M C;  4A3F C;  4QIW D;  5CJ9 A;  4KAT A;  3S0X A;  2FQO A;  5IYC C;  3TTG A;  3HKZ L;  3GEI A;  1UV7 A;  4C3I C;  4KAW X;  2NVX K;  1XZP A;  1I50 C;  1INN A;  3S2D K;  4A3I K;  3GTO K;  2E2H C;  3OPF A;  1WQH A;  3BP3 A;  4X6A C;  2V6S A;  1EFW A;  1YX2 A;  3AQP A;  4X6A K;  1YNJ A;  3GTM K;  3JST A;  4QJV B;  1I3Q A;  4A3B C;  1PJ6 A;  5FJ8 K;  4LR2 A;  1O2F B;  3HOV K;  5IYD K;  1EK8 A;  1Y1W A;  3GTQ K;  4LK0 A;  3FOF A;  2WAQ D;  1B4A A;  2VUM K;  4KC6 A;  3I4M K;  5E68 A;  1XZQ A;  1SFO K;  1AB4 A;  1O27 A;  3EQL A;  3I4M C;  2NVT C;  3GTJ C;  5D4D A;  3V4G A;  2O5I A;  3K7A C;  2ZUF A;  4PAA A;  4A3D C;  2NVQ C;  2XCQ A;  3RZD K;  1I3Q C;  4BLB A;  4M1X A;  3H3V D;  3S2H C;  2CFA B;  1VJE A;  3G4A A;  2PMZ L;  3GEH A;  2E2H A;  3HOX K;  4C3H K;  4RMF A;  1RU0 A;  1I50 A;  5M5X K;  2JA7 A;  1O25 A;  3M4O C;  3CQZ A;  4KAS A;  3FKI K;  1DCH A;  1EH1 A;  4P5B A;  3GEE A;  2GSN A;  2NVY K;  3GTL A;  5TMC A;  1O24 A;  2E2H K;  1USO A;  4KM9 A;  1F7V A;  1WCM C;  4A93 K;  2JA7 K;  4BY7 K;  3DXJ A;  2RH6 A;  5TMF A;  2R7Z C;  3OEP A;  5IP9 C;  5C4X C;  2Y0S L;  3HXA A;  4OIN A;  3I4N C;  5IP9 K;  2R93 K;  4JK1 A;  3FOE A;  1TWA A;  1TWC K;  1R9T A;  4KM8 A;  2V6U A;  3S16 K;  2A69 A;  4A3E C;  5IYC K;  4KB2 A;  1EQR A;  3S14 K;  1SFO C;  3ORE A;  2R92 A;  5C44 K;  4A3E K;  1XXB A;  5M3M K;  3GIR A;  3N0B A;  1I6H K;  2R93 A;  3T00 A;  3S1Q K;  3A8J A;  5TJ3 A;  3HOU C;  3IPJ A;  4J3N A;  1X31 C;  4GT9 A;  1Y1V C;  4Q4Z A;  5FLM K;  3N3Y A;  3M4O K;  3HOZ K;  4KN7 A;  2R7Z K;  2BE5 A;  1TWC C;  4C3J C;  2JA6 A;  4A3M K;  3GTO A;  4OIQ A;  3GTK A;  4AYB L;  4GZY A;  3GTP A;  3CQZ K;  1TWG K;  1HQM A;  1JOE A;  2VUM A;  3GTG K;  3I4N K;  2NVY C;  3RZO C;  4WJ3 M;  4KMA A;  2B63 K;  3AD9 C;  5EGE A;  1WSR A;  3MML B;  1K83 A;  1O28 A;  4YFN A;  3GDZ A;  1B4B A;  2JA8 K;  3GTQ A;  2E2I K;  2WAQ L;  2XCR B;  2GAG C;  4C45 A;  4A93 C;  4KMD A;  3PO3 K;  3H0G C;  1TWF C;  4NOI A;  5C44 C;  1TWH A;  5JFE A;  1I6V A;  2D6F C;  4G7Z A;  1VH2 A;  2E2I A;  2Y0S D;  4PAB A;  2JA5 C;  1R9T K;  1SMY A;  4A3G C;  4MEX A;  3VA7 A;  2E2J C;  2P5M A;  5IOQ A;  1ZBS A;  4GTA A;  1IS1 A;  3GTG A;  3L4J A;  3FKI A;  4GFQ A;  1HI9 A;  3GSI A;  4GTL A;  3GTM A;  4BY7 C;  4MQ9 A;  3QX3 A;  4A3D K;  1O29 A;  1WCM K;  4A3C C;  5M3F K;  3PO2 K;  1XXC A;  2B63 C;  4G0V A;  2XCO A;  1TWH K;  2ZUE A;  5IP7 C;  3SZZ A;  4BBR C;  1BS2 A;  2YU9 A;  1PJ7 A;  1TWG C;  3FHZ A;  3S17 C;  4OIP A;  2JA5 K;  3S2D C;  4YG2 A;  4WIL A;  2PHC B;  3GTP K;  4C3H C;  4MEY A;  5CHP A;  4YFK A;  3WOD A;  4Y7N K; 
#chains in the Genus database with same CATH homology
 1Y1V K;  4OIR A;  2WB1 D;  3GTO C;  1Y1W K;  4OIO A;  3HOZ C;  2R93 K;  4JK1 A;  2JA6 C;  4Y7N C;  4A3J K;  3HOW K;  1TWC K;  3S16 K;  4LJZ A;  2A69 A;  4A3E C;  5C3E C;  4A3J C;  3S15 C;  4C3J K;  4A3L C;  2PPB A;  5IYC K;  3S14 K;  1SFO C;  2NVX C;  4LK1 A;  5C44 K;  4A3E K;  3S15 K;  5FLM C;  5M3M K;  3S17 K;  3M3Y K;  4A3F C;  2NVT K;  4QIW D;  4Y52 C;  2A6E A;  1I6H K;  5IYC C;  4G7O A;  3HKZ L;  3S1Q K;  3GTK K;  4Y52 K;  4KMU A;  3HOU C;  3GTJ K;  2NVX K;  1I50 C;  2R92 K;  1Y1V C;  4Q4Z A;  5FLM K;  3S2D K;  4A3I K;  3GTO K;  2E2H C;  4KN7 A;  3HOZ K;  3M4O K;  3H0G K;  1R9T C;  4A3G K;  4XSX A;  1I50 K;  1TWA C;  4X6A C;  4BBR K;  2BE5 A;  2R7Z K;  1TWC C;  4QJV A;  5C4J C;  4A3M K;  2E2I C;  1XPP A;  4BBS C;  4OIQ A;  1TWA K;  4AYB L;  4XLP A;  1YNJ A;  3S1R C;  3S16 C;  3CQZ K;  1TWG K;  1HQM A;  4QJV B;  3RZD C;  3GTM K;  3PO2 C;  3S1M K;  4A3B C;  4X6A K;  2JA6 K;  1TWF K;  5IYB K;  5FJ8 K;  3GTG K;  2NVY C;  3I4N K;  3S1R K;  4ZH4 A;  3RZO C;  1TWH C;  3HOV K;  2PA8 L;  5IYD K;  3GTQ K;  4LK0 A;  4GZY A;  4XSZ A;  2WAQ D;  2B63 K;  2VUM K;  2WB1 L;  2YU9 C;  3I4M K;  3HOW C;  1SFO K;  4A3C K;  4YFN A;  2JA8 K;  4A3M C;  2E2I K;  2WAQ L;  3S1N K;  5IYD C;  3EQL A;  2YU9 K;  3HKZ D;  3I4M C;  2NVT C;  4A93 C;  3GTJ C;  5D4D A;  1I3Q K;  3PO3 K;  3H0G C;  2O5I A;  1TWF C;  3K7A C;  5M5Y K;  5IYB C;  4NOI A;  5C44 C;  3GTL C;  3S14 C;  1YNN A;  4A3D C;  2NVQ C;  4A3K C;  2VUM C;  1I6V A;  3CQZ C;  2A6H A;  3RZD K;  1I3Q C;  2E2J K;  3GTM C;  4C2M K;  4G7Z A;  3HOX C;  4A3F K;  3GTP C;  3H3V D;  4BXX C;  3GTK C;  4A3K K;  3FKI C;  2JA7 C;  3S2H C;  2Y0S D;  2JA5 C;  2PMZ L;  1R9T K;  1SMY A;  3GTG C;  4MEX A;  3RZO K;  4BXX K;  4A3G C;  3K7A K;  2E2J C;  4C3I K;  5C4J K;  3HOX K;  4C3H K;  4KN4 A;  4LLG A;  5C4X K;  5M5X K;  3HOY K;  4QIW L;  1ZYR A;  3S2H K;  4XLN A;  4A3I C;  3M4O C;  3PO3 C;  1IW7 A;  1BDF A;  1K83 K;  3FKI K;  5IP7 K;  4BY1 C;  4BY7 C;  3H3V L;  4MQ9 A;  4A3D K;  2R93 C;  1WCM K;  2NVY K;  4A3C C;  5M3F K;  4A3L K;  5TMC A;  2E2H K;  3PO2 K;  4A3B K;  2PMZ D;  2B63 C;  2R92 C;  1WCM C;  2CW0 A;  2PA8 D;  2O5J A;  4A93 K;  1TWH K;  2JA7 K;  3HOV C;  5IP7 C;  4BY1 K;  4BY7 K;  3M3Y C;  3DXJ A;  3GTQ C;  5TMF A;  4BBR C;  2R7Z C;  1K83 C;  1TWG C;  2A68 A;  3S17 C;  3S1M C;  4AYB D;  5M5W K;  4OIP A;  2JA5 K;  3S1Q C;  3S1N C;  3S2D C;  2NVQ K;  4BBS K;  2JA8 C;  5IP9 C;  1Y1W C;  5C3E K;  4Q5S A;  1I6H C;  4G7H A;  4YG2 A;  3HOY C;  5C4X C;  2Y0S L;  3GTL K;  3GTP K;  4OIN A;  4MEY A;  3I4N C;  5IP9 K;  4YFK A;  3WOD A;  4YFX A;  3HOU K;  4Y7N K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...