3M3YK

Rna polymerase ii elongation complex c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m3yK00
1I50K 5M5WK 2R93K 3S14K 2YU9C 2JA8K 5C4XC 5C44C 3S15C 3H0GK 4A93K 5D4DA 4X6AC 4XLNA 5TMFA 3S17C 4A3DC 3WODA 4NOIA 2NVTK 5IYCC 4QIWL 3HOYK 4GZYA 3M3YK 3HOZK 5C3EK 4A3LK 1WCMK 3FKIC 3S1MK 1TWAK 4Y7NK 2JA6K 2WB1L 4A3FK 5FJ8K 1TWFK 4MQ9A 3S1NC 5IP9C 5M3MK 3I4NC 4XLPA 3GTQC 5M5YK 2B63C 4A3BK 3S1QC 4C3HK 3S16C 3HOWC 3I4MC 3PO2C 3K7AK 4A3MK 1TWCK 1TWGK 3DXJA 4A3IK 5IP7C 1R9TK 4QIWD 4A3EC 1SFOK 3GTLC 4G7HA 3HOXC 4OIQA 5IYDK 1YNJA 3RZDC 4BY7K 1Y1VC 1Y1WC 3S2HK 4KN7A 1I3QC 2WB1D 2NVQK 3GTOK 4BBRK 3H3VL 4BBSC 2A68A 4XSXA 4LLGA 5FLMK 2VUMC 1K83K 3GTJC 3GTGC 2R7ZC 3GTMC 3HOUK 3S2DC 4A3KC 4A3CC 4Q5SA 3CQZC 3S1RK 2WAQL 2JA7C 5M3FK 3GTKC 5TMCA 2JA5C 3PO3C 4A3JC 2E2JC 2R93C 5C4XK 2YU9K 3GTPC 5C44K 1I6HC 4BY1C 2R92C 2E2HC 3S15K 2E2IC 4Y52C 4OIPA 2O5IA 4OIOA 3S14C 3S17K 2NVXC 3H3VD 5IYCK 4C2MK 1YNNA 3FKIK 4G7ZA 3RZOC 4BXXC 5IYBC 4KMUA 2WAQD 3S1NK 5IP9K 3I4NK 1TWAC 3GTQK 5C4JC 2PPBA 2B63K 3S1QK 3S16K 3HOWK 3PO2K 4MEYA 1TWHC 2NVYC 3HOVC 3K7AC 3GTLK 2PA8L 4QJVB 1HQMA 4A3EK 4YFNA 3HOXK 4XSZA 4YG2A 3RZDK 1Y1VK 1Y1WK 3M4OC 4A3GC 1I3QK 4YFXA 5M5XK 4BY7C 4BBSK 4MEXA 2VUMK 1I50C 3GTGK 3GTJK 4A3CK 3GTMK 2R7ZK 3S2DK 1I6HK 2JA8C 4X6AK 4A3DK 3CQZK 3H0GC 4A93C 2A6EA 2JA7K 4JK1A 4QJVA 1ZYRA 3GTKK 2PA8D 2JA5K 4OINA 2NVTC 3HOYC 4A3JK 2E2JK 3M3YC 3PO3K 3HKZL 3GTPK 3HOZC 2PMZL 5C3EC 4A3LC 4AYBL 1WCMC 2E2HK 4BY1K 2E2IK 2R92K 4LK0A 1I6VA 3S1MC 4OIRA 4Y7NC 3EQLA 2JA6C 4A3FC 4Y52K 2NVXK 1TWFC 1SMYA 2A69A 4C3JK 3I4MK 2CW0A 4YFKA 4A3BC 2A6HA 4BXXK 3RZOK 4A3MC 1TWCC 5IYBK 5IP7K 2Y0SL 1IW7A 1TWGC 4LJZA 4A3IC 5C4JK 1R9TC 1SFOC 3HKZD 4LK1A 5IYDC 2PMZD 4AYBD 4C3IK 1TWHK 2NVYK 3HOVK 3S2HC 2NVQC 4G7OA 4Q4ZA 4BBRC 1BDFA 3GTOC 2O5JA 4A3KK 1XPPA 5FLMC 4ZH4A 1K83C 3HOUC 3M4OK 4A3GK 3S1RC 2Y0SD 4KN4A 2BE5A
chains in the Genus database with same CATH superfamily
3AD9C 1VH2A 5CHPA 5M5WK 1R9TA 2JA8K 4O2DA 5C4XC 5C44C 4FZBA 1WORA 4A3DC 4NOIA 4GZYA 4XCHA 4C2MC 5C3EK 1WCMK 2ZUFA 2JA6K 3AD7C 3S1NC 3I4NC 3GEHA 3AQPA 5M5YK 2B63C 3S1QC 3S16C 3K7AK 1IQ0A 1O27A 1TWFA 5IP7C 5IYDK 3RZDC 1DD5A 3T01A 3FKIA 1I3QC 1G51A 4LLGA 2VUMC 3GTGC 3GTJC 2R7ZC 1EI6A 4A3KC 3GTOA 2GSNA 1XXAA 2JA5C 2E2JC 4AH6A 3GTPC 1I6HC 1XZPB 4OIPA 2O5IA 3S17K 3IPJA 2NVXC 5IYCK 4C3JC 1YNNA 3OEPA 2YU9A 1BGWA 5EGEA 4KMUA 5IP9K 1TWAC 5C4JC 1VJEA 1XXCA 4MEYA 1PJ5A 3GDZA 2W7VA 4KC6A 4BKWA 1IE0A 3GTLK 2PA8L 3GEIA 1Y1VK 1Y1WK 4A3GC 1ZBSA 3OREA 4BY7C 4GTCA 1F9NA 4A3CK 3GTMK 2JA8C 1J6XA 4A3DK 3CQZK 2NVYA 2JH3A 1ZYRA 3GTKK 2R93K 5C3EC 1USOA 1WCMC 2GAGC 3GSIA 2JA6C 3SZYA 1XZQB 1ISEA 1I50A 3RZOK 3GEEA 1IBAA 2ZFZA 5IP7K 5IYBK 1PJ7A 1EFWA 1O29A 1B4BA 3HKZD 5IYDC 1TWHK 3HOVK 2GSOA 2O5JA 4A3KK 1XPPA 1JVIA 4GFQA 1GE9A 4LQYA 1J6VA 3CAGA 4A93K 1X31C 4X6AC 4XLNA 3S17C 3A8JA 5IYCC 1L0WA 4KASA 1JOEA 1TWAK 2GSUA 2WB1L 4A3FK 1TWFK 4MQ9A 3N0BA 5IP9C 1ZXOA 4XLPA 1YX2A 4C3HK 1J6WA 4A3MK 1TWCK 3TTGA 4QIWD 3GTLC 4KAWX 4BY7K 1Y1VC 1Y1WC 1WQHA 4KN7A 1XZPA 4KATA 2NVQK 3GTOK 3H3VL 1DCHA 4A3CC 4GTEA 3GTMC 2B63A 1O25A 1IL2A 3CQZC 3S1RK 1B4AA 5M3FK 1KQ4A 1DCPA 3GTKC 1K83A 2R93C 2YU9K 4BLAA 1C0AA 4OIOA 4G0WA 1WQGA 5L46A 2VUMA 3GTJA 3RZOC 4KM8A 5IYBC 4GTAA 2WAQD 3GTQK 2PPBA 4KMDA 3GTPA 1TWHC 2KWAA 3HOVC 4QJVB 1HQMA 2NVXA 4YFNA 3VA7A 4YFXA 5M5XK 4MEXA 2EBBA 4X6AK 1O28A 1F7UA 4A93C 2A6EA 4WILA 4KB2A 3JSTA 2PMZL 4BY1K 2E2IK 4P9SA 4OIRA 2JA7A 3QX3A 4A3FC 1TWFC 4KMHA 4ILDA 2CW0A 5CJ9A 2R92A 4C3HC 2E2HA 4A3MC 1TWCC 4M1XA 2Y0SL 3NUHA 4LJZA 1HI9A 1JQWA 2RGRA 4AYBD 1WCMA 2NVQC 2JA6A 4Q4ZA 3GTOC 3AQOA 2XCRB 5E68A 3M4OK 4FM9A 3S1RC 4GT9A 2YU9C 3LAPA 1AB4A 3TFIA 5D4DA 5TMFA 3WODA 3BUEA 2NVTK 3HOYK 3HOZK 4A3LK 2ZUEA 1WOOA 3H0GA 5FJ8K 5M3MK 1O26A 4KARA 3GTQC 3I4MC 4A3IK 1R9TK 4OIQA 1YNJA 2CFAB 2XCQA 3S2HK 1WOPA 1TWGA 4BBRK 1SFOA 2A68A 5FLMK 1K83K 3HOUK 3BP3A 5TMCA 3GTLA 3TFHA 4BY1C 3S15K 2E2IC 3ADAC 3S14C 1Y1WA 4WJ4A 4WJ3M 5HL8A 3FKIK 4G7ZA 3GTMA 3AH5A 1XXBA 3MMLB 3TFJA 1RU0A 3FOFA 3GTKA 2XCOA 4KM9A 3HOWK 4KDDA 3PO2K 4LOWA 3FOEA 4A3EK 3HOXK 2V6TA 4YG2A 5EGHA 3LAJA 4GTLA 3M4OC 1VRQC 3T00A 5IOTA 3G4CA 4BBSK 3S2DK 1USMA 5IORA 1ZVUA 1I3QA 1TWHA 4JK1A 2JA7K 2PA8D 3PO3K 4OINA 2NVTC 4BLBA 4A3JK 3HOYC 3GTGA 3HKZL 3HOZC 2R7ZA 4A3LC 2R92K 2E2HK 5IOQA 1I6VA 4Y52K 4GTDA 3HXAA 3A8IA 2D6FC 2JA5A 3I4MK 4YFKA 2PHCB 4BXXK 3T02A 2FQOA 4A3IC 1R9TC 4DDQA 2P8TA 4C3IK 2NVYK 3S2HC 1J98A 1TWAA 4BBRC 1BDFA 1XZQA 1WQFA 5FLMC 4ZH4A 1K83C 3HOUC 1BS2A 3BP8C 4G0VA 1TWCA 4KN4A 2Y3PA 2BE5A 3OPFA 1I50K 3S14K 3S15C 1O2AA 3H0GK 1O2FB 3G4AA 3V4GA 1VLOA 4QIWL 1V5VA 3M3YK 5IOSA 3FKIC 2CFAA 3GIRA 3S1MK 4Y7NK 3N0CA 3S0XA 3A8KA 4A3BK 3HOWC 3PO2C 1TWGK 3DXJA 4A3EC 1SFOK 4G7HA 3HOXC 1DCOA 1WSVA 2WB1D 4KB4A 1WOSA 4BBSC 4XSXA 3N3YA 3S2DC 3GTQA 1WSRA 4Q5SA 3Q3QA 1PJ6A 5JVOA 2WAQL 2JA7C 3PO3C 1INNA 4A3JC 5C4XK 1F93A 5C44K 2R92C 2E2HC 3L4JA 4Y52C 3H3VD 4RMFA 4C2MK 4BXXC 3S1NK 3I4NK 2V6SA 2B63K 3S1QK 3S16K 4C3IC 2NVYC 2E2IA 3K7AC 2P5MA 4P5BA 5JFEA 1UV7A 4XSZA 3LPXA 3RZDK 4LR2A 1I3QK 5TJ3A 1BJTA 4G0UA 2VUMK 3GTGK 1I50C 4GTBA 3GTJK 2R7ZK 1Y1VA 2GAHC 4PABA 3H0GC 1EH1A 1EK8A 1EQRA 4QJVA 4PAAA 4KMAA 2JA5K 2E2JK 3M3YC 4P5AA 3GTPK 1I6HK 4AYBL 3CQZA 3S1MC 4LK0A 1O2BA 4Y7NC 3EQLA 4J3NA 3AD8C 2NVXK 1O24A 1SMYA 2A69A 4C3JK 2R93A 1IS1A 1ZQ1C 4A3BC 1F7VA 2A6HA 3ERED 2V6UA 1IW7A 1TWGC 2FQTA 5C4JK 1SFOC 4C45A 4LK1A 2PMZD 1YCLA 4GTFA 3L4KA 4G7OA 1VGXA 3SZZA 1WIHA 4A3GK 3FHZA 2RH6A 2Y0SD
chains in the Genus database with same CATH topology
1I50K 5M5WK 2R93K 3S14K 2YU9C 2JA8K 5C4XC 5C44C 3S15C 3H0GK 4A93K 5D4DA 4X6AC 4XLNA 5TMFA 3S17C 4A3DC 3WODA 4NOIA 2NVTK 5IYCC 4QIWL 3HOYK 4GZYA 3M3YK 3HOZK 5C3EK 4A3LK 1WCMK 3FKIC 3S1MK 1TWAK 4Y7NK 2JA6K 2WB1L 4A3FK 5FJ8K 1TWFK 4MQ9A 3S1NC 5IP9C 5M3MK 3I4NC 4XLPA 3GTQC 5M5YK 2B63C 4A3BK 3S1QC 4C3HK 3S16C 3HOWC 3I4MC 3PO2C 3K7AK 4A3MK 1TWCK 1TWGK 3DXJA 4A3IK 5IP7C 1R9TK 4QIWD 4A3EC 1SFOK 3GTLC 4G7HA 3HOXC 4OIQA 5IYDK 1YNJA 3RZDC 4BY7K 1Y1VC 1Y1WC 3S2HK 4KN7A 1I3QC 2WB1D 2NVQK 3GTOK 4BBRK 3H3VL 4BBSC 2A68A 4XSXA 4LLGA 5FLMK 2VUMC 1K83K 3GTJC 3GTGC 2R7ZC 3GTMC 3HOUK 3S2DC 4A3KC 4A3CC 4Q5SA 3CQZC 3S1RK 2WAQL 2JA7C 5M3FK 3GTKC 5TMCA 2JA5C 3PO3C 4A3JC 2E2JC 2R93C 5C4XK 2YU9K 3GTPC 5C44K 1I6HC 4BY1C 2R92C 2E2HC 3S15K 2E2IC 4Y52C 4OIPA 2O5IA 4OIOA 3S14C 3S17K 2NVXC 3H3VD 5IYCK 4C2MK 1YNNA 3FKIK 4G7ZA 3RZOC 4BXXC 5IYBC 4KMUA 2WAQD 3S1NK 5IP9K 3I4NK 1TWAC 3GTQK 5C4JC 2PPBA 2B63K 3S1QK 3S16K 3HOWK 3PO2K 4MEYA 1TWHC 2NVYC 3HOVC 3K7AC 3GTLK 2PA8L 4QJVB 1HQMA 4A3EK 4YFNA 3HOXK 4XSZA 4YG2A 3RZDK 1Y1VK 1Y1WK 3M4OC 4A3GC 1I3QK 4YFXA 5M5XK 4BY7C 4BBSK 4MEXA 2VUMK 1I50C 3GTGK 3GTJK 4A3CK 3GTMK 2R7ZK 3S2DK 1I6HK 2JA8C 4X6AK 4A3DK 3CQZK 3H0GC 4A93C 2A6EA 2JA7K 4JK1A 4QJVA 1ZYRA 3GTKK 2PA8D 2JA5K 4OINA 2NVTC 3HOYC 4A3JK 2E2JK 3M3YC 3PO3K 3HKZL 3GTPK 3HOZC 2PMZL 5C3EC 4A3LC 4AYBL 1WCMC 2E2HK 4BY1K 2E2IK 2R92K 4LK0A 1I6VA 3S1MC 4OIRA 4Y7NC 3EQLA 2JA6C 4A3FC 4Y52K 2NVXK 1TWFC 1SMYA 2A69A 4C3JK 3I4MK 2CW0A 4YFKA 4A3BC 2A6HA 4BXXK 3RZOK 4A3MC 1TWCC 5IYBK 5IP7K 2Y0SL 1IW7A 1TWGC 4LJZA 4A3IC 5C4JK 1R9TC 1SFOC 3HKZD 4LK1A 5IYDC 2PMZD 4AYBD 4C3IK 1TWHK 2NVYK 3HOVK 3S2HC 2NVQC 4G7OA 4Q4ZA 4BBRC 1BDFA 3GTOC 2O5JA 4A3KK 1XPPA 5FLMC 4ZH4A 1K83C 3HOUC 3M4OK 4A3GK 3S1RC 2Y0SD 4KN4A 2BE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 K;  5M5W K;  2R93 K;  3S14 K;  2YU9 C;  2JA8 K;  5C4X C;  5C44 C;  3S15 C;  3H0G K;  4A93 K;  5D4D A;  4X6A C;  4XLN A;  5TMF A;  3S17 C;  4A3D C;  3WOD A;  4NOI A;  2NVT K;  5IYC C;  4QIW L;  3HOY K;  4GZY A;  3M3Y K;  3HOZ K;  5C3E K;  4A3L K;  1WCM K;  3FKI C;  3S1M K;  1TWA K;  4Y7N K;  2JA6 K;  2WB1 L;  4A3F K;  5FJ8 K;  1TWF K;  4MQ9 A;  3S1N C;  5IP9 C;  5M3M K;  3I4N C;  4XLP A;  3GTQ C;  5M5Y K;  2B63 C;  4A3B K;  3S1Q C;  4C3H K;  3S16 C;  3HOW C;  3I4M C;  3PO2 C;  3K7A K;  4A3M K;  1TWC K;  1TWG K;  3DXJ A;  4A3I K;  5IP7 C;  1R9T K;  4QIW D;  4A3E C;  1SFO K;  3GTL C;  4G7H A;  3HOX C;  4OIQ A;  5IYD K;  1YNJ A;  3RZD C;  4BY7 K;  1Y1V C;  1Y1W C;  3S2H K;  4KN7 A;  1I3Q C;  2WB1 D;  2NVQ K;  3GTO K;  4BBR K;  3H3V L;  4BBS C;  2A68 A;  4XSX A;  4LLG A;  5FLM K;  2VUM C;  1K83 K;  3GTJ C;  3GTG C;  2R7Z C;  3GTM C;  3HOU K;  3S2D C;  4A3K C;  4A3C C;  4Q5S A;  3CQZ C;  3S1R K;  2WAQ L;  2JA7 C;  5M3F K;  3GTK C;  5TMC A;  2JA5 C;  3PO3 C;  4A3J C;  2E2J C;  2R93 C;  5C4X K;  2YU9 K;  3GTP C;  5C44 K;  1I6H C;  4BY1 C;  2R92 C;  2E2H C;  3S15 K;  2E2I C;  4Y52 C;  4OIP A;  2O5I A;  4OIO A;  3S14 C;  3S17 K;  2NVX C;  3H3V D;  5IYC K;  4C2M K;  1YNN A;  3FKI K;  4G7Z A;  3RZO C;  4BXX C;  5IYB C;  4KMU A;  2WAQ D;  3S1N K;  5IP9 K;  3I4N K;  1TWA C;  3GTQ K;  5C4J C;  2PPB A;  2B63 K;  3S1Q K;  3S16 K;  3HOW K;  3PO2 K;  4MEY A;  1TWH C;  2NVY C;  3HOV C;  3K7A C;  3GTL K;  2PA8 L;  4QJV B;  1HQM A;  4A3E K;  4YFN A;  3HOX K;  4XSZ A;  4YG2 A;  3RZD K;  1Y1V K;  1Y1W K;  3M4O C;  4A3G C;  1I3Q K;  4YFX A;  5M5X K;  4BY7 C;  4BBS K;  4MEX A;  2VUM K;  1I50 C;  3GTG K;  3GTJ K;  4A3C K;  3GTM K;  2R7Z K;  3S2D K;  1I6H K;  2JA8 C;  4X6A K;  4A3D K;  3CQZ K;  3H0G C;  4A93 C;  2A6E A;  2JA7 K;  4JK1 A;  4QJV A;  1ZYR A;  3GTK K;  2PA8 D;  2JA5 K;  4OIN A;  2NVT C;  3HOY C;  4A3J K;  2E2J K;  3M3Y C;  3PO3 K;  3HKZ L;  3GTP K;  3HOZ C;  2PMZ L;  5C3E C;  4A3L C;  4AYB L;  1WCM C;  2E2H K;  4BY1 K;  2E2I K;  2R92 K;  4LK0 A;  1I6V A;  3S1M C;  4OIR A;  4Y7N C;  3EQL A;  2JA6 C;  4A3F C;  4Y52 K;  2NVX K;  1TWF C;  1SMY A;  2A69 A;  4C3J K;  3I4M K;  2CW0 A;  4YFK A;  4A3B C;  2A6H A;  4BXX K;  3RZO K;  4A3M C;  1TWC C;  5IYB K;  5IP7 K;  2Y0S L;  1IW7 A;  1TWG C;  4LJZ A;  4A3I C;  5C4J K;  1R9T C;  1SFO C;  3HKZ D;  4LK1 A;  5IYD C;  2PMZ D;  4AYB D;  4C3I K;  1TWH K;  2NVY K;  3HOV K;  3S2H C;  2NVQ C;  4G7O A;  4Q4Z A;  4BBR C;  1BDF A;  3GTO C;  2O5J A;  4A3K K;  1XPP A;  5FLM C;  4ZH4 A;  1K83 C;  3HOU C;  3M4O K;  4A3G K;  3S1R C;  2Y0S D;  4KN4 A;  2BE5 A; 
#chains in the Genus database with same CATH topology
 3AD9 C;  1VH2 A;  5CHP A;  5M5W K;  1R9T A;  2JA8 K;  4O2D A;  5C4X C;  5C44 C;  4FZB A;  1WOR A;  4A3D C;  4NOI A;  4GZY A;  4XCH A;  4C2M C;  5C3E K;  1WCM K;  2ZUF A;  2JA6 K;  3AD7 C;  3S1N C;  3I4N C;  3GEH A;  3AQP A;  5M5Y K;  2B63 C;  3S1Q C;  3S16 C;  3K7A K;  1IQ0 A;  1O27 A;  1TWF A;  5IP7 C;  5IYD K;  3RZD C;  1DD5 A;  3T01 A;  3FKI A;  1I3Q C;  1G51 A;  4LLG A;  2VUM C;  3GTG C;  3GTJ C;  2R7Z C;  1EI6 A;  4A3K C;  3GTO A;  2GSN A;  1XXA A;  2JA5 C;  2E2J C;  4AH6 A;  3GTP C;  1I6H C;  1XZP B;  4OIP A;  2O5I A;  3S17 K;  3IPJ A;  2NVX C;  5IYC K;  4C3J C;  1YNN A;  3OEP A;  2YU9 A;  1BGW A;  5EGE A;  4KMU A;  5IP9 K;  1TWA C;  5C4J C;  1VJE A;  1XXC A;  4MEY A;  1PJ5 A;  3GDZ A;  2W7V A;  4KC6 A;  4BKW A;  1IE0 A;  3GTL K;  2PA8 L;  3GEI A;  1Y1V K;  1Y1W K;  4A3G C;  1ZBS A;  3ORE A;  4BY7 C;  4GTC A;  1F9N A;  4A3C K;  3GTM K;  2JA8 C;  1J6X A;  4A3D K;  3CQZ K;  2NVY A;  2JH3 A;  1ZYR A;  3GTK K;  2R93 K;  5C3E C;  1USO A;  1WCM C;  2GAG C;  3GSI A;  2JA6 C;  3SZY A;  1XZQ B;  1ISE A;  1I50 A;  3RZO K;  3GEE A;  1IBA A;  2ZFZ A;  5IP7 K;  5IYB K;  1PJ7 A;  1EFW A;  1O29 A;  1B4B A;  3HKZ D;  5IYD C;  1TWH K;  3HOV K;  2GSO A;  2O5J A;  4A3K K;  1XPP A;  1JVI A;  4GFQ A;  1GE9 A;  4LQY A;  1J6V A;  3CAG A;  4A93 K;  1X31 C;  4X6A C;  4XLN A;  3S17 C;  3A8J A;  5IYC C;  1L0W A;  4KAS A;  1JOE A;  1TWA K;  2GSU A;  2WB1 L;  4A3F K;  1TWF K;  4MQ9 A;  3N0B A;  5IP9 C;  1ZXO A;  4XLP A;  1YX2 A;  4C3H K;  1J6W A;  4A3M K;  1TWC K;  3TTG A;  4QIW D;  3GTL C;  4KAW X;  4BY7 K;  1Y1V C;  1Y1W C;  1WQH A;  4KN7 A;  1XZP A;  4KAT A;  2NVQ K;  3GTO K;  3H3V L;  1DCH A;  4A3C C;  4GTE A;  3GTM C;  2B63 A;  1O25 A;  1IL2 A;  3CQZ C;  3S1R K;  1B4A A;  5M3F K;  1KQ4 A;  1DCP A;  3GTK C;  1K83 A;  2R93 C;  2YU9 K;  4BLA A;  1C0A A;  4OIO A;  4G0W A;  1WQG A;  5L46 A;  2VUM A;  3GTJ A;  3RZO C;  4KM8 A;  5IYB C;  4GTA A;  2WAQ D;  3GTQ K;  2PPB A;  4KMD A;  3GTP A;  1TWH C;  2KWA A;  3HOV C;  4QJV B;  1HQM A;  2NVX A;  4YFN A;  3VA7 A;  4YFX A;  5M5X K;  4MEX A;  2EBB A;  4X6A K;  1O28 A;  1F7U A;  4A93 C;  2A6E A;  4WIL A;  4KB2 A;  3JST A;  2PMZ L;  4BY1 K;  2E2I K;  4P9S A;  4OIR A;  2JA7 A;  3QX3 A;  4A3F C;  1TWF C;  4KMH A;  4ILD A;  2CW0 A;  5CJ9 A;  2R92 A;  4C3H C;  2E2H A;  4A3M C;  1TWC C;  4M1X A;  2Y0S L;  3NUH A;  4LJZ A;  1HI9 A;  1JQW A;  2RGR A;  4AYB D;  1WCM A;  2NVQ C;  2JA6 A;  4Q4Z A;  3GTO C;  3AQO A;  2XCR B;  5E68 A;  3M4O K;  4FM9 A;  3S1R C;  4GT9 A;  2YU9 C;  3LAP A;  1AB4 A;  3TFI A;  5D4D A;  5TMF A;  3WOD A;  3BUE A;  2NVT K;  3HOY K;  3HOZ K;  4A3L K;  2ZUE A;  1WOO A;  3H0G A;  5FJ8 K;  5M3M K;  1O26 A;  4KAR A;  3GTQ C;  3I4M C;  4A3I K;  1R9T K;  4OIQ A;  1YNJ A;  2CFA B;  2XCQ A;  3S2H K;  1WOP A;  1TWG A;  4BBR K;  1SFO A;  2A68 A;  5FLM K;  1K83 K;  3HOU K;  3BP3 A;  5TMC A;  3GTL A;  3TFH A;  4BY1 C;  3S15 K;  2E2I C;  3ADA C;  3S14 C;  1Y1W A;  4WJ4 A;  4WJ3 M;  5HL8 A;  3FKI K;  4G7Z A;  3GTM A;  3AH5 A;  1XXB A;  3MML B;  3TFJ A;  1RU0 A;  3FOF A;  3GTK A;  2XCO A;  4KM9 A;  3HOW K;  4KDD A;  3PO2 K;  4LOW A;  3FOE A;  4A3E K;  3HOX K;  2V6T A;  4YG2 A;  5EGH A;  3LAJ A;  4GTL A;  3M4O C;  1VRQ C;  3T00 A;  5IOT A;  3G4C A;  4BBS K;  3S2D K;  1USM A;  5IOR A;  1ZVU A;  1I3Q A;  1TWH A;  4JK1 A;  2JA7 K;  2PA8 D;  3PO3 K;  4OIN A;  2NVT C;  4BLB A;  4A3J K;  3HOY C;  3GTG A;  3HKZ L;  3HOZ C;  2R7Z A;  4A3L C;  2R92 K;  2E2H K;  5IOQ A;  1I6V A;  4Y52 K;  4GTD A;  3HXA A;  3A8I A;  2D6F C;  2JA5 A;  3I4M K;  4YFK A;  2PHC B;  4BXX K;  3T02 A;  2FQO A;  4A3I C;  1R9T C;  4DDQ A;  2P8T A;  4C3I K;  2NVY K;  3S2H C;  1J98 A;  1TWA A;  4BBR C;  1BDF A;  1XZQ A;  1WQF A;  5FLM C;  4ZH4 A;  1K83 C;  3HOU C;  1BS2 A;  3BP8 C;  4G0V A;  1TWC A;  4KN4 A;  2Y3P A;  2BE5 A;  3OPF A;  1I50 K;  3S14 K;  3S15 C;  1O2A A;  3H0G K;  1O2F B;  3G4A A;  3V4G A;  1VLO A;  4QIW L;  1V5V A;  3M3Y K;  5IOS A;  3FKI C;  2CFA A;  3GIR A;  3S1M K;  4Y7N K;  3N0C A;  3S0X A;  3A8K A;  4A3B K;  3HOW C;  3PO2 C;  1TWG K;  3DXJ A;  4A3E C;  1SFO K;  4G7H A;  3HOX C;  1DCO A;  1WSV A;  2WB1 D;  4KB4 A;  1WOS A;  4BBS C;  4XSX A;  3N3Y A;  3S2D C;  3GTQ A;  1WSR A;  4Q5S A;  3Q3Q A;  1PJ6 A;  5JVO A;  2WAQ L;  2JA7 C;  3PO3 C;  1INN A;  4A3J C;  5C4X K;  1F93 A;  5C44 K;  2R92 C;  2E2H C;  3L4J A;  4Y52 C;  3H3V D;  4RMF A;  4C2M K;  4BXX C;  3S1N K;  3I4N K;  2V6S A;  2B63 K;  3S1Q K;  3S16 K;  4C3I C;  2NVY C;  2E2I A;  3K7A C;  2P5M A;  4P5B A;  5JFE A;  1UV7 A;  4XSZ A;  3LPX A;  3RZD K;  4LR2 A;  1I3Q K;  5TJ3 A;  1BJT A;  4G0U A;  2VUM K;  3GTG K;  1I50 C;  4GTB A;  3GTJ K;  2R7Z K;  1Y1V A;  2GAH C;  4PAB A;  3H0G C;  1EH1 A;  1EK8 A;  1EQR A;  4QJV A;  4PAA A;  4KMA A;  2JA5 K;  2E2J K;  3M3Y C;  4P5A A;  3GTP K;  1I6H K;  4AYB L;  3CQZ A;  3S1M C;  4LK0 A;  1O2B A;  4Y7N C;  3EQL A;  4J3N A;  3AD8 C;  2NVX K;  1O24 A;  1SMY A;  2A69 A;  4C3J K;  2R93 A;  1IS1 A;  1ZQ1 C;  4A3B C;  1F7V A;  2A6H A;  3ERE D;  2V6U A;  1IW7 A;  1TWG C;  2FQT A;  5C4J K;  1SFO C;  4C45 A;  4LK1 A;  2PMZ D;  1YCL A;  4GTF A;  3L4K A;  4G7O A;  1VGX A;  3SZZ A;  1WIH A;  4A3G K;  3FHZ A;  2RH6 A;  2Y0S D; 
#chains in the Genus database with same CATH homology
 1I50 K;  5M5W K;  2R93 K;  3S14 K;  2YU9 C;  2JA8 K;  5C4X C;  5C44 C;  3S15 C;  3H0G K;  4A93 K;  5D4D A;  4X6A C;  4XLN A;  5TMF A;  3S17 C;  4A3D C;  3WOD A;  4NOI A;  2NVT K;  5IYC C;  4QIW L;  3HOY K;  4GZY A;  3M3Y K;  3HOZ K;  5C3E K;  4A3L K;  1WCM K;  3FKI C;  3S1M K;  1TWA K;  4Y7N K;  2JA6 K;  2WB1 L;  4A3F K;  5FJ8 K;  1TWF K;  4MQ9 A;  3S1N C;  5IP9 C;  5M3M K;  3I4N C;  4XLP A;  3GTQ C;  5M5Y K;  2B63 C;  4A3B K;  3S1Q C;  4C3H K;  3S16 C;  3HOW C;  3I4M C;  3PO2 C;  3K7A K;  4A3M K;  1TWC K;  1TWG K;  3DXJ A;  4A3I K;  5IP7 C;  1R9T K;  4QIW D;  4A3E C;  1SFO K;  3GTL C;  4G7H A;  3HOX C;  4OIQ A;  5IYD K;  1YNJ A;  3RZD C;  4BY7 K;  1Y1V C;  1Y1W C;  3S2H K;  4KN7 A;  1I3Q C;  2WB1 D;  2NVQ K;  3GTO K;  4BBR K;  3H3V L;  4BBS C;  2A68 A;  4XSX A;  4LLG A;  5FLM K;  2VUM C;  1K83 K;  3GTJ C;  3GTG C;  2R7Z C;  3GTM C;  3HOU K;  3S2D C;  4A3K C;  4A3C C;  4Q5S A;  3CQZ C;  3S1R K;  2WAQ L;  2JA7 C;  5M3F K;  3GTK C;  5TMC A;  2JA5 C;  3PO3 C;  4A3J C;  2E2J C;  2R93 C;  5C4X K;  2YU9 K;  3GTP C;  5C44 K;  1I6H C;  4BY1 C;  2R92 C;  2E2H C;  3S15 K;  2E2I C;  4Y52 C;  4OIP A;  2O5I A;  4OIO A;  3S14 C;  3S17 K;  2NVX C;  3H3V D;  5IYC K;  4C2M K;  1YNN A;  3FKI K;  4G7Z A;  3RZO C;  4BXX C;  5IYB C;  4KMU A;  2WAQ D;  3S1N K;  5IP9 K;  3I4N K;  1TWA C;  3GTQ K;  5C4J C;  2PPB A;  2B63 K;  3S1Q K;  3S16 K;  3HOW K;  3PO2 K;  4MEY A;  1TWH C;  2NVY C;  3HOV C;  3K7A C;  3GTL K;  2PA8 L;  4QJV B;  1HQM A;  4A3E K;  4YFN A;  3HOX K;  4XSZ A;  4YG2 A;  3RZD K;  1Y1V K;  1Y1W K;  3M4O C;  4A3G C;  1I3Q K;  4YFX A;  5M5X K;  4BY7 C;  4BBS K;  4MEX A;  2VUM K;  1I50 C;  3GTG K;  3GTJ K;  4A3C K;  3GTM K;  2R7Z K;  3S2D K;  1I6H K;  2JA8 C;  4X6A K;  4A3D K;  3CQZ K;  3H0G C;  4A93 C;  2A6E A;  2JA7 K;  4JK1 A;  4QJV A;  1ZYR A;  3GTK K;  2PA8 D;  2JA5 K;  4OIN A;  2NVT C;  3HOY C;  4A3J K;  2E2J K;  3M3Y C;  3PO3 K;  3HKZ L;  3GTP K;  3HOZ C;  2PMZ L;  5C3E C;  4A3L C;  4AYB L;  1WCM C;  2E2H K;  4BY1 K;  2E2I K;  2R92 K;  4LK0 A;  1I6V A;  3S1M C;  4OIR A;  4Y7N C;  3EQL A;  2JA6 C;  4A3F C;  4Y52 K;  2NVX K;  1TWF C;  1SMY A;  2A69 A;  4C3J K;  3I4M K;  2CW0 A;  4YFK A;  4A3B C;  2A6H A;  4BXX K;  3RZO K;  4A3M C;  1TWC C;  5IYB K;  5IP7 K;  2Y0S L;  1IW7 A;  1TWG C;  4LJZ A;  4A3I C;  5C4J K;  1R9T C;  1SFO C;  3HKZ D;  4LK1 A;  5IYD C;  2PMZ D;  4AYB D;  4C3I K;  1TWH K;  2NVY K;  3HOV K;  3S2H C;  2NVQ C;  4G7O A;  4Q4Z A;  4BBR C;  1BDF A;  3GTO C;  2O5J A;  4A3K K;  1XPP A;  5FLM C;  4ZH4 A;  1K83 C;  3HOU C;  3M4O K;  4A3G K;  3S1R C;  2Y0S D;  4KN4 A;  2BE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...