3M3YK

Rna polymerase ii elongation complex c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m3yK00
1I3QK 5TMFA 2PMZD 4C3IK 3S1NC 3PO2K 3HOXK 1Y1VC 3M4OK 4BY1K 4MEXA 4A93C 3S17K 2VUMK 3M3YC 4YFNA 4AYBL 3HOUC 3HOVC 4Y52C 4MEYA 3HOWK 3S14K 3S1MC 3S1RC 4AYBD 5IP7C 4BY7K 1YNJA 4XSZA 1I50C 3RZDK 4LK1A 4GZYA 5M5XK 4NOIA 4QIWL 4A3IC 4BBRC 2R92C 3S2HC 5C4JK 2JA7K 2NVTC 3S2DC 4XSXA 1R9TK 2JA5C 4QIWD 4BXXC 3S1QC 1WCMC 2A69A 5C4XC 3HKZD 5FLMC 3H0GK 4Q4ZA 3GTMC 2R93K 3GTJC 5M3MK 4A3KK 4QJVA 4A3DC 1TWGK 1ZYRA 1I3QC 3I4MK 2PMZL 4XLPA 3HOXC 2E2JK 3PO2C 2A6EA 4Y7NK 2JA6K 1K83K 5C3EK 3DXJA 1BDFA 4BY1C 3HOZK 3WODA 2VUMC 3GTOK 3S17C 3HOWC 4A3JK 1TWCK 1TWFC 3GTPK 3S14C 5M5WK 4BY7C 5IYCK 3K7AK 4OIOA 1XPPA 4C2MK 3RZDC 2PA8L 5C4JC 2JA7C 3S16K 2WAQD 1R9TC 4OIPA 2YU9K 2PA8D 3CQZK 3I4NK 3S15K 4A3CK 3HKZL 3H0GC 4KN4A 2R93C 2NVQK 2NVYK 2WB1L 4A3KC 1TWGC 3EQLA 2E2IK 1HQMA 1I6VA 2A68A 1Y1WK 3GTQK 2A6HA 3I4MC 3FKIK 2R7ZK 5IYDK 2WB1D 2E2JC 2NVXK 4YFKA 4YG2A 4LJZA 2O5IA 1K83C 5C3EC 2JA6C 3GTLK 3HOYK 3HOZC 3PO3K 2O5JA 3GTOC 2BE5A 4OINA 2PPBA 4A3GK 3S1NK 2B63K 4A3JC 5TMCA 1TWCC 4QJVB 3GTPC 4A3LK 5IYBK 3M3YK 5IYCC 4X6AK 2E2HK 1TWAK 3S16C 2WAQL 4A3FK 1SFOK 3RZOK 3CQZC 3I4NC 3S15C 4A3CC 2Y0SL 4A3IK 5C44K 4A3MK 4LLGA 2NVQC 4A3BK 4C3HK 2NVYC 1TWHK 4XLNA 3GTGK 2Y0SD 2E2IC 2R7ZC 3GTQC 4ZH4A 3FKIC 2NVXC 2JA8K 4OIRA 3GTLC 3HOYC 4C3JK 3GTKK 2CW0A 4G7HA 4Y7NC 4A3GC 5IP9K 4A3EK 2B63C 4BBSK 4A3LC 4KN7A 1I6HK 5IYBC 4MQ9A 1Y1VK 1SMYA 5D4DA 4X6AC 2E2HC 4KMUA 1TWAC 5M5YK 4A93K 3K7AC 1TWFK 4OIQA 1SFOC 4A3FC 4LK0A 5M3FK 3RZOC 3HOUK 3HOVK 4G7OA 3H3VL 4A3MC 4Y52K 5C44C 4JK1A 2YU9C 3S1RK 3S1MK 5IP7K 4A3BC 1TWHC 1IW7A 1I50K 3GTGC 3H3VD 4Q5SA 4BBRK 2R92K 1YNNA 2NVTK 3S2HK 3S2DK 2JA8C 2JA5K 1Y1WC 4BXXK 5C4XK 1WCMK 5IYDC 5FJ8K 3M4OC 3S1QK 5FLMK 3GTKC 4G7ZA 5IP9C 3GTMK 3GTJK 4A3EC 3PO3C 4BBSC 4YFXA 4A3DK 1I6HC
chains in the Genus database with same CATH superfamily
3S0XA 2R92A 1RU0A 3BUEA 1WQFA 4MEXA 4A93C 5EGHA 2VUMK 3HOWK 1IS1A 3S1MC 2P8TA 4PAAA 1I50C 1I3QA 5M5XK 4NOIA 3S2DC 2JA7K 2JA5C 4BXXC 2A69A 1O28A 3HKZD 2EBBA 3T01A 5M3MK 3FHZA 4QJVA 1ZYRA 4XLPA 3G4CA 2E2JK 2W7VA 1R9TA 3DXJA 3HOZK 2VUMC 3GTOK 1F7VA 2R93A 3HOWC 4A3JK 1TWGA 2PHCB 4P5AA 3K7AK 3OPFA 1O26A 2JA6A 2ZUFA 3CAGA 1K83A 2JA7C 1AB4A 2PA8D 3OREA 4RMFA 2NVQK 2FQOA 2V6SA 1EI6A 3GIRA 1KQ4A 3EQLA 2R7ZK 1I6VA 2WB1D 2E2JC 4LJZA 3GTLK 3AD8C 3HOZC 3GTOC 5L46A 3ERED 4AH6A 1XZPA 2B63K 4A3JC 5TMCA 1ZVUA 4QJVB 2E2IA 4BLAA 1WORA 3FKIA 2NVXA 2E2HK 1J98A 5E68A 5JVOA 1HI9A 2CFAA 1WOOA 4LLGA 1J6VA 4C45A 4C3HK 4BLBA 2NVQC 4A3BK 2R7ZC 3GTLC 4C3JK 1XZQA 1BGWA 2B63C 4BBSK 1TWHA 5D4DA 1SMYA 3A8KA 2E2HC 5M5YK 4LK0A 5M3FK 1VLOA 4G7OA 1XZPB 3H3VL 4A3BC 1DCHA 1Y1VA 2R92K 3S2HK 3L4KA 1Y1WC 5C4XK 3S1QK 4KDDA 2CFAB 3PO3C 4BBSC 4YFXA 1I3QK 5TMFA 3AQPA 3ADAC 4FZBA 1XZQB 4YFNA 5HL8A 1JQWA 4MEYA 1O2BA 4AYBD 3RZDK 4LK1A 4GZYA 4KMHA 2R92C 1WQGA 4LOWA 5C4JK 3S2HC 1R9TK 4QIWD 3S1QC 5C4XC 4XCHA 4Q4ZA 2R93K 1TWGK 2V6TA 1I3QC 3SZYA 1O27A 2JA6K 1K83K 5C3EK 1YCLA 3WODA 1ZBSA 1IBAA 3H0GA 1TWFC 3N3YA 4OIOA 4C2MK 3RZDC 5C4JC 1WSVA 1R9TC 2YU9K 5CJ9A 3S15K 4WJ4A 1TWCA 3GTPA 2R93C 1TWGC 2E2IK 1HQMA 3QX3A 4PABA 5TJ3A 1IL2A 3FKIK 2NVXK 2JA6C 1K83C 5C3EC 3HOYK 1EQRA 4A3GK 3TFJA 3S1NK 2NVYA 4LR2A 2V6UA 3TFIA 3M3YK 3GTQA 4M1XA 4KM8A 1USOA 3SZZA 3S15C 2Y0SL 4A3IK 5C44K 4A3MK 4ILDA 1TWHK 2E2IC 3FKIC 1JOEA 4GTAA 4KASA 2NVXC 4OIRA 1SFOA 3HOYC 3BP3A 4A3GC 2YU9A 2GSNA 3GTGA 4KMDA 3FOEA 1Y1VK 4KMUA 3K7AC 4Y52K 4A3MC 5C44C 4JK1A 5IP7K 1TWHC 4Q5SA 4GTBA 1F93A 1YNNA 3LAJA 5FJ8K 1WOPA 3AD7C 4GFQA 3FOFA 3LAPA 1F7UA 4A3DK 4KARA 1EH1A 4G0VA 3PO2K 1Y1VC 4J3NA 3M4OK 3NUHA 1WCMA 1VJEA 1O2AA 4P9SA 5IOTA 2KWAA 4G0WA 3GTMA 3GTJA 4Y52C 3S14K 5IP7C 1YNJA 4XSZA 2Y3PA 5EGEA 4GTDA 3A8IA 1L0WA 4C3HC 4XSXA 4KMAA 3HXAA 2D6FC 1IE0A 4G0UA 3H0GK 4KB2A 4C3JC 4A3DC 4KAWX 2PMZL 3PO2C 2A6EA 4Y7NK 3M4OC 3GSIA 3GEIA 2XCQA 1TWCK 3GTPK 3S14C 1XXBA 4WJ3M 1XPPA 2PA8L 4OIPA 3JSTA 1WSRA 3H0GC 4KN4A 2NVYK 2WB1L 3N0BA 3GTQK 5IYDK 4YFKA 1BS2A 2GAGC 3CQZA 1USMA 2BE5A 3OEPA 4P5BA 3A8JA 3AH5A 1C0AA 2GSOA 1TWCC 3GTPC 3MMLB 1XXCA 4KM9A 4X6AK 1O25A 2WAQL 4A3FK 1SFOK 3AQOA 3TTGA 3GDZA 2NVYC 4XLNA 3GTGK 2GAHC 3GTQC 4ZH4A 1J6WA 1TWAA 1X31C 1BJTA 1WIHA 1O24A 2ZUEA 2CW0A 4G7HA 5IP9K 4A3EK 1B4BA 4LQYA 1I6HK 3VA7A 4X6AC 1ISEA 1J6XA 4C2MC 5IOSA 4A3FC 1SFOC 4OIQA 3GTKA 3HOUK 3HOVK 3T00A 2YU9C 3S1RK 1G51A 1IW7A 4GT9A 3GTGC 3H3VD 4BBRK 2NVTK 1TWFA 4GTFA 1PJ5A 1WCMK 3T02A 4KB4A 3V4GA 5FLMK 5IP9C 3GTMK 3GTJK 4A3EC 1I50A 1I6HC 4C3IK 2PMZD 3S1NC 3HOXK 4BY1K 2JA5A 3S17K 3M3YC 4KC6A 4AYBL 3HOUC 3HOVC 3TFHA 2P5MA 3S1RC 3LPXA 1IQ0A 1B4AA 4BY7K 4KATA 4A3IC 4QIWL 4DDQA 4GTCA 4BBRC 2NVTC 2VUMA 1WCMC 1DCOA 1JVIA 3N0CA 5FLMC 3GTMC 3GTJC 4A3KK 1V5VA 4C3IC 3I4MK 3L4JA 2XCOA 4BKWA 3HOXC 2JA7A 4BY1C 1BDFA 3S17C 4GTLA 3BP8C 1INNA 5M5WK 4BY7C 5IYCK 3GEHA 3S16K 2WAQD 3GTOA 4O2DA 3CQZK 1PJ7A 3IPJA 3I4NK 4A3CK 3HKZL 4A3KC 1YX2A 1ZQ1C 2A68A 1Y1WK 2A6HA 3I4MC 4GTEA 4YG2A 1ZXOA 2O5IA 2O5JA 3PO3K 1EK8A 1XXAA 2RGRA 2PPBA 4OINA 2RH6A 4FM9A 3AD9C 1VGXA 1VH2A 4A3LK 5IYBK 2R7ZA 5IYCC 1EFWA 5IORA 1TWAK 3G4AA 3GTLA 3S16C 2JH3A 2XCRB 2GSUA 3RZOK 3CQZC 3I4NC 4A3CC 2B63A 2Y0SD 1O29A 3Q3QA 2E2HA 1GE9A 3GEEA 2JA8K 1VRQC 5JFEA 3GTKK 4Y7NC 1WOSA 1DD5A 4A3LC 4KN7A 5IYBC 4MQ9A 1UV7A 1TWAC 4A93K 1Y1WA 1TWFK 1O2FB 1DCPA 3RZOC 1WQHA 1F9NA 3S1MK 1I50K 5IOQA 3S2DK 2JA8C 2FQTA 2JA5K 4BXXK 2ZFZA 5IYDC 3GTKC 4WILA 4G7ZA 1PJ6A 5CHPA
chains in the Genus database with same CATH topology
1I3QK 5TMFA 2PMZD 4C3IK 3S1NC 3PO2K 3HOXK 1Y1VC 3M4OK 4BY1K 4MEXA 4A93C 3S17K 2VUMK 3M3YC 4YFNA 4AYBL 3HOUC 3HOVC 4Y52C 4MEYA 3HOWK 3S14K 3S1MC 3S1RC 4AYBD 5IP7C 4BY7K 1YNJA 4XSZA 1I50C 3RZDK 4LK1A 4GZYA 5M5XK 4NOIA 4QIWL 4A3IC 4BBRC 2R92C 3S2HC 5C4JK 2JA7K 2NVTC 3S2DC 4XSXA 1R9TK 2JA5C 4QIWD 4BXXC 3S1QC 1WCMC 2A69A 5C4XC 3HKZD 5FLMC 3H0GK 4Q4ZA 3GTMC 2R93K 3GTJC 5M3MK 4A3KK 4QJVA 4A3DC 1TWGK 1ZYRA 1I3QC 3I4MK 2PMZL 4XLPA 3HOXC 2E2JK 3PO2C 2A6EA 4Y7NK 2JA6K 1K83K 5C3EK 3DXJA 1BDFA 4BY1C 3HOZK 3WODA 2VUMC 3GTOK 3S17C 3HOWC 4A3JK 1TWCK 1TWFC 3GTPK 3S14C 5M5WK 4BY7C 5IYCK 3K7AK 4OIOA 1XPPA 4C2MK 3RZDC 2PA8L 5C4JC 2JA7C 3S16K 2WAQD 1R9TC 4OIPA 2YU9K 2PA8D 3CQZK 3I4NK 3S15K 4A3CK 3HKZL 3H0GC 4KN4A 2R93C 2NVQK 2NVYK 2WB1L 4A3KC 1TWGC 3EQLA 2E2IK 1HQMA 1I6VA 2A68A 1Y1WK 3GTQK 2A6HA 3I4MC 3FKIK 2R7ZK 5IYDK 2WB1D 2E2JC 2NVXK 4YFKA 4YG2A 4LJZA 2O5IA 1K83C 5C3EC 2JA6C 3GTLK 3HOYK 3HOZC 3PO3K 2O5JA 3GTOC 2BE5A 4OINA 2PPBA 4A3GK 3S1NK 2B63K 4A3JC 5TMCA 1TWCC 4QJVB 3GTPC 4A3LK 5IYBK 3M3YK 5IYCC 4X6AK 2E2HK 1TWAK 3S16C 2WAQL 4A3FK 1SFOK 3RZOK 3CQZC 3I4NC 3S15C 4A3CC 2Y0SL 4A3IK 5C44K 4A3MK 4LLGA 2NVQC 4A3BK 4C3HK 2NVYC 1TWHK 4XLNA 3GTGK 2Y0SD 2E2IC 2R7ZC 3GTQC 4ZH4A 3FKIC 2NVXC 2JA8K 4OIRA 3GTLC 3HOYC 4C3JK 3GTKK 2CW0A 4G7HA 4Y7NC 4A3GC 5IP9K 4A3EK 2B63C 4BBSK 4A3LC 4KN7A 1I6HK 5IYBC 4MQ9A 1Y1VK 1SMYA 5D4DA 4X6AC 2E2HC 4KMUA 1TWAC 5M5YK 4A93K 3K7AC 1TWFK 4OIQA 1SFOC 4A3FC 4LK0A 5M3FK 3RZOC 3HOUK 3HOVK 4G7OA 3H3VL 4A3MC 4Y52K 5C44C 4JK1A 2YU9C 3S1RK 3S1MK 5IP7K 4A3BC 1TWHC 1IW7A 1I50K 3GTGC 3H3VD 4Q5SA 4BBRK 2R92K 1YNNA 2NVTK 3S2HK 3S2DK 2JA8C 2JA5K 1Y1WC 4BXXK 5C4XK 1WCMK 5IYDC 5FJ8K 3M4OC 3S1QK 5FLMK 3GTKC 4G7ZA 5IP9C 3GTMK 3GTJK 4A3EC 3PO3C 4BBSC 4YFXA 4A3DK 1I6HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q K;  5TMF A;  2PMZ D;  4C3I K;  3S1N C;  3PO2 K;  3HOX K;  1Y1V C;  3M4O K;  4BY1 K;  4MEX A;  4A93 C;  3S17 K;  2VUM K;  3M3Y C;  4YFN A;  4AYB L;  3HOU C;  3HOV C;  4Y52 C;  4MEY A;  3HOW K;  3S14 K;  3S1M C;  3S1R C;  4AYB D;  5IP7 C;  4BY7 K;  1YNJ A;  4XSZ A;  1I50 C;  3RZD K;  4LK1 A;  4GZY A;  5M5X K;  4NOI A;  4QIW L;  4A3I C;  4BBR C;  2R92 C;  3S2H C;  5C4J K;  2JA7 K;  2NVT C;  3S2D C;  4XSX A;  1R9T K;  2JA5 C;  4QIW D;  4BXX C;  3S1Q C;  1WCM C;  2A69 A;  5C4X C;  3HKZ D;  5FLM C;  3H0G K;  4Q4Z A;  3GTM C;  2R93 K;  3GTJ C;  5M3M K;  4A3K K;  4QJV A;  4A3D C;  1TWG K;  1ZYR A;  1I3Q C;  3I4M K;  2PMZ L;  4XLP A;  3HOX C;  2E2J K;  3PO2 C;  2A6E A;  4Y7N K;  2JA6 K;  1K83 K;  5C3E K;  3DXJ A;  1BDF A;  4BY1 C;  3HOZ K;  3WOD A;  2VUM C;  3GTO K;  3S17 C;  3HOW C;  4A3J K;  1TWC K;  1TWF C;  3GTP K;  3S14 C;  5M5W K;  4BY7 C;  5IYC K;  3K7A K;  4OIO A;  1XPP A;  4C2M K;  3RZD C;  2PA8 L;  5C4J C;  2JA7 C;  3S16 K;  2WAQ D;  1R9T C;  4OIP A;  2YU9 K;  2PA8 D;  3CQZ K;  3I4N K;  3S15 K;  4A3C K;  3HKZ L;  3H0G C;  4KN4 A;  2R93 C;  2NVQ K;  2NVY K;  2WB1 L;  4A3K C;  1TWG C;  3EQL A;  2E2I K;  1HQM A;  1I6V A;  2A68 A;  1Y1W K;  3GTQ K;  2A6H A;  3I4M C;  3FKI K;  2R7Z K;  5IYD K;  2WB1 D;  2E2J C;  2NVX K;  4YFK A;  4YG2 A;  4LJZ A;  2O5I A;  1K83 C;  5C3E C;  2JA6 C;  3GTL K;  3HOY K;  3HOZ C;  3PO3 K;  2O5J A;  3GTO C;  2BE5 A;  4OIN A;  2PPB A;  4A3G K;  3S1N K;  2B63 K;  4A3J C;  5TMC A;  1TWC C;  4QJV B;  3GTP C;  4A3L K;  5IYB K;  3M3Y K;  5IYC C;  4X6A K;  2E2H K;  1TWA K;  3S16 C;  2WAQ L;  4A3F K;  1SFO K;  3RZO K;  3CQZ C;  3I4N C;  3S15 C;  4A3C C;  2Y0S L;  4A3I K;  5C44 K;  4A3M K;  4LLG A;  2NVQ C;  4A3B K;  4C3H K;  2NVY C;  1TWH K;  4XLN A;  3GTG K;  2Y0S D;  2E2I C;  2R7Z C;  3GTQ C;  4ZH4 A;  3FKI C;  2NVX C;  2JA8 K;  4OIR A;  3GTL C;  3HOY C;  4C3J K;  3GTK K;  2CW0 A;  4G7H A;  4Y7N C;  4A3G C;  5IP9 K;  4A3E K;  2B63 C;  4BBS K;  4A3L C;  4KN7 A;  1I6H K;  5IYB C;  4MQ9 A;  1Y1V K;  1SMY A;  5D4D A;  4X6A C;  2E2H C;  4KMU A;  1TWA C;  5M5Y K;  4A93 K;  3K7A C;  1TWF K;  4OIQ A;  1SFO C;  4A3F C;  4LK0 A;  5M3F K;  3RZO C;  3HOU K;  3HOV K;  4G7O A;  3H3V L;  4A3M C;  4Y52 K;  5C44 C;  4JK1 A;  2YU9 C;  3S1R K;  3S1M K;  5IP7 K;  4A3B C;  1TWH C;  1IW7 A;  1I50 K;  3GTG C;  3H3V D;  4Q5S A;  4BBR K;  2R92 K;  1YNN A;  2NVT K;  3S2H K;  3S2D K;  2JA8 C;  2JA5 K;  1Y1W C;  4BXX K;  5C4X K;  1WCM K;  5IYD C;  5FJ8 K;  3M4O C;  3S1Q K;  5FLM K;  3GTK C;  4G7Z A;  5IP9 C;  3GTM K;  3GTJ K;  4A3E C;  3PO3 C;  4BBS C;  4YFX A;  4A3D K;  1I6H C; 
#chains in the Genus database with same CATH topology
 3S0X A;  2R92 A;  1RU0 A;  3BUE A;  1WQF A;  4MEX A;  4A93 C;  5EGH A;  2VUM K;  3HOW K;  1IS1 A;  3S1M C;  2P8T A;  4PAA A;  1I50 C;  1I3Q A;  5M5X K;  4NOI A;  3S2D C;  2JA7 K;  2JA5 C;  4BXX C;  2A69 A;  1O28 A;  3HKZ D;  2EBB A;  3T01 A;  5M3M K;  3FHZ A;  4QJV A;  1ZYR A;  4XLP A;  3G4C A;  2E2J K;  2W7V A;  1R9T A;  3DXJ A;  3HOZ K;  2VUM C;  3GTO K;  1F7V A;  2R93 A;  3HOW C;  4A3J K;  1TWG A;  2PHC B;  4P5A A;  3K7A K;  3OPF A;  1O26 A;  2JA6 A;  2ZUF A;  3CAG A;  1K83 A;  2JA7 C;  1AB4 A;  2PA8 D;  3ORE A;  4RMF A;  2NVQ K;  2FQO A;  2V6S A;  1EI6 A;  3GIR A;  1KQ4 A;  3EQL A;  2R7Z K;  1I6V A;  2WB1 D;  2E2J C;  4LJZ A;  3GTL K;  3AD8 C;  3HOZ C;  3GTO C;  5L46 A;  3ERE D;  4AH6 A;  1XZP A;  2B63 K;  4A3J C;  5TMC A;  1ZVU A;  4QJV B;  2E2I A;  4BLA A;  1WOR A;  3FKI A;  2NVX A;  2E2H K;  1J98 A;  5E68 A;  5JVO A;  1HI9 A;  2CFA A;  1WOO A;  4LLG A;  1J6V A;  4C45 A;  4C3H K;  4BLB A;  2NVQ C;  4A3B K;  2R7Z C;  3GTL C;  4C3J K;  1XZQ A;  1BGW A;  2B63 C;  4BBS K;  1TWH A;  5D4D A;  1SMY A;  3A8K A;  2E2H C;  5M5Y K;  4LK0 A;  5M3F K;  1VLO A;  4G7O A;  1XZP B;  3H3V L;  4A3B C;  1DCH A;  1Y1V A;  2R92 K;  3S2H K;  3L4K A;  1Y1W C;  5C4X K;  3S1Q K;  4KDD A;  2CFA B;  3PO3 C;  4BBS C;  4YFX A;  1I3Q K;  5TMF A;  3AQP A;  3ADA C;  4FZB A;  1XZQ B;  4YFN A;  5HL8 A;  1JQW A;  4MEY A;  1O2B A;  4AYB D;  3RZD K;  4LK1 A;  4GZY A;  4KMH A;  2R92 C;  1WQG A;  4LOW A;  5C4J K;  3S2H C;  1R9T K;  4QIW D;  3S1Q C;  5C4X C;  4XCH A;  4Q4Z A;  2R93 K;  1TWG K;  2V6T A;  1I3Q C;  3SZY A;  1O27 A;  2JA6 K;  1K83 K;  5C3E K;  1YCL A;  3WOD A;  1ZBS A;  1IBA A;  3H0G A;  1TWF C;  3N3Y A;  4OIO A;  4C2M K;  3RZD C;  5C4J C;  1WSV A;  1R9T C;  2YU9 K;  5CJ9 A;  3S15 K;  4WJ4 A;  1TWC A;  3GTP A;  2R93 C;  1TWG C;  2E2I K;  1HQM A;  3QX3 A;  4PAB A;  5TJ3 A;  1IL2 A;  3FKI K;  2NVX K;  2JA6 C;  1K83 C;  5C3E C;  3HOY K;  1EQR A;  4A3G K;  3TFJ A;  3S1N K;  2NVY A;  4LR2 A;  2V6U A;  3TFI A;  3M3Y K;  3GTQ A;  4M1X A;  4KM8 A;  1USO A;  3SZZ A;  3S15 C;  2Y0S L;  4A3I K;  5C44 K;  4A3M K;  4ILD A;  1TWH K;  2E2I C;  3FKI C;  1JOE A;  4GTA A;  4KAS A;  2NVX C;  4OIR A;  1SFO A;  3HOY C;  3BP3 A;  4A3G C;  2YU9 A;  2GSN A;  3GTG A;  4KMD A;  3FOE A;  1Y1V K;  4KMU A;  3K7A C;  4Y52 K;  4A3M C;  5C44 C;  4JK1 A;  5IP7 K;  1TWH C;  4Q5S A;  4GTB A;  1F93 A;  1YNN A;  3LAJ A;  5FJ8 K;  1WOP A;  3AD7 C;  4GFQ A;  3FOF A;  3LAP A;  1F7U A;  4A3D K;  4KAR A;  1EH1 A;  4G0V A;  3PO2 K;  1Y1V C;  4J3N A;  3M4O K;  3NUH A;  1WCM A;  1VJE A;  1O2A A;  4P9S A;  5IOT A;  2KWA A;  4G0W A;  3GTM A;  3GTJ A;  4Y52 C;  3S14 K;  5IP7 C;  1YNJ A;  4XSZ A;  2Y3P A;  5EGE A;  4GTD A;  3A8I A;  1L0W A;  4C3H C;  4XSX A;  4KMA A;  3HXA A;  2D6F C;  1IE0 A;  4G0U A;  3H0G K;  4KB2 A;  4C3J C;  4A3D C;  4KAW X;  2PMZ L;  3PO2 C;  2A6E A;  4Y7N K;  3M4O C;  3GSI A;  3GEI A;  2XCQ A;  1TWC K;  3GTP K;  3S14 C;  1XXB A;  4WJ3 M;  1XPP A;  2PA8 L;  4OIP A;  3JST A;  1WSR A;  3H0G C;  4KN4 A;  2NVY K;  2WB1 L;  3N0B A;  3GTQ K;  5IYD K;  4YFK A;  1BS2 A;  2GAG C;  3CQZ A;  1USM A;  2BE5 A;  3OEP A;  4P5B A;  3A8J A;  3AH5 A;  1C0A A;  2GSO A;  1TWC C;  3GTP C;  3MML B;  1XXC A;  4KM9 A;  4X6A K;  1O25 A;  2WAQ L;  4A3F K;  1SFO K;  3AQO A;  3TTG A;  3GDZ A;  2NVY C;  4XLN A;  3GTG K;  2GAH C;  3GTQ C;  4ZH4 A;  1J6W A;  1TWA A;  1X31 C;  1BJT A;  1WIH A;  1O24 A;  2ZUE A;  2CW0 A;  4G7H A;  5IP9 K;  4A3E K;  1B4B A;  4LQY A;  1I6H K;  3VA7 A;  4X6A C;  1ISE A;  1J6X A;  4C2M C;  5IOS A;  4A3F C;  1SFO C;  4OIQ A;  3GTK A;  3HOU K;  3HOV K;  3T00 A;  2YU9 C;  3S1R K;  1G51 A;  1IW7 A;  4GT9 A;  3GTG C;  3H3V D;  4BBR K;  2NVT K;  1TWF A;  4GTF A;  1PJ5 A;  1WCM K;  3T02 A;  4KB4 A;  3V4G A;  5FLM K;  5IP9 C;  3GTM K;  3GTJ K;  4A3E C;  1I50 A;  1I6H C;  4C3I K;  2PMZ D;  3S1N C;  3HOX K;  4BY1 K;  2JA5 A;  3S17 K;  3M3Y C;  4KC6 A;  4AYB L;  3HOU C;  3HOV C;  3TFH A;  2P5M A;  3S1R C;  3LPX A;  1IQ0 A;  1B4A A;  4BY7 K;  4KAT A;  4A3I C;  4QIW L;  4DDQ A;  4GTC A;  4BBR C;  2NVT C;  2VUM A;  1WCM C;  1DCO A;  1JVI A;  3N0C A;  5FLM C;  3GTM C;  3GTJ C;  4A3K K;  1V5V A;  4C3I C;  3I4M K;  3L4J A;  2XCO A;  4BKW A;  3HOX C;  2JA7 A;  4BY1 C;  1BDF A;  3S17 C;  4GTL A;  3BP8 C;  1INN A;  5M5W K;  4BY7 C;  5IYC K;  3GEH A;  3S16 K;  2WAQ D;  3GTO A;  4O2D A;  3CQZ K;  1PJ7 A;  3IPJ A;  3I4N K;  4A3C K;  3HKZ L;  4A3K C;  1YX2 A;  1ZQ1 C;  2A68 A;  1Y1W K;  2A6H A;  3I4M C;  4GTE A;  4YG2 A;  1ZXO A;  2O5I A;  2O5J A;  3PO3 K;  1EK8 A;  1XXA A;  2RGR A;  2PPB A;  4OIN A;  2RH6 A;  4FM9 A;  3AD9 C;  1VGX A;  1VH2 A;  4A3L K;  5IYB K;  2R7Z A;  5IYC C;  1EFW A;  5IOR A;  1TWA K;  3G4A A;  3GTL A;  3S16 C;  2JH3 A;  2XCR B;  2GSU A;  3RZO K;  3CQZ C;  3I4N C;  4A3C C;  2B63 A;  2Y0S D;  1O29 A;  3Q3Q A;  2E2H A;  1GE9 A;  3GEE A;  2JA8 K;  1VRQ C;  5JFE A;  3GTK K;  4Y7N C;  1WOS A;  1DD5 A;  4A3L C;  4KN7 A;  5IYB C;  4MQ9 A;  1UV7 A;  1TWA C;  4A93 K;  1Y1W A;  1TWF K;  1O2F B;  1DCP A;  3RZO C;  1WQH A;  1F9N A;  3S1M K;  1I50 K;  5IOQ A;  3S2D K;  2JA8 C;  2FQT A;  2JA5 K;  4BXX K;  2ZFZ A;  5IYD C;  3GTK C;  4WIL A;  4G7Z A;  1PJ6 A;  5CHP A; 
#chains in the Genus database with same CATH homology
 1I3Q K;  5TMF A;  2PMZ D;  4C3I K;  3S1N C;  3PO2 K;  3HOX K;  1Y1V C;  3M4O K;  4BY1 K;  4MEX A;  4A93 C;  3S17 K;  2VUM K;  3M3Y C;  4YFN A;  4AYB L;  3HOU C;  3HOV C;  4Y52 C;  4MEY A;  3HOW K;  3S14 K;  3S1M C;  3S1R C;  4AYB D;  5IP7 C;  4BY7 K;  1YNJ A;  4XSZ A;  1I50 C;  3RZD K;  4LK1 A;  4GZY A;  5M5X K;  4NOI A;  4QIW L;  4A3I C;  4BBR C;  2R92 C;  3S2H C;  5C4J K;  2JA7 K;  2NVT C;  3S2D C;  4XSX A;  1R9T K;  2JA5 C;  4QIW D;  4BXX C;  3S1Q C;  1WCM C;  2A69 A;  5C4X C;  3HKZ D;  5FLM C;  3H0G K;  4Q4Z A;  3GTM C;  2R93 K;  3GTJ C;  5M3M K;  4A3K K;  4QJV A;  4A3D C;  1TWG K;  1ZYR A;  1I3Q C;  3I4M K;  2PMZ L;  4XLP A;  3HOX C;  2E2J K;  3PO2 C;  2A6E A;  4Y7N K;  2JA6 K;  1K83 K;  5C3E K;  3DXJ A;  1BDF A;  4BY1 C;  3HOZ K;  3WOD A;  2VUM C;  3GTO K;  3S17 C;  3HOW C;  4A3J K;  1TWC K;  1TWF C;  3GTP K;  3S14 C;  5M5W K;  4BY7 C;  5IYC K;  3K7A K;  4OIO A;  1XPP A;  4C2M K;  3RZD C;  2PA8 L;  5C4J C;  2JA7 C;  3S16 K;  2WAQ D;  1R9T C;  4OIP A;  2YU9 K;  2PA8 D;  3CQZ K;  3I4N K;  3S15 K;  4A3C K;  3HKZ L;  3H0G C;  4KN4 A;  2R93 C;  2NVQ K;  2NVY K;  2WB1 L;  4A3K C;  1TWG C;  3EQL A;  2E2I K;  1HQM A;  1I6V A;  2A68 A;  1Y1W K;  3GTQ K;  2A6H A;  3I4M C;  3FKI K;  2R7Z K;  5IYD K;  2WB1 D;  2E2J C;  2NVX K;  4YFK A;  4YG2 A;  4LJZ A;  2O5I A;  1K83 C;  5C3E C;  2JA6 C;  3GTL K;  3HOY K;  3HOZ C;  3PO3 K;  2O5J A;  3GTO C;  2BE5 A;  4OIN A;  2PPB A;  4A3G K;  3S1N K;  2B63 K;  4A3J C;  5TMC A;  1TWC C;  4QJV B;  3GTP C;  4A3L K;  5IYB K;  3M3Y K;  5IYC C;  4X6A K;  2E2H K;  1TWA K;  3S16 C;  2WAQ L;  4A3F K;  1SFO K;  3RZO K;  3CQZ C;  3I4N C;  3S15 C;  4A3C C;  2Y0S L;  4A3I K;  5C44 K;  4A3M K;  4LLG A;  2NVQ C;  4A3B K;  4C3H K;  2NVY C;  1TWH K;  4XLN A;  3GTG K;  2Y0S D;  2E2I C;  2R7Z C;  3GTQ C;  4ZH4 A;  3FKI C;  2NVX C;  2JA8 K;  4OIR A;  3GTL C;  3HOY C;  4C3J K;  3GTK K;  2CW0 A;  4G7H A;  4Y7N C;  4A3G C;  5IP9 K;  4A3E K;  2B63 C;  4BBS K;  4A3L C;  4KN7 A;  1I6H K;  5IYB C;  4MQ9 A;  1Y1V K;  1SMY A;  5D4D A;  4X6A C;  2E2H C;  4KMU A;  1TWA C;  5M5Y K;  4A93 K;  3K7A C;  1TWF K;  4OIQ A;  1SFO C;  4A3F C;  4LK0 A;  5M3F K;  3RZO C;  3HOU K;  3HOV K;  4G7O A;  3H3V L;  4A3M C;  4Y52 K;  5C44 C;  4JK1 A;  2YU9 C;  3S1R K;  3S1M K;  5IP7 K;  4A3B C;  1TWH C;  1IW7 A;  1I50 K;  3GTG C;  3H3V D;  4Q5S A;  4BBR K;  2R92 K;  1YNN A;  2NVT K;  3S2H K;  3S2D K;  2JA8 C;  2JA5 K;  1Y1W C;  4BXX K;  5C4X K;  1WCM K;  5IYD C;  5FJ8 K;  3M4O C;  3S1Q K;  5FLM K;  3GTK C;  4G7Z A;  5IP9 C;  3GTM K;  3GTJ K;  4A3E C;  3PO3 C;  4BBS C;  4YFX A;  4A3D K;  1I6H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...