2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
3PO3C 3PO2K 5IP9K 4A93C 4C3IK 3FKIC 4G7ZA 2A68A 3H3VD 3S1QC 5TMFA 4Y52K 4A3JC 1WCMK 3HOXC 4NOIA 4BY1K 3S2HK 1BDFA 5C4XK 4Q4ZA 1I6HK 4A3IK 2WB1L 1R9TC 4BBRC 4A3EC 4KN4A 2JA8K 2PPBA 3GTLC 2R92C 3S14K 5M5YK 4KMUA 5D4DA 1TWCK 3M3YC 4A3KC 1TWGK 3S15K 3H0GK 1TWAC 4C3JK 4G7HA 1Y1WC 5IYDC 2E2IK 1YNJA 3HOYC 3GTKC 3M3YK 1Y1VC 4A3LK 4C3HK 4QIWD 1I50C 2NVQC 3CQZC 1TWCC 5IYCC 4A3FC 4OIRA 4MEYA 5M5XK 2PMZD 3GTJK 4OIQA 4LK0A 2R7ZC 4A3LC 1R9TK 1TWHC 2NVTC 3M4OC 2NVQK 4YFKA 3S2DK 4OIOA 4Y52C 1ZYRA 3GTMC 4OINA 3HOYK 1XPPA 5IYDK 3HOZK 2E2IC 2E2JC 3S15C 4A3MC 3EQLA 2JA5K 4XLPA 1I3QK 4GZYA 4A3DC 3K7AC 1IW7A 2JA8C 3S16C 1TWFC 5C44K 2NVXK 3H3VL 1HQMA 4A3BK 3S1NC 3HKZD 1I6HC 2E2HK 5FLMC 4YFNA 3RZDC 4BY1C 2JA6K 3S2HC 2A6HA 1WCMC 2A69A 3GTGC 3HOWC 3GTQK 4BBSC 2JA6C 1TWFK 3PO3K 2O5JA 5IP7C 1I3QC 4A3DK 4XSZA 3HOVC 2WAQD 2JA7C 2R93C 3PO2C 4QJVA 3HOWK 4BBSK 4AYBD 2B63C 2JA5C 5IP7K 3HOZC 2BE5A 5C4JK 1SFOC 3S1MK 3GTQC 4MQ9A 3S1NK 4Q5SA 2VUMK 2R7ZK 3RZDK 3S1RK 4ZH4A 3RZOC 4BXXK 2E2HC 2O5IA 3S17K 4A3GK 3GTOK 4A3BC 3I4NC 1TWHK 2PMZL 2NVTK 3M4OK 3S16K 1K83C 4Y7NK 3K7AK 1Y1VK 2PA8D 5IYBC 5M5WK 2CW0A 2Y0SD 4A3MK 1TWAK 1I50K 3H0GC 1Y1WK 3DXJA 3GTMK 4C2MK 3GTPK 4X6AK 2R92K 4MEXA 1K83K 4LJZA 3WODA 4BBRK 4A3EK 3I4NK 5IYBK 5IYCK 4A3IC 4QJVB 5C4XC 4Y7NC 2WB1D 3GTJC 4OIPA 2WAQL 2PA8L 3HKZL 4LK1A 5TMCA 5FJ8K 4A3FK 3GTKK 3CQZK 4YG2A 4YFXA 1TWGC 3S2DC 1YNNA 3HOXK 3GTPC 4X6AC 2A6EA 3S14C 5C4JC 1SFOK 4G7OA 2JA7K 5M3FK 2R93K 4LLGA 4QIWL 4A3KK 3FKIK 3GTOC 3I4MC 4A93K 5M3MK 3GTLK 2NVYK 4AYBL 4A3CK 2VUMC 4BY7C 4A3JK 3HOVK 3GTGK 3S1MC 3S17C 4A3GC 4XLNA 1I6VA 4KN7A 3S1RC 3RZOK 1SMYA 2Y0SL 5C3EK 2YU9C 3HOUC 4BXXC 4JK1A 2NVYC 4XSXA 5C3EC 2YU9K 5FLMK 3HOUK 4A3CC 3S1QK 4BY7K 3I4MK 2B63K 2NVXC 5C44C 5IP9C 2E2JK
chains in the Genus database with same CATH superfamily
2R7ZA 4GT9A 2A68A 1O2AA 1KQ4A 4KMHA 4BY1K 5IOSA 2WB1L 1R9TC 1Y1VA 4BBRC 3GTQA 1C0AA 5IORA 5M5YK 5D4DA 1BGWA 4KARA 4A3KC 4C3JK 4G7HA 1YNJA 1Y1VC 1O24A 4C3HK 4QIWD 3CQZC 4KB2A 1TWCC 5M5XK 2PMZD 4RMFA 3GTJK 4LK0A 4OIQA 2NVTC 3M4OC 4FM9A 1XZPB 4PABA 4YFKA 1R9TA 3GTMC 4OINA 2W7VA 2E2IC 2E2JC 1WOOA 2GSOA 4GZYA 2JA8C 1DD5A 3H3VL 2GSUA 2E2HK 4KDDA 2JA6K 2A69A 3HOWC 1O2BA 3PO3K 1I3QC 4A3DK 1J6VA 2R93C 3PO2C 1ZBSA 2JA5C 1EI6A 2BE5A 3Q3QA 3A8KA 2VUMK 4BXXK 2O5IA 3S17K 4A3GK 3AH5A 1J98A 1TWHK 3AD8C 2FQTA 1WQGA 2YU9A 1K83C 4KMDA 3K7AK 2PA8D 5IYBC 2CW0A 1Y1WK 1TWAK 1B4AA 1I50K 1PJ5A 2FQOA 3ERED 3GTMK 4X6AK 2R92K 1J6XA 4MEXA 4KM8A 1DCOA 3I4NK 5IYBK 5IYCK 1PJ7A 5C4XC 2WB1D 1ZVUA 4ILDA 2PA8L 4KAWX 3HKZL 3N0BA 5TMCA 2GSNA 5FJ8K 1O2FB 4YFXA 1O25A 1YNNA 3TFIA 4G7OA 3GDZA 2JA7K 5M3FK 4GTEA 4QIWL 4KASA 4A3KK 5EGHA 3I4MC 4A93K 3GTGA 2GAGC 2R92A 2RH6A 4AYBL 3GTLA 1YX2A 4A3JK 3V4GA 1Y1WA 4KC6A 4KN7A 1SMYA 3HOUC 1USMA 1IL2A 4XSXA 2YU9K 1VLOA 5IOQA 2NVXC 3GTKA 3PO3C 4A93C 4C3IK 3H3VD 3S1QC 1XZQB 1IS1A 3HOXC 3T02A 4NOIA 1BDFA 1F7UA 4FZBA 1EH1A 1IBAA 4KN4A 2JA8K 1RU0A 4GTBA 4KMUA 3M3YC 4WILA 1Y1WC 4C3HC 3GTKC 1I50C 2NVQC 3OEPA 5IYCC 4A3FC 5HL8A 2CFAA 1R9TK 1TWHC 3NUHA 4OIOA 1TWFA 5CHPA 4KATA 3AD9C 3IPJA 4A3MC 4WJ3M 2JA5K 2V6TA 4XLPA 3QX3A 3A8JA 1TWFC 3S16C 3HKZD 1I6HC 3GSIA 5FLMC 1JOEA 4YFNA 4G0UA 3GEIA 3GTQK 4P5BA 4GTLA 2O5JA 5IP7C 1EFWA 1G51A 2JA7C 4QJVA 3HOWK 4AYBD 2B63C 4XCHA 1XXBA 5IP7K 5L46A 1SFOC 1XXCA 2CFAB 2R7ZK 4LQYA 4ZH4A 4BKWA 1TWGA 3GTOK 3S16K 2D6FC 4GTDA 3OREA 5M5WK 4C3JC 3DXJA 1VH2A 1K83K 4BBRK 5JFEA 3G4CA 1WSVA 4LOWA 4Y7NC 1SFOA 4LK1A 4A3FK 2B63A 4YG2A 1WORA 1TWGC 5IOTA 3GTPC 2A6EA 5C4JC 1VGXA 4BLAA 4P9SA 1J6WA 3GTOC 3GEHA 4A3CK 3GTPA 5TJ3A 3S1MC 4G0VA 4XLNA 1WOSA 1I6VA 3S1RC 4BLBA 3RZOK 5C3EK 3CAGA 3G4AA 4A3CC 5FLMK 2GAHC 1IE0A 3FOFA 2B63K 2E2JK 2E2IK 5IP9K 3FKIC 3N0CA 5TMFA 4G0WA 3FHZA 3TTGA 1K83A 1BS2A 1WCMK 2XCQA 3BUEA 4Q4ZA 1I6HK 5E68A 4A3EC 3GTLC 1O27A 2PPBA 3S14K 3AD7C 3GEEA 2ZUFA 3GTOA 1TWGK 3H0GK 5IYDC 3HOYC 4A3LK 1I3QA 4OIRA 4MEYA 2JH3A 2R7ZC 3SZYA 2NVQK 1PJ6A 1JQWA 4GTFA 4M1XA 4Y52C 1XPPA 3HOZK 3S0XA 3S15C 3EQLA 3K7AC 1F93A 1B4BA 1IW7A 3ADAC 5C44K 2NVXK 1HQMA 1DCPA 3S1NC 1O29A 2JA5A 1TWCA 3S2HC 3RZDC 4C3IC 4BBSC 1TWFK 2ZFZA 3LAPA 3AQOA 3TFJA 2KWAA 2ZUEA 3T00A 2XCRB 4Q5SA 4MQ9A 3LAJA 3RZDK 2E2HC 2EBBA 2P5MA 2Y0SD 1ZQ1C 1AB4A 3A8IA 4C2MK 3TFHA 2NVYA 4LJZA 3WODA 1F7VA 4A3IC 4QJVB 5JVOA 2V6UA 5EGEA 1ISEA 4OIPA 4C45A 3GTJC 3GTKK 3CQZK 4O2DA 3CQZA 3S2DC 1USOA 3HOXK 4X6AC 4GTAA 4LLGA 3T01A 1O28A 3GTLK 2NVYK 1GE9A 2VUMC 1BJTA 3GTGK 1V5VA 4KMAA 3S17C 4A3GC 3GIRA 4BXXC 2JA7A 3L4JA 2Y0SL 2YU9C 4GTCA 3HOUK 2NVYC 3L4KA 3N3YA 3I4MK 5C44C 5IP9C 1HI9A 3PO2K 2V6SA 4G7ZA 3LPXA 4Y52K 4A3JC 3GTMA 3S2HK 5C4XK 1I50A 1TWAA 4A3IK 1L0WA 4LR2A 2R92C 4J3NA 4C2MC 1TWHA 1TWCK 3S2DK 3S15K 1TWAC 3M3YK 2NVXA 2XCOA 1WSRA 1UV7A 2VUMA 1VJEA 1F9NA 1X31C 4A3LC 1YCLA 1ZXOA 3JSTA 2Y3PA 1DCHA 1ZYRA 3HOYK 5IYDK 2JA6A 2E2HA 1I3QK 4A3DC 2RGRA 1O26A 4AH6A 4PAAA 4A3BK 3H0GA 1IQ0A 4BY1C 2A6HA 1WCMC 3GTGC 4DDQA 2JA6C 3HXAA 4XSZA 3HOVC 2WAQD 1WCMA 3GTJA 3FOEA 4BBSK 1EQRA 3VA7A 3HOZC 5C4JK 3S1NK 3S1MK 3GTQC 2E2IA 3S1RK 3RZOC 2PHCB 4GFQA 4KB4A 4A3BC 2NVTK 2PMZL 3M4OK 3I4NC 3AQPA 4Y7NK 1Y1VK 4A3MK 3H0GC 1XXAA 4P5AA 4WJ4A 3GTPK 3BP3A 2P8TA 3OPFA 4A3EK 1WOPA 2WAQL 5CJ9A 1WQHA 1WQFA 1XZQA 3S14C 1SFOK 2R93K 3FKIK 5M3MK 3SZZA 1VRQC 3BP8C 3MMLB 4BY7C 1JVIA 3HOVK 3FKIA 2R93A 1WIHA 4JK1A 4KM9A 5C3EC 4BY7K 1XZPA 3S1QK 1INNA 1EK8A
chains in the Genus database with same CATH topology
3PO3C 3PO2K 5IP9K 4A93C 4C3IK 3FKIC 4G7ZA 2A68A 3H3VD 3S1QC 5TMFA 4Y52K 4A3JC 1WCMK 3HOXC 4NOIA 4BY1K 3S2HK 1BDFA 5C4XK 4Q4ZA 1I6HK 4A3IK 2WB1L 1R9TC 4BBRC 4A3EC 4KN4A 2JA8K 2PPBA 3GTLC 2R92C 3S14K 5M5YK 4KMUA 5D4DA 1TWCK 3M3YC 4A3KC 1TWGK 3S15K 3H0GK 1TWAC 4C3JK 4G7HA 1Y1WC 5IYDC 2E2IK 1YNJA 3HOYC 3GTKC 3M3YK 1Y1VC 4A3LK 4C3HK 4QIWD 1I50C 2NVQC 3CQZC 1TWCC 5IYCC 4A3FC 4OIRA 4MEYA 5M5XK 2PMZD 3GTJK 4OIQA 4LK0A 2R7ZC 4A3LC 1R9TK 1TWHC 2NVTC 3M4OC 2NVQK 4YFKA 3S2DK 4OIOA 4Y52C 1ZYRA 3GTMC 4OINA 3HOYK 1XPPA 5IYDK 3HOZK 2E2IC 2E2JC 3S15C 4A3MC 3EQLA 2JA5K 4XLPA 1I3QK 4GZYA 4A3DC 3K7AC 1IW7A 2JA8C 3S16C 1TWFC 5C44K 2NVXK 3H3VL 1HQMA 4A3BK 3S1NC 3HKZD 1I6HC 2E2HK 5FLMC 4YFNA 3RZDC 4BY1C 2JA6K 3S2HC 2A6HA 1WCMC 2A69A 3GTGC 3HOWC 3GTQK 4BBSC 2JA6C 1TWFK 3PO3K 2O5JA 5IP7C 1I3QC 4A3DK 4XSZA 3HOVC 2WAQD 2JA7C 2R93C 3PO2C 4QJVA 3HOWK 4BBSK 4AYBD 2B63C 2JA5C 5IP7K 3HOZC 2BE5A 5C4JK 1SFOC 3S1MK 3GTQC 4MQ9A 3S1NK 4Q5SA 2VUMK 2R7ZK 3RZDK 3S1RK 4ZH4A 3RZOC 4BXXK 2E2HC 2O5IA 3S17K 4A3GK 3GTOK 4A3BC 3I4NC 1TWHK 2PMZL 2NVTK 3M4OK 3S16K 1K83C 4Y7NK 3K7AK 1Y1VK 2PA8D 5IYBC 5M5WK 2CW0A 2Y0SD 4A3MK 1TWAK 1I50K 3H0GC 1Y1WK 3DXJA 3GTMK 4C2MK 3GTPK 4X6AK 2R92K 4MEXA 1K83K 4LJZA 3WODA 4BBRK 4A3EK 3I4NK 5IYBK 5IYCK 4A3IC 4QJVB 5C4XC 4Y7NC 2WB1D 3GTJC 4OIPA 2WAQL 2PA8L 3HKZL 4LK1A 5TMCA 5FJ8K 4A3FK 3GTKK 3CQZK 4YG2A 4YFXA 1TWGC 3S2DC 1YNNA 3HOXK 3GTPC 4X6AC 2A6EA 3S14C 5C4JC 1SFOK 4G7OA 2JA7K 5M3FK 2R93K 4LLGA 4QIWL 4A3KK 3FKIK 3GTOC 3I4MC 4A93K 5M3MK 3GTLK 2NVYK 4AYBL 4A3CK 2VUMC 4BY7C 4A3JK 3HOVK 3GTGK 3S1MC 3S17C 4A3GC 4XLNA 1I6VA 4KN7A 3S1RC 3RZOK 1SMYA 2Y0SL 5C3EK 2YU9C 3HOUC 4BXXC 4JK1A 2NVYC 4XSXA 5C3EC 2YU9K 5FLMK 3HOUK 4A3CC 3S1QK 4BY7K 3I4MK 2B63K 2NVXC 5C44C 5IP9C 2E2JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 C;  3PO2 K;  5IP9 K;  4A93 C;  4C3I K;  3FKI C;  4G7Z A;  2A68 A;  3H3V D;  3S1Q C;  5TMF A;  4Y52 K;  4A3J C;  1WCM K;  3HOX C;  4NOI A;  4BY1 K;  3S2H K;  1BDF A;  5C4X K;  4Q4Z A;  1I6H K;  4A3I K;  2WB1 L;  1R9T C;  4BBR C;  4A3E C;  4KN4 A;  2JA8 K;  2PPB A;  3GTL C;  2R92 C;  3S14 K;  5M5Y K;  4KMU A;  5D4D A;  1TWC K;  3M3Y C;  4A3K C;  1TWG K;  3S15 K;  3H0G K;  1TWA C;  4C3J K;  4G7H A;  1Y1W C;  5IYD C;  2E2I K;  1YNJ A;  3HOY C;  3GTK C;  3M3Y K;  1Y1V C;  4A3L K;  4C3H K;  4QIW D;  1I50 C;  2NVQ C;  3CQZ C;  1TWC C;  5IYC C;  4A3F C;  4OIR A;  4MEY A;  5M5X K;  2PMZ D;  3GTJ K;  4OIQ A;  4LK0 A;  2R7Z C;  4A3L C;  1R9T K;  1TWH C;  2NVT C;  3M4O C;  2NVQ K;  4YFK A;  3S2D K;  4OIO A;  4Y52 C;  1ZYR A;  3GTM C;  4OIN A;  3HOY K;  1XPP A;  5IYD K;  3HOZ K;  2E2I C;  2E2J C;  3S15 C;  4A3M C;  3EQL A;  2JA5 K;  4XLP A;  1I3Q K;  4GZY A;  4A3D C;  3K7A C;  1IW7 A;  2JA8 C;  3S16 C;  1TWF C;  5C44 K;  2NVX K;  3H3V L;  1HQM A;  4A3B K;  3S1N C;  3HKZ D;  1I6H C;  2E2H K;  5FLM C;  4YFN A;  3RZD C;  4BY1 C;  2JA6 K;  3S2H C;  2A6H A;  1WCM C;  2A69 A;  3GTG C;  3HOW C;  3GTQ K;  4BBS C;  2JA6 C;  1TWF K;  3PO3 K;  2O5J A;  5IP7 C;  1I3Q C;  4A3D K;  4XSZ A;  3HOV C;  2WAQ D;  2JA7 C;  2R93 C;  3PO2 C;  4QJV A;  3HOW K;  4BBS K;  4AYB D;  2B63 C;  2JA5 C;  5IP7 K;  3HOZ C;  2BE5 A;  5C4J K;  1SFO C;  3S1M K;  3GTQ C;  4MQ9 A;  3S1N K;  4Q5S A;  2VUM K;  2R7Z K;  3RZD K;  3S1R K;  4ZH4 A;  3RZO C;  4BXX K;  2E2H C;  2O5I A;  3S17 K;  4A3G K;  3GTO K;  4A3B C;  3I4N C;  1TWH K;  2PMZ L;  2NVT K;  3M4O K;  3S16 K;  1K83 C;  4Y7N K;  3K7A K;  1Y1V K;  2PA8 D;  5IYB C;  5M5W K;  2CW0 A;  2Y0S D;  4A3M K;  1TWA K;  1I50 K;  3H0G C;  1Y1W K;  3DXJ A;  3GTM K;  4C2M K;  3GTP K;  4X6A K;  2R92 K;  4MEX A;  1K83 K;  4LJZ A;  3WOD A;  4BBR K;  4A3E K;  3I4N K;  5IYB K;  5IYC K;  4A3I C;  4QJV B;  5C4X C;  4Y7N C;  2WB1 D;  3GTJ C;  4OIP A;  2WAQ L;  2PA8 L;  3HKZ L;  4LK1 A;  5TMC A;  5FJ8 K;  4A3F K;  3GTK K;  3CQZ K;  4YG2 A;  4YFX A;  1TWG C;  3S2D C;  1YNN A;  3HOX K;  3GTP C;  4X6A C;  2A6E A;  3S14 C;  5C4J C;  1SFO K;  4G7O A;  2JA7 K;  5M3F K;  2R93 K;  4LLG A;  4QIW L;  4A3K K;  3FKI K;  3GTO C;  3I4M C;  4A93 K;  5M3M K;  3GTL K;  2NVY K;  4AYB L;  4A3C K;  2VUM C;  4BY7 C;  4A3J K;  3HOV K;  3GTG K;  3S1M C;  3S17 C;  4A3G C;  4XLN A;  1I6V A;  4KN7 A;  3S1R C;  3RZO K;  1SMY A;  2Y0S L;  5C3E K;  2YU9 C;  3HOU C;  4BXX C;  4JK1 A;  2NVY C;  4XSX A;  5C3E C;  2YU9 K;  5FLM K;  3HOU K;  4A3C C;  3S1Q K;  4BY7 K;  3I4M K;  2B63 K;  2NVX C;  5C44 C;  5IP9 C;  2E2J K; 
#chains in the Genus database with same CATH topology
 2R7Z A;  4GT9 A;  2A68 A;  1O2A A;  1KQ4 A;  4KMH A;  4BY1 K;  5IOS A;  2WB1 L;  1R9T C;  1Y1V A;  4BBR C;  3GTQ A;  1C0A A;  5IOR A;  5M5Y K;  5D4D A;  1BGW A;  4KAR A;  4A3K C;  4C3J K;  4G7H A;  1YNJ A;  1Y1V C;  1O24 A;  4C3H K;  4QIW D;  3CQZ C;  4KB2 A;  1TWC C;  5M5X K;  2PMZ D;  4RMF A;  3GTJ K;  4LK0 A;  4OIQ A;  2NVT C;  3M4O C;  4FM9 A;  1XZP B;  4PAB A;  4YFK A;  1R9T A;  3GTM C;  4OIN A;  2W7V A;  2E2I C;  2E2J C;  1WOO A;  2GSO A;  4GZY A;  2JA8 C;  1DD5 A;  3H3V L;  2GSU A;  2E2H K;  4KDD A;  2JA6 K;  2A69 A;  3HOW C;  1O2B A;  3PO3 K;  1I3Q C;  4A3D K;  1J6V A;  2R93 C;  3PO2 C;  1ZBS A;  2JA5 C;  1EI6 A;  2BE5 A;  3Q3Q A;  3A8K A;  2VUM K;  4BXX K;  2O5I A;  3S17 K;  4A3G K;  3AH5 A;  1J98 A;  1TWH K;  3AD8 C;  2FQT A;  1WQG A;  2YU9 A;  1K83 C;  4KMD A;  3K7A K;  2PA8 D;  5IYB C;  2CW0 A;  1Y1W K;  1TWA K;  1B4A A;  1I50 K;  1PJ5 A;  2FQO A;  3ERE D;  3GTM K;  4X6A K;  2R92 K;  1J6X A;  4MEX A;  4KM8 A;  1DCO A;  3I4N K;  5IYB K;  5IYC K;  1PJ7 A;  5C4X C;  2WB1 D;  1ZVU A;  4ILD A;  2PA8 L;  4KAW X;  3HKZ L;  3N0B A;  5TMC A;  2GSN A;  5FJ8 K;  1O2F B;  4YFX A;  1O25 A;  1YNN A;  3TFI A;  4G7O A;  3GDZ A;  2JA7 K;  5M3F K;  4GTE A;  4QIW L;  4KAS A;  4A3K K;  5EGH A;  3I4M C;  4A93 K;  3GTG A;  2GAG C;  2R92 A;  2RH6 A;  4AYB L;  3GTL A;  1YX2 A;  4A3J K;  3V4G A;  1Y1W A;  4KC6 A;  4KN7 A;  1SMY A;  3HOU C;  1USM A;  1IL2 A;  4XSX A;  2YU9 K;  1VLO A;  5IOQ A;  2NVX C;  3GTK A;  3PO3 C;  4A93 C;  4C3I K;  3H3V D;  3S1Q C;  1XZQ B;  1IS1 A;  3HOX C;  3T02 A;  4NOI A;  1BDF A;  1F7U A;  4FZB A;  1EH1 A;  1IBA A;  4KN4 A;  2JA8 K;  1RU0 A;  4GTB A;  4KMU A;  3M3Y C;  4WIL A;  1Y1W C;  4C3H C;  3GTK C;  1I50 C;  2NVQ C;  3OEP A;  5IYC C;  4A3F C;  5HL8 A;  2CFA A;  1R9T K;  1TWH C;  3NUH A;  4OIO A;  1TWF A;  5CHP A;  4KAT A;  3AD9 C;  3IPJ A;  4A3M C;  4WJ3 M;  2JA5 K;  2V6T A;  4XLP A;  3QX3 A;  3A8J A;  1TWF C;  3S16 C;  3HKZ D;  1I6H C;  3GSI A;  5FLM C;  1JOE A;  4YFN A;  4G0U A;  3GEI A;  3GTQ K;  4P5B A;  4GTL A;  2O5J A;  5IP7 C;  1EFW A;  1G51 A;  2JA7 C;  4QJV A;  3HOW K;  4AYB D;  2B63 C;  4XCH A;  1XXB A;  5IP7 K;  5L46 A;  1SFO C;  1XXC A;  2CFA B;  2R7Z K;  4LQY A;  4ZH4 A;  4BKW A;  1TWG A;  3GTO K;  3S16 K;  2D6F C;  4GTD A;  3ORE A;  5M5W K;  4C3J C;  3DXJ A;  1VH2 A;  1K83 K;  4BBR K;  5JFE A;  3G4C A;  1WSV A;  4LOW A;  4Y7N C;  1SFO A;  4LK1 A;  4A3F K;  2B63 A;  4YG2 A;  1WOR A;  1TWG C;  5IOT A;  3GTP C;  2A6E A;  5C4J C;  1VGX A;  4BLA A;  4P9S A;  1J6W A;  3GTO C;  3GEH A;  4A3C K;  3GTP A;  5TJ3 A;  3S1M C;  4G0V A;  4XLN A;  1WOS A;  1I6V A;  3S1R C;  4BLB A;  3RZO K;  5C3E K;  3CAG A;  3G4A A;  4A3C C;  5FLM K;  2GAH C;  1IE0 A;  3FOF A;  2B63 K;  2E2J K;  2E2I K;  5IP9 K;  3FKI C;  3N0C A;  5TMF A;  4G0W A;  3FHZ A;  3TTG A;  1K83 A;  1BS2 A;  1WCM K;  2XCQ A;  3BUE A;  4Q4Z A;  1I6H K;  5E68 A;  4A3E C;  3GTL C;  1O27 A;  2PPB A;  3S14 K;  3AD7 C;  3GEE A;  2ZUF A;  3GTO A;  1TWG K;  3H0G K;  5IYD C;  3HOY C;  4A3L K;  1I3Q A;  4OIR A;  4MEY A;  2JH3 A;  2R7Z C;  3SZY A;  2NVQ K;  1PJ6 A;  1JQW A;  4GTF A;  4M1X A;  4Y52 C;  1XPP A;  3HOZ K;  3S0X A;  3S15 C;  3EQL A;  3K7A C;  1F93 A;  1B4B A;  1IW7 A;  3ADA C;  5C44 K;  2NVX K;  1HQM A;  1DCP A;  3S1N C;  1O29 A;  2JA5 A;  1TWC A;  3S2H C;  3RZD C;  4C3I C;  4BBS C;  1TWF K;  2ZFZ A;  3LAP A;  3AQO A;  3TFJ A;  2KWA A;  2ZUE A;  3T00 A;  2XCR B;  4Q5S A;  4MQ9 A;  3LAJ A;  3RZD K;  2E2H C;  2EBB A;  2P5M A;  2Y0S D;  1ZQ1 C;  1AB4 A;  3A8I A;  4C2M K;  3TFH A;  2NVY A;  4LJZ A;  3WOD A;  1F7V A;  4A3I C;  4QJV B;  5JVO A;  2V6U A;  5EGE A;  1ISE A;  4OIP A;  4C45 A;  3GTJ C;  3GTK K;  3CQZ K;  4O2D A;  3CQZ A;  3S2D C;  1USO A;  3HOX K;  4X6A C;  4GTA A;  4LLG A;  3T01 A;  1O28 A;  3GTL K;  2NVY K;  1GE9 A;  2VUM C;  1BJT A;  3GTG K;  1V5V A;  4KMA A;  3S17 C;  4A3G C;  3GIR A;  4BXX C;  2JA7 A;  3L4J A;  2Y0S L;  2YU9 C;  4GTC A;  3HOU K;  2NVY C;  3L4K A;  3N3Y A;  3I4M K;  5C44 C;  5IP9 C;  1HI9 A;  3PO2 K;  2V6S A;  4G7Z A;  3LPX A;  4Y52 K;  4A3J C;  3GTM A;  3S2H K;  5C4X K;  1I50 A;  1TWA A;  4A3I K;  1L0W A;  4LR2 A;  2R92 C;  4J3N A;  4C2M C;  1TWH A;  1TWC K;  3S2D K;  3S15 K;  1TWA C;  3M3Y K;  2NVX A;  2XCO A;  1WSR A;  1UV7 A;  2VUM A;  1VJE A;  1F9N A;  1X31 C;  4A3L C;  1YCL A;  1ZXO A;  3JST A;  2Y3P A;  1DCH A;  1ZYR A;  3HOY K;  5IYD K;  2JA6 A;  2E2H A;  1I3Q K;  4A3D C;  2RGR A;  1O26 A;  4AH6 A;  4PAA A;  4A3B K;  3H0G A;  1IQ0 A;  4BY1 C;  2A6H A;  1WCM C;  3GTG C;  4DDQ A;  2JA6 C;  3HXA A;  4XSZ A;  3HOV C;  2WAQ D;  1WCM A;  3GTJ A;  3FOE A;  4BBS K;  1EQR A;  3VA7 A;  3HOZ C;  5C4J K;  3S1N K;  3S1M K;  3GTQ C;  2E2I A;  3S1R K;  3RZO C;  2PHC B;  4GFQ A;  4KB4 A;  4A3B C;  2NVT K;  2PMZ L;  3M4O K;  3I4N C;  3AQP A;  4Y7N K;  1Y1V K;  4A3M K;  3H0G C;  1XXA A;  4P5A A;  4WJ4 A;  3GTP K;  3BP3 A;  2P8T A;  3OPF A;  4A3E K;  1WOP A;  2WAQ L;  5CJ9 A;  1WQH A;  1WQF A;  1XZQ A;  3S14 C;  1SFO K;  2R93 K;  3FKI K;  5M3M K;  3SZZ A;  1VRQ C;  3BP8 C;  3MML B;  4BY7 C;  1JVI A;  3HOV K;  3FKI A;  2R93 A;  1WIH A;  4JK1 A;  4KM9 A;  5C3E C;  4BY7 K;  1XZP A;  3S1Q K;  1INN A;  1EK8 A; 
#chains in the Genus database with same CATH homology
 3PO3 C;  3PO2 K;  5IP9 K;  4A93 C;  4C3I K;  3FKI C;  4G7Z A;  2A68 A;  3H3V D;  3S1Q C;  5TMF A;  4Y52 K;  4A3J C;  1WCM K;  3HOX C;  4NOI A;  4BY1 K;  3S2H K;  1BDF A;  5C4X K;  4Q4Z A;  1I6H K;  4A3I K;  2WB1 L;  1R9T C;  4BBR C;  4A3E C;  4KN4 A;  2JA8 K;  2PPB A;  3GTL C;  2R92 C;  3S14 K;  5M5Y K;  4KMU A;  5D4D A;  1TWC K;  3M3Y C;  4A3K C;  1TWG K;  3S15 K;  3H0G K;  1TWA C;  4C3J K;  4G7H A;  1Y1W C;  5IYD C;  2E2I K;  1YNJ A;  3HOY C;  3GTK C;  3M3Y K;  1Y1V C;  4A3L K;  4C3H K;  4QIW D;  1I50 C;  2NVQ C;  3CQZ C;  1TWC C;  5IYC C;  4A3F C;  4OIR A;  4MEY A;  5M5X K;  2PMZ D;  3GTJ K;  4OIQ A;  4LK0 A;  2R7Z C;  4A3L C;  1R9T K;  1TWH C;  2NVT C;  3M4O C;  2NVQ K;  4YFK A;  3S2D K;  4OIO A;  4Y52 C;  1ZYR A;  3GTM C;  4OIN A;  3HOY K;  1XPP A;  5IYD K;  3HOZ K;  2E2I C;  2E2J C;  3S15 C;  4A3M C;  3EQL A;  2JA5 K;  4XLP A;  1I3Q K;  4GZY A;  4A3D C;  3K7A C;  1IW7 A;  2JA8 C;  3S16 C;  1TWF C;  5C44 K;  2NVX K;  3H3V L;  1HQM A;  4A3B K;  3S1N C;  3HKZ D;  1I6H C;  2E2H K;  5FLM C;  4YFN A;  3RZD C;  4BY1 C;  2JA6 K;  3S2H C;  2A6H A;  1WCM C;  2A69 A;  3GTG C;  3HOW C;  3GTQ K;  4BBS C;  2JA6 C;  1TWF K;  3PO3 K;  2O5J A;  5IP7 C;  1I3Q C;  4A3D K;  4XSZ A;  3HOV C;  2WAQ D;  2JA7 C;  2R93 C;  3PO2 C;  4QJV A;  3HOW K;  4BBS K;  4AYB D;  2B63 C;  2JA5 C;  5IP7 K;  3HOZ C;  2BE5 A;  5C4J K;  1SFO C;  3S1M K;  3GTQ C;  4MQ9 A;  3S1N K;  4Q5S A;  2VUM K;  2R7Z K;  3RZD K;  3S1R K;  4ZH4 A;  3RZO C;  4BXX K;  2E2H C;  2O5I A;  3S17 K;  4A3G K;  3GTO K;  4A3B C;  3I4N C;  1TWH K;  2PMZ L;  2NVT K;  3M4O K;  3S16 K;  1K83 C;  4Y7N K;  3K7A K;  1Y1V K;  2PA8 D;  5IYB C;  5M5W K;  2CW0 A;  2Y0S D;  4A3M K;  1TWA K;  1I50 K;  3H0G C;  1Y1W K;  3DXJ A;  3GTM K;  4C2M K;  3GTP K;  4X6A K;  2R92 K;  4MEX A;  1K83 K;  4LJZ A;  3WOD A;  4BBR K;  4A3E K;  3I4N K;  5IYB K;  5IYC K;  4A3I C;  4QJV B;  5C4X C;  4Y7N C;  2WB1 D;  3GTJ C;  4OIP A;  2WAQ L;  2PA8 L;  3HKZ L;  4LK1 A;  5TMC A;  5FJ8 K;  4A3F K;  3GTK K;  3CQZ K;  4YG2 A;  4YFX A;  1TWG C;  3S2D C;  1YNN A;  3HOX K;  3GTP C;  4X6A C;  2A6E A;  3S14 C;  5C4J C;  1SFO K;  4G7O A;  2JA7 K;  5M3F K;  2R93 K;  4LLG A;  4QIW L;  4A3K K;  3FKI K;  3GTO C;  3I4M C;  4A93 K;  5M3M K;  3GTL K;  2NVY K;  4AYB L;  4A3C K;  2VUM C;  4BY7 C;  4A3J K;  3HOV K;  3GTG K;  3S1M C;  3S17 C;  4A3G C;  4XLN A;  1I6V A;  4KN7 A;  3S1R C;  3RZO K;  1SMY A;  2Y0S L;  5C3E K;  2YU9 C;  3HOU C;  4BXX C;  4JK1 A;  2NVY C;  4XSX A;  5C3E C;  2YU9 K;  5FLM K;  3HOU K;  4A3C C;  3S1Q K;  4BY7 K;  3I4M K;  2B63 K;  2NVX C;  5C44 C;  5IP9 C;  2E2J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...