2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
3GTGC 3DXJA 3S1NC 2R7ZC 3H0GC 2NVXK 3S2DK 5TMCA 5C3EK 3GTQK 5TMFA 5IP7K 4Y7NC 4A3EK 3S15C 1R9TK 1TWFC 4QIWD 2VUMK 5M5XK 1I6VA 1I50C 4QJVA 3S2HK 4Q5SA 4ZH4A 3RZDK 2Y0SL 5IP9C 2JA7C 3S17C 3HOUK 1TWHC 4YG2A 3HOVK 2JA5C 2A6HA 4AYBL 1TWGK 2PA8L 2E2IK 1WCMC 2JA8C 3S1QK 3S16C 3FKIC 3HOXK 4A3IC 2JA6K 2PMZL 4KN7A 4YFNA 4A93K 4BY7K 3HKZD 4Y52K 3PO2K 4A3JK 4C3HK 3RZOC 3GTGK 5M5YK 2O5IA 2E2JK 3HOWC 1SMYA 2YU9C 5IYCC 4A3MC 5IYBC 4A3FK 2R92C 5C4JK 4BY1C 4XLPA 4GZYA 2CW0A 4G7HA 1SFOC 1Y1WK 3GTOC 1TWFK 1Y1VC 3M3YK 1IW7A 2NVTC 3HOYK 3GTPC 3M4OC 2E2HC 3I4NK 2A68A 1ZYRA 4OIQA 2JA7K 2R93K 2BE5A 4A3CK 4QJVB 1TWHK 2PPBA 3S1MC 4MEYA 2NVQK 2JA8K 1WCMK 5FLMC 4A3BC 4LK0A 4A3KC 3GTMC 3S16K 2WAQD 1K83K 3FKIK 1TWAC 4OIPA 4A3LK 1BDFA 4XLNA 4A3IK 3H3VL 5C44K 1I3QC 4XSXA 3CQZC 3GTJK 4BBSC 3I4MC 4OINA 1XPPA 4Q4ZA 4XSZA 3GTKC 1I6HC 3RZOK 3PO3K 2YU9K 3HOZK 5IYCK 5IYBK 3S1NK 2R7ZK 4G7OA 2WB1L 3H0GK 5M3FK 3HKZL 2NVXC 2Y0SD 4KMUA 4BBRC 4A3DC 1TWCC 3S15K 4Y7NK 4LK1A 3GTPK 5D4DA 2PA8D 5IYDC 4BXXC 4NOIA 1I50K 4OIOA 4KN4A 3S17K 5IP9K 3S1RC 2JA5K 3GTMK 4X6AC 4G7ZA 2B63C 4QIWL 2A6EA 1TWGC 3WODA 2E2IC 3S14C 3S1QC 2NVYC 3HOXC 3GTKK 4YFKA 4C3IK 3GTLC 4LJZA 1I6HK 4BY7C 4A93C 5M3MK 3K7AC 4A3JC 3HOWK 4A3GC 1YNNA 2E2JC 4YFXA 3EQLA 4A3MK 2A69A 4BBRK 4A3FC 4BY1K 2R92K 1TWCK 5C4JC 4A3DK 3S2DC 1SFOK 4OIRA 3GTOK 1Y1VK 1Y1WC 5C3EC 3M3YC 3GTQC 4BXXK 5IYDK 4MQ9A 5IP7C 5FJ8K 4A3EC 2NVTK 1R9TC 3HOYC 3M4OK 2E2HK 4AYBD 3I4NC 4LLGA 2VUMC 2R93C 3H3VD 3S2HC 4A3CC 3S1RK 3S1MK 3RZDC 4X6AK 4MEXA 2B63K 2NVQC 1HQMA 3HOUC 2PMZD 5FLMK 5C4XK 4A3BK 4A3KK 3HOVC 3S14K 2O5JA 4C2MK 4A3LC 1K83C 1TWAK 2NVYK 5M5WK 5C4XC 1I3QK 5C44C 3CQZK 3GTJC 3GTLK 4C3JK 3I4MK 2WB1D 4BBSK 3K7AK 2JA6C 3PO3C 4A3GK 1YNJA 2WAQL 4JK1A 4Y52C 3HOZC 3PO2C
chains in the Genus database with same CATH superfamily
3GTGC 3DXJA 2R7ZC 3H0GC 3SZZA 3BP8C 4A3EK 3G4AA 4KB2A 1PJ6A 1O26A 2JA7C 2RGRA 1VH2A 1IBAA 4G0VA 2PA8L 2JA8C 1J6VA 1XZQB 5CHPA 4P9SA 3CAGA 2PMZL 4KN7A 4ILDA 4YFNA 4A93K 1JVIA 3RZOC 3FKIA 1INNA 2W7VA 2R92C 4BY1C 2CW0A 1IQ0A 4G7HA 3M3YK 1Y1VC 1IW7A 3AD8C 2YU9A 1O2AA 4BKWA 2NVTC 2E2HC 3I4NK 1WORA 1B4AA 1ZYRA 4A3CK 1SFOA 3LPXA 3GTOA 2NVQK 4WILA 1UV7A 3S16K 3FKIK 1BDFA 4A3IK 5C44K 1I3QC 4XSXA 3S0XA 3TFJA 3GTJK 4OINA 3PO3K 2YU9K 2WB1L 4A3DC 1TWCC 4LK1A 4J3NA 4BXXC 1I50K 2NVXA 2RH6A 1DCPA 5IP9K 1PJ5A 3BUEA 2JA5K 4G7ZA 1XXAA 4QIWL 3WODA 3IPJA 2Y3PA 4GTBA 4KMHA 4C3IK 4LJZA 1VRQC 4BY7C 2E2IA 5M3MK 3K7AC 4C3HC 2E2JC 3EQLA 4GTAA 1O24A 2A69A 3ADAC 4KASA 4BBRK 5C4JC 2XCRB 3S2DC 2GSNA 4KDDA 5FJ8K 1VJEA 4AYBD 4KC6A 2VUMC 3S2HC 3S1RK 2P8TA 1WQHA 4MEXA 4KB4A 2V6UA 2O5JA 5C4XK 1R9TA 3GEHA 3S14K 1TWAK 1WIHA 3GTLK 3CQZK 3LAJA 1J98A 2GAHC 1K83A 3PO2C 3V4GA 3GEEA 2EBBA 3GTQK 5IOTA 3AH5A 1R9TK 3GTGA 1EH1A 2GSUA 4XCHA 2R7ZA 1B4BA 3H0GA 4QJVA 4Q5SA 4GTLA 2Y0SL 3HOUK 3GTPA 3HOVK 2A6HA 4AYBL 1TWGK 2V6TA 1WCMC 2P5MA 2JA7A 3HOXK 1G51A 4GTDA 4KMDA 4A3JK 3T01A 3GTGK 5E68A 1YCLA 3GTKA 5JFEA 4A3MC 5IYBC 4A3FK 1BS2A 1Y1WK 3GTPC 4WJ4A 1ZXOA 2JA7K 1YX2A 2R92A 2R93K 2BE5A 1BGWA 1Y1VA 2JA8K 1RU0A 4LK0A 2E2HA 4A3LK 1DD5A 4LOWA 3A8KA 4BBSC 4KM8A 4Q4ZA 3GTKC 2CFAA 1WOSA 4FZBA 1V5VA 3RZOK 3HOZK 1I3QA 3QX3A 3S1NK 4G7OA 5M3FK 4KMUA 2KWAA 3S15K 4Y7NK 3OEPA 3N0BA 4NOIA 4P5BA 4KN4A 3S17K 1TWCA 4X6AC 2B63C 2XCQA 4YFKA 1O25A 1F93A 1VGXA 1WQGA 5HL8A 4M1XA 1L0WA 4A93C 3HOWK 4A3GC 2ZFZA 4A3DK 1TWCK 1F7VA 1F9NA 1SFOK 2FQTA 3AQPA 3GTOK 3GSIA 5C3EC 3M3YC 4BXXK 4GTEA 4MQ9A 5IP7C 3M4OK 3I4NC 2V6SA 3H3VD 1JQWA 3MMLB 4A3CC 3S1MK 3RZDC 4BLAA 2NVQC 4A3BK 5FLMK 4A3KK 4C2MK 2VUMA 5C44C 3GTJC 4C3JK 3I4MK 3K7AK 2JA6C 1XZPA 1XZPB 4LR2A 3TFIA 3TTGA 1YNJA 3PO3C 2E2JK 4Y52C 3L4KA 1IE0A 2NVXK 3S2DK 5TMCA 3FOFA 1TWFC 2VUMK 1I50C 3S2HK 4P5AA 5IP9C 1XXBA 1TWHC 4YG2A 2JA5C 2E2IK 4O2DA 4RMFA 3S1QK 1DCHA 3GDZA 3TFHA 1IS1A 2D6FC 3JSTA 1WCMA 3PO2K 2O5IA 3T00A 1SMYA 4C45A 5CJ9A 5IYCC 4KARA 1USOA 3GIRA 1HI9A 4GFQA 3HOYK 2A68A 4QJVB 1EFWA 2PPBA 2GSOA 1ZQ1C 1WCMK 5C4XC 3GTMC 2ZUEA 2WAQD 1K83K 1EK8A 1TWAC 4XLNA 3CQZC 1EI6A 1XPPA 2ZUFA 1I6HC 1AB4A 3OREA 4G0WA 5IYBK 2R7ZK 3H0GK 3A8JA 1O2BA 5JVOA 1O28A 5D4DA 4LQYA 3GTPK 4KMAA 2PA8D 5IYDC 4PABA 4KATA 1ZBSA 1TWGC 1USMA 2NVYC 3HOXC 3GTKK 1PJ7A 2B63A 5EGHA 2CFAB 1VLOA 4A3JC 4GTCA 1YNNA 1F7UA 4YFXA 4A3FC 2GAGC 4BY1K 1IL2A 2R92K 5IOSA 3HXAA 1Y1VK 1Y1WC 3N0CA 1ZVUA 4A3EC 2NVTK 2E2HK 4LLGA 5TJ3A 2R93C 4X6AK 2B63K 1HQMA 1XZQA 4A3LC 3N3YA 4GT9A 1J6XA 1I3QK 2WB1D 1X31C 4A3GK 3HOZC 3GTJA 3S1NC 1DCOA 2JA6A 4DDQA 5C3EK 5TMFA 5IP7K 4Y7NC 3S15C 4QIWD 5M5XK 1I6VA 4ZH4A 2XCOA 3RZDK 3S17C 2PHCB 5EGEA 1TWFA 1I50A 3S16C 3FKIC 3FOEA 4GTFA 1TWHA 4A3IC 2JA6K 2JA5A 1BJTA 4BY7K 3HKZD 4Y52K 4C3HK 1WOPA 5M5YK 3HOWC 2YU9C 1JOEA 1EQRA 5C4JK 4XLPA 4GZYA 1SFOC 3GTOC 1TWFK 3M4OC 5IOQA 4OIQA 1TWHK 4AH6A 3S1MC 1ISEA 3BP3A 4MEYA 1O2FB 2FQOA 4A3BC 5FLMC 4BLBA 4A3KC 3NUHA 4OIPA 4C2MC 3FHZA 3H3VL 4C3JC 3I4MC 3AQOA 4XSZA 3SZYA 4C3IC 3GTMA 4WJ3M 1TWAA 2JH3A 3AD7C 5L46A 4KM9A 5IYCK 3GTLA 3CQZA 3ERED 3HKZL 2NVXC 2Y0SD 4BBRC 3AD9C 5IORA 1WSRA 1WQFA 4PAAA 4OIOA 3VA7A 3GTQA 3S1RC 3GTMK 4FM9A 1O27A 3L4JA 2A6EA 2E2IC 3OPFA 3S14C 3S1QC 3LAPA 4G0UA 3GTLC 1I6HK 1TWGA 3GEIA 1J6WA 1GE9A 1O29A 2NVYA 4A3MK 3G4CA 4KAWX 4OIRA 5IYDK 3GTQC 1WOOA 1R9TC 3HOYC 1Y1WA 1WSVA 3HOUC 2PMZD 3Q3QA 3HOVC 1K83C 2NVYK 1KQ4A 2R93A 5M5WK 3T02A 4BBSK 1C0AA 1XXCA 3A8IA 2WAQL 4JK1A
chains in the Genus database with same CATH topology
3GTGC 3DXJA 3S1NC 2R7ZC 3H0GC 2NVXK 3S2DK 5TMCA 5C3EK 3GTQK 5TMFA 5IP7K 4Y7NC 4A3EK 3S15C 1R9TK 1TWFC 4QIWD 2VUMK 5M5XK 1I6VA 1I50C 4QJVA 3S2HK 4Q5SA 4ZH4A 3RZDK 2Y0SL 5IP9C 2JA7C 3S17C 3HOUK 1TWHC 4YG2A 3HOVK 2JA5C 2A6HA 4AYBL 1TWGK 2PA8L 2E2IK 1WCMC 2JA8C 3S1QK 3S16C 3FKIC 3HOXK 4A3IC 2JA6K 2PMZL 4KN7A 4YFNA 4A93K 4BY7K 3HKZD 4Y52K 3PO2K 4A3JK 4C3HK 3RZOC 3GTGK 5M5YK 2O5IA 2E2JK 3HOWC 1SMYA 2YU9C 5IYCC 4A3MC 5IYBC 4A3FK 2R92C 5C4JK 4BY1C 4XLPA 4GZYA 2CW0A 4G7HA 1SFOC 1Y1WK 3GTOC 1TWFK 1Y1VC 3M3YK 1IW7A 2NVTC 3HOYK 3GTPC 3M4OC 2E2HC 3I4NK 2A68A 1ZYRA 4OIQA 2JA7K 2R93K 2BE5A 4A3CK 4QJVB 1TWHK 2PPBA 3S1MC 4MEYA 2NVQK 2JA8K 1WCMK 5FLMC 4A3BC 4LK0A 4A3KC 3GTMC 3S16K 2WAQD 1K83K 3FKIK 1TWAC 4OIPA 4A3LK 1BDFA 4XLNA 4A3IK 3H3VL 5C44K 1I3QC 4XSXA 3CQZC 3GTJK 4BBSC 3I4MC 4OINA 1XPPA 4Q4ZA 4XSZA 3GTKC 1I6HC 3RZOK 3PO3K 2YU9K 3HOZK 5IYCK 5IYBK 3S1NK 2R7ZK 4G7OA 2WB1L 3H0GK 5M3FK 3HKZL 2NVXC 2Y0SD 4KMUA 4BBRC 4A3DC 1TWCC 3S15K 4Y7NK 4LK1A 3GTPK 5D4DA 2PA8D 5IYDC 4BXXC 4NOIA 1I50K 4OIOA 4KN4A 3S17K 5IP9K 3S1RC 2JA5K 3GTMK 4X6AC 4G7ZA 2B63C 4QIWL 2A6EA 1TWGC 3WODA 2E2IC 3S14C 3S1QC 2NVYC 3HOXC 3GTKK 4YFKA 4C3IK 3GTLC 4LJZA 1I6HK 4BY7C 4A93C 5M3MK 3K7AC 4A3JC 3HOWK 4A3GC 1YNNA 2E2JC 4YFXA 3EQLA 4A3MK 2A69A 4BBRK 4A3FC 4BY1K 2R92K 1TWCK 5C4JC 4A3DK 3S2DC 1SFOK 4OIRA 3GTOK 1Y1VK 1Y1WC 5C3EC 3M3YC 3GTQC 4BXXK 5IYDK 4MQ9A 5IP7C 5FJ8K 4A3EC 2NVTK 1R9TC 3HOYC 3M4OK 2E2HK 4AYBD 3I4NC 4LLGA 2VUMC 2R93C 3H3VD 3S2HC 4A3CC 3S1RK 3S1MK 3RZDC 4X6AK 4MEXA 2B63K 2NVQC 1HQMA 3HOUC 2PMZD 5FLMK 5C4XK 4A3BK 4A3KK 3HOVC 3S14K 2O5JA 4C2MK 4A3LC 1K83C 1TWAK 2NVYK 5M5WK 5C4XC 1I3QK 5C44C 3CQZK 3GTJC 3GTLK 4C3JK 3I4MK 2WB1D 4BBSK 3K7AK 2JA6C 3PO3C 4A3GK 1YNJA 2WAQL 4JK1A 4Y52C 3HOZC 3PO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG C;  3DXJ A;  3S1N C;  2R7Z C;  3H0G C;  2NVX K;  3S2D K;  5TMC A;  5C3E K;  3GTQ K;  5TMF A;  5IP7 K;  4Y7N C;  4A3E K;  3S15 C;  1R9T K;  1TWF C;  4QIW D;  2VUM K;  5M5X K;  1I6V A;  1I50 C;  4QJV A;  3S2H K;  4Q5S A;  4ZH4 A;  3RZD K;  2Y0S L;  5IP9 C;  2JA7 C;  3S17 C;  3HOU K;  1TWH C;  4YG2 A;  3HOV K;  2JA5 C;  2A6H A;  4AYB L;  1TWG K;  2PA8 L;  2E2I K;  1WCM C;  2JA8 C;  3S1Q K;  3S16 C;  3FKI C;  3HOX K;  4A3I C;  2JA6 K;  2PMZ L;  4KN7 A;  4YFN A;  4A93 K;  4BY7 K;  3HKZ D;  4Y52 K;  3PO2 K;  4A3J K;  4C3H K;  3RZO C;  3GTG K;  5M5Y K;  2O5I A;  2E2J K;  3HOW C;  1SMY A;  2YU9 C;  5IYC C;  4A3M C;  5IYB C;  4A3F K;  2R92 C;  5C4J K;  4BY1 C;  4XLP A;  4GZY A;  2CW0 A;  4G7H A;  1SFO C;  1Y1W K;  3GTO C;  1TWF K;  1Y1V C;  3M3Y K;  1IW7 A;  2NVT C;  3HOY K;  3GTP C;  3M4O C;  2E2H C;  3I4N K;  2A68 A;  1ZYR A;  4OIQ A;  2JA7 K;  2R93 K;  2BE5 A;  4A3C K;  4QJV B;  1TWH K;  2PPB A;  3S1M C;  4MEY A;  2NVQ K;  2JA8 K;  1WCM K;  5FLM C;  4A3B C;  4LK0 A;  4A3K C;  3GTM C;  3S16 K;  2WAQ D;  1K83 K;  3FKI K;  1TWA C;  4OIP A;  4A3L K;  1BDF A;  4XLN A;  4A3I K;  3H3V L;  5C44 K;  1I3Q C;  4XSX A;  3CQZ C;  3GTJ K;  4BBS C;  3I4M C;  4OIN A;  1XPP A;  4Q4Z A;  4XSZ A;  3GTK C;  1I6H C;  3RZO K;  3PO3 K;  2YU9 K;  3HOZ K;  5IYC K;  5IYB K;  3S1N K;  2R7Z K;  4G7O A;  2WB1 L;  3H0G K;  5M3F K;  3HKZ L;  2NVX C;  2Y0S D;  4KMU A;  4BBR C;  4A3D C;  1TWC C;  3S15 K;  4Y7N K;  4LK1 A;  3GTP K;  5D4D A;  2PA8 D;  5IYD C;  4BXX C;  4NOI A;  1I50 K;  4OIO A;  4KN4 A;  3S17 K;  5IP9 K;  3S1R C;  2JA5 K;  3GTM K;  4X6A C;  4G7Z A;  2B63 C;  4QIW L;  2A6E A;  1TWG C;  3WOD A;  2E2I C;  3S14 C;  3S1Q C;  2NVY C;  3HOX C;  3GTK K;  4YFK A;  4C3I K;  3GTL C;  4LJZ A;  1I6H K;  4BY7 C;  4A93 C;  5M3M K;  3K7A C;  4A3J C;  3HOW K;  4A3G C;  1YNN A;  2E2J C;  4YFX A;  3EQL A;  4A3M K;  2A69 A;  4BBR K;  4A3F C;  4BY1 K;  2R92 K;  1TWC K;  5C4J C;  4A3D K;  3S2D C;  1SFO K;  4OIR A;  3GTO K;  1Y1V K;  1Y1W C;  5C3E C;  3M3Y C;  3GTQ C;  4BXX K;  5IYD K;  4MQ9 A;  5IP7 C;  5FJ8 K;  4A3E C;  2NVT K;  1R9T C;  3HOY C;  3M4O K;  2E2H K;  4AYB D;  3I4N C;  4LLG A;  2VUM C;  2R93 C;  3H3V D;  3S2H C;  4A3C C;  3S1R K;  3S1M K;  3RZD C;  4X6A K;  4MEX A;  2B63 K;  2NVQ C;  1HQM A;  3HOU C;  2PMZ D;  5FLM K;  5C4X K;  4A3B K;  4A3K K;  3HOV C;  3S14 K;  2O5J A;  4C2M K;  4A3L C;  1K83 C;  1TWA K;  2NVY K;  5M5W K;  5C4X C;  1I3Q K;  5C44 C;  3CQZ K;  3GTJ C;  3GTL K;  4C3J K;  3I4M K;  2WB1 D;  4BBS K;  3K7A K;  2JA6 C;  3PO3 C;  4A3G K;  1YNJ A;  2WAQ L;  4JK1 A;  4Y52 C;  3HOZ C;  3PO2 C; 
#chains in the Genus database with same CATH topology
 3GTG C;  3DXJ A;  2R7Z C;  3H0G C;  3SZZ A;  3BP8 C;  4A3E K;  3G4A A;  4KB2 A;  1PJ6 A;  1O26 A;  2JA7 C;  2RGR A;  1VH2 A;  1IBA A;  4G0V A;  2PA8 L;  2JA8 C;  1J6V A;  1XZQ B;  5CHP A;  4P9S A;  3CAG A;  2PMZ L;  4KN7 A;  4ILD A;  4YFN A;  4A93 K;  1JVI A;  3RZO C;  3FKI A;  1INN A;  2W7V A;  2R92 C;  4BY1 C;  2CW0 A;  1IQ0 A;  4G7H A;  3M3Y K;  1Y1V C;  1IW7 A;  3AD8 C;  2YU9 A;  1O2A A;  4BKW A;  2NVT C;  2E2H C;  3I4N K;  1WOR A;  1B4A A;  1ZYR A;  4A3C K;  1SFO A;  3LPX A;  3GTO A;  2NVQ K;  4WIL A;  1UV7 A;  3S16 K;  3FKI K;  1BDF A;  4A3I K;  5C44 K;  1I3Q C;  4XSX A;  3S0X A;  3TFJ A;  3GTJ K;  4OIN A;  3PO3 K;  2YU9 K;  2WB1 L;  4A3D C;  1TWC C;  4LK1 A;  4J3N A;  4BXX C;  1I50 K;  2NVX A;  2RH6 A;  1DCP A;  5IP9 K;  1PJ5 A;  3BUE A;  2JA5 K;  4G7Z A;  1XXA A;  4QIW L;  3WOD A;  3IPJ A;  2Y3P A;  4GTB A;  4KMH A;  4C3I K;  4LJZ A;  1VRQ C;  4BY7 C;  2E2I A;  5M3M K;  3K7A C;  4C3H C;  2E2J C;  3EQL A;  4GTA A;  1O24 A;  2A69 A;  3ADA C;  4KAS A;  4BBR K;  5C4J C;  2XCR B;  3S2D C;  2GSN A;  4KDD A;  5FJ8 K;  1VJE A;  4AYB D;  4KC6 A;  2VUM C;  3S2H C;  3S1R K;  2P8T A;  1WQH A;  4MEX A;  4KB4 A;  2V6U A;  2O5J A;  5C4X K;  1R9T A;  3GEH A;  3S14 K;  1TWA K;  1WIH A;  3GTL K;  3CQZ K;  3LAJ A;  1J98 A;  2GAH C;  1K83 A;  3PO2 C;  3V4G A;  3GEE A;  2EBB A;  3GTQ K;  5IOT A;  3AH5 A;  1R9T K;  3GTG A;  1EH1 A;  2GSU A;  4XCH A;  2R7Z A;  1B4B A;  3H0G A;  4QJV A;  4Q5S A;  4GTL A;  2Y0S L;  3HOU K;  3GTP A;  3HOV K;  2A6H A;  4AYB L;  1TWG K;  2V6T A;  1WCM C;  2P5M A;  2JA7 A;  3HOX K;  1G51 A;  4GTD A;  4KMD A;  4A3J K;  3T01 A;  3GTG K;  5E68 A;  1YCL A;  3GTK A;  5JFE A;  4A3M C;  5IYB C;  4A3F K;  1BS2 A;  1Y1W K;  3GTP C;  4WJ4 A;  1ZXO A;  2JA7 K;  1YX2 A;  2R92 A;  2R93 K;  2BE5 A;  1BGW A;  1Y1V A;  2JA8 K;  1RU0 A;  4LK0 A;  2E2H A;  4A3L K;  1DD5 A;  4LOW A;  3A8K A;  4BBS C;  4KM8 A;  4Q4Z A;  3GTK C;  2CFA A;  1WOS A;  4FZB A;  1V5V A;  3RZO K;  3HOZ K;  1I3Q A;  3QX3 A;  3S1N K;  4G7O A;  5M3F K;  4KMU A;  2KWA A;  3S15 K;  4Y7N K;  3OEP A;  3N0B A;  4NOI A;  4P5B A;  4KN4 A;  3S17 K;  1TWC A;  4X6A C;  2B63 C;  2XCQ A;  4YFK A;  1O25 A;  1F93 A;  1VGX A;  1WQG A;  5HL8 A;  4M1X A;  1L0W A;  4A93 C;  3HOW K;  4A3G C;  2ZFZ A;  4A3D K;  1TWC K;  1F7V A;  1F9N A;  1SFO K;  2FQT A;  3AQP A;  3GTO K;  3GSI A;  5C3E C;  3M3Y C;  4BXX K;  4GTE A;  4MQ9 A;  5IP7 C;  3M4O K;  3I4N C;  2V6S A;  3H3V D;  1JQW A;  3MML B;  4A3C C;  3S1M K;  3RZD C;  4BLA A;  2NVQ C;  4A3B K;  5FLM K;  4A3K K;  4C2M K;  2VUM A;  5C44 C;  3GTJ C;  4C3J K;  3I4M K;  3K7A K;  2JA6 C;  1XZP A;  1XZP B;  4LR2 A;  3TFI A;  3TTG A;  1YNJ A;  3PO3 C;  2E2J K;  4Y52 C;  3L4K A;  1IE0 A;  2NVX K;  3S2D K;  5TMC A;  3FOF A;  1TWF C;  2VUM K;  1I50 C;  3S2H K;  4P5A A;  5IP9 C;  1XXB A;  1TWH C;  4YG2 A;  2JA5 C;  2E2I K;  4O2D A;  4RMF A;  3S1Q K;  1DCH A;  3GDZ A;  3TFH A;  1IS1 A;  2D6F C;  3JST A;  1WCM A;  3PO2 K;  2O5I A;  3T00 A;  1SMY A;  4C45 A;  5CJ9 A;  5IYC C;  4KAR A;  1USO A;  3GIR A;  1HI9 A;  4GFQ A;  3HOY K;  2A68 A;  4QJV B;  1EFW A;  2PPB A;  2GSO A;  1ZQ1 C;  1WCM K;  5C4X C;  3GTM C;  2ZUE A;  2WAQ D;  1K83 K;  1EK8 A;  1TWA C;  4XLN A;  3CQZ C;  1EI6 A;  1XPP A;  2ZUF A;  1I6H C;  1AB4 A;  3ORE A;  4G0W A;  5IYB K;  2R7Z K;  3H0G K;  3A8J A;  1O2B A;  5JVO A;  1O28 A;  5D4D A;  4LQY A;  3GTP K;  4KMA A;  2PA8 D;  5IYD C;  4PAB A;  4KAT A;  1ZBS A;  1TWG C;  1USM A;  2NVY C;  3HOX C;  3GTK K;  1PJ7 A;  2B63 A;  5EGH A;  2CFA B;  1VLO A;  4A3J C;  4GTC A;  1YNN A;  1F7U A;  4YFX A;  4A3F C;  2GAG C;  4BY1 K;  1IL2 A;  2R92 K;  5IOS A;  3HXA A;  1Y1V K;  1Y1W C;  3N0C A;  1ZVU A;  4A3E C;  2NVT K;  2E2H K;  4LLG A;  5TJ3 A;  2R93 C;  4X6A K;  2B63 K;  1HQM A;  1XZQ A;  4A3L C;  3N3Y A;  4GT9 A;  1J6X A;  1I3Q K;  2WB1 D;  1X31 C;  4A3G K;  3HOZ C;  3GTJ A;  3S1N C;  1DCO A;  2JA6 A;  4DDQ A;  5C3E K;  5TMF A;  5IP7 K;  4Y7N C;  3S15 C;  4QIW D;  5M5X K;  1I6V A;  4ZH4 A;  2XCO A;  3RZD K;  3S17 C;  2PHC B;  5EGE A;  1TWF A;  1I50 A;  3S16 C;  3FKI C;  3FOE A;  4GTF A;  1TWH A;  4A3I C;  2JA6 K;  2JA5 A;  1BJT A;  4BY7 K;  3HKZ D;  4Y52 K;  4C3H K;  1WOP A;  5M5Y K;  3HOW C;  2YU9 C;  1JOE A;  1EQR A;  5C4J K;  4XLP A;  4GZY A;  1SFO C;  3GTO C;  1TWF K;  3M4O C;  5IOQ A;  4OIQ A;  1TWH K;  4AH6 A;  3S1M C;  1ISE A;  3BP3 A;  4MEY A;  1O2F B;  2FQO A;  4A3B C;  5FLM C;  4BLB A;  4A3K C;  3NUH A;  4OIP A;  4C2M C;  3FHZ A;  3H3V L;  4C3J C;  3I4M C;  3AQO A;  4XSZ A;  3SZY A;  4C3I C;  3GTM A;  4WJ3 M;  1TWA A;  2JH3 A;  3AD7 C;  5L46 A;  4KM9 A;  5IYC K;  3GTL A;  3CQZ A;  3ERE D;  3HKZ L;  2NVX C;  2Y0S D;  4BBR C;  3AD9 C;  5IOR A;  1WSR A;  1WQF A;  4PAA A;  4OIO A;  3VA7 A;  3GTQ A;  3S1R C;  3GTM K;  4FM9 A;  1O27 A;  3L4J A;  2A6E A;  2E2I C;  3OPF A;  3S14 C;  3S1Q C;  3LAP A;  4G0U A;  3GTL C;  1I6H K;  1TWG A;  3GEI A;  1J6W A;  1GE9 A;  1O29 A;  2NVY A;  4A3M K;  3G4C A;  4KAW X;  4OIR A;  5IYD K;  3GTQ C;  1WOO A;  1R9T C;  3HOY C;  1Y1W A;  1WSV A;  3HOU C;  2PMZ D;  3Q3Q A;  3HOV C;  1K83 C;  2NVY K;  1KQ4 A;  2R93 A;  5M5W K;  3T02 A;  4BBS K;  1C0A A;  1XXC A;  3A8I A;  2WAQ L;  4JK1 A; 
#chains in the Genus database with same CATH homology
 3GTG C;  3DXJ A;  3S1N C;  2R7Z C;  3H0G C;  2NVX K;  3S2D K;  5TMC A;  5C3E K;  3GTQ K;  5TMF A;  5IP7 K;  4Y7N C;  4A3E K;  3S15 C;  1R9T K;  1TWF C;  4QIW D;  2VUM K;  5M5X K;  1I6V A;  1I50 C;  4QJV A;  3S2H K;  4Q5S A;  4ZH4 A;  3RZD K;  2Y0S L;  5IP9 C;  2JA7 C;  3S17 C;  3HOU K;  1TWH C;  4YG2 A;  3HOV K;  2JA5 C;  2A6H A;  4AYB L;  1TWG K;  2PA8 L;  2E2I K;  1WCM C;  2JA8 C;  3S1Q K;  3S16 C;  3FKI C;  3HOX K;  4A3I C;  2JA6 K;  2PMZ L;  4KN7 A;  4YFN A;  4A93 K;  4BY7 K;  3HKZ D;  4Y52 K;  3PO2 K;  4A3J K;  4C3H K;  3RZO C;  3GTG K;  5M5Y K;  2O5I A;  2E2J K;  3HOW C;  1SMY A;  2YU9 C;  5IYC C;  4A3M C;  5IYB C;  4A3F K;  2R92 C;  5C4J K;  4BY1 C;  4XLP A;  4GZY A;  2CW0 A;  4G7H A;  1SFO C;  1Y1W K;  3GTO C;  1TWF K;  1Y1V C;  3M3Y K;  1IW7 A;  2NVT C;  3HOY K;  3GTP C;  3M4O C;  2E2H C;  3I4N K;  2A68 A;  1ZYR A;  4OIQ A;  2JA7 K;  2R93 K;  2BE5 A;  4A3C K;  4QJV B;  1TWH K;  2PPB A;  3S1M C;  4MEY A;  2NVQ K;  2JA8 K;  1WCM K;  5FLM C;  4A3B C;  4LK0 A;  4A3K C;  3GTM C;  3S16 K;  2WAQ D;  1K83 K;  3FKI K;  1TWA C;  4OIP A;  4A3L K;  1BDF A;  4XLN A;  4A3I K;  3H3V L;  5C44 K;  1I3Q C;  4XSX A;  3CQZ C;  3GTJ K;  4BBS C;  3I4M C;  4OIN A;  1XPP A;  4Q4Z A;  4XSZ A;  3GTK C;  1I6H C;  3RZO K;  3PO3 K;  2YU9 K;  3HOZ K;  5IYC K;  5IYB K;  3S1N K;  2R7Z K;  4G7O A;  2WB1 L;  3H0G K;  5M3F K;  3HKZ L;  2NVX C;  2Y0S D;  4KMU A;  4BBR C;  4A3D C;  1TWC C;  3S15 K;  4Y7N K;  4LK1 A;  3GTP K;  5D4D A;  2PA8 D;  5IYD C;  4BXX C;  4NOI A;  1I50 K;  4OIO A;  4KN4 A;  3S17 K;  5IP9 K;  3S1R C;  2JA5 K;  3GTM K;  4X6A C;  4G7Z A;  2B63 C;  4QIW L;  2A6E A;  1TWG C;  3WOD A;  2E2I C;  3S14 C;  3S1Q C;  2NVY C;  3HOX C;  3GTK K;  4YFK A;  4C3I K;  3GTL C;  4LJZ A;  1I6H K;  4BY7 C;  4A93 C;  5M3M K;  3K7A C;  4A3J C;  3HOW K;  4A3G C;  1YNN A;  2E2J C;  4YFX A;  3EQL A;  4A3M K;  2A69 A;  4BBR K;  4A3F C;  4BY1 K;  2R92 K;  1TWC K;  5C4J C;  4A3D K;  3S2D C;  1SFO K;  4OIR A;  3GTO K;  1Y1V K;  1Y1W C;  5C3E C;  3M3Y C;  3GTQ C;  4BXX K;  5IYD K;  4MQ9 A;  5IP7 C;  5FJ8 K;  4A3E C;  2NVT K;  1R9T C;  3HOY C;  3M4O K;  2E2H K;  4AYB D;  3I4N C;  4LLG A;  2VUM C;  2R93 C;  3H3V D;  3S2H C;  4A3C C;  3S1R K;  3S1M K;  3RZD C;  4X6A K;  4MEX A;  2B63 K;  2NVQ C;  1HQM A;  3HOU C;  2PMZ D;  5FLM K;  5C4X K;  4A3B K;  4A3K K;  3HOV C;  3S14 K;  2O5J A;  4C2M K;  4A3L C;  1K83 C;  1TWA K;  2NVY K;  5M5W K;  5C4X C;  1I3Q K;  5C44 C;  3CQZ K;  3GTJ C;  3GTL K;  4C3J K;  3I4M K;  2WB1 D;  4BBS K;  3K7A K;  2JA6 C;  3PO3 C;  4A3G K;  1YNJ A;  2WAQ L;  4JK1 A;  4Y52 C;  3HOZ C;  3PO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...