2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
1K83K 4C2MK 2E2JC 5M3MK 4A3IK 4LLGA 2WB1L 3S15C 4QIWD 2E2IK 5C4JK 3HOWK 4A3BC 5C4XC 2E2HC 5FJ8K 2PA8D 4GZYA 2JA7K 3GTGC 1Y1VK 1ZYRA 2JA5C 4A3EC 4A93C 4A3MK 3GTMC 3DXJA 3S2DC 3GTKC 2E2JK 1BDFA 2O5JA 5C3EC 3HOYC 1XPPA 2NVXC 1HQMA 3HOVC 3S15K 3HKZL 4A3LC 4A3BK 3M4OK 5C4XK 2Y0SL 2B63C 2WAQL 4XLPA 4A3DC 1IW7A 3GTGK 4OIOA 2PPBA 4C3HK 2JA5K 4A3EK 4A3GK 2A6HA 2JA8K 4C3IK 3GTMK 3S2DK 3GTKK 5M5WK 5IP9K 1TWFC 5C3EK 4XLNA 1R9TC 2NVXK 2YU9K 3GTLK 3HOVK 3GTJC 5M3FK 3PO3C 4A3LK 2A68A 5IYBC 2B63K 3GTQC 4A3DK 3H3VD 2NVTK 3S1NC 3S16C 1I50C 3M4OC 2VUMC 1I3QK 4A3JC 1TWFK 1TWAC 3S14C 1R9TK 4AYBD 3EQLA 3PO3K 4A3GC 3GTJK 4QIWL 3I4NC 3S1MC 2JA8C 5D4DA 4YFKA 2NVQC 2R93K 5IYBK 2PA8L 5IP9C 3GTQK 3GTLC 3RZOC 2YU9C 2O5IA 2PMZD 3S16K 3S1NK 3FKIK 3HOUC 4QJVA 1I50K 4OIRA 5IYDC 2VUMK 5C44C 1SFOC 3H0GK 2NVYC 2NVTC 4A3JK 3I4MC 1TWAK 3S14K 3GTPC 3I4NK 3S1QC 3S1MK 4YFNA 2NVQK 4OIPA 4A3KC 1I3QC 4Y7NC 1I6HC 4MEYA 5M5XK 1YNNA 3RZOK 3HOUK 4YG2A 5IYCC 1TWHC 4Y52C 4C3JK 4Q4ZA 4Q5SA 2JA6C 2R93C 5C44K 1SFOK 4LK0A 5IYDK 1WCMC 2NVYK 3I4MK 1TWGC 4KN7A 3FKIC 4ZH4A 3GTPK 3S1QK 4BXXC 4MQ9A 4G7OA 3H0GC 4G7HA 3S2HC 4A3KK 3S17K 4Y7NK 2R7ZC 3H3VL 4LJZA 1I6HK 4KN4A 4NOIA 5IYCK 1TWHK 4Y52K 3K7AC 2JA6K 5TMFA 3PO2C 1WCMK 4X6AK 1TWGK 5IP7C 1YNJA 2A6EA 4AYBL 1I6VA 3GTOC 3RZDC 4BXXK 3S2HK 2CW0A 4G7ZA 4BY1C 2WB1D 2R7ZK 5FLMC 2PMZL 3HOXC 4LK1A 1Y1WC 4YFXA 4XSZA 3K7AK 2R92C 3PO2K 3S17C 4OINA 4BBRC 5IP7K 3HOZC 3GTOK 3RZDK 4BY7C 1SMYA 4X6AC 4BY1K 5FLMK 4A3CK 5M5YK 3HKZD 1TWCC 3HOXK 4A3FK 1Y1WK 4OIQA 2Y0SD 4BBSC 4XSXA 2WAQD 2R92K 3CQZC 4BBRK 3M3YC 3HOZK 4QJVB 4MEXA 5TMCA 3S1RC 1K83C 2E2HK 4BY7K 4JK1A 4A3IC 2E2IC 3HOWC 5C4JC 1TWCK 4A93K 4KMUA 4BBSK 3WODA 2BE5A 3CQZK 2JA7C 2A69A 1Y1VC 4A3CC 3M3YK 4A3FC 3HOYK 4A3MC 3S1RK
chains in the Genus database with same CATH superfamily
2D6FC 2FQTA 4KDDA 4A3IK 2WB1L 3S15C 2E2IK 3HOWK 5FJ8K 2PA8D 3GTGC 1Y1VK 3V4GA 1Y1WA 3S2DC 3DXJA 3GTKC 3IPJA 1O29A 3HOVC 3GIRA 4A3BK 3M4OK 5C4XK 5JVOA 4KARA 1WIHA 2WAQL 2B63C 4A3DC 4KASA 1IW7A 4LR2A 4A3GK 2JA8K 4C3IK 3CQZA 1J6VA 5C3EK 3GTLK 2YU9K 3GTJC 4FM9A 3QX3A 4GTBA 3GTQC 3H3VD 1VRQC 3M4OC 2VUMC 5EGHA 3L4KA 2JA7A 4A3JC 1TWFK 3PO3K 4AYBD 4RMFA 3FOFA 4A3GC 1O2FB 3S1MC 3TFIA 2JA8C 5D4DA 3GTLC 3RZOC 2YU9C 3S1NK 3GEIA 3HOUC 3HXAA 2E2HA 5IYDC 3N3YA 2JA5A 3I4NK 4P5AA 3FOEA 4G0VA 2NVQK 4OIPA 2NVXA 5IYCC 1O27A 4Y52C 4GTFA 1SFOK 1WCMC 1TWGC 4KN7A 1XZPB 4O2DA 3GEEA 1I3QA 1R9TA 1I6HK 1O26A 2JA6K 2PHCB 1HI9A 1ZVUA 4X6AK 3FKIA 4BLBA 1B4AA 1F9NA 3GTOC 4BXXK 1F7VA 1WOSA 5FLMC 4LK1A 2RGRA 4BLAA 4YFXA 2R92C 5IP7K 3TTGA 4KM8A 1WORA 2FQOA 4GTDA 2GSNA 4BY7C 1IL2A 4X6AC 3HOXK 1TWCC 3VA7A 4A3FK 4OIQA 4KAWX 4BBSC 2XCOA 4BBRK 1TWHA 3HOZK 1K83C 1KQ4A 4KATA 4C2MC 3AQOA 3H0GA 3FHZA 1WQGA 4A3FC 3SZYA 2E2JC 5M3MK 3A8IA 4QIWD 4P9SA 5JFEA 4C3HC 3GTMC 1XZPA 2P8TA 3AH5A 3T02A 1HQMA 3S15K 3HKZL 1WQHA 2EBBA 1DCPA 4LOWA 3GTGK 2ZFZA 3S2DK 3GTKK 3AQPA 5M5WK 4GTAA 4BKWA 3HOVK 1BS2A 5M3FK 1IE0A 5HL8A 4M1XA 2B63K 4A3DK 2E2IA 1I50C 3S14C 1Y1VA 1TWAC 3EQLA 4GT9A 3GTJK 3Q3QA 2R93K 3GTQK 2PA8L 4DDQA 4C3JC 2VUMK 5C44C 2NVYC 4A3JK 3GTPC 3S1MK 2ZUFA 4A3KC 4MEYA 3RZOK 3BP8C 2V6UA 3HOUK 4KC6A 4Q5SA 1YCLA 2GSOA 2R93C 5IYDK 4LK0A 3S2HC 1TWFA 2R7ZC 3H3VL 1XZQB 4NOIA 5IYCK 2W7VA 4Y52K 5TMFA 3PO2C 1WCMK 1TWGK 3TFJA 4AYBL 1I6VA 1WOPA 2CW0A 3GEHA 4J3NA 1Y1WC 4XSZA 5IOQA 4G0WA 2ZUEA 3LAPA 1V5VA 1SFOA 3GTOK 1SMYA 5FLMK 4A3CK 5M5YK 2Y0SD 4XSXA 2R92K 3CQZC 4QJVB 2JA6A 3S1RC 2E2HK 1G51A 4BY7K 2V6SA 5C4JC 1TWCK 5E68A 4A93K 4BBSK 4GTEA 3WODA 1BJTA 2JA7C 4A3CC 5IORA 1GE9A 4A3MC 4GTLA 1K83K 4C2MK 1XXCA 1YX2A 4LLGA 3TFHA 2E2HC 3A8KA 1ZYRA 2JA5C 4A3EC 4KB2A 4A93C 1XXAA 1IBAA 1DCOA 2E2JK 1BDFA 3HOYC 4LQYA 3G4CA 2NVXC 1PJ6A 1XZQA 4A3LC 3LAJA 4PABA 4C3HK 2Y3PA 3GTMK 4WJ4A 4XLNA 1R9TC 4G0UA 5IYBC 5IOSA 3S16C 1X31C 3OPFA 4KMAA 4FZBA 4P5BA 4QIWL 1WOOA 1WSVA 5CJ9A 2PMZD 4QJVA 1I50K 3OREA 3H0GK 3I4MC 3S14K 3GDZA 1EQRA 1TWAK 3GTGA 2GAHC 3S1QC 3GTKA 1ZXOA 4Y7NC 5CHPA 1YNNA 1VGXA 1TWHC 4C3JK 4Q4ZA 2B63A 5C44K 2NVYK 1EH1A 4ZH4A 3GTPK 2GAGC 4G7OA 3H0GC 4A3KK 4LJZA 1USMA 3GTJA 4KN4A 3ADAC 3K7AC 3GTQA 2RH6A 1J98A 1YNJA 2A6EA 2VUMA 1O25A 3RZDC 3S2HK 4BY1C 2WB1D 1J6XA 1AB4A 3LPXA 2R7ZK 2P5MA 3PO2K 3GTLA 2YU9A 4OINA 4AH6A 3BUEA 5TJ3A 1IQ0A 4GFQA 4WJ3M 1PJ7A 1C0AA 3NUHA 1Y1WK 2WAQD 4WILA 5EGEA 3M3YC 1WCMA 1TWGA 3ERED 4A3IC 2E2IC 3HOWC 1USOA 1INNA 1O2BA 3CQZK 1Y1VC 1IS1A 3A8JA 3T00A 3S1RK 1B4BA 1J6WA 1ISEA 3S0XA 5C4JK 1F93A 4A3BC 1EFWA 3GTOA 5C4XC 1ZBSA 4GZYA 2JA7K 1O2AA 4A3MK 2GSUA 4C3IC 2R92A 1ZQ1C 2O5JA 5C3EC 4XCHA 1XPPA 4KMDA 3N0CA 1VLOA 2Y0SL 5IOTA 1UV7A 4XLPA 3L4JA 2CFAB 1TWCA 4OIOA 2PPBA 2JA5K 4A3EK 2A6HA 1JVIA 1VH2A 5L46A 5IP9K 1TWFC 3HOYK 3PO3C 2NVXK 4A3LK 1K83A 2A68A 3OEPA 3S1NC 2NVTK 1PJ5A 4ILDA 4KMHA 1WSRA 3AD9C 1O24A 3GSIA 1I3QK 4KM9A 3AD7C 1R9TK 1VJEA 3I4NC 4C45A 3MMLB 4YFKA 2NVQC 5IYBK 5IP9C 2O5IA 3S16K 3FKIK 2V6TA 4OIRA 1JQWA 1SFOC 1DD5A 2NVTC 1JOEA 3GTMA 4YFNA 1O28A 1DCHA 1I3QC 1I6HC 5M5XK 4YG2A 3JSTA 4KB4A 3T01A 2JA6C 3AD8C 3I4MK 3FKIC 1XXBA 3S1QK 4BXXC 4MQ9A 4G7HA 3G4AA 3S17K 4Y7NK 3SZZA 1RU0A 1TWHK 1BGWA 5IP7C 1I50A 3BP3A 4G7ZA 1TWAA 2CFAA 1WQFA 2PMZL 3HOXC 3K7AK 3S17C 4BBRC 3HOZC 3CAGA 3RZDK 2XCQA 2NVYA 3N0BA 4BY1K 3GTPA 3HKZD 1EI6A 1EK8A 4MEXA 4GTCA 5TMCA 2R93A 4JK1A 2KWAA 2JH3A 1L0WA 4KMUA 4PAAA 1F7UA 2BE5A 2R7ZA 2XCRB 2A69A 3M3YK
chains in the Genus database with same CATH topology
1K83K 4C2MK 2E2JC 5M3MK 4A3IK 4LLGA 2WB1L 3S15C 4QIWD 2E2IK 5C4JK 3HOWK 4A3BC 5C4XC 2E2HC 5FJ8K 2PA8D 4GZYA 2JA7K 3GTGC 1Y1VK 1ZYRA 2JA5C 4A3EC 4A93C 4A3MK 3GTMC 3DXJA 3S2DC 3GTKC 2E2JK 1BDFA 2O5JA 5C3EC 3HOYC 1XPPA 2NVXC 1HQMA 3HOVC 3S15K 3HKZL 4A3LC 4A3BK 3M4OK 5C4XK 2Y0SL 2B63C 2WAQL 4XLPA 4A3DC 1IW7A 3GTGK 4OIOA 2PPBA 4C3HK 2JA5K 4A3EK 4A3GK 2A6HA 2JA8K 4C3IK 3GTMK 3S2DK 3GTKK 5M5WK 5IP9K 1TWFC 5C3EK 4XLNA 1R9TC 2NVXK 2YU9K 3GTLK 3HOVK 3GTJC 5M3FK 3PO3C 4A3LK 2A68A 5IYBC 2B63K 3GTQC 4A3DK 3H3VD 2NVTK 3S1NC 3S16C 1I50C 3M4OC 2VUMC 1I3QK 4A3JC 1TWFK 1TWAC 3S14C 1R9TK 4AYBD 3EQLA 3PO3K 4A3GC 3GTJK 4QIWL 3I4NC 3S1MC 2JA8C 5D4DA 4YFKA 2NVQC 2R93K 5IYBK 2PA8L 5IP9C 3GTQK 3GTLC 3RZOC 2YU9C 2O5IA 2PMZD 3S16K 3S1NK 3FKIK 3HOUC 4QJVA 1I50K 4OIRA 5IYDC 2VUMK 5C44C 1SFOC 3H0GK 2NVYC 2NVTC 4A3JK 3I4MC 1TWAK 3S14K 3GTPC 3I4NK 3S1QC 3S1MK 4YFNA 2NVQK 4OIPA 4A3KC 1I3QC 4Y7NC 1I6HC 4MEYA 5M5XK 1YNNA 3RZOK 3HOUK 4YG2A 5IYCC 1TWHC 4Y52C 4C3JK 4Q4ZA 4Q5SA 2JA6C 2R93C 5C44K 1SFOK 4LK0A 5IYDK 1WCMC 2NVYK 3I4MK 1TWGC 4KN7A 3FKIC 4ZH4A 3GTPK 3S1QK 4BXXC 4MQ9A 4G7OA 3H0GC 4G7HA 3S2HC 4A3KK 3S17K 4Y7NK 2R7ZC 3H3VL 4LJZA 1I6HK 4KN4A 4NOIA 5IYCK 1TWHK 4Y52K 3K7AC 2JA6K 5TMFA 3PO2C 1WCMK 4X6AK 1TWGK 5IP7C 1YNJA 2A6EA 4AYBL 1I6VA 3GTOC 3RZDC 4BXXK 3S2HK 2CW0A 4G7ZA 4BY1C 2WB1D 2R7ZK 5FLMC 2PMZL 3HOXC 4LK1A 1Y1WC 4YFXA 4XSZA 3K7AK 2R92C 3PO2K 3S17C 4OINA 4BBRC 5IP7K 3HOZC 3GTOK 3RZDK 4BY7C 1SMYA 4X6AC 4BY1K 5FLMK 4A3CK 5M5YK 3HKZD 1TWCC 3HOXK 4A3FK 1Y1WK 4OIQA 2Y0SD 4BBSC 4XSXA 2WAQD 2R92K 3CQZC 4BBRK 3M3YC 3HOZK 4QJVB 4MEXA 5TMCA 3S1RC 1K83C 2E2HK 4BY7K 4JK1A 4A3IC 2E2IC 3HOWC 5C4JC 1TWCK 4A93K 4KMUA 4BBSK 3WODA 2BE5A 3CQZK 2JA7C 2A69A 1Y1VC 4A3CC 3M3YK 4A3FC 3HOYK 4A3MC 3S1RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 K;  4C2M K;  2E2J C;  5M3M K;  4A3I K;  4LLG A;  2WB1 L;  3S15 C;  4QIW D;  2E2I K;  5C4J K;  3HOW K;  4A3B C;  5C4X C;  2E2H C;  5FJ8 K;  2PA8 D;  4GZY A;  2JA7 K;  3GTG C;  1Y1V K;  1ZYR A;  2JA5 C;  4A3E C;  4A93 C;  4A3M K;  3GTM C;  3DXJ A;  3S2D C;  3GTK C;  2E2J K;  1BDF A;  2O5J A;  5C3E C;  3HOY C;  1XPP A;  2NVX C;  1HQM A;  3HOV C;  3S15 K;  3HKZ L;  4A3L C;  4A3B K;  3M4O K;  5C4X K;  2Y0S L;  2B63 C;  2WAQ L;  4XLP A;  4A3D C;  1IW7 A;  3GTG K;  4OIO A;  2PPB A;  4C3H K;  2JA5 K;  4A3E K;  4A3G K;  2A6H A;  2JA8 K;  4C3I K;  3GTM K;  3S2D K;  3GTK K;  5M5W K;  5IP9 K;  1TWF C;  5C3E K;  4XLN A;  1R9T C;  2NVX K;  2YU9 K;  3GTL K;  3HOV K;  3GTJ C;  5M3F K;  3PO3 C;  4A3L K;  2A68 A;  5IYB C;  2B63 K;  3GTQ C;  4A3D K;  3H3V D;  2NVT K;  3S1N C;  3S16 C;  1I50 C;  3M4O C;  2VUM C;  1I3Q K;  4A3J C;  1TWF K;  1TWA C;  3S14 C;  1R9T K;  4AYB D;  3EQL A;  3PO3 K;  4A3G C;  3GTJ K;  4QIW L;  3I4N C;  3S1M C;  2JA8 C;  5D4D A;  4YFK A;  2NVQ C;  2R93 K;  5IYB K;  2PA8 L;  5IP9 C;  3GTQ K;  3GTL C;  3RZO C;  2YU9 C;  2O5I A;  2PMZ D;  3S16 K;  3S1N K;  3FKI K;  3HOU C;  4QJV A;  1I50 K;  4OIR A;  5IYD C;  2VUM K;  5C44 C;  1SFO C;  3H0G K;  2NVY C;  2NVT C;  4A3J K;  3I4M C;  1TWA K;  3S14 K;  3GTP C;  3I4N K;  3S1Q C;  3S1M K;  4YFN A;  2NVQ K;  4OIP A;  4A3K C;  1I3Q C;  4Y7N C;  1I6H C;  4MEY A;  5M5X K;  1YNN A;  3RZO K;  3HOU K;  4YG2 A;  5IYC C;  1TWH C;  4Y52 C;  4C3J K;  4Q4Z A;  4Q5S A;  2JA6 C;  2R93 C;  5C44 K;  1SFO K;  4LK0 A;  5IYD K;  1WCM C;  2NVY K;  3I4M K;  1TWG C;  4KN7 A;  3FKI C;  4ZH4 A;  3GTP K;  3S1Q K;  4BXX C;  4MQ9 A;  4G7O A;  3H0G C;  4G7H A;  3S2H C;  4A3K K;  3S17 K;  4Y7N K;  2R7Z C;  3H3V L;  4LJZ A;  1I6H K;  4KN4 A;  4NOI A;  5IYC K;  1TWH K;  4Y52 K;  3K7A C;  2JA6 K;  5TMF A;  3PO2 C;  1WCM K;  4X6A K;  1TWG K;  5IP7 C;  1YNJ A;  2A6E A;  4AYB L;  1I6V A;  3GTO C;  3RZD C;  4BXX K;  3S2H K;  2CW0 A;  4G7Z A;  4BY1 C;  2WB1 D;  2R7Z K;  5FLM C;  2PMZ L;  3HOX C;  4LK1 A;  1Y1W C;  4YFX A;  4XSZ A;  3K7A K;  2R92 C;  3PO2 K;  3S17 C;  4OIN A;  4BBR C;  5IP7 K;  3HOZ C;  3GTO K;  3RZD K;  4BY7 C;  1SMY A;  4X6A C;  4BY1 K;  5FLM K;  4A3C K;  5M5Y K;  3HKZ D;  1TWC C;  3HOX K;  4A3F K;  1Y1W K;  4OIQ A;  2Y0S D;  4BBS C;  4XSX A;  2WAQ D;  2R92 K;  3CQZ C;  4BBR K;  3M3Y C;  3HOZ K;  4QJV B;  4MEX A;  5TMC A;  3S1R C;  1K83 C;  2E2H K;  4BY7 K;  4JK1 A;  4A3I C;  2E2I C;  3HOW C;  5C4J C;  1TWC K;  4A93 K;  4KMU A;  4BBS K;  3WOD A;  2BE5 A;  3CQZ K;  2JA7 C;  2A69 A;  1Y1V C;  4A3C C;  3M3Y K;  4A3F C;  3HOY K;  4A3M C;  3S1R K; 
#chains in the Genus database with same CATH topology
 2D6F C;  2FQT A;  4KDD A;  4A3I K;  2WB1 L;  3S15 C;  2E2I K;  3HOW K;  5FJ8 K;  2PA8 D;  3GTG C;  1Y1V K;  3V4G A;  1Y1W A;  3S2D C;  3DXJ A;  3GTK C;  3IPJ A;  1O29 A;  3HOV C;  3GIR A;  4A3B K;  3M4O K;  5C4X K;  5JVO A;  4KAR A;  1WIH A;  2WAQ L;  2B63 C;  4A3D C;  4KAS A;  1IW7 A;  4LR2 A;  4A3G K;  2JA8 K;  4C3I K;  3CQZ A;  1J6V A;  5C3E K;  3GTL K;  2YU9 K;  3GTJ C;  4FM9 A;  3QX3 A;  4GTB A;  3GTQ C;  3H3V D;  1VRQ C;  3M4O C;  2VUM C;  5EGH A;  3L4K A;  2JA7 A;  4A3J C;  1TWF K;  3PO3 K;  4AYB D;  4RMF A;  3FOF A;  4A3G C;  1O2F B;  3S1M C;  3TFI A;  2JA8 C;  5D4D A;  3GTL C;  3RZO C;  2YU9 C;  3S1N K;  3GEI A;  3HOU C;  3HXA A;  2E2H A;  5IYD C;  3N3Y A;  2JA5 A;  3I4N K;  4P5A A;  3FOE A;  4G0V A;  2NVQ K;  4OIP A;  2NVX A;  5IYC C;  1O27 A;  4Y52 C;  4GTF A;  1SFO K;  1WCM C;  1TWG C;  4KN7 A;  1XZP B;  4O2D A;  3GEE A;  1I3Q A;  1R9T A;  1I6H K;  1O26 A;  2JA6 K;  2PHC B;  1HI9 A;  1ZVU A;  4X6A K;  3FKI A;  4BLB A;  1B4A A;  1F9N A;  3GTO C;  4BXX K;  1F7V A;  1WOS A;  5FLM C;  4LK1 A;  2RGR A;  4BLA A;  4YFX A;  2R92 C;  5IP7 K;  3TTG A;  4KM8 A;  1WOR A;  2FQO A;  4GTD A;  2GSN A;  4BY7 C;  1IL2 A;  4X6A C;  3HOX K;  1TWC C;  3VA7 A;  4A3F K;  4OIQ A;  4KAW X;  4BBS C;  2XCO A;  4BBR K;  1TWH A;  3HOZ K;  1K83 C;  1KQ4 A;  4KAT A;  4C2M C;  3AQO A;  3H0G A;  3FHZ A;  1WQG A;  4A3F C;  3SZY A;  2E2J C;  5M3M K;  3A8I A;  4QIW D;  4P9S A;  5JFE A;  4C3H C;  3GTM C;  1XZP A;  2P8T A;  3AH5 A;  3T02 A;  1HQM A;  3S15 K;  3HKZ L;  1WQH A;  2EBB A;  1DCP A;  4LOW A;  3GTG K;  2ZFZ A;  3S2D K;  3GTK K;  3AQP A;  5M5W K;  4GTA A;  4BKW A;  3HOV K;  1BS2 A;  5M3F K;  1IE0 A;  5HL8 A;  4M1X A;  2B63 K;  4A3D K;  2E2I A;  1I50 C;  3S14 C;  1Y1V A;  1TWA C;  3EQL A;  4GT9 A;  3GTJ K;  3Q3Q A;  2R93 K;  3GTQ K;  2PA8 L;  4DDQ A;  4C3J C;  2VUM K;  5C44 C;  2NVY C;  4A3J K;  3GTP C;  3S1M K;  2ZUF A;  4A3K C;  4MEY A;  3RZO K;  3BP8 C;  2V6U A;  3HOU K;  4KC6 A;  4Q5S A;  1YCL A;  2GSO A;  2R93 C;  5IYD K;  4LK0 A;  3S2H C;  1TWF A;  2R7Z C;  3H3V L;  1XZQ B;  4NOI A;  5IYC K;  2W7V A;  4Y52 K;  5TMF A;  3PO2 C;  1WCM K;  1TWG K;  3TFJ A;  4AYB L;  1I6V A;  1WOP A;  2CW0 A;  3GEH A;  4J3N A;  1Y1W C;  4XSZ A;  5IOQ A;  4G0W A;  2ZUE A;  3LAP A;  1V5V A;  1SFO A;  3GTO K;  1SMY A;  5FLM K;  4A3C K;  5M5Y K;  2Y0S D;  4XSX A;  2R92 K;  3CQZ C;  4QJV B;  2JA6 A;  3S1R C;  2E2H K;  1G51 A;  4BY7 K;  2V6S A;  5C4J C;  1TWC K;  5E68 A;  4A93 K;  4BBS K;  4GTE A;  3WOD A;  1BJT A;  2JA7 C;  4A3C C;  5IOR A;  1GE9 A;  4A3M C;  4GTL A;  1K83 K;  4C2M K;  1XXC A;  1YX2 A;  4LLG A;  3TFH A;  2E2H C;  3A8K A;  1ZYR A;  2JA5 C;  4A3E C;  4KB2 A;  4A93 C;  1XXA A;  1IBA A;  1DCO A;  2E2J K;  1BDF A;  3HOY C;  4LQY A;  3G4C A;  2NVX C;  1PJ6 A;  1XZQ A;  4A3L C;  3LAJ A;  4PAB A;  4C3H K;  2Y3P A;  3GTM K;  4WJ4 A;  4XLN A;  1R9T C;  4G0U A;  5IYB C;  5IOS A;  3S16 C;  1X31 C;  3OPF A;  4KMA A;  4FZB A;  4P5B A;  4QIW L;  1WOO A;  1WSV A;  5CJ9 A;  2PMZ D;  4QJV A;  1I50 K;  3ORE A;  3H0G K;  3I4M C;  3S14 K;  3GDZ A;  1EQR A;  1TWA K;  3GTG A;  2GAH C;  3S1Q C;  3GTK A;  1ZXO A;  4Y7N C;  5CHP A;  1YNN A;  1VGX A;  1TWH C;  4C3J K;  4Q4Z A;  2B63 A;  5C44 K;  2NVY K;  1EH1 A;  4ZH4 A;  3GTP K;  2GAG C;  4G7O A;  3H0G C;  4A3K K;  4LJZ A;  1USM A;  3GTJ A;  4KN4 A;  3ADA C;  3K7A C;  3GTQ A;  2RH6 A;  1J98 A;  1YNJ A;  2A6E A;  2VUM A;  1O25 A;  3RZD C;  3S2H K;  4BY1 C;  2WB1 D;  1J6X A;  1AB4 A;  3LPX A;  2R7Z K;  2P5M A;  3PO2 K;  3GTL A;  2YU9 A;  4OIN A;  4AH6 A;  3BUE A;  5TJ3 A;  1IQ0 A;  4GFQ A;  4WJ3 M;  1PJ7 A;  1C0A A;  3NUH A;  1Y1W K;  2WAQ D;  4WIL A;  5EGE A;  3M3Y C;  1WCM A;  1TWG A;  3ERE D;  4A3I C;  2E2I C;  3HOW C;  1USO A;  1INN A;  1O2B A;  3CQZ K;  1Y1V C;  1IS1 A;  3A8J A;  3T00 A;  3S1R K;  1B4B A;  1J6W A;  1ISE A;  3S0X A;  5C4J K;  1F93 A;  4A3B C;  1EFW A;  3GTO A;  5C4X C;  1ZBS A;  4GZY A;  2JA7 K;  1O2A A;  4A3M K;  2GSU A;  4C3I C;  2R92 A;  1ZQ1 C;  2O5J A;  5C3E C;  4XCH A;  1XPP A;  4KMD A;  3N0C A;  1VLO A;  2Y0S L;  5IOT A;  1UV7 A;  4XLP A;  3L4J A;  2CFA B;  1TWC A;  4OIO A;  2PPB A;  2JA5 K;  4A3E K;  2A6H A;  1JVI A;  1VH2 A;  5L46 A;  5IP9 K;  1TWF C;  3HOY K;  3PO3 C;  2NVX K;  4A3L K;  1K83 A;  2A68 A;  3OEP A;  3S1N C;  2NVT K;  1PJ5 A;  4ILD A;  4KMH A;  1WSR A;  3AD9 C;  1O24 A;  3GSI A;  1I3Q K;  4KM9 A;  3AD7 C;  1R9T K;  1VJE A;  3I4N C;  4C45 A;  3MML B;  4YFK A;  2NVQ C;  5IYB K;  5IP9 C;  2O5I A;  3S16 K;  3FKI K;  2V6T A;  4OIR A;  1JQW A;  1SFO C;  1DD5 A;  2NVT C;  1JOE A;  3GTM A;  4YFN A;  1O28 A;  1DCH A;  1I3Q C;  1I6H C;  5M5X K;  4YG2 A;  3JST A;  4KB4 A;  3T01 A;  2JA6 C;  3AD8 C;  3I4M K;  3FKI C;  1XXB A;  3S1Q K;  4BXX C;  4MQ9 A;  4G7H A;  3G4A A;  3S17 K;  4Y7N K;  3SZZ A;  1RU0 A;  1TWH K;  1BGW A;  5IP7 C;  1I50 A;  3BP3 A;  4G7Z A;  1TWA A;  2CFA A;  1WQF A;  2PMZ L;  3HOX C;  3K7A K;  3S17 C;  4BBR C;  3HOZ C;  3CAG A;  3RZD K;  2XCQ A;  2NVY A;  3N0B A;  4BY1 K;  3GTP A;  3HKZ D;  1EI6 A;  1EK8 A;  4MEX A;  4GTC A;  5TMC A;  2R93 A;  4JK1 A;  2KWA A;  2JH3 A;  1L0W A;  4KMU A;  4PAA A;  1F7U A;  2BE5 A;  2R7Z A;  2XCR B;  2A69 A;  3M3Y K; 
#chains in the Genus database with same CATH homology
 1K83 K;  4C2M K;  2E2J C;  5M3M K;  4A3I K;  4LLG A;  2WB1 L;  3S15 C;  4QIW D;  2E2I K;  5C4J K;  3HOW K;  4A3B C;  5C4X C;  2E2H C;  5FJ8 K;  2PA8 D;  4GZY A;  2JA7 K;  3GTG C;  1Y1V K;  1ZYR A;  2JA5 C;  4A3E C;  4A93 C;  4A3M K;  3GTM C;  3DXJ A;  3S2D C;  3GTK C;  2E2J K;  1BDF A;  2O5J A;  5C3E C;  3HOY C;  1XPP A;  2NVX C;  1HQM A;  3HOV C;  3S15 K;  3HKZ L;  4A3L C;  4A3B K;  3M4O K;  5C4X K;  2Y0S L;  2B63 C;  2WAQ L;  4XLP A;  4A3D C;  1IW7 A;  3GTG K;  4OIO A;  2PPB A;  4C3H K;  2JA5 K;  4A3E K;  4A3G K;  2A6H A;  2JA8 K;  4C3I K;  3GTM K;  3S2D K;  3GTK K;  5M5W K;  5IP9 K;  1TWF C;  5C3E K;  4XLN A;  1R9T C;  2NVX K;  2YU9 K;  3GTL K;  3HOV K;  3GTJ C;  5M3F K;  3PO3 C;  4A3L K;  2A68 A;  5IYB C;  2B63 K;  3GTQ C;  4A3D K;  3H3V D;  2NVT K;  3S1N C;  3S16 C;  1I50 C;  3M4O C;  2VUM C;  1I3Q K;  4A3J C;  1TWF K;  1TWA C;  3S14 C;  1R9T K;  4AYB D;  3EQL A;  3PO3 K;  4A3G C;  3GTJ K;  4QIW L;  3I4N C;  3S1M C;  2JA8 C;  5D4D A;  4YFK A;  2NVQ C;  2R93 K;  5IYB K;  2PA8 L;  5IP9 C;  3GTQ K;  3GTL C;  3RZO C;  2YU9 C;  2O5I A;  2PMZ D;  3S16 K;  3S1N K;  3FKI K;  3HOU C;  4QJV A;  1I50 K;  4OIR A;  5IYD C;  2VUM K;  5C44 C;  1SFO C;  3H0G K;  2NVY C;  2NVT C;  4A3J K;  3I4M C;  1TWA K;  3S14 K;  3GTP C;  3I4N K;  3S1Q C;  3S1M K;  4YFN A;  2NVQ K;  4OIP A;  4A3K C;  1I3Q C;  4Y7N C;  1I6H C;  4MEY A;  5M5X K;  1YNN A;  3RZO K;  3HOU K;  4YG2 A;  5IYC C;  1TWH C;  4Y52 C;  4C3J K;  4Q4Z A;  4Q5S A;  2JA6 C;  2R93 C;  5C44 K;  1SFO K;  4LK0 A;  5IYD K;  1WCM C;  2NVY K;  3I4M K;  1TWG C;  4KN7 A;  3FKI C;  4ZH4 A;  3GTP K;  3S1Q K;  4BXX C;  4MQ9 A;  4G7O A;  3H0G C;  4G7H A;  3S2H C;  4A3K K;  3S17 K;  4Y7N K;  2R7Z C;  3H3V L;  4LJZ A;  1I6H K;  4KN4 A;  4NOI A;  5IYC K;  1TWH K;  4Y52 K;  3K7A C;  2JA6 K;  5TMF A;  3PO2 C;  1WCM K;  4X6A K;  1TWG K;  5IP7 C;  1YNJ A;  2A6E A;  4AYB L;  1I6V A;  3GTO C;  3RZD C;  4BXX K;  3S2H K;  2CW0 A;  4G7Z A;  4BY1 C;  2WB1 D;  2R7Z K;  5FLM C;  2PMZ L;  3HOX C;  4LK1 A;  1Y1W C;  4YFX A;  4XSZ A;  3K7A K;  2R92 C;  3PO2 K;  3S17 C;  4OIN A;  4BBR C;  5IP7 K;  3HOZ C;  3GTO K;  3RZD K;  4BY7 C;  1SMY A;  4X6A C;  4BY1 K;  5FLM K;  4A3C K;  5M5Y K;  3HKZ D;  1TWC C;  3HOX K;  4A3F K;  1Y1W K;  4OIQ A;  2Y0S D;  4BBS C;  4XSX A;  2WAQ D;  2R92 K;  3CQZ C;  4BBR K;  3M3Y C;  3HOZ K;  4QJV B;  4MEX A;  5TMC A;  3S1R C;  1K83 C;  2E2H K;  4BY7 K;  4JK1 A;  4A3I C;  2E2I C;  3HOW C;  5C4J C;  1TWC K;  4A93 K;  4KMU A;  4BBS K;  3WOD A;  2BE5 A;  3CQZ K;  2JA7 C;  2A69 A;  1Y1V C;  4A3C C;  3M3Y K;  4A3F C;  3HOY K;  4A3M C;  3S1R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...