2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
3HOZK 3EQLA 4Y7NC 4BXXC 3PO3K 5C3EK 2E2HK 5IYCK 3S14K 2R92C 1I50C 3HOXC 2NVQK 2A68A 1IW7A 5C4JK 4C2MK 4BBRC 1TWHK 4A3EK 3S2DC 5M5WK 2JA7C 2R93C 5IP9C 3HKZL 4AYBL 4A3GK 5FLMK 3S1NK 2E2HC 1WCMC 5C44C 1TWAK 1R9TK 3M4OK 4A3CC 4Y7NK 4YFNA 5M5XK 4A3LC 4X6AC 2A69A 2CW0A 1TWHC 5TMCA 5IYBC 2WB1L 5D4DA 2R92K 2A6HA 1I50K 4KN4A 4YG2A 4OIOA 3HOXK 4A3KC 3S1MC 3RZOC 4LK0A 4LK1A 3CQZC 4BBRK 3HOUC 3S2DK 4BY1C 1HQMA 2PA8D 4KMUA 4XSXA 5IP7C 2JA7K 4BBSC 1YNJA 5IP9K 1K83C 1Y1VK 3K7AC 4A3FC 4LLGA 1WCMK 5C44K 2WAQD 1SMYA 4JK1A 4A3CK 3HOWC 4BY7C 3M3YC 3S17C 4A3LK 4X6AK 4A93C 5IYBK 3H3VL 3S1MK 1I6VA 4A3KK 1Y1VC 2PMZL 3RZOK 3CQZK 3HOUK 3GTKC 4A3MC 4BY1K 3GTQC 4QIWD 5IP7K 4G7ZA 4OIRA 4BBSK 1I3QC 2R7ZK 1K83K 3K7AK 4A3FK 2O5IA 3HOYC 4OIPA 2BE5A 4A3JC 4BY7K 4ZH4A 3HOWK 3M3YK 3S17K 1R9TC 3S2HK 1ZYRA 2JA5K 4YFXA 4A93K 3S16K 4OIQA 2WB1D 4YFKA 1TWFK 4A3IC 2JA8C 2YU9C 2NVTC 2Y0SD 2R7ZC 3S16C 4LJZA 4GZYA 1Y1WC 5C4XK 4NOIA 4Y52C 4G7OA 3GTKK 4A3MK 1YNNA 3DXJA 3GTOC 3GTQK 3PO2K 1I3QK 3I4NC 4Q5SA 3S2HC 4C3HK 3HOYK 1TWCC 2JA5C 4Q4ZA 4QJVA 4A3JK 4A3DC 2NVXC 1TWFC 4C3JK 2JA6C 2E2JK 5C4XC 5TMFA 1XPPA 4C3IK 2PA8L 2B63K 3HOVC 3H0GC 2JA8K 5FJ8K 4A3IK 5IYDC 2YU9K 2NVTK 4AYBD 3HKZD 2PPBA 4XSZA 3PO2C 1TWGC 3RZDC 1Y1WK 3GTLK 4Y52K 2WAQL 4G7HA 3GTPC 4OINA 3GTOK 1BDFA 3I4NK 3GTGC 1TWCK 2E2JC 3S1QC 3FKIK 3I4MC 4A3BK 2B63C 3S1RK 2NVXK 1I6HK 4QJVB 5M3FK 2VUMC 2NVYC 1I6HC 2JA6K 3GTJC 3GTMC 2E2IC 3GTLC 1SFOC 4QIWL 3S15C 3HOVK 3HOZC 3H0GK 5M3MK 5IYDK 3PO3C 5C3EC 1TWGK 3RZDK 3FKIC 5IYCC 5M5YK 3S14C 4A3BC 4KN7A 3GTPK 3S1RC 4A3DK 4MEXA 2NVQC 4BXXK 3GTGK 5C4JC 3S1QK 4XLPA 4A3EC 3I4MK 3WODA 2VUMK 2Y0SL 3H3VD 2NVYK 2O5JA 4XLNA 3GTJK 5FLMC 4MEYA 4MQ9A 2PMZD 2E2IK 3GTMK 3S1NC 4A3GC 1SFOK 1TWAC 3M4OC 3S15K 2A6EA 2R93K
chains in the Genus database with same CATH superfamily
3EQLA 2GSOA 5HL8A 2E2HK 5IYCK 3HOXC 2A68A 5C4JK 4C2MK 5IOTA 1IE0A 1O2AA 1IQ0A 3HKZL 4KMHA 2E2HC 1TWAK 3M4OK 4Y7NK 3BUEA 1BJTA 5JVOA 4KMDA 2WB1L 1WSVA 5D4DA 2FQTA 2R92K 4KN4A 4OIOA 3N0CA 3CQZC 3N0BA 1HQMA 2PA8D 1YNJA 5IP9K 2NVXA 4A3FC 1ZBSA 1WCMK 5C44K 3BP8C 3HOWC 4BY7C 3S17C 4A3LK 4X6AK 1WQHA 2V6TA 4P5BA 1I6VA 4A3KK 3S1MK 3RZOK 1DD5A 4FZBA 3HOUK 3GTKC 4A3MC 3GEEA 4BY1K 4QIWD 4G7ZA 4BBSK 1K83K 2O5IA 5IORA 2NVYA 4OIPA 3GTMA 1Y1WA 1ZXOA 3A8IA 4C3JC 1IL2A 1JOEA 3M3YK 4C3IC 2JA5K 4YFKA 2YU9C 2Y0SD 4GZYA 5C4XK 4NOIA 4GTBA 1YNNA 3GTQK 3GTOC 3PO2K 1I3QK 1YX2A 3HOYK 2JA5C 4KATA 1O29A 3GTPA 1RU0A 5C4XC 1F7UA 1XPPA 3H0GC 4A3IK 5IYDC 1ZVUA 3PO2C 4DDQA 3VA7A 4OINA 1BDFA 1V5VA 3S1QC 2D6FC 3BP3A 2V6SA 1WCMA 1WSRA 3L4JA 4AH6A 2E2IC 3AQPA 1ISEA 1XXBA 3HOZC 3PO3C 4FM9A 2GSUA 3N3YA 5M5YK 4A3DK 1R9TA 2NVQC 3GTGK 1K83A 1INNA 3I4MK 2O5JA 1YCLA 4XLNA 1EH1A 5TJ3A 5FLMC 1VRQC 3MMLB 5IOQA 4A3DC 3AH5A 4G0VA 1Y1VA 3S14K 4RMFA 1I50C 3ADAC 3GTQA 1I3QA 3T00A 1TWHK 4A3EK 4KARA 3S2DC 5M5WK 2JA7C 4AYBL 4A3GK 3S1NK 4P9SA 4YFNA 3GEIA 2A69A 2R7ZA 1TWHC 5IYBC 4YG2A 3HOXK 4LK0A 3G4CA 5IP7C 4J3NA 3K7AC 3JSTA 4LLGA 3FOEA 1PJ5A 2PMZL 1JQWA 3Q3QA 3CQZK 1L0WA 1WOSA 4KB2A 4A3FK 4C3HC 1IBAA 1DCHA 4BY7K 3HOWK 3S17K 1ZYRA 4YFXA 4KM8A 1TWCA 4OIQA 2WB1D 3FKIA 1TWFK 3S16C 2NVTC 2RGRA 1Y1WC 1IS1A 1F9NA 5EGEA 4Y52C 2JA6A 3GTKK 4A3MK 3I4NC 4XCHA 4GTDA 1J98A 4WJ3M 4Q4ZA 4QJVA 1TWFC 1WQGA 4C3JK 1KQ4A 3TFIA 2ZUFA 5TMFA 4C3IK 1WOPA 2PA8L 2B63K 3HOVC 5FJ8K 2YU9K 2PPBA 4XSZA 2VUMA 1TWGC 3GTLK 4G7HA 3GTPC 3GTOK 1XZPA 2B63C 2E2HA 4QJVB 5M3FK 4BKWA 3GTJC 4GTLA 3GTLC 1SFOC 4QIWL 3S15C 3H0GK 5M3MK 4GTAA 5IYDK 2GSNA 5C3EC 2W7VA 1C0AA 3OEPA 3CQZA 1VJEA 1TWAA 4MEXA 4G0WA 4BXXK 1HI9A 3S1QK 4XLPA 1XZPB 3H3VD 2Y0SL 2PHCB 1EFWA 2R92A 4MEYA 2E2IK 4KM9A 1R9TC 2A6EA 2R93K 3HOZK 4BXXC 3PO3K 3CAGA 3GTKA 2NVQK 4WILA 1IW7A 2RH6A 4BBRC 2R93C 1USMA 4KB4A 5FLMK 3OREA 4A3CC 4LR2A 1J6VA 2YU9A 1WORA 1B4BA 1PJ6A 1I50K 3GTOA 3S2DK 4XSXA 2JA7K 2JA5A 1PJ7A 2ZUEA 3T02A 5JFEA 2WAQD 1EK8A 3H0GA 3LAPA 4A93C 5IYBK 4GFQA 5EGHA 3GSIA 1O27A 4GTFA 5IP7K 4OIRA 4WJ4A 1EQRA 3K7AK 1O24A 2V6UA 1GE9A 4A3JC 2E2IA 4ZH4A 3S2HK 4KMAA 1BS2A 3FOFA 2JA8C 3LPXA 2P8TA 4KC6A 4LJZA 2XCQA 3OPFA 2GAHC 1G51A 1O28A 4G7OA 1BGWA 3S2HC 4C3HK 1DCOA 1TWCC 4PABA 3AQOA 2NVXC 5CHPA 2JA6C 3S0XA 3AD9C 1O2BA 2CFAA 4O2DA 3GTGA 3S16K 1I6HK 2NVTK 1O26A 1XXAA 3HKZD 1I50A 3RZDC 1Y1WK 4Y52K 4BLBA 3I4NK 2JA7A 3GIRA 3G4AA 4C45A 3S1RK 3AD8C 2VUMC 1I6HC 2NVYC 3GTMC 3HXAA 3A8JA 2CFAB 2GAGC 1VH2A 3HOVK 1TWHA 4LOWA 1TWGK 1AB4A 5IYCC 1O25A 4KN7A 3GTPK 3S1RC 3T01A 3TTGA 4KAWX 3L4KA 5C4JC 4C2MC 2KWAA 3GTJK 3QX3A 1SFOK 1TWAC 3M4OC 3S15K 4Y7NC 5C3EK 2XCOA 3NUHA 1X31C 2R92C 1UV7A 4KASA 4GT9A 4KDDA 5IP9C 1DCPA 4P5AA 1XXCA 3SZZA 1WCMC 5C44C 1R9TK 3GDZA 5M5XK 5CJ9A 3FHZA 4A3LC 4X6AC 2CW0A 5IOSA 5TMCA 1USOA 2A6HA 3S1MC 4A3KC 2XCRB 3RZOC 2ZFZA 1JVIA 4LK1A 4BBRK 3HOUC 4BY1C 4KMUA 1XZQA 4BBSC 2P5MA 1K83C 1Y1VK 3TFJA 1TWFA 1J6XA 1SMYA 4JK1A 4A3CK 3TFHA 3M3YC 2EBBA 1TWGA 1O2FB 3H3VL 4LQYA 1Y1VC 1WQFA 3GTQC 4PAAA 1I3QC 2R7ZK 1XZQB 3LAJA 2JH3A 3HOYC 2B63A 2BE5A 3GTJA 3GTLA 1SFOA 3A8KA 4A93K 3IPJA 3AD7C 4A3IC 2R7ZC 3DXJA 4G0UA 4Q5SA 4ILDA 4A3JK 4GTCA 1J6WA 3ERED 2E2JK 1EI6A 2Y3PA 2JA8K 4AYBD 2WAQL 1ZQ1C 4M1XA 2FQOA 2R93A 3GTGC 1TWCK 4GTEA 2E2JC 1WIHA 3FKIK 3I4MC 4A3BK 2NVXK 1F7VA 2JA6K 5E68A 1WOOA 3GEHA 1B4AA 1VGXA 3RZDK 3FKIC 1F93A 3S14C 4A3BC 5L46A 1VLOA 3SZYA 4A3EC 3WODA 4BLAA 2VUMK 2NVYK 4A3GC 3V4GA 4MQ9A 2PMZD 3GTMK 3S1NC
chains in the Genus database with same CATH topology
3HOZK 3EQLA 4Y7NC 4BXXC 3PO3K 5C3EK 2E2HK 5IYCK 3S14K 2R92C 1I50C 3HOXC 2NVQK 2A68A 1IW7A 5C4JK 4C2MK 4BBRC 1TWHK 4A3EK 3S2DC 5M5WK 2JA7C 2R93C 5IP9C 3HKZL 4AYBL 4A3GK 5FLMK 3S1NK 2E2HC 1WCMC 5C44C 1TWAK 1R9TK 3M4OK 4A3CC 4Y7NK 4YFNA 5M5XK 4A3LC 4X6AC 2A69A 2CW0A 1TWHC 5TMCA 5IYBC 2WB1L 5D4DA 2R92K 2A6HA 1I50K 4KN4A 4YG2A 4OIOA 3HOXK 4A3KC 3S1MC 3RZOC 4LK0A 4LK1A 3CQZC 4BBRK 3HOUC 3S2DK 4BY1C 1HQMA 2PA8D 4KMUA 4XSXA 5IP7C 2JA7K 4BBSC 1YNJA 5IP9K 1K83C 1Y1VK 3K7AC 4A3FC 4LLGA 1WCMK 5C44K 2WAQD 1SMYA 4JK1A 4A3CK 3HOWC 4BY7C 3M3YC 3S17C 4A3LK 4X6AK 4A93C 5IYBK 3H3VL 3S1MK 1I6VA 4A3KK 1Y1VC 2PMZL 3RZOK 3CQZK 3HOUK 3GTKC 4A3MC 4BY1K 3GTQC 4QIWD 5IP7K 4G7ZA 4OIRA 4BBSK 1I3QC 2R7ZK 1K83K 3K7AK 4A3FK 2O5IA 3HOYC 4OIPA 2BE5A 4A3JC 4BY7K 4ZH4A 3HOWK 3M3YK 3S17K 1R9TC 3S2HK 1ZYRA 2JA5K 4YFXA 4A93K 3S16K 4OIQA 2WB1D 4YFKA 1TWFK 4A3IC 2JA8C 2YU9C 2NVTC 2Y0SD 2R7ZC 3S16C 4LJZA 4GZYA 1Y1WC 5C4XK 4NOIA 4Y52C 4G7OA 3GTKK 4A3MK 1YNNA 3DXJA 3GTOC 3GTQK 3PO2K 1I3QK 3I4NC 4Q5SA 3S2HC 4C3HK 3HOYK 1TWCC 2JA5C 4Q4ZA 4QJVA 4A3JK 4A3DC 2NVXC 1TWFC 4C3JK 2JA6C 2E2JK 5C4XC 5TMFA 1XPPA 4C3IK 2PA8L 2B63K 3HOVC 3H0GC 2JA8K 5FJ8K 4A3IK 5IYDC 2YU9K 2NVTK 4AYBD 3HKZD 2PPBA 4XSZA 3PO2C 1TWGC 3RZDC 1Y1WK 3GTLK 4Y52K 2WAQL 4G7HA 3GTPC 4OINA 3GTOK 1BDFA 3I4NK 3GTGC 1TWCK 2E2JC 3S1QC 3FKIK 3I4MC 4A3BK 2B63C 3S1RK 2NVXK 1I6HK 4QJVB 5M3FK 2VUMC 2NVYC 1I6HC 2JA6K 3GTJC 3GTMC 2E2IC 3GTLC 1SFOC 4QIWL 3S15C 3HOVK 3HOZC 3H0GK 5M3MK 5IYDK 3PO3C 5C3EC 1TWGK 3RZDK 3FKIC 5IYCC 5M5YK 3S14C 4A3BC 4KN7A 3GTPK 3S1RC 4A3DK 4MEXA 2NVQC 4BXXK 3GTGK 5C4JC 3S1QK 4XLPA 4A3EC 3I4MK 3WODA 2VUMK 2Y0SL 3H3VD 2NVYK 2O5JA 4XLNA 3GTJK 5FLMC 4MEYA 4MQ9A 2PMZD 2E2IK 3GTMK 3S1NC 4A3GC 1SFOK 1TWAC 3M4OC 3S15K 2A6EA 2R93K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ K;  3EQL A;  4Y7N C;  4BXX C;  3PO3 K;  5C3E K;  2E2H K;  5IYC K;  3S14 K;  2R92 C;  1I50 C;  3HOX C;  2NVQ K;  2A68 A;  1IW7 A;  5C4J K;  4C2M K;  4BBR C;  1TWH K;  4A3E K;  3S2D C;  5M5W K;  2JA7 C;  2R93 C;  5IP9 C;  3HKZ L;  4AYB L;  4A3G K;  5FLM K;  3S1N K;  2E2H C;  1WCM C;  5C44 C;  1TWA K;  1R9T K;  3M4O K;  4A3C C;  4Y7N K;  4YFN A;  5M5X K;  4A3L C;  4X6A C;  2A69 A;  2CW0 A;  1TWH C;  5TMC A;  5IYB C;  2WB1 L;  5D4D A;  2R92 K;  2A6H A;  1I50 K;  4KN4 A;  4YG2 A;  4OIO A;  3HOX K;  4A3K C;  3S1M C;  3RZO C;  4LK0 A;  4LK1 A;  3CQZ C;  4BBR K;  3HOU C;  3S2D K;  4BY1 C;  1HQM A;  2PA8 D;  4KMU A;  4XSX A;  5IP7 C;  2JA7 K;  4BBS C;  1YNJ A;  5IP9 K;  1K83 C;  1Y1V K;  3K7A C;  4A3F C;  4LLG A;  1WCM K;  5C44 K;  2WAQ D;  1SMY A;  4JK1 A;  4A3C K;  3HOW C;  4BY7 C;  3M3Y C;  3S17 C;  4A3L K;  4X6A K;  4A93 C;  5IYB K;  3H3V L;  3S1M K;  1I6V A;  4A3K K;  1Y1V C;  2PMZ L;  3RZO K;  3CQZ K;  3HOU K;  3GTK C;  4A3M C;  4BY1 K;  3GTQ C;  4QIW D;  5IP7 K;  4G7Z A;  4OIR A;  4BBS K;  1I3Q C;  2R7Z K;  1K83 K;  3K7A K;  4A3F K;  2O5I A;  3HOY C;  4OIP A;  2BE5 A;  4A3J C;  4BY7 K;  4ZH4 A;  3HOW K;  3M3Y K;  3S17 K;  1R9T C;  3S2H K;  1ZYR A;  2JA5 K;  4YFX A;  4A93 K;  3S16 K;  4OIQ A;  2WB1 D;  4YFK A;  1TWF K;  4A3I C;  2JA8 C;  2YU9 C;  2NVT C;  2Y0S D;  2R7Z C;  3S16 C;  4LJZ A;  4GZY A;  1Y1W C;  5C4X K;  4NOI A;  4Y52 C;  4G7O A;  3GTK K;  4A3M K;  1YNN A;  3DXJ A;  3GTO C;  3GTQ K;  3PO2 K;  1I3Q K;  3I4N C;  4Q5S A;  3S2H C;  4C3H K;  3HOY K;  1TWC C;  2JA5 C;  4Q4Z A;  4QJV A;  4A3J K;  4A3D C;  2NVX C;  1TWF C;  4C3J K;  2JA6 C;  2E2J K;  5C4X C;  5TMF A;  1XPP A;  4C3I K;  2PA8 L;  2B63 K;  3HOV C;  3H0G C;  2JA8 K;  5FJ8 K;  4A3I K;  5IYD C;  2YU9 K;  2NVT K;  4AYB D;  3HKZ D;  2PPB A;  4XSZ A;  3PO2 C;  1TWG C;  3RZD C;  1Y1W K;  3GTL K;  4Y52 K;  2WAQ L;  4G7H A;  3GTP C;  4OIN A;  3GTO K;  1BDF A;  3I4N K;  3GTG C;  1TWC K;  2E2J C;  3S1Q C;  3FKI K;  3I4M C;  4A3B K;  2B63 C;  3S1R K;  2NVX K;  1I6H K;  4QJV B;  5M3F K;  2VUM C;  2NVY C;  1I6H C;  2JA6 K;  3GTJ C;  3GTM C;  2E2I C;  3GTL C;  1SFO C;  4QIW L;  3S15 C;  3HOV K;  3HOZ C;  3H0G K;  5M3M K;  5IYD K;  3PO3 C;  5C3E C;  1TWG K;  3RZD K;  3FKI C;  5IYC C;  5M5Y K;  3S14 C;  4A3B C;  4KN7 A;  3GTP K;  3S1R C;  4A3D K;  4MEX A;  2NVQ C;  4BXX K;  3GTG K;  5C4J C;  3S1Q K;  4XLP A;  4A3E C;  3I4M K;  3WOD A;  2VUM K;  2Y0S L;  3H3V D;  2NVY K;  2O5J A;  4XLN A;  3GTJ K;  5FLM C;  4MEY A;  4MQ9 A;  2PMZ D;  2E2I K;  3GTM K;  3S1N C;  4A3G C;  1SFO K;  1TWA C;  3M4O C;  3S15 K;  2A6E A;  2R93 K; 
#chains in the Genus database with same CATH topology
 3EQL A;  2GSO A;  5HL8 A;  2E2H K;  5IYC K;  3HOX C;  2A68 A;  5C4J K;  4C2M K;  5IOT A;  1IE0 A;  1O2A A;  1IQ0 A;  3HKZ L;  4KMH A;  2E2H C;  1TWA K;  3M4O K;  4Y7N K;  3BUE A;  1BJT A;  5JVO A;  4KMD A;  2WB1 L;  1WSV A;  5D4D A;  2FQT A;  2R92 K;  4KN4 A;  4OIO A;  3N0C A;  3CQZ C;  3N0B A;  1HQM A;  2PA8 D;  1YNJ A;  5IP9 K;  2NVX A;  4A3F C;  1ZBS A;  1WCM K;  5C44 K;  3BP8 C;  3HOW C;  4BY7 C;  3S17 C;  4A3L K;  4X6A K;  1WQH A;  2V6T A;  4P5B A;  1I6V A;  4A3K K;  3S1M K;  3RZO K;  1DD5 A;  4FZB A;  3HOU K;  3GTK C;  4A3M C;  3GEE A;  4BY1 K;  4QIW D;  4G7Z A;  4BBS K;  1K83 K;  2O5I A;  5IOR A;  2NVY A;  4OIP A;  3GTM A;  1Y1W A;  1ZXO A;  3A8I A;  4C3J C;  1IL2 A;  1JOE A;  3M3Y K;  4C3I C;  2JA5 K;  4YFK A;  2YU9 C;  2Y0S D;  4GZY A;  5C4X K;  4NOI A;  4GTB A;  1YNN A;  3GTQ K;  3GTO C;  3PO2 K;  1I3Q K;  1YX2 A;  3HOY K;  2JA5 C;  4KAT A;  1O29 A;  3GTP A;  1RU0 A;  5C4X C;  1F7U A;  1XPP A;  3H0G C;  4A3I K;  5IYD C;  1ZVU A;  3PO2 C;  4DDQ A;  3VA7 A;  4OIN A;  1BDF A;  1V5V A;  3S1Q C;  2D6F C;  3BP3 A;  2V6S A;  1WCM A;  1WSR A;  3L4J A;  4AH6 A;  2E2I C;  3AQP A;  1ISE A;  1XXB A;  3HOZ C;  3PO3 C;  4FM9 A;  2GSU A;  3N3Y A;  5M5Y K;  4A3D K;  1R9T A;  2NVQ C;  3GTG K;  1K83 A;  1INN A;  3I4M K;  2O5J A;  1YCL A;  4XLN A;  1EH1 A;  5TJ3 A;  5FLM C;  1VRQ C;  3MML B;  5IOQ A;  4A3D C;  3AH5 A;  4G0V A;  1Y1V A;  3S14 K;  4RMF A;  1I50 C;  3ADA C;  3GTQ A;  1I3Q A;  3T00 A;  1TWH K;  4A3E K;  4KAR A;  3S2D C;  5M5W K;  2JA7 C;  4AYB L;  4A3G K;  3S1N K;  4P9S A;  4YFN A;  3GEI A;  2A69 A;  2R7Z A;  1TWH C;  5IYB C;  4YG2 A;  3HOX K;  4LK0 A;  3G4C A;  5IP7 C;  4J3N A;  3K7A C;  3JST A;  4LLG A;  3FOE A;  1PJ5 A;  2PMZ L;  1JQW A;  3Q3Q A;  3CQZ K;  1L0W A;  1WOS A;  4KB2 A;  4A3F K;  4C3H C;  1IBA A;  1DCH A;  4BY7 K;  3HOW K;  3S17 K;  1ZYR A;  4YFX A;  4KM8 A;  1TWC A;  4OIQ A;  2WB1 D;  3FKI A;  1TWF K;  3S16 C;  2NVT C;  2RGR A;  1Y1W C;  1IS1 A;  1F9N A;  5EGE A;  4Y52 C;  2JA6 A;  3GTK K;  4A3M K;  3I4N C;  4XCH A;  4GTD A;  1J98 A;  4WJ3 M;  4Q4Z A;  4QJV A;  1TWF C;  1WQG A;  4C3J K;  1KQ4 A;  3TFI A;  2ZUF A;  5TMF A;  4C3I K;  1WOP A;  2PA8 L;  2B63 K;  3HOV C;  5FJ8 K;  2YU9 K;  2PPB A;  4XSZ A;  2VUM A;  1TWG C;  3GTL K;  4G7H A;  3GTP C;  3GTO K;  1XZP A;  2B63 C;  2E2H A;  4QJV B;  5M3F K;  4BKW A;  3GTJ C;  4GTL A;  3GTL C;  1SFO C;  4QIW L;  3S15 C;  3H0G K;  5M3M K;  4GTA A;  5IYD K;  2GSN A;  5C3E C;  2W7V A;  1C0A A;  3OEP A;  3CQZ A;  1VJE A;  1TWA A;  4MEX A;  4G0W A;  4BXX K;  1HI9 A;  3S1Q K;  4XLP A;  1XZP B;  3H3V D;  2Y0S L;  2PHC B;  1EFW A;  2R92 A;  4MEY A;  2E2I K;  4KM9 A;  1R9T C;  2A6E A;  2R93 K;  3HOZ K;  4BXX C;  3PO3 K;  3CAG A;  3GTK A;  2NVQ K;  4WIL A;  1IW7 A;  2RH6 A;  4BBR C;  2R93 C;  1USM A;  4KB4 A;  5FLM K;  3ORE A;  4A3C C;  4LR2 A;  1J6V A;  2YU9 A;  1WOR A;  1B4B A;  1PJ6 A;  1I50 K;  3GTO A;  3S2D K;  4XSX A;  2JA7 K;  2JA5 A;  1PJ7 A;  2ZUE A;  3T02 A;  5JFE A;  2WAQ D;  1EK8 A;  3H0G A;  3LAP A;  4A93 C;  5IYB K;  4GFQ A;  5EGH A;  3GSI A;  1O27 A;  4GTF A;  5IP7 K;  4OIR A;  4WJ4 A;  1EQR A;  3K7A K;  1O24 A;  2V6U A;  1GE9 A;  4A3J C;  2E2I A;  4ZH4 A;  3S2H K;  4KMA A;  1BS2 A;  3FOF A;  2JA8 C;  3LPX A;  2P8T A;  4KC6 A;  4LJZ A;  2XCQ A;  3OPF A;  2GAH C;  1G51 A;  1O28 A;  4G7O A;  1BGW A;  3S2H C;  4C3H K;  1DCO A;  1TWC C;  4PAB A;  3AQO A;  2NVX C;  5CHP A;  2JA6 C;  3S0X A;  3AD9 C;  1O2B A;  2CFA A;  4O2D A;  3GTG A;  3S16 K;  1I6H K;  2NVT K;  1O26 A;  1XXA A;  3HKZ D;  1I50 A;  3RZD C;  1Y1W K;  4Y52 K;  4BLB A;  3I4N K;  2JA7 A;  3GIR A;  3G4A A;  4C45 A;  3S1R K;  3AD8 C;  2VUM C;  1I6H C;  2NVY C;  3GTM C;  3HXA A;  3A8J A;  2CFA B;  2GAG C;  1VH2 A;  3HOV K;  1TWH A;  4LOW A;  1TWG K;  1AB4 A;  5IYC C;  1O25 A;  4KN7 A;  3GTP K;  3S1R C;  3T01 A;  3TTG A;  4KAW X;  3L4K A;  5C4J C;  4C2M C;  2KWA A;  3GTJ K;  3QX3 A;  1SFO K;  1TWA C;  3M4O C;  3S15 K;  4Y7N C;  5C3E K;  2XCO A;  3NUH A;  1X31 C;  2R92 C;  1UV7 A;  4KAS A;  4GT9 A;  4KDD A;  5IP9 C;  1DCP A;  4P5A A;  1XXC A;  3SZZ A;  1WCM C;  5C44 C;  1R9T K;  3GDZ A;  5M5X K;  5CJ9 A;  3FHZ A;  4A3L C;  4X6A C;  2CW0 A;  5IOS A;  5TMC A;  1USO A;  2A6H A;  3S1M C;  4A3K C;  2XCR B;  3RZO C;  2ZFZ A;  1JVI A;  4LK1 A;  4BBR K;  3HOU C;  4BY1 C;  4KMU A;  1XZQ A;  4BBS C;  2P5M A;  1K83 C;  1Y1V K;  3TFJ A;  1TWF A;  1J6X A;  1SMY A;  4JK1 A;  4A3C K;  3TFH A;  3M3Y C;  2EBB A;  1TWG A;  1O2F B;  3H3V L;  4LQY A;  1Y1V C;  1WQF A;  3GTQ C;  4PAA A;  1I3Q C;  2R7Z K;  1XZQ B;  3LAJ A;  2JH3 A;  3HOY C;  2B63 A;  2BE5 A;  3GTJ A;  3GTL A;  1SFO A;  3A8K A;  4A93 K;  3IPJ A;  3AD7 C;  4A3I C;  2R7Z C;  3DXJ A;  4G0U A;  4Q5S A;  4ILD A;  4A3J K;  4GTC A;  1J6W A;  3ERE D;  2E2J K;  1EI6 A;  2Y3P A;  2JA8 K;  4AYB D;  2WAQ L;  1ZQ1 C;  4M1X A;  2FQO A;  2R93 A;  3GTG C;  1TWC K;  4GTE A;  2E2J C;  1WIH A;  3FKI K;  3I4M C;  4A3B K;  2NVX K;  1F7V A;  2JA6 K;  5E68 A;  1WOO A;  3GEH A;  1B4A A;  1VGX A;  3RZD K;  3FKI C;  1F93 A;  3S14 C;  4A3B C;  5L46 A;  1VLO A;  3SZY A;  4A3E C;  3WOD A;  4BLA A;  2VUM K;  2NVY K;  4A3G C;  3V4G A;  4MQ9 A;  2PMZ D;  3GTM K;  3S1N C; 
#chains in the Genus database with same CATH homology
 3HOZ K;  3EQL A;  4Y7N C;  4BXX C;  3PO3 K;  5C3E K;  2E2H K;  5IYC K;  3S14 K;  2R92 C;  1I50 C;  3HOX C;  2NVQ K;  2A68 A;  1IW7 A;  5C4J K;  4C2M K;  4BBR C;  1TWH K;  4A3E K;  3S2D C;  5M5W K;  2JA7 C;  2R93 C;  5IP9 C;  3HKZ L;  4AYB L;  4A3G K;  5FLM K;  3S1N K;  2E2H C;  1WCM C;  5C44 C;  1TWA K;  1R9T K;  3M4O K;  4A3C C;  4Y7N K;  4YFN A;  5M5X K;  4A3L C;  4X6A C;  2A69 A;  2CW0 A;  1TWH C;  5TMC A;  5IYB C;  2WB1 L;  5D4D A;  2R92 K;  2A6H A;  1I50 K;  4KN4 A;  4YG2 A;  4OIO A;  3HOX K;  4A3K C;  3S1M C;  3RZO C;  4LK0 A;  4LK1 A;  3CQZ C;  4BBR K;  3HOU C;  3S2D K;  4BY1 C;  1HQM A;  2PA8 D;  4KMU A;  4XSX A;  5IP7 C;  2JA7 K;  4BBS C;  1YNJ A;  5IP9 K;  1K83 C;  1Y1V K;  3K7A C;  4A3F C;  4LLG A;  1WCM K;  5C44 K;  2WAQ D;  1SMY A;  4JK1 A;  4A3C K;  3HOW C;  4BY7 C;  3M3Y C;  3S17 C;  4A3L K;  4X6A K;  4A93 C;  5IYB K;  3H3V L;  3S1M K;  1I6V A;  4A3K K;  1Y1V C;  2PMZ L;  3RZO K;  3CQZ K;  3HOU K;  3GTK C;  4A3M C;  4BY1 K;  3GTQ C;  4QIW D;  5IP7 K;  4G7Z A;  4OIR A;  4BBS K;  1I3Q C;  2R7Z K;  1K83 K;  3K7A K;  4A3F K;  2O5I A;  3HOY C;  4OIP A;  2BE5 A;  4A3J C;  4BY7 K;  4ZH4 A;  3HOW K;  3M3Y K;  3S17 K;  1R9T C;  3S2H K;  1ZYR A;  2JA5 K;  4YFX A;  4A93 K;  3S16 K;  4OIQ A;  2WB1 D;  4YFK A;  1TWF K;  4A3I C;  2JA8 C;  2YU9 C;  2NVT C;  2Y0S D;  2R7Z C;  3S16 C;  4LJZ A;  4GZY A;  1Y1W C;  5C4X K;  4NOI A;  4Y52 C;  4G7O A;  3GTK K;  4A3M K;  1YNN A;  3DXJ A;  3GTO C;  3GTQ K;  3PO2 K;  1I3Q K;  3I4N C;  4Q5S A;  3S2H C;  4C3H K;  3HOY K;  1TWC C;  2JA5 C;  4Q4Z A;  4QJV A;  4A3J K;  4A3D C;  2NVX C;  1TWF C;  4C3J K;  2JA6 C;  2E2J K;  5C4X C;  5TMF A;  1XPP A;  4C3I K;  2PA8 L;  2B63 K;  3HOV C;  3H0G C;  2JA8 K;  5FJ8 K;  4A3I K;  5IYD C;  2YU9 K;  2NVT K;  4AYB D;  3HKZ D;  2PPB A;  4XSZ A;  3PO2 C;  1TWG C;  3RZD C;  1Y1W K;  3GTL K;  4Y52 K;  2WAQ L;  4G7H A;  3GTP C;  4OIN A;  3GTO K;  1BDF A;  3I4N K;  3GTG C;  1TWC K;  2E2J C;  3S1Q C;  3FKI K;  3I4M C;  4A3B K;  2B63 C;  3S1R K;  2NVX K;  1I6H K;  4QJV B;  5M3F K;  2VUM C;  2NVY C;  1I6H C;  2JA6 K;  3GTJ C;  3GTM C;  2E2I C;  3GTL C;  1SFO C;  4QIW L;  3S15 C;  3HOV K;  3HOZ C;  3H0G K;  5M3M K;  5IYD K;  3PO3 C;  5C3E C;  1TWG K;  3RZD K;  3FKI C;  5IYC C;  5M5Y K;  3S14 C;  4A3B C;  4KN7 A;  3GTP K;  3S1R C;  4A3D K;  4MEX A;  2NVQ C;  4BXX K;  3GTG K;  5C4J C;  3S1Q K;  4XLP A;  4A3E C;  3I4M K;  3WOD A;  2VUM K;  2Y0S L;  3H3V D;  2NVY K;  2O5J A;  4XLN A;  3GTJ K;  5FLM C;  4MEY A;  4MQ9 A;  2PMZ D;  2E2I K;  3GTM K;  3S1N C;  4A3G C;  1SFO K;  1TWA C;  3M4O C;  3S15 K;  2A6E A;  2R93 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...