2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
3CQZK 3K7AK 2JA6K 5IYDC 5C3EC 4A3DC 2R7ZK 2YU9C 5FJ8K 2WB1D 2E2IK 1HQMA 3HKZL 4GZYA 5C4XC 4A3JK 5M5XK 3S2HC 1XPPA 4A3BK 4LK1A 3GTPK 3DXJA 4BXXC 3S1MK 2PMZD 4A3EK 1TWAC 2A68A 4MEXA 1YNJA 5C4JK 4BBSC 4G7ZA 4A3MK 1TWFC 2JA5C 4A3CC 5TMCA 4A93K 1IW7A 2E2HC 3I4NC 3S14K 4KMUA 5IYBK 4A3IK 2NVXC 2JA8C 3S1NC 4C3JK 4X6AK 4YFNA 4Q4ZA 2R93C 2CW0A 3H3VL 4BY1K 3GTLC 5IP9C 4A3GK 3M4OC 5M5WK 3RZDK 5IP7K 1I3QK 1Y1WC 5M3MK 4Q5SA 3GTQK 5C3EK 4A3FC 2NVQC 3HOZK 3EQLA 3HKZD 4LJZA 4QJVB 2YU9K 3HOWC 4A3DK 1Y1VC 1TWHC 2E2JC 1I50C 5IYCC 1TWCC 5C4XK 4Y52K 3S2HK 3RZOC 4KN7A 3S17C 1I6VA 2VUMC 4BXXK 2PA8L 1TWAK 2A6HA 1SMYA 5FLMC 4BBRC 4A3CK 1TWFK 4BBSK 2E2HK 3HOXK 3I4NK 3H3VD 2R92C 3S1QC 1I6HC 4OIRA 3FKIK 3H0GC 2JA8K 3HOVK 3S1NK 4BY7C 5C44C 2R93K 2B63C 3GTMC 5IP9K 2JA7C 3M4OK 4A3LC 3S15K 5D4DA 2A6EA 3K7AC 2JA6C 4NOIA 1R9TC 1TWGC 1Y1WK 3I4MC 4A3FK 2NVQK 5IYDK 3HOWK 1Y1VK 4C2MK 4XLPA 4OIPA 3S1RC 3HOUC 2PPBA 1I50K 2O5IA 5IYCK 2PA8D 3GTJC 4A3KC 4Y7NC 1SFOC 4XSXA 5M3FK 4ZH4A 4JK1A 4A3MC 3S17K 2VUMK 4LK0A 1K83C 3PO2C 5FLMK 4G7HA 4BBRK 2O5JA 2JA5K 2Y0SL 4OIQA 1ZYRA 3PO3C 1I6HK 4MQ9A 3S2DC 3H0GK 4OINA 2NVTC 2NVYC 2NVXK 4MEYA 5C44K 3S16C 5TMFA 3GTGC 4AYBL 2B63K 3GTKC 3GTMK 4G7OA 5M5YK 3HOYC 2WAQL 3M3YC 4LLGA 3GTLK 2JA7K 4QIWL 4A3LK 3GTOC 1WCMC 3GTQC 3CQZC 4YG2A 1TWGK 1BDFA 4C3IK 1R9TK 3HOZC 4XSZA 3I4MK 2R7ZC 2E2IC 4OIOA 4Y52C 1TWHK 3S1RK 3WODA 2E2JK 4A3JC 3HOUK 2WB1L 4A3BC 3GTJK 3GTPC 1TWCK 4Y7NK 4A3KK 1SFOK 3S1MC 4XLNA 4A3EC 3RZOK 1YNNA 2Y0SD 5C4JC 1K83K 3HOXC 3PO2K 4A93C 2A69A 2PMZL 3FKIC 2BE5A 3HOVC 3S14C 4AYBD 3PO3K 5IYBC 4A3IC 4C3HK 2WAQD 2R92K 2NVTK 3S2DK 2NVYK 3S1QK 3S16K 4X6AC 4QIWD 4BY1C 3GTGK 4BY7K 3GTKK 4YFKA 4A3GC 3HOYK 4KN4A 4YFXA 3M3YK 3S15C 3RZDC 5IP7C 1I3QC 3GTOK 1WCMK 4QJVA
chains in the Genus database with same CATH superfamily
3CQZK 2JA6K 5C3EC 1USMA 2YU9C 1J6VA 1TWHA 2WB1D 1WORA 1G51A 1RU0A 2E2IK 3GTJA 4GZYA 5C4XC 1INNA 1XPPA 4A3BK 4BXXC 3S1MK 1WQGA 4A3CC 1WQFA 4G7ZA 1TWFC 1IW7A 2E2HC 2R92A 4J3NA 2JA8C 2ZFZA 3FHZA 5IP9C 2JH3A 5M5WK 4WILA 3RZDK 2JA6A 1XXCA 1YX2A 5M3MK 4Q5SA 4M1XA 4A3FC 3HOZK 2E2IA 3HOWC 4GT9A 4C2MC 5IOQA 2D6FC 1DCPA 4KDDA 1I50C 1TWCC 1C0AA 3FOFA 3RZOC 1WOPA 4P5BA 4BLAA 2PA8L 4BBSK 3HOXK 4KB2A 3HOVK 5C44C 1IL2A 2R93K 2B63C 1YCLA 3AD7C 1ZQ1C 1WCMA 3K7AC 4NOIA 3V4GA 1R9TC 2ZUFA 1VH2A 4OIPA 3S1RC 3AQOA 5IYCK 1X31C 1O2BA 1SFOC 2V6UA 4KATA 4XSXA 4ZH4A 1USOA 2XCOA 2VUMK 3QX3A 3PO3C 2FQTA 2R93A 1UV7A 3TTGA 4C3HC 3H0GK 1WOOA 2NVYC 2NVXK 4MEYA 3GTKC 3FOEA 3GTMK 3M3YC 4LLGA 2JA7K 1JQWA 4GTDA 3L4JA 3I4MK 4XSZA 1L0WA 2R7ZC 3SZZA 3GSIA 2EBBA 4GTLA 4A3JC 2VUMA 3OREA 3LPXA 5JFEA 4Y7NK 1TWAA 1O26A 1K83K 1WIHA 4WJ4A 2A69A 2PMZL 3S14C 2NVXA 5IYBC 3GTMA 3S2DK 1PJ7A 2NVTK 3S1QK 3T02A 3TFJA 3ADAC 4A3GC 4P5AA 3G4AA 1ZXOA 3HOYK 3GTOK 5IYDC 1J98A 4KAWX 3A8IA 3HKZL 1IQ0A 3T01A 3S2HC 4GTAA 4LK1A 3GTPK 3DXJA 4GTFA 4KMHA 4A3EK 5JVOA 5C4JK 2XCRB 5TMCA 4A93K 3I4NC 2V6TA 4KC6A 4A3IK 4YFNA 3A8JA 2CW0A 3H3VL 4BY1K 3M4OC 1B4AA 3T00A 5IP7K 4C3IC 3BP8C 5C3EK 2NVQC 4QJVB 4GTEA 2YU9K 1F7UA 1Y1VC 1TWHC 1O28A 5C4XK 4Y52K 2P8TA 4BXXK 1I6VA 5FLMC 1SMYA 4A3CK 4BBRC 1TWFK 2E2HK 2R92C 3FKIK 2JA8K 3GTGA 3OEPA 4O2DA 1PJ6A 5IP9K 3S15K 2A6EA 2Y3PA 3CQZA 2JA6C 1TWGC 4A3FK 3HOWK 4C2MK 3HOUC 1I50K 2PA8D 3SZYA 4G0UA 5M3FK 4JK1A 4PAAA 4LK0A 4G7HA 3FKIA 2O5JA 2JA5K 1JOEA 2Y0SL 4G0WA 1ZYRA 4MQ9A 4BKWA 5C44K 2B63K 3GTLK 4KB4A 1WCMC 1R9TK 3HOZC 1BDFA 1I50A 4OIOA 3S1RK 2E2JK 1O25A 1EK8A 2GSUA 4RMFA 3GIRA 1SFOK 3TFIA 4XLNA 1YNNA 3N0BA 2JA5A 3HOXC 1EH1A 3HOVC 3PO3K 1WOSA 4C3HK 4C3JC 4X6AC 2NVYK 4GTBA 3GTLA 4BY7K 3GTKK 4YFKA 3Q3QA 1VRQC 3M3YK 4P9SA 1EI6A 1I3QC 4XCHA 3G4CA 4A3DC 2R7ZK 1HQMA 1F93A 4A3JK 1DCHA 5M5XK 2KWAA 4FZBA 2PMZD 1TWAC 2A68A 3GEEA 4MEXA 1YNJA 4A3MK 3S14K 3H0GA 4KMUA 5IYBK 3LAJA 2NVXC 1PJ5A 3S1NC 1XZPA 4LOWA 2JA7A 4A3GK 3S0XA 1BJTA 1BS2A 1Y1WC 3GTQK 2RGRA 3EQLA 3HKZD 1ZBSA 5IORA 1EFWA 1XXBA 2PHCB 3S2HK 1IS1A 4FM9A 4KARA 3S17C 1K83A 1O2AA 3I4NK 3BP3A 3H3VD 3S1QC 1I6HC 4OIRA 4LR2A 3N3YA 3BUEA 3GTOA 3M4OK 4A3LC 5D4DA 3GTQA 3CAGA 1VJEA 2NVQK 4GFQA 3AQPA 1Y1VK 1VLOA 4C45A 4XLPA 2PPBA 2O5IA 1O24A 3GTPA 3GTJC 3LAPA 4A3KC 1F7VA 3PO2C 5FLMK 2CFAA 4BBRK 4OIQA 1AB4A 2GAHC 2P5MA 3OPFA 4OINA 3S16C 5TMFA 3GTGC 4AYBL 4G7OA 2WAQL 1WQHA 4QIWL 3CQZC 1TWGK 2YU9A 1Y1VA 1O27A 1IBAA 2E2IC 1ISEA 1O2FB 4Y52C 3HOUK 2WB1L 4BLBA 4A3BC 2XCQA 5L46A 1TWCK 3S1MC 3RZOK 3VA7A 2Y0SD 3TFHA 1TWFA 2E2HA 5E68A 3FKIC 2BE5A 1DCOA 3JSTA 3L4KA 4KN4A 5TJ3A 3GEHA 4YFXA 3S15C 3RZDC 1TWGA 1WCMK 1XZQA 3K7AK 3GDZA 1XZQB 1BGWA 5FJ8K 4ILDA 1F9NA 1TWCA 5IOTA 1B4BA 2GSNA 4LQYA 4BBSC 2JA5C 4KM9A 4KMAA 4C3JK 4Q4ZA 3ERED 2R93C 4X6AK 2B63A 4PABA 4KM8A 3GTLC 2V6SA 1JVIA 1I3QK 1R9TA 3AH5A 5EGHA 4A3DK 4LJZA 2E2JC 5EGEA 3AD8C 5IYCC 2RH6A 1SFOA 4KN7A 2VUMC 1TWAK 2A6HA 2NVYA 3H0GC 3S1NK 4BY7C 3GTKA 3GTMC 4WJ3M 1I3QA 2JA7C 1XZPB 3AD9C 1KQ4A 1Y1WK 3I4MC 2R7ZA 5IYDK 1IE0A 1DD5A 1EQRA 5CHPA 1GE9A 4GTCA 5IOSA 1XXAA 4Y7NC 1HI9A 3IPJA 5HL8A 4A3MC 3S17K 1K83C 3N0CA 1WSRA 2ZUEA 2GSOA 1I6HK 3S2DC 2NVTC 1J6WA 1V5VA 3MMLB 5M5YK 3HOYC 2W7VA 3A8KA 3NUHA 2FQOA 3GTOC 4A3LK 1Y1WA 3GTQC 4YG2A 4C3IK 1WSVA 5CJ9A 3GEIA 1TWHK 4DDQA 3WODA 4G0VA 3GTJK 3GTPC 4A3KK 1O29A 4A3EC 4KMDA 4AH6A 5C4JC 3PO2K 4A93C 1VGXA 1ZVUA 4AYBD 2CFAB 4A3IC 1J6XA 2WAQD 2R92K 3S16K 4QIWD 4BY1C 3HXAA 2GAGC 3GTGK 4KASA 5IP7C 4QJVA
chains in the Genus database with same CATH topology
3CQZK 3K7AK 2JA6K 5IYDC 5C3EC 4A3DC 2R7ZK 2YU9C 5FJ8K 2WB1D 2E2IK 1HQMA 3HKZL 4GZYA 5C4XC 4A3JK 5M5XK 3S2HC 1XPPA 4A3BK 4LK1A 3GTPK 3DXJA 4BXXC 3S1MK 2PMZD 4A3EK 1TWAC 2A68A 4MEXA 1YNJA 5C4JK 4BBSC 4G7ZA 4A3MK 1TWFC 2JA5C 4A3CC 5TMCA 4A93K 1IW7A 2E2HC 3I4NC 3S14K 4KMUA 5IYBK 4A3IK 2NVXC 2JA8C 3S1NC 4C3JK 4X6AK 4YFNA 4Q4ZA 2R93C 2CW0A 3H3VL 4BY1K 3GTLC 5IP9C 4A3GK 3M4OC 5M5WK 3RZDK 5IP7K 1I3QK 1Y1WC 5M3MK 4Q5SA 3GTQK 5C3EK 4A3FC 2NVQC 3HOZK 3EQLA 3HKZD 4LJZA 4QJVB 2YU9K 3HOWC 4A3DK 1Y1VC 1TWHC 2E2JC 1I50C 5IYCC 1TWCC 5C4XK 4Y52K 3S2HK 3RZOC 4KN7A 3S17C 1I6VA 2VUMC 4BXXK 2PA8L 1TWAK 2A6HA 1SMYA 5FLMC 4BBRC 4A3CK 1TWFK 4BBSK 2E2HK 3HOXK 3I4NK 3H3VD 2R92C 3S1QC 1I6HC 4OIRA 3FKIK 3H0GC 2JA8K 3HOVK 3S1NK 4BY7C 5C44C 2R93K 2B63C 3GTMC 5IP9K 2JA7C 3M4OK 4A3LC 3S15K 5D4DA 2A6EA 3K7AC 2JA6C 4NOIA 1R9TC 1TWGC 1Y1WK 3I4MC 4A3FK 2NVQK 5IYDK 3HOWK 1Y1VK 4C2MK 4XLPA 4OIPA 3S1RC 3HOUC 2PPBA 1I50K 2O5IA 5IYCK 2PA8D 3GTJC 4A3KC 4Y7NC 1SFOC 4XSXA 5M3FK 4ZH4A 4JK1A 4A3MC 3S17K 2VUMK 4LK0A 1K83C 3PO2C 5FLMK 4G7HA 4BBRK 2O5JA 2JA5K 2Y0SL 4OIQA 1ZYRA 3PO3C 1I6HK 4MQ9A 3S2DC 3H0GK 4OINA 2NVTC 2NVYC 2NVXK 4MEYA 5C44K 3S16C 5TMFA 3GTGC 4AYBL 2B63K 3GTKC 3GTMK 4G7OA 5M5YK 3HOYC 2WAQL 3M3YC 4LLGA 3GTLK 2JA7K 4QIWL 4A3LK 3GTOC 1WCMC 3GTQC 3CQZC 4YG2A 1TWGK 1BDFA 4C3IK 1R9TK 3HOZC 4XSZA 3I4MK 2R7ZC 2E2IC 4OIOA 4Y52C 1TWHK 3S1RK 3WODA 2E2JK 4A3JC 3HOUK 2WB1L 4A3BC 3GTJK 3GTPC 1TWCK 4Y7NK 4A3KK 1SFOK 3S1MC 4XLNA 4A3EC 3RZOK 1YNNA 2Y0SD 5C4JC 1K83K 3HOXC 3PO2K 4A93C 2A69A 2PMZL 3FKIC 2BE5A 3HOVC 3S14C 4AYBD 3PO3K 5IYBC 4A3IC 4C3HK 2WAQD 2R92K 2NVTK 3S2DK 2NVYK 3S1QK 3S16K 4X6AC 4QIWD 4BY1C 3GTGK 4BY7K 3GTKK 4YFKA 4A3GC 3HOYK 4KN4A 4YFXA 3M3YK 3S15C 3RZDC 5IP7C 1I3QC 3GTOK 1WCMK 4QJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ K;  3K7A K;  2JA6 K;  5IYD C;  5C3E C;  4A3D C;  2R7Z K;  2YU9 C;  5FJ8 K;  2WB1 D;  2E2I K;  1HQM A;  3HKZ L;  4GZY A;  5C4X C;  4A3J K;  5M5X K;  3S2H C;  1XPP A;  4A3B K;  4LK1 A;  3GTP K;  3DXJ A;  4BXX C;  3S1M K;  2PMZ D;  4A3E K;  1TWA C;  2A68 A;  4MEX A;  1YNJ A;  5C4J K;  4BBS C;  4G7Z A;  4A3M K;  1TWF C;  2JA5 C;  4A3C C;  5TMC A;  4A93 K;  1IW7 A;  2E2H C;  3I4N C;  3S14 K;  4KMU A;  5IYB K;  4A3I K;  2NVX C;  2JA8 C;  3S1N C;  4C3J K;  4X6A K;  4YFN A;  4Q4Z A;  2R93 C;  2CW0 A;  3H3V L;  4BY1 K;  3GTL C;  5IP9 C;  4A3G K;  3M4O C;  5M5W K;  3RZD K;  5IP7 K;  1I3Q K;  1Y1W C;  5M3M K;  4Q5S A;  3GTQ K;  5C3E K;  4A3F C;  2NVQ C;  3HOZ K;  3EQL A;  3HKZ D;  4LJZ A;  4QJV B;  2YU9 K;  3HOW C;  4A3D K;  1Y1V C;  1TWH C;  2E2J C;  1I50 C;  5IYC C;  1TWC C;  5C4X K;  4Y52 K;  3S2H K;  3RZO C;  4KN7 A;  3S17 C;  1I6V A;  2VUM C;  4BXX K;  2PA8 L;  1TWA K;  2A6H A;  1SMY A;  5FLM C;  4BBR C;  4A3C K;  1TWF K;  4BBS K;  2E2H K;  3HOX K;  3I4N K;  3H3V D;  2R92 C;  3S1Q C;  1I6H C;  4OIR A;  3FKI K;  3H0G C;  2JA8 K;  3HOV K;  3S1N K;  4BY7 C;  5C44 C;  2R93 K;  2B63 C;  3GTM C;  5IP9 K;  2JA7 C;  3M4O K;  4A3L C;  3S15 K;  5D4D A;  2A6E A;  3K7A C;  2JA6 C;  4NOI A;  1R9T C;  1TWG C;  1Y1W K;  3I4M C;  4A3F K;  2NVQ K;  5IYD K;  3HOW K;  1Y1V K;  4C2M K;  4XLP A;  4OIP A;  3S1R C;  3HOU C;  2PPB A;  1I50 K;  2O5I A;  5IYC K;  2PA8 D;  3GTJ C;  4A3K C;  4Y7N C;  1SFO C;  4XSX A;  5M3F K;  4ZH4 A;  4JK1 A;  4A3M C;  3S17 K;  2VUM K;  4LK0 A;  1K83 C;  3PO2 C;  5FLM K;  4G7H A;  4BBR K;  2O5J A;  2JA5 K;  2Y0S L;  4OIQ A;  1ZYR A;  3PO3 C;  1I6H K;  4MQ9 A;  3S2D C;  3H0G K;  4OIN A;  2NVT C;  2NVY C;  2NVX K;  4MEY A;  5C44 K;  3S16 C;  5TMF A;  3GTG C;  4AYB L;  2B63 K;  3GTK C;  3GTM K;  4G7O A;  5M5Y K;  3HOY C;  2WAQ L;  3M3Y C;  4LLG A;  3GTL K;  2JA7 K;  4QIW L;  4A3L K;  3GTO C;  1WCM C;  3GTQ C;  3CQZ C;  4YG2 A;  1TWG K;  1BDF A;  4C3I K;  1R9T K;  3HOZ C;  4XSZ A;  3I4M K;  2R7Z C;  2E2I C;  4OIO A;  4Y52 C;  1TWH K;  3S1R K;  3WOD A;  2E2J K;  4A3J C;  3HOU K;  2WB1 L;  4A3B C;  3GTJ K;  3GTP C;  1TWC K;  4Y7N K;  4A3K K;  1SFO K;  3S1M C;  4XLN A;  4A3E C;  3RZO K;  1YNN A;  2Y0S D;  5C4J C;  1K83 K;  3HOX C;  3PO2 K;  4A93 C;  2A69 A;  2PMZ L;  3FKI C;  2BE5 A;  3HOV C;  3S14 C;  4AYB D;  3PO3 K;  5IYB C;  4A3I C;  4C3H K;  2WAQ D;  2R92 K;  2NVT K;  3S2D K;  2NVY K;  3S1Q K;  3S16 K;  4X6A C;  4QIW D;  4BY1 C;  3GTG K;  4BY7 K;  3GTK K;  4YFK A;  4A3G C;  3HOY K;  4KN4 A;  4YFX A;  3M3Y K;  3S15 C;  3RZD C;  5IP7 C;  1I3Q C;  3GTO K;  1WCM K;  4QJV A; 
#chains in the Genus database with same CATH topology
 3CQZ K;  2JA6 K;  5C3E C;  1USM A;  2YU9 C;  1J6V A;  1TWH A;  2WB1 D;  1WOR A;  1G51 A;  1RU0 A;  2E2I K;  3GTJ A;  4GZY A;  5C4X C;  1INN A;  1XPP A;  4A3B K;  4BXX C;  3S1M K;  1WQG A;  4A3C C;  1WQF A;  4G7Z A;  1TWF C;  1IW7 A;  2E2H C;  2R92 A;  4J3N A;  2JA8 C;  2ZFZ A;  3FHZ A;  5IP9 C;  2JH3 A;  5M5W K;  4WIL A;  3RZD K;  2JA6 A;  1XXC A;  1YX2 A;  5M3M K;  4Q5S A;  4M1X A;  4A3F C;  3HOZ K;  2E2I A;  3HOW C;  4GT9 A;  4C2M C;  5IOQ A;  2D6F C;  1DCP A;  4KDD A;  1I50 C;  1TWC C;  1C0A A;  3FOF A;  3RZO C;  1WOP A;  4P5B A;  4BLA A;  2PA8 L;  4BBS K;  3HOX K;  4KB2 A;  3HOV K;  5C44 C;  1IL2 A;  2R93 K;  2B63 C;  1YCL A;  3AD7 C;  1ZQ1 C;  1WCM A;  3K7A C;  4NOI A;  3V4G A;  1R9T C;  2ZUF A;  1VH2 A;  4OIP A;  3S1R C;  3AQO A;  5IYC K;  1X31 C;  1O2B A;  1SFO C;  2V6U A;  4KAT A;  4XSX A;  4ZH4 A;  1USO A;  2XCO A;  2VUM K;  3QX3 A;  3PO3 C;  2FQT A;  2R93 A;  1UV7 A;  3TTG A;  4C3H C;  3H0G K;  1WOO A;  2NVY C;  2NVX K;  4MEY A;  3GTK C;  3FOE A;  3GTM K;  3M3Y C;  4LLG A;  2JA7 K;  1JQW A;  4GTD A;  3L4J A;  3I4M K;  4XSZ A;  1L0W A;  2R7Z C;  3SZZ A;  3GSI A;  2EBB A;  4GTL A;  4A3J C;  2VUM A;  3ORE A;  3LPX A;  5JFE A;  4Y7N K;  1TWA A;  1O26 A;  1K83 K;  1WIH A;  4WJ4 A;  2A69 A;  2PMZ L;  3S14 C;  2NVX A;  5IYB C;  3GTM A;  3S2D K;  1PJ7 A;  2NVT K;  3S1Q K;  3T02 A;  3TFJ A;  3ADA C;  4A3G C;  4P5A A;  3G4A A;  1ZXO A;  3HOY K;  3GTO K;  5IYD C;  1J98 A;  4KAW X;  3A8I A;  3HKZ L;  1IQ0 A;  3T01 A;  3S2H C;  4GTA A;  4LK1 A;  3GTP K;  3DXJ A;  4GTF A;  4KMH A;  4A3E K;  5JVO A;  5C4J K;  2XCR B;  5TMC A;  4A93 K;  3I4N C;  2V6T A;  4KC6 A;  4A3I K;  4YFN A;  3A8J A;  2CW0 A;  3H3V L;  4BY1 K;  3M4O C;  1B4A A;  3T00 A;  5IP7 K;  4C3I C;  3BP8 C;  5C3E K;  2NVQ C;  4QJV B;  4GTE A;  2YU9 K;  1F7U A;  1Y1V C;  1TWH C;  1O28 A;  5C4X K;  4Y52 K;  2P8T A;  4BXX K;  1I6V A;  5FLM C;  1SMY A;  4A3C K;  4BBR C;  1TWF K;  2E2H K;  2R92 C;  3FKI K;  2JA8 K;  3GTG A;  3OEP A;  4O2D A;  1PJ6 A;  5IP9 K;  3S15 K;  2A6E A;  2Y3P A;  3CQZ A;  2JA6 C;  1TWG C;  4A3F K;  3HOW K;  4C2M K;  3HOU C;  1I50 K;  2PA8 D;  3SZY A;  4G0U A;  5M3F K;  4JK1 A;  4PAA A;  4LK0 A;  4G7H A;  3FKI A;  2O5J A;  2JA5 K;  1JOE A;  2Y0S L;  4G0W A;  1ZYR A;  4MQ9 A;  4BKW A;  5C44 K;  2B63 K;  3GTL K;  4KB4 A;  1WCM C;  1R9T K;  3HOZ C;  1BDF A;  1I50 A;  4OIO A;  3S1R K;  2E2J K;  1O25 A;  1EK8 A;  2GSU A;  4RMF A;  3GIR A;  1SFO K;  3TFI A;  4XLN A;  1YNN A;  3N0B A;  2JA5 A;  3HOX C;  1EH1 A;  3HOV C;  3PO3 K;  1WOS A;  4C3H K;  4C3J C;  4X6A C;  2NVY K;  4GTB A;  3GTL A;  4BY7 K;  3GTK K;  4YFK A;  3Q3Q A;  1VRQ C;  3M3Y K;  4P9S A;  1EI6 A;  1I3Q C;  4XCH A;  3G4C A;  4A3D C;  2R7Z K;  1HQM A;  1F93 A;  4A3J K;  1DCH A;  5M5X K;  2KWA A;  4FZB A;  2PMZ D;  1TWA C;  2A68 A;  3GEE A;  4MEX A;  1YNJ A;  4A3M K;  3S14 K;  3H0G A;  4KMU A;  5IYB K;  3LAJ A;  2NVX C;  1PJ5 A;  3S1N C;  1XZP A;  4LOW A;  2JA7 A;  4A3G K;  3S0X A;  1BJT A;  1BS2 A;  1Y1W C;  3GTQ K;  2RGR A;  3EQL A;  3HKZ D;  1ZBS A;  5IOR A;  1EFW A;  1XXB A;  2PHC B;  3S2H K;  1IS1 A;  4FM9 A;  4KAR A;  3S17 C;  1K83 A;  1O2A A;  3I4N K;  3BP3 A;  3H3V D;  3S1Q C;  1I6H C;  4OIR A;  4LR2 A;  3N3Y A;  3BUE A;  3GTO A;  3M4O K;  4A3L C;  5D4D A;  3GTQ A;  3CAG A;  1VJE A;  2NVQ K;  4GFQ A;  3AQP A;  1Y1V K;  1VLO A;  4C45 A;  4XLP A;  2PPB A;  2O5I A;  1O24 A;  3GTP A;  3GTJ C;  3LAP A;  4A3K C;  1F7V A;  3PO2 C;  5FLM K;  2CFA A;  4BBR K;  4OIQ A;  1AB4 A;  2GAH C;  2P5M A;  3OPF A;  4OIN A;  3S16 C;  5TMF A;  3GTG C;  4AYB L;  4G7O A;  2WAQ L;  1WQH A;  4QIW L;  3CQZ C;  1TWG K;  2YU9 A;  1Y1V A;  1O27 A;  1IBA A;  2E2I C;  1ISE A;  1O2F B;  4Y52 C;  3HOU K;  2WB1 L;  4BLB A;  4A3B C;  2XCQ A;  5L46 A;  1TWC K;  3S1M C;  3RZO K;  3VA7 A;  2Y0S D;  3TFH A;  1TWF A;  2E2H A;  5E68 A;  3FKI C;  2BE5 A;  1DCO A;  3JST A;  3L4K A;  4KN4 A;  5TJ3 A;  3GEH A;  4YFX A;  3S15 C;  3RZD C;  1TWG A;  1WCM K;  1XZQ A;  3K7A K;  3GDZ A;  1XZQ B;  1BGW A;  5FJ8 K;  4ILD A;  1F9N A;  1TWC A;  5IOT A;  1B4B A;  2GSN A;  4LQY A;  4BBS C;  2JA5 C;  4KM9 A;  4KMA A;  4C3J K;  4Q4Z A;  3ERE D;  2R93 C;  4X6A K;  2B63 A;  4PAB A;  4KM8 A;  3GTL C;  2V6S A;  1JVI A;  1I3Q K;  1R9T A;  3AH5 A;  5EGH A;  4A3D K;  4LJZ A;  2E2J C;  5EGE A;  3AD8 C;  5IYC C;  2RH6 A;  1SFO A;  4KN7 A;  2VUM C;  1TWA K;  2A6H A;  2NVY A;  3H0G C;  3S1N K;  4BY7 C;  3GTK A;  3GTM C;  4WJ3 M;  1I3Q A;  2JA7 C;  1XZP B;  3AD9 C;  1KQ4 A;  1Y1W K;  3I4M C;  2R7Z A;  5IYD K;  1IE0 A;  1DD5 A;  1EQR A;  5CHP A;  1GE9 A;  4GTC A;  5IOS A;  1XXA A;  4Y7N C;  1HI9 A;  3IPJ A;  5HL8 A;  4A3M C;  3S17 K;  1K83 C;  3N0C A;  1WSR A;  2ZUE A;  2GSO A;  1I6H K;  3S2D C;  2NVT C;  1J6W A;  1V5V A;  3MML B;  5M5Y K;  3HOY C;  2W7V A;  3A8K A;  3NUH A;  2FQO A;  3GTO C;  4A3L K;  1Y1W A;  3GTQ C;  4YG2 A;  4C3I K;  1WSV A;  5CJ9 A;  3GEI A;  1TWH K;  4DDQ A;  3WOD A;  4G0V A;  3GTJ K;  3GTP C;  4A3K K;  1O29 A;  4A3E C;  4KMD A;  4AH6 A;  5C4J C;  3PO2 K;  4A93 C;  1VGX A;  1ZVU A;  4AYB D;  2CFA B;  4A3I C;  1J6X A;  2WAQ D;  2R92 K;  3S16 K;  4QIW D;  4BY1 C;  3HXA A;  2GAG C;  3GTG K;  4KAS A;  5IP7 C;  4QJV A; 
#chains in the Genus database with same CATH homology
 3CQZ K;  3K7A K;  2JA6 K;  5IYD C;  5C3E C;  4A3D C;  2R7Z K;  2YU9 C;  5FJ8 K;  2WB1 D;  2E2I K;  1HQM A;  3HKZ L;  4GZY A;  5C4X C;  4A3J K;  5M5X K;  3S2H C;  1XPP A;  4A3B K;  4LK1 A;  3GTP K;  3DXJ A;  4BXX C;  3S1M K;  2PMZ D;  4A3E K;  1TWA C;  2A68 A;  4MEX A;  1YNJ A;  5C4J K;  4BBS C;  4G7Z A;  4A3M K;  1TWF C;  2JA5 C;  4A3C C;  5TMC A;  4A93 K;  1IW7 A;  2E2H C;  3I4N C;  3S14 K;  4KMU A;  5IYB K;  4A3I K;  2NVX C;  2JA8 C;  3S1N C;  4C3J K;  4X6A K;  4YFN A;  4Q4Z A;  2R93 C;  2CW0 A;  3H3V L;  4BY1 K;  3GTL C;  5IP9 C;  4A3G K;  3M4O C;  5M5W K;  3RZD K;  5IP7 K;  1I3Q K;  1Y1W C;  5M3M K;  4Q5S A;  3GTQ K;  5C3E K;  4A3F C;  2NVQ C;  3HOZ K;  3EQL A;  3HKZ D;  4LJZ A;  4QJV B;  2YU9 K;  3HOW C;  4A3D K;  1Y1V C;  1TWH C;  2E2J C;  1I50 C;  5IYC C;  1TWC C;  5C4X K;  4Y52 K;  3S2H K;  3RZO C;  4KN7 A;  3S17 C;  1I6V A;  2VUM C;  4BXX K;  2PA8 L;  1TWA K;  2A6H A;  1SMY A;  5FLM C;  4BBR C;  4A3C K;  1TWF K;  4BBS K;  2E2H K;  3HOX K;  3I4N K;  3H3V D;  2R92 C;  3S1Q C;  1I6H C;  4OIR A;  3FKI K;  3H0G C;  2JA8 K;  3HOV K;  3S1N K;  4BY7 C;  5C44 C;  2R93 K;  2B63 C;  3GTM C;  5IP9 K;  2JA7 C;  3M4O K;  4A3L C;  3S15 K;  5D4D A;  2A6E A;  3K7A C;  2JA6 C;  4NOI A;  1R9T C;  1TWG C;  1Y1W K;  3I4M C;  4A3F K;  2NVQ K;  5IYD K;  3HOW K;  1Y1V K;  4C2M K;  4XLP A;  4OIP A;  3S1R C;  3HOU C;  2PPB A;  1I50 K;  2O5I A;  5IYC K;  2PA8 D;  3GTJ C;  4A3K C;  4Y7N C;  1SFO C;  4XSX A;  5M3F K;  4ZH4 A;  4JK1 A;  4A3M C;  3S17 K;  2VUM K;  4LK0 A;  1K83 C;  3PO2 C;  5FLM K;  4G7H A;  4BBR K;  2O5J A;  2JA5 K;  2Y0S L;  4OIQ A;  1ZYR A;  3PO3 C;  1I6H K;  4MQ9 A;  3S2D C;  3H0G K;  4OIN A;  2NVT C;  2NVY C;  2NVX K;  4MEY A;  5C44 K;  3S16 C;  5TMF A;  3GTG C;  4AYB L;  2B63 K;  3GTK C;  3GTM K;  4G7O A;  5M5Y K;  3HOY C;  2WAQ L;  3M3Y C;  4LLG A;  3GTL K;  2JA7 K;  4QIW L;  4A3L K;  3GTO C;  1WCM C;  3GTQ C;  3CQZ C;  4YG2 A;  1TWG K;  1BDF A;  4C3I K;  1R9T K;  3HOZ C;  4XSZ A;  3I4M K;  2R7Z C;  2E2I C;  4OIO A;  4Y52 C;  1TWH K;  3S1R K;  3WOD A;  2E2J K;  4A3J C;  3HOU K;  2WB1 L;  4A3B C;  3GTJ K;  3GTP C;  1TWC K;  4Y7N K;  4A3K K;  1SFO K;  3S1M C;  4XLN A;  4A3E C;  3RZO K;  1YNN A;  2Y0S D;  5C4J C;  1K83 K;  3HOX C;  3PO2 K;  4A93 C;  2A69 A;  2PMZ L;  3FKI C;  2BE5 A;  3HOV C;  3S14 C;  4AYB D;  3PO3 K;  5IYB C;  4A3I C;  4C3H K;  2WAQ D;  2R92 K;  2NVT K;  3S2D K;  2NVY K;  3S1Q K;  3S16 K;  4X6A C;  4QIW D;  4BY1 C;  3GTG K;  4BY7 K;  3GTK K;  4YFK A;  4A3G C;  3HOY K;  4KN4 A;  4YFX A;  3M3Y K;  3S15 C;  3RZD C;  5IP7 C;  1I3Q C;  3GTO K;  1WCM K;  4QJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...