2R92K

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r92K00
3S1QC 1Y1VC 2A6HA 3M4OC 4BY7C 2A68A 4BBSC 4YG2A 5D4DA 4A93C 3GTKC 2PMZL 5M3FK 4A93K 3GTPK 3S17K 2Y0SL 1I6HK 1Y1WC 4C3IK 1SFOC 1YNNA 3HKZD 4LK0A 3GTMC 3HOUK 4OINA 5IYDK 1XPPA 5M5WK 2R7ZK 3RZOK 1TWHC 5TMFA 3HOXC 4OIRA 4OIPA 5C44C 5C4JC 3GTKK 2PA8L 2O5IA 1I50K 4MEXA 3S16K 3PO2C 5IP9K 2B63K 3S2HC 4BY7K 4QIWL 4A3KC 2NVTC 3S1MK 4JK1A 2JA6K 4BXXK 3HOWC 1TWHK 4A3KK 2WB1D 4GZYA 3M3YC 3S1NC 3DXJA 1SFOK 4C3JK 2YU9C 4A3JK 4A3LK 2E2JC 2NVQK 3GTGK 1SMYA 4Q4ZA 3GTQC 4LK1A 2PMZD 5C4XK 2JA6C 3GTLC 1TWCC 4BBSK 3S14C 3FKIK 5IP7C 1HQMA 3HKZL 2NVXC 3GTLK 3S14K 4OIQA 4MQ9A 5M3MK 3H3VD 5IYCC 4A3IC 4YFNA 1TWFK 3K7AC 4YFKA 2JA5C 1TWAK 4XSXA 3FKIC 1TWFC 1TWGK 4NOIA 2R92K 2NVYK 3GTPC 4QIWD 4ZH4A 3HOYC 2E2HC 2JA7K 4X6AK 4Y7NC 2R93K 2WB1L 4A3DK 4BBRC 3GTJC 2E2IK 2NVTK 2CW0A 5IP7K 4A3GK 4C2MK 1R9TK 3H0GC 3I4MK 3S17C 4A3LC 2JA5K 4A3DC 4KN7A 5IYBC 3CQZC 5FLMK 1I6VA 3HOYK 3HOZC 4QJVA 3HOXK 3I4NC 2YU9K 3S1MC 5M5XK 4BY1C 3GTMK 3S16C 3M3YK 1WCMK 3S1QK 5IYCK 2E2HK 4X6AC 4A3EC 1K83C 2Y0SD 3H3VL 4MEYA 3S1RC 2NVXK 3RZDK 4G7OA 4QJVB 1BDFA 1TWGC 2WAQL 4YFXA 4XLPA 3S1RK 1R9TC 3S1NK 3RZDC 3GTOK 2PA8D 3EQLA 4LLGA 4Y52K 2R93C 1WCMC 2A6EA 5C3EK 1YNJA 3GTOC 4A3FK 4A3MK 3PO3C 4Q5SA 2PPBA 2O5JA 5TMCA 4BY1K 4A3FC 3CQZK 2VUMC 4BXXC 3GTQK 3HOZK 4A3EK 4Y52C 4A3CC 2A69A 2R92C 3H0GK 2VUMK 3I4MC 3WODA 4G7HA 3S2DC 1IW7A 4A3JC 4C3HK 4XLNA 1ZYRA 2BE5A 5FJ8K 4BBRK 3HOWK 1K83K 2JA8K 1I3QK 3HOVK 3S15K 4OIOA 2NVYC 4AYBL 2R7ZC 2JA7C 4AYBD 2JA8C 3HOVC 4XSZA 3K7AK 1I50C 2WAQD 3GTJK 2E2IC 3I4NK 3PO3K 3PO2K 3S2HK 4A3BC 3S2DK 5C4XC 3RZOC 5IYBK 4A3CK 1I3QC 4A3BK 5C44K 5C4JK 2E2JK 2NVQC 5IYDC 1Y1WK 1TWAC 4KN4A 4LJZA 4A3GC 1I6HC 3HOUC 5IP9C 2B63C 5C3EC 1Y1VK 5M5YK 1TWCK 4A3IK 4Y7NK 4A3MC 4G7ZA 3S15C 4KMUA 3M4OK 3GTGC 5FLMC
chains in the Genus database with same CATH superfamily
1Y1VC 4KAWX 1IS1A 4KB4A 3BP3A 4BY7C 1WOOA 3GTOA 4BBSC 1WSVA 3ADAC 3AQOA 5D4DA 2RH6A 1HI9A 2Y0SL 1I6HK 1Y1WC 4C3IK 1YNNA 3H0GA 4FZBA 3A8JA 1TWHC 5C4JC 4GTLA 4MEXA 4BLBA 4BY7K 3FOEA 4DDQA 1VJEA 4KMDA 2NVTC 1XZPB 1ZBSA 2D6FC 2WB1D 4GTFA 3M3YC 3DXJA 1SFOK 4A3JK 2B63A 4Q4ZA 3GTQC 3GTLA 3TFHA 2PMZD 1TWFA 1USMA 3FKIA 3FKIK 3AQPA 2YU9A 3HKZL 2NVXC 1G51A 4BKWA 4GTAA 4A3IC 3TFIA 1O28A 3GEEA 4XSXA 5IORA 2JA6A 2NVYK 1V5VA 4QIWD 1GE9A 1JQWA 3G4CA 1O2BA 2R93K 2R92A 4RMFA 4BBRC 4A3GK 4A3LC 3I4MK 4A3DC 3FOFA 5FLMK 1I6VA 3HOYK 3HOZC 3S1MC 2EBBA 1WQGA 3GTKA 1EI6A 1EQRA 3GTMK 3M3YK 5IYCK 5IOQA 1J6VA 1DD5A 1K83C 3SZYA 4MEYA 2WAQL 2Y3PA 3S1RK 1EH1A 3GTOK 3EQLA 3OPFA 2R93C 4A3MK 4KMHA 5TMCA 4BLAA 2CFAB 4BXXC 4KB2A 4A3EK 4A3CC 1INNA 3NUHA 4J3NA 2VUMK 1IW7A 1O24A 1ZYRA 3HOWK 1K83K 1IE0A 4G0VA 4AYBL 3N3YA 1PJ7A 1F9NA 3GTJK 4A3BC 3S2HK 3RZOC 5C44K 1XXBA 2NVQC 2ZUEA 4LJZA 4A3GC 1VLOA 5M5YK 1C0AA 1J6WA 3S15C 1O2FB 3S1QC 2A6HA 3M4OC 4GTEA 4LQYA 5E68A 1WQHA 2PMZL 4GTDA 3GTPK 3L4JA 4LK0A 3GTMA 2R7ZK 3RZOK 5TMFA 3N0BA 3HOXC 5C44C 3GTKK 4LR2A 4ILDA 4KATA 3S2HC 5IP9K 2P5MA 4QIWL 3S1MK 3MMLB 5IOSA 4M1XA 3HOWC 4WJ3M 3S1NC 4FM9A 4KASA 4A3LK 3VA7A 1SMYA 3FHZA 1RU0A 4LK1A 2JA6C 3S14C 5IP7C 4P5BA 5JVOA 3S14K 3LAPA 5M3MK 3H3VD 4O2DA 4WILA 4KM9A 1WOPA 5HL8A 4WJ4A 1ISEA 2JA5C 3FKIC 1TWFC 4NOIA 2R92K 2R93A 4ZH4A 1WSRA 1YCLA 2PHCB 3GTJC 4GFQA 3S17C 5IOTA 1F7VA 3I4NC 3HOXK 2YU9K 3SZZA 4A3EC 3A8KA 4C45A 3RZDK 4G7OA 3T02A 1R9TC 3ERED 3RZDC 2PA8D 4LLGA 2A6EA 1VH2A 1YNJA 3GTOC 2W7VA 4C3HC 1Y1VA 4A3FC 1ZXOA 3GTJA 3GTQK 2R7ZA 2A69A 2V6UA 3WODA 1XXCA 4A3JC 4XLNA 2KWAA 3A8IA 2R7ZC 1WORA 2WAQD 2GAHC 1XXAA 5C4XC 4A3CK 5C4JK 2E2JK 3GSIA 1O25A 2JH3A 1Y1WK 4XCHA 1R9TA 1L0WA 3M4OK 4A3IK 4Y7NK 4A3MC 4G7ZA 4KMUA 1O27A 3S0XA 1PJ6A 1WOSA 3OREA 2RGRA 4LOWA 5CJ9A 1B4AA 3GIRA 1WCMA 3L4KA 1YX2A 5M3FK 4A93K 3S17K 1SFOC 3GTMC 5M5WK 2GSOA 4OIRA 2PA8L 2O5IA 1I50K 3S16K 2B63K 2XCRB 4A3KC 2JA5A 1ZQ1C 4JK1A 3GEHA 4BXXK 1TWHK 1X31C 4GZYA 2JA7A 5TJ3A 2E2JC 1B4BA 2ZFZA 5C4XK 3TTGA 3GDZA 4BBSK 1J6XA 4MQ9A 5L46A 5IYCC 4YFNA 1TWAK 3HOYC 2E2HC 5CHPA 1IL2A 4A3DK 2NVTK 2CW0A 3N0CA 4C3JC 4C2MK 2JA5K 1PJ5A 4KN7A 5IYBC 2GSUA 2XCOA 3S1QK 4X6AC 3H3VL 2P8TA 3G4AA 3S1RC 2V6SA 1K83A 2NVXK 1IQ0A 1TWGC 4C2MC 4GTCA 4XLPA 3S1NK 2GSNA 4Y52K 2CFAA 3OEPA 1O2AA 1XZQA 4P9SA 4G0UA 3HOZK 4Y52C 2R92C 3I4MC 1O26A 3S2DC 4C3HK 1I3QA 2BE5A 5FJ8K 4BBRK 3HOVK 1I3QK 1VRQC 1EK8A 2NVYC 3LAJA 3AH5A 4AYBD 2JA8C 3BUEA 1IBAA 3GEIA 4GTBA 2E2IC 3PO2K 5IYBK 1I3QC 5EGHA 5IYDC 3GTQA 3HOUC 2B63C 1EFWA 5C3EC 1Y1VK 3PO3K 1DCOA 4KMAA 2A68A 4YG2A 1ZVUA 3GTKC 4A93C 1KQ4A 1JVIA 5IYDK 3GTGC 3HKZD 3HOUK 4OINA 1XPPA 2ZUFA 4KARA 4OIPA 5JFEA 1XZQB 3PO2C 1USOA 4C3IC 3AD7C 3QX3A 1DCHA 3BP8C 2JA6K 2E2IA 1F7UA 4A3KK 1AB4A 3LPXA 2NVXA 4C3JK 2YU9C 2NVYA 2NVQK 3GTGK 2FQOA 1TWAA 2E2HA 3Q3QA 3GTLC 1TWCC 4KC6A 1HQMA 3GTLK 1F93A 4OIQA 4AH6A 4P5AA 1UV7A 1TWFK 3K7AC 4YFKA 1TWGK 3GTPC 4X6AK 2JA7K 1BS2A 4Y7NC 1TWGA 4KM8A 2WB1L 1TWHA 2E2IK 5IP7K 1R9TK 3H0GC 2XCQA 1Y1WA 3AD9C 1WQFA 3CQZC 1JOEA 1WIHA 4QJVA 5M5XK 4G0WA 5EGEA 2FQTA 4BY1C 4GT9A 3S16C 1WCMK 2E2HK 2Y0SD 3CAGA 3GTGA 1SFOA 4QJVB 4YFXA 1BDFA 1O29A 3AD8C 4KDDA 1WCMC 5C3EK 4Q5SA 4A3FK 3PO3C 3CQZA 2PPBA 2O5JA 1XZPA 1I50A 4BY1K 3IPJA 3TFJA 3CQZK 2VUMC 1J98A 3H0GK 4G7HA 3GTPA 1I6HC 2JA8K 1VGXA 3S15K 4OIOA 3V4GA 1BJTA 1DCPA 4PABA 2JA7C 2V6TA 3HOVC 2VUMA 3T00A 4XSZA 3K7AK 1I50C 3I4NK 3S2DK 1TWCA 4A3BK 1TWAC 4KN4A 3T01A 1BGWA 5IP9C 2GAGC 3JSTA 1TWCK 4PAAA 3HXAA 5FLMC
chains in the Genus database with same CATH topology
3S1QC 1Y1VC 2A6HA 3M4OC 4BY7C 2A68A 4BBSC 4YG2A 5D4DA 4A93C 3GTKC 2PMZL 5M3FK 4A93K 3GTPK 3S17K 2Y0SL 1I6HK 1Y1WC 4C3IK 1SFOC 1YNNA 3HKZD 4LK0A 3GTMC 3HOUK 4OINA 5IYDK 1XPPA 5M5WK 2R7ZK 3RZOK 1TWHC 5TMFA 3HOXC 4OIRA 4OIPA 5C44C 5C4JC 3GTKK 2PA8L 2O5IA 1I50K 4MEXA 3S16K 3PO2C 5IP9K 2B63K 3S2HC 4BY7K 4QIWL 4A3KC 2NVTC 3S1MK 4JK1A 2JA6K 4BXXK 3HOWC 1TWHK 4A3KK 2WB1D 4GZYA 3M3YC 3S1NC 3DXJA 1SFOK 4C3JK 2YU9C 4A3JK 4A3LK 2E2JC 2NVQK 3GTGK 1SMYA 4Q4ZA 3GTQC 4LK1A 2PMZD 5C4XK 2JA6C 3GTLC 1TWCC 4BBSK 3S14C 3FKIK 5IP7C 1HQMA 3HKZL 2NVXC 3GTLK 3S14K 4OIQA 4MQ9A 5M3MK 3H3VD 5IYCC 4A3IC 4YFNA 1TWFK 3K7AC 4YFKA 2JA5C 1TWAK 4XSXA 3FKIC 1TWFC 1TWGK 4NOIA 2R92K 2NVYK 3GTPC 4QIWD 4ZH4A 3HOYC 2E2HC 2JA7K 4X6AK 4Y7NC 2R93K 2WB1L 4A3DK 4BBRC 3GTJC 2E2IK 2NVTK 2CW0A 5IP7K 4A3GK 4C2MK 1R9TK 3H0GC 3I4MK 3S17C 4A3LC 2JA5K 4A3DC 4KN7A 5IYBC 3CQZC 5FLMK 1I6VA 3HOYK 3HOZC 4QJVA 3HOXK 3I4NC 2YU9K 3S1MC 5M5XK 4BY1C 3GTMK 3S16C 3M3YK 1WCMK 3S1QK 5IYCK 2E2HK 4X6AC 4A3EC 1K83C 2Y0SD 3H3VL 4MEYA 3S1RC 2NVXK 3RZDK 4G7OA 4QJVB 1BDFA 1TWGC 2WAQL 4YFXA 4XLPA 3S1RK 1R9TC 3S1NK 3RZDC 3GTOK 2PA8D 3EQLA 4LLGA 4Y52K 2R93C 1WCMC 2A6EA 5C3EK 1YNJA 3GTOC 4A3FK 4A3MK 3PO3C 4Q5SA 2PPBA 2O5JA 5TMCA 4BY1K 4A3FC 3CQZK 2VUMC 4BXXC 3GTQK 3HOZK 4A3EK 4Y52C 4A3CC 2A69A 2R92C 3H0GK 2VUMK 3I4MC 3WODA 4G7HA 3S2DC 1IW7A 4A3JC 4C3HK 4XLNA 1ZYRA 2BE5A 5FJ8K 4BBRK 3HOWK 1K83K 2JA8K 1I3QK 3HOVK 3S15K 4OIOA 2NVYC 4AYBL 2R7ZC 2JA7C 4AYBD 2JA8C 3HOVC 4XSZA 3K7AK 1I50C 2WAQD 3GTJK 2E2IC 3I4NK 3PO3K 3PO2K 3S2HK 4A3BC 3S2DK 5C4XC 3RZOC 5IYBK 4A3CK 1I3QC 4A3BK 5C44K 5C4JK 2E2JK 2NVQC 5IYDC 1Y1WK 1TWAC 4KN4A 4LJZA 4A3GC 1I6HC 3HOUC 5IP9C 2B63C 5C3EC 1Y1VK 5M5YK 1TWCK 4A3IK 4Y7NK 4A3MC 4G7ZA 3S15C 4KMUA 3M4OK 3GTGC 5FLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q C;  1Y1V C;  2A6H A;  3M4O C;  4BY7 C;  2A68 A;  4BBS C;  4YG2 A;  5D4D A;  4A93 C;  3GTK C;  2PMZ L;  5M3F K;  4A93 K;  3GTP K;  3S17 K;  2Y0S L;  1I6H K;  1Y1W C;  4C3I K;  1SFO C;  1YNN A;  3HKZ D;  4LK0 A;  3GTM C;  3HOU K;  4OIN A;  5IYD K;  1XPP A;  5M5W K;  2R7Z K;  3RZO K;  1TWH C;  5TMF A;  3HOX C;  4OIR A;  4OIP A;  5C44 C;  5C4J C;  3GTK K;  2PA8 L;  2O5I A;  1I50 K;  4MEX A;  3S16 K;  3PO2 C;  5IP9 K;  2B63 K;  3S2H C;  4BY7 K;  4QIW L;  4A3K C;  2NVT C;  3S1M K;  4JK1 A;  2JA6 K;  4BXX K;  3HOW C;  1TWH K;  4A3K K;  2WB1 D;  4GZY A;  3M3Y C;  3S1N C;  3DXJ A;  1SFO K;  4C3J K;  2YU9 C;  4A3J K;  4A3L K;  2E2J C;  2NVQ K;  3GTG K;  1SMY A;  4Q4Z A;  3GTQ C;  4LK1 A;  2PMZ D;  5C4X K;  2JA6 C;  3GTL C;  1TWC C;  4BBS K;  3S14 C;  3FKI K;  5IP7 C;  1HQM A;  3HKZ L;  2NVX C;  3GTL K;  3S14 K;  4OIQ A;  4MQ9 A;  5M3M K;  3H3V D;  5IYC C;  4A3I C;  4YFN A;  1TWF K;  3K7A C;  4YFK A;  2JA5 C;  1TWA K;  4XSX A;  3FKI C;  1TWF C;  1TWG K;  4NOI A;  2R92 K;  2NVY K;  3GTP C;  4QIW D;  4ZH4 A;  3HOY C;  2E2H C;  2JA7 K;  4X6A K;  4Y7N C;  2R93 K;  2WB1 L;  4A3D K;  4BBR C;  3GTJ C;  2E2I K;  2NVT K;  2CW0 A;  5IP7 K;  4A3G K;  4C2M K;  1R9T K;  3H0G C;  3I4M K;  3S17 C;  4A3L C;  2JA5 K;  4A3D C;  4KN7 A;  5IYB C;  3CQZ C;  5FLM K;  1I6V A;  3HOY K;  3HOZ C;  4QJV A;  3HOX K;  3I4N C;  2YU9 K;  3S1M C;  5M5X K;  4BY1 C;  3GTM K;  3S16 C;  3M3Y K;  1WCM K;  3S1Q K;  5IYC K;  2E2H K;  4X6A C;  4A3E C;  1K83 C;  2Y0S D;  3H3V L;  4MEY A;  3S1R C;  2NVX K;  3RZD K;  4G7O A;  4QJV B;  1BDF A;  1TWG C;  2WAQ L;  4YFX A;  4XLP A;  3S1R K;  1R9T C;  3S1N K;  3RZD C;  3GTO K;  2PA8 D;  3EQL A;  4LLG A;  4Y52 K;  2R93 C;  1WCM C;  2A6E A;  5C3E K;  1YNJ A;  3GTO C;  4A3F K;  4A3M K;  3PO3 C;  4Q5S A;  2PPB A;  2O5J A;  5TMC A;  4BY1 K;  4A3F C;  3CQZ K;  2VUM C;  4BXX C;  3GTQ K;  3HOZ K;  4A3E K;  4Y52 C;  4A3C C;  2A69 A;  2R92 C;  3H0G K;  2VUM K;  3I4M C;  3WOD A;  4G7H A;  3S2D C;  1IW7 A;  4A3J C;  4C3H K;  4XLN A;  1ZYR A;  2BE5 A;  5FJ8 K;  4BBR K;  3HOW K;  1K83 K;  2JA8 K;  1I3Q K;  3HOV K;  3S15 K;  4OIO A;  2NVY C;  4AYB L;  2R7Z C;  2JA7 C;  4AYB D;  2JA8 C;  3HOV C;  4XSZ A;  3K7A K;  1I50 C;  2WAQ D;  3GTJ K;  2E2I C;  3I4N K;  3PO3 K;  3PO2 K;  3S2H K;  4A3B C;  3S2D K;  5C4X C;  3RZO C;  5IYB K;  4A3C K;  1I3Q C;  4A3B K;  5C44 K;  5C4J K;  2E2J K;  2NVQ C;  5IYD C;  1Y1W K;  1TWA C;  4KN4 A;  4LJZ A;  4A3G C;  1I6H C;  3HOU C;  5IP9 C;  2B63 C;  5C3E C;  1Y1V K;  5M5Y K;  1TWC K;  4A3I K;  4Y7N K;  4A3M C;  4G7Z A;  3S15 C;  4KMU A;  3M4O K;  3GTG C;  5FLM C; 
#chains in the Genus database with same CATH topology
 1Y1V C;  4KAW X;  1IS1 A;  4KB4 A;  3BP3 A;  4BY7 C;  1WOO A;  3GTO A;  4BBS C;  1WSV A;  3ADA C;  3AQO A;  5D4D A;  2RH6 A;  1HI9 A;  2Y0S L;  1I6H K;  1Y1W C;  4C3I K;  1YNN A;  3H0G A;  4FZB A;  3A8J A;  1TWH C;  5C4J C;  4GTL A;  4MEX A;  4BLB A;  4BY7 K;  3FOE A;  4DDQ A;  1VJE A;  4KMD A;  2NVT C;  1XZP B;  1ZBS A;  2D6F C;  2WB1 D;  4GTF A;  3M3Y C;  3DXJ A;  1SFO K;  4A3J K;  2B63 A;  4Q4Z A;  3GTQ C;  3GTL A;  3TFH A;  2PMZ D;  1TWF A;  1USM A;  3FKI A;  3FKI K;  3AQP A;  2YU9 A;  3HKZ L;  2NVX C;  1G51 A;  4BKW A;  4GTA A;  4A3I C;  3TFI A;  1O28 A;  3GEE A;  4XSX A;  5IOR A;  2JA6 A;  2NVY K;  1V5V A;  4QIW D;  1GE9 A;  1JQW A;  3G4C A;  1O2B A;  2R93 K;  2R92 A;  4RMF A;  4BBR C;  4A3G K;  4A3L C;  3I4M K;  4A3D C;  3FOF A;  5FLM K;  1I6V A;  3HOY K;  3HOZ C;  3S1M C;  2EBB A;  1WQG A;  3GTK A;  1EI6 A;  1EQR A;  3GTM K;  3M3Y K;  5IYC K;  5IOQ A;  1J6V A;  1DD5 A;  1K83 C;  3SZY A;  4MEY A;  2WAQ L;  2Y3P A;  3S1R K;  1EH1 A;  3GTO K;  3EQL A;  3OPF A;  2R93 C;  4A3M K;  4KMH A;  5TMC A;  4BLA A;  2CFA B;  4BXX C;  4KB2 A;  4A3E K;  4A3C C;  1INN A;  3NUH A;  4J3N A;  2VUM K;  1IW7 A;  1O24 A;  1ZYR A;  3HOW K;  1K83 K;  1IE0 A;  4G0V A;  4AYB L;  3N3Y A;  1PJ7 A;  1F9N A;  3GTJ K;  4A3B C;  3S2H K;  3RZO C;  5C44 K;  1XXB A;  2NVQ C;  2ZUE A;  4LJZ A;  4A3G C;  1VLO A;  5M5Y K;  1C0A A;  1J6W A;  3S15 C;  1O2F B;  3S1Q C;  2A6H A;  3M4O C;  4GTE A;  4LQY A;  5E68 A;  1WQH A;  2PMZ L;  4GTD A;  3GTP K;  3L4J A;  4LK0 A;  3GTM A;  2R7Z K;  3RZO K;  5TMF A;  3N0B A;  3HOX C;  5C44 C;  3GTK K;  4LR2 A;  4ILD A;  4KAT A;  3S2H C;  5IP9 K;  2P5M A;  4QIW L;  3S1M K;  3MML B;  5IOS A;  4M1X A;  3HOW C;  4WJ3 M;  3S1N C;  4FM9 A;  4KAS A;  4A3L K;  3VA7 A;  1SMY A;  3FHZ A;  1RU0 A;  4LK1 A;  2JA6 C;  3S14 C;  5IP7 C;  4P5B A;  5JVO A;  3S14 K;  3LAP A;  5M3M K;  3H3V D;  4O2D A;  4WIL A;  4KM9 A;  1WOP A;  5HL8 A;  4WJ4 A;  1ISE A;  2JA5 C;  3FKI C;  1TWF C;  4NOI A;  2R92 K;  2R93 A;  4ZH4 A;  1WSR A;  1YCL A;  2PHC B;  3GTJ C;  4GFQ A;  3S17 C;  5IOT A;  1F7V A;  3I4N C;  3HOX K;  2YU9 K;  3SZZ A;  4A3E C;  3A8K A;  4C45 A;  3RZD K;  4G7O A;  3T02 A;  1R9T C;  3ERE D;  3RZD C;  2PA8 D;  4LLG A;  2A6E A;  1VH2 A;  1YNJ A;  3GTO C;  2W7V A;  4C3H C;  1Y1V A;  4A3F C;  1ZXO A;  3GTJ A;  3GTQ K;  2R7Z A;  2A69 A;  2V6U A;  3WOD A;  1XXC A;  4A3J C;  4XLN A;  2KWA A;  3A8I A;  2R7Z C;  1WOR A;  2WAQ D;  2GAH C;  1XXA A;  5C4X C;  4A3C K;  5C4J K;  2E2J K;  3GSI A;  1O25 A;  2JH3 A;  1Y1W K;  4XCH A;  1R9T A;  1L0W A;  3M4O K;  4A3I K;  4Y7N K;  4A3M C;  4G7Z A;  4KMU A;  1O27 A;  3S0X A;  1PJ6 A;  1WOS A;  3ORE A;  2RGR A;  4LOW A;  5CJ9 A;  1B4A A;  3GIR A;  1WCM A;  3L4K A;  1YX2 A;  5M3F K;  4A93 K;  3S17 K;  1SFO C;  3GTM C;  5M5W K;  2GSO A;  4OIR A;  2PA8 L;  2O5I A;  1I50 K;  3S16 K;  2B63 K;  2XCR B;  4A3K C;  2JA5 A;  1ZQ1 C;  4JK1 A;  3GEH A;  4BXX K;  1TWH K;  1X31 C;  4GZY A;  2JA7 A;  5TJ3 A;  2E2J C;  1B4B A;  2ZFZ A;  5C4X K;  3TTG A;  3GDZ A;  4BBS K;  1J6X A;  4MQ9 A;  5L46 A;  5IYC C;  4YFN A;  1TWA K;  3HOY C;  2E2H C;  5CHP A;  1IL2 A;  4A3D K;  2NVT K;  2CW0 A;  3N0C A;  4C3J C;  4C2M K;  2JA5 K;  1PJ5 A;  4KN7 A;  5IYB C;  2GSU A;  2XCO A;  3S1Q K;  4X6A C;  3H3V L;  2P8T A;  3G4A A;  3S1R C;  2V6S A;  1K83 A;  2NVX K;  1IQ0 A;  1TWG C;  4C2M C;  4GTC A;  4XLP A;  3S1N K;  2GSN A;  4Y52 K;  2CFA A;  3OEP A;  1O2A A;  1XZQ A;  4P9S A;  4G0U A;  3HOZ K;  4Y52 C;  2R92 C;  3I4M C;  1O26 A;  3S2D C;  4C3H K;  1I3Q A;  2BE5 A;  5FJ8 K;  4BBR K;  3HOV K;  1I3Q K;  1VRQ C;  1EK8 A;  2NVY C;  3LAJ A;  3AH5 A;  4AYB D;  2JA8 C;  3BUE A;  1IBA A;  3GEI A;  4GTB A;  2E2I C;  3PO2 K;  5IYB K;  1I3Q C;  5EGH A;  5IYD C;  3GTQ A;  3HOU C;  2B63 C;  1EFW A;  5C3E C;  1Y1V K;  3PO3 K;  1DCO A;  4KMA A;  2A68 A;  4YG2 A;  1ZVU A;  3GTK C;  4A93 C;  1KQ4 A;  1JVI A;  5IYD K;  3GTG C;  3HKZ D;  3HOU K;  4OIN A;  1XPP A;  2ZUF A;  4KAR A;  4OIP A;  5JFE A;  1XZQ B;  3PO2 C;  1USO A;  4C3I C;  3AD7 C;  3QX3 A;  1DCH A;  3BP8 C;  2JA6 K;  2E2I A;  1F7U A;  4A3K K;  1AB4 A;  3LPX A;  2NVX A;  4C3J K;  2YU9 C;  2NVY A;  2NVQ K;  3GTG K;  2FQO A;  1TWA A;  2E2H A;  3Q3Q A;  3GTL C;  1TWC C;  4KC6 A;  1HQM A;  3GTL K;  1F93 A;  4OIQ A;  4AH6 A;  4P5A A;  1UV7 A;  1TWF K;  3K7A C;  4YFK A;  1TWG K;  3GTP C;  4X6A K;  2JA7 K;  1BS2 A;  4Y7N C;  1TWG A;  4KM8 A;  2WB1 L;  1TWH A;  2E2I K;  5IP7 K;  1R9T K;  3H0G C;  2XCQ A;  1Y1W A;  3AD9 C;  1WQF A;  3CQZ C;  1JOE A;  1WIH A;  4QJV A;  5M5X K;  4G0W A;  5EGE A;  2FQT A;  4BY1 C;  4GT9 A;  3S16 C;  1WCM K;  2E2H K;  2Y0S D;  3CAG A;  3GTG A;  1SFO A;  4QJV B;  4YFX A;  1BDF A;  1O29 A;  3AD8 C;  4KDD A;  1WCM C;  5C3E K;  4Q5S A;  4A3F K;  3PO3 C;  3CQZ A;  2PPB A;  2O5J A;  1XZP A;  1I50 A;  4BY1 K;  3IPJ A;  3TFJ A;  3CQZ K;  2VUM C;  1J98 A;  3H0G K;  4G7H A;  3GTP A;  1I6H C;  2JA8 K;  1VGX A;  3S15 K;  4OIO A;  3V4G A;  1BJT A;  1DCP A;  4PAB A;  2JA7 C;  2V6T A;  3HOV C;  2VUM A;  3T00 A;  4XSZ A;  3K7A K;  1I50 C;  3I4N K;  3S2D K;  1TWC A;  4A3B K;  1TWA C;  4KN4 A;  3T01 A;  1BGW A;  5IP9 C;  2GAG C;  3JST A;  1TWC K;  4PAA A;  3HXA A;  5FLM C; 
#chains in the Genus database with same CATH homology
 3S1Q C;  1Y1V C;  2A6H A;  3M4O C;  4BY7 C;  2A68 A;  4BBS C;  4YG2 A;  5D4D A;  4A93 C;  3GTK C;  2PMZ L;  5M3F K;  4A93 K;  3GTP K;  3S17 K;  2Y0S L;  1I6H K;  1Y1W C;  4C3I K;  1SFO C;  1YNN A;  3HKZ D;  4LK0 A;  3GTM C;  3HOU K;  4OIN A;  5IYD K;  1XPP A;  5M5W K;  2R7Z K;  3RZO K;  1TWH C;  5TMF A;  3HOX C;  4OIR A;  4OIP A;  5C44 C;  5C4J C;  3GTK K;  2PA8 L;  2O5I A;  1I50 K;  4MEX A;  3S16 K;  3PO2 C;  5IP9 K;  2B63 K;  3S2H C;  4BY7 K;  4QIW L;  4A3K C;  2NVT C;  3S1M K;  4JK1 A;  2JA6 K;  4BXX K;  3HOW C;  1TWH K;  4A3K K;  2WB1 D;  4GZY A;  3M3Y C;  3S1N C;  3DXJ A;  1SFO K;  4C3J K;  2YU9 C;  4A3J K;  4A3L K;  2E2J C;  2NVQ K;  3GTG K;  1SMY A;  4Q4Z A;  3GTQ C;  4LK1 A;  2PMZ D;  5C4X K;  2JA6 C;  3GTL C;  1TWC C;  4BBS K;  3S14 C;  3FKI K;  5IP7 C;  1HQM A;  3HKZ L;  2NVX C;  3GTL K;  3S14 K;  4OIQ A;  4MQ9 A;  5M3M K;  3H3V D;  5IYC C;  4A3I C;  4YFN A;  1TWF K;  3K7A C;  4YFK A;  2JA5 C;  1TWA K;  4XSX A;  3FKI C;  1TWF C;  1TWG K;  4NOI A;  2R92 K;  2NVY K;  3GTP C;  4QIW D;  4ZH4 A;  3HOY C;  2E2H C;  2JA7 K;  4X6A K;  4Y7N C;  2R93 K;  2WB1 L;  4A3D K;  4BBR C;  3GTJ C;  2E2I K;  2NVT K;  2CW0 A;  5IP7 K;  4A3G K;  4C2M K;  1R9T K;  3H0G C;  3I4M K;  3S17 C;  4A3L C;  2JA5 K;  4A3D C;  4KN7 A;  5IYB C;  3CQZ C;  5FLM K;  1I6V A;  3HOY K;  3HOZ C;  4QJV A;  3HOX K;  3I4N C;  2YU9 K;  3S1M C;  5M5X K;  4BY1 C;  3GTM K;  3S16 C;  3M3Y K;  1WCM K;  3S1Q K;  5IYC K;  2E2H K;  4X6A C;  4A3E C;  1K83 C;  2Y0S D;  3H3V L;  4MEY A;  3S1R C;  2NVX K;  3RZD K;  4G7O A;  4QJV B;  1BDF A;  1TWG C;  2WAQ L;  4YFX A;  4XLP A;  3S1R K;  1R9T C;  3S1N K;  3RZD C;  3GTO K;  2PA8 D;  3EQL A;  4LLG A;  4Y52 K;  2R93 C;  1WCM C;  2A6E A;  5C3E K;  1YNJ A;  3GTO C;  4A3F K;  4A3M K;  3PO3 C;  4Q5S A;  2PPB A;  2O5J A;  5TMC A;  4BY1 K;  4A3F C;  3CQZ K;  2VUM C;  4BXX C;  3GTQ K;  3HOZ K;  4A3E K;  4Y52 C;  4A3C C;  2A69 A;  2R92 C;  3H0G K;  2VUM K;  3I4M C;  3WOD A;  4G7H A;  3S2D C;  1IW7 A;  4A3J C;  4C3H K;  4XLN A;  1ZYR A;  2BE5 A;  5FJ8 K;  4BBR K;  3HOW K;  1K83 K;  2JA8 K;  1I3Q K;  3HOV K;  3S15 K;  4OIO A;  2NVY C;  4AYB L;  2R7Z C;  2JA7 C;  4AYB D;  2JA8 C;  3HOV C;  4XSZ A;  3K7A K;  1I50 C;  2WAQ D;  3GTJ K;  2E2I C;  3I4N K;  3PO3 K;  3PO2 K;  3S2H K;  4A3B C;  3S2D K;  5C4X C;  3RZO C;  5IYB K;  4A3C K;  1I3Q C;  4A3B K;  5C44 K;  5C4J K;  2E2J K;  2NVQ C;  5IYD C;  1Y1W K;  1TWA C;  4KN4 A;  4LJZ A;  4A3G C;  1I6H C;  3HOU C;  5IP9 C;  2B63 C;  5C3E C;  1Y1V K;  5M5Y K;  1TWC K;  4A3I K;  4Y7N K;  4A3M C;  4G7Z A;  3S15 C;  4KMU A;  3M4O K;  3GTG C;  5FLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...