5HL8A

1.93 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (c-terminal fragment; residues 309-397) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Protein transport
molecule keywords Type II secretion system protein L
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 5hl8A00
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH superfamily
4A3EK 3GTKK 3S1NC 1USMA 1UV7A 2WB1D 3SZZA 3S1RK 1VH2A 2WAQL 5C44K 1I50C 4A3FK 3HOVK 1XXCA 2EBBA 5TMCA 3HOVC 4KATA 2CFAB 4P9SA 3S14K 5C3EK 3ADAC 2JA6C 1GE9A 4BBSK 3HOUC 1SFOA 4QIWL 1WOOA 1IL2A 5EGHA 2R7ZC 4XSZA 1VLOA 2D6FC 1TWHC 4FZBA 2R93C 3HOXK 1IBAA 4QIWD 2NVYK 4G0UA 3M3YC 3S2HC 5TMFA 3H0GA 4PABA 3GTMA 5JFEA 2JA5A 1IQ0A 3H3VL 4Y52C 5JVOA 4C3HK 2ZFZA 3G4CA 4OINA 4KMHA 1I50A 1G51A 4KASA 3RZOK 4A3JC 3GTQC 3HOZC 4KB4A 2ZUFA 4BBRC 1K83K 2RGRA 3GTJK 4FM9A 1WOPA 1VJEA 2A6EA 3HKZD 4A3GK 2JA8C 4KAWX 1TWFK 2NVXC 2NVTC 5C4JC 1K83C 5IYBK 4Y7NK 2R93A 1WSRA 4A3LC 1B4BA 4BLBA 5CHPA 3TFJA 5M5XK 1R9TA 2R7ZA 3GEIA 3S0XA 3HOYC 2A69A 2E2IK 5IORA 2VUMK 2JA7C 3AQOA 3GTLA 2PMZL 4KM8A 1ZYRA 2VUMC 3GTOC 3PO3K 3GSIA 3HOXC 2XCQA 4GTBA 3K7AC 4MEXA 3M3YK 1AB4A 1Y1WA 1JQWA 4GTAA 4GTCA 4A3CC 1IE0A 4X6AK 3LAJA 4KMUA 5CJ9A 1TWHA 3GIRA 1J6VA 4G0VA 2FQTA 2Y0SL 1B4AA 1SFOK 4WJ4A 4YFXA 2O5JA 1XXAA 3GTGC 2E2HK 5M3MK 1C0AA 3GTQK 3CQZK 3V4GA 2PPBA 3FKIA 3TFIA 5FLMC 4O2DA 1I6VA 4YFKA 5C44C 4A3FC 3OPFA 2JA5C 2B63A 4C3IK 3GTMK 3HOWK 1XXBA 2Y3PA 1XZQA 3GDZA 3GTGA 1WCMC 1XPPA 1WCMK 5IOTA 4MQ9A 4A3DC 3H0GC 4A93C 2XCRB 3GTJA 1ISEA 3S2DK 5IOQA 1ZBSA 2E2IC 3N0CA 5L46A 2XCOA 3HOWC 4AH6A 5IYCC 2NVYC 1XZPA 1DCHA 2PMZD 4NOIA 1IW7A 3L4KA 3T02A 4BXXC 1EQRA 1TWAA 1I6HC 5EGEA 3M4OC 2V6TA 4KDDA 3IPJA 3DXJA 4P5BA 4OIQA 1TWGK 4KC6A 4QJVB 2KWAA 1BJTA 3NUHA 4A3JK 1TWCC 2NVQK 3GTLK 1O26A 4XLNA 3GTKA 2E2HC 4GTFA 1JOEA 4C3JK 3S1RC 3S17K 2R92A 3S15K 5C4XC 3S16K 4BY1K 3FHZA 4KM9A 3S16C 2Y0SD 5IYBC 4Y7NC 1WIHA 1WOSA 1PJ7A 2GAGC 2PA8D 1JVIA 2P5MA 3TFHA 1I3QA 5IP7K 1Y1VK 3GTOK 3PO3C 2JA5K 3PO2K 2B63K 1RU0A 2PHCB 3GTPA 5IOSA 3RZOC 1EK8A 3GEEA 3I4NC 1K83A 3M4OK 4A3LK 1PJ6A 3K7AK 5M3FK 3HXAA 2FQOA 4LR2A 4LK1A 4GT9A 1YNJA 1BGWA 4OIPA 1DCOA 4A3MK 5E68A 2A6HA 4DDQA 3QX3A 4Y52K 2CW0A 2GSUA 4ILDA 4BY1C 5D4DA 1TWAK 1F7UA 3GTMC 2JH3A 4Q5SA 3RZDK 3AH5A 5M5WK 4C2MC 1BS2A 2E2IA 1O29A 3A8KA 2GSNA 2P8TA 4P5AA 2PA8L 4C2MK 3AD7C 3GTPC 2YU9A 1TWFC 4BBSC 4AYBD 3S2DC 1Y1WK 4C3HC 3RZDC 1INNA 3CAGA 1J6WA 3S1MK 2GSOA 4X6AC 2YU9C 2GAHC 1YCLA 5HL8A 4A3IC 1ZVUA 1X31C 2V6UA 4A3CK 4GTLA 1I3QK 4A3IK 1Y1VA 4PAAA 4LLGA 3FOEA 2E2HA 4C3IC 4BKWA 2WAQD 3TTGA 1O2BA 3ERED 4ZH4A 1WCMA 3VA7A 3LAPA 3H3VD 1O27A 3T00A 2JA6K 3CQZC 4LK0A 3HOUK 3I4MC 1TWCA 3A8IA 3G4AA 5FJ8K 4LQYA 2VUMA 1KQ4A 1USOA 4A93K 1TWFA 4OIOA 1PJ5A 2RH6A 1ZXOA 4BXXK 1DD5A 3S14C 4KMDA 4LOWA 3FOFA 1TWGA 4JK1A 1WORA 4KMAA 4A3MC 2ZUEA 4KARA 1O24A 3T01A 1TWHK 1DCPA 3BUEA 2JA7K 1HQMA 3HKZL 3GTLC 4G0WA 2B63C 3CQZA 1XZQB 3FKIK 3EQLA 2CFAA 4GTEA 3S1QK 5TJ3A 5C4JK 5IP9K 1I6HK 3SZYA 1O2FB 1F7VA 3HOZK 1L0WA 1J6XA 4G7OA 2BE5A 1O28A 3H0GK 4MEYA 3WODA 2O5IA 1Y1VC 4A3KK 4XLPA 4A3GC 4A3EC 3BP8C 3GTKC 3S1NK 1O25A 4J3NA 4GTDA 4BY7K 1I50K 4Q4ZA 4WJ3M 4G7ZA 5IYDK 3HOYK 2E2JK 3GTOA 4C3JC 1TWAC 5M5YK 4QJVA 2R7ZK 3L4JA 4YFNA 3N3YA 3GTPK 2NVXK 4A3BC 3I4NK 1TWCK 1F93A 2NVQC 1J98A 1WQFA 5IYDC 1R9TC 5IP9C 1YNNA 3GTJC 3AQPA 1R9TK 1TWGC 2A68A 5FLMK 3A8JA 4YG2A 2WB1L 1V5VA 1ZQ1C 4AYBL 1SFOC 4A3KC 4A3BK 3I4MK 1YX2A 2W7VA 1EFWA 2R92K 1XZPB 4KB2A 4KN7A 3S1QC 1SMYA 4A3DK 3N0BA 1EH1A 3GTQA 3BP3A 3AD8C 3Q3QA 1O2AA 4BY7C 2JA7A 4BLAA 4XCHA 4KN4A 4M1XA 3GEHA 4RMFA 2NVYA 2E2JC 2R92C 1WQGA 1IS1A 4LJZA 3LPXA 2YU9K 2JA8K 5C4XK 5C3EC 3S17C 3AD9C 4XSXA 1Y1WC 1EI6A 1VRQC 2NVTK 1WQHA 3PO2C 3GTGK 5IYCK 3JSTA 3OEPA 2JA6A 3MMLB 4BBRK 3OREA 5IP7C 1I3QC 4G7HA 4OIRA 1F9NA 4WILA 1BDFA 3FKIC 1VGXA 2R93K 4C45A 3S1MC 2NVXA 1WSVA 2V6SA 1HI9A 3S2HK 4GFQA 3S15C 4GZYA
chains in the Genus database with same CATH topology
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV7 A;  5HL8 A;  2W7V A; 
#chains in the Genus database with same CATH topology
 4A3E K;  3GTK K;  3S1N C;  1USM A;  1UV7 A;  2WB1 D;  3SZZ A;  3S1R K;  1VH2 A;  2WAQ L;  5C44 K;  1I50 C;  4A3F K;  3HOV K;  1XXC A;  2EBB A;  5TMC A;  3HOV C;  4KAT A;  2CFA B;  4P9S A;  3S14 K;  5C3E K;  3ADA C;  2JA6 C;  1GE9 A;  4BBS K;  3HOU C;  1SFO A;  4QIW L;  1WOO A;  1IL2 A;  5EGH A;  2R7Z C;  4XSZ A;  1VLO A;  2D6F C;  1TWH C;  4FZB A;  2R93 C;  3HOX K;  1IBA A;  4QIW D;  2NVY K;  4G0U A;  3M3Y C;  3S2H C;  5TMF A;  3H0G A;  4PAB A;  3GTM A;  5JFE A;  2JA5 A;  1IQ0 A;  3H3V L;  4Y52 C;  5JVO A;  4C3H K;  2ZFZ A;  3G4C A;  4OIN A;  4KMH A;  1I50 A;  1G51 A;  4KAS A;  3RZO K;  4A3J C;  3GTQ C;  3HOZ C;  4KB4 A;  2ZUF A;  4BBR C;  1K83 K;  2RGR A;  3GTJ K;  4FM9 A;  1WOP A;  1VJE A;  2A6E A;  3HKZ D;  4A3G K;  2JA8 C;  4KAW X;  1TWF K;  2NVX C;  2NVT C;  5C4J C;  1K83 C;  5IYB K;  4Y7N K;  2R93 A;  1WSR A;  4A3L C;  1B4B A;  4BLB A;  5CHP A;  3TFJ A;  5M5X K;  1R9T A;  2R7Z A;  3GEI A;  3S0X A;  3HOY C;  2A69 A;  2E2I K;  5IOR A;  2VUM K;  2JA7 C;  3AQO A;  3GTL A;  2PMZ L;  4KM8 A;  1ZYR A;  2VUM C;  3GTO C;  3PO3 K;  3GSI A;  3HOX C;  2XCQ A;  4GTB A;  3K7A C;  4MEX A;  3M3Y K;  1AB4 A;  1Y1W A;  1JQW A;  4GTA A;  4GTC A;  4A3C C;  1IE0 A;  4X6A K;  3LAJ A;  4KMU A;  5CJ9 A;  1TWH A;  3GIR A;  1J6V A;  4G0V A;  2FQT A;  2Y0S L;  1B4A A;  1SFO K;  4WJ4 A;  4YFX A;  2O5J A;  1XXA A;  3GTG C;  2E2H K;  5M3M K;  1C0A A;  3GTQ K;  3CQZ K;  3V4G A;  2PPB A;  3FKI A;  3TFI A;  5FLM C;  4O2D A;  1I6V A;  4YFK A;  5C44 C;  4A3F C;  3OPF A;  2JA5 C;  2B63 A;  4C3I K;  3GTM K;  3HOW K;  1XXB A;  2Y3P A;  1XZQ A;  3GDZ A;  3GTG A;  1WCM C;  1XPP A;  1WCM K;  5IOT A;  4MQ9 A;  4A3D C;  3H0G C;  4A93 C;  2XCR B;  3GTJ A;  1ISE A;  3S2D K;  5IOQ A;  1ZBS A;  2E2I C;  3N0C A;  5L46 A;  2XCO A;  3HOW C;  4AH6 A;  5IYC C;  2NVY C;  1XZP A;  1DCH A;  2PMZ D;  4NOI A;  1IW7 A;  3L4K A;  3T02 A;  4BXX C;  1EQR A;  1TWA A;  1I6H C;  5EGE A;  3M4O C;  2V6T A;  4KDD A;  3IPJ A;  3DXJ A;  4P5B A;  4OIQ A;  1TWG K;  4KC6 A;  4QJV B;  2KWA A;  1BJT A;  3NUH A;  4A3J K;  1TWC C;  2NVQ K;  3GTL K;  1O26 A;  4XLN A;  3GTK A;  2E2H C;  4GTF A;  1JOE A;  4C3J K;  3S1R C;  3S17 K;  2R92 A;  3S15 K;  5C4X C;  3S16 K;  4BY1 K;  3FHZ A;  4KM9 A;  3S16 C;  2Y0S D;  5IYB C;  4Y7N C;  1WIH A;  1WOS A;  1PJ7 A;  2GAG C;  2PA8 D;  1JVI A;  2P5M A;  3TFH A;  1I3Q A;  5IP7 K;  1Y1V K;  3GTO K;  3PO3 C;  2JA5 K;  3PO2 K;  2B63 K;  1RU0 A;  2PHC B;  3GTP A;  5IOS A;  3RZO C;  1EK8 A;  3GEE A;  3I4N C;  1K83 A;  3M4O K;  4A3L K;  1PJ6 A;  3K7A K;  5M3F K;  3HXA A;  2FQO A;  4LR2 A;  4LK1 A;  4GT9 A;  1YNJ A;  1BGW A;  4OIP A;  1DCO A;  4A3M K;  5E68 A;  2A6H A;  4DDQ A;  3QX3 A;  4Y52 K;  2CW0 A;  2GSU A;  4ILD A;  4BY1 C;  5D4D A;  1TWA K;  1F7U A;  3GTM C;  2JH3 A;  4Q5S A;  3RZD K;  3AH5 A;  5M5W K;  4C2M C;  1BS2 A;  2E2I A;  1O29 A;  3A8K A;  2GSN A;  2P8T A;  4P5A A;  2PA8 L;  4C2M K;  3AD7 C;  3GTP C;  2YU9 A;  1TWF C;  4BBS C;  4AYB D;  3S2D C;  1Y1W K;  4C3H C;  3RZD C;  1INN A;  3CAG A;  1J6W A;  3S1M K;  2GSO A;  4X6A C;  2YU9 C;  2GAH C;  1YCL A;  5HL8 A;  4A3I C;  1ZVU A;  1X31 C;  2V6U A;  4A3C K;  4GTL A;  1I3Q K;  4A3I K;  1Y1V A;  4PAA A;  4LLG A;  3FOE A;  2E2H A;  4C3I C;  4BKW A;  2WAQ D;  3TTG A;  1O2B A;  3ERE D;  4ZH4 A;  1WCM A;  3VA7 A;  3LAP A;  3H3V D;  1O27 A;  3T00 A;  2JA6 K;  3CQZ C;  4LK0 A;  3HOU K;  3I4M C;  1TWC A;  3A8I A;  3G4A A;  5FJ8 K;  4LQY A;  2VUM A;  1KQ4 A;  1USO A;  4A93 K;  1TWF A;  4OIO A;  1PJ5 A;  2RH6 A;  1ZXO A;  4BXX K;  1DD5 A;  3S14 C;  4KMD A;  4LOW A;  3FOF A;  1TWG A;  4JK1 A;  1WOR A;  4KMA A;  4A3M C;  2ZUE A;  4KAR A;  1O24 A;  3T01 A;  1TWH K;  1DCP A;  3BUE A;  2JA7 K;  1HQM A;  3HKZ L;  3GTL C;  4G0W A;  2B63 C;  3CQZ A;  1XZQ B;  3FKI K;  3EQL A;  2CFA A;  4GTE A;  3S1Q K;  5TJ3 A;  5C4J K;  5IP9 K;  1I6H K;  3SZY A;  1O2F B;  1F7V A;  3HOZ K;  1L0W A;  1J6X A;  4G7O A;  2BE5 A;  1O28 A;  3H0G K;  4MEY A;  3WOD A;  2O5I A;  1Y1V C;  4A3K K;  4XLP A;  4A3G C;  4A3E C;  3BP8 C;  3GTK C;  3S1N K;  1O25 A;  4J3N A;  4GTD A;  4BY7 K;  1I50 K;  4Q4Z A;  4WJ3 M;  4G7Z A;  5IYD K;  3HOY K;  2E2J K;  3GTO A;  4C3J C;  1TWA C;  5M5Y K;  4QJV A;  2R7Z K;  3L4J A;  4YFN A;  3N3Y A;  3GTP K;  2NVX K;  4A3B C;  3I4N K;  1TWC K;  1F93 A;  2NVQ C;  1J98 A;  1WQF A;  5IYD C;  1R9T C;  5IP9 C;  1YNN A;  3GTJ C;  3AQP A;  1R9T K;  1TWG C;  2A68 A;  5FLM K;  3A8J A;  4YG2 A;  2WB1 L;  1V5V A;  1ZQ1 C;  4AYB L;  1SFO C;  4A3K C;  4A3B K;  3I4M K;  1YX2 A;  2W7V A;  1EFW A;  2R92 K;  1XZP B;  4KB2 A;  4KN7 A;  3S1Q C;  1SMY A;  4A3D K;  3N0B A;  1EH1 A;  3GTQ A;  3BP3 A;  3AD8 C;  3Q3Q A;  1O2A A;  4BY7 C;  2JA7 A;  4BLA A;  4XCH A;  4KN4 A;  4M1X A;  3GEH A;  4RMF A;  2NVY A;  2E2J C;  2R92 C;  1WQG A;  1IS1 A;  4LJZ A;  3LPX A;  2YU9 K;  2JA8 K;  5C4X K;  5C3E C;  3S17 C;  3AD9 C;  4XSX A;  1Y1W C;  1EI6 A;  1VRQ C;  2NVT K;  1WQH A;  3PO2 C;  3GTG K;  5IYC K;  3JST A;  3OEP A;  2JA6 A;  3MML B;  4BBR K;  3ORE A;  5IP7 C;  1I3Q C;  4G7H A;  4OIR A;  1F9N A;  4WIL A;  1BDF A;  3FKI C;  1VGX A;  2R93 K;  4C45 A;  3S1M C;  2NVX A;  1WSV A;  2V6S A;  1HI9 A;  3S2H K;  4GFQ A;  3S15 C;  4GZY A; 
#chains in the Genus database with same CATH homology
 1UV7 A;  5HL8 A;  2W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...