5HL8A

1.93 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (c-terminal fragment; residues 309-397) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type II secretion system protein L
publication title 1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Protein transport
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 5hl8A00
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH superfamily
4G0VA 3NUHA 1TWAK 1F7UA 3S1MC 3GEEA 1TWCC 3M3YK 1O28A 2CFAA 1L0WA 4BY1K 1VJEA 4FZBA 1TWAC 4C3IC 4YFXA 1WCMA 2YU9C 3M3YC 2NVTK 5IP9K 4X6AK 1PJ6A 3FKIA 3GTLK 2R7ZC 3H0GC 1I6VA 2E2HK 4KN4A 5IOQA 5IP9C 3HOVC 4X6AC 4A3CC 1WIHA 3GTLC 1I50K 4LQYA 1O24A 3HKZL 3HOWC 2JH3A 1BJTA 4GT9A 1INNA 2BE5A 3HOZK 1I50C 3PO3K 1O27A 4A3FK 1TWGA 2JA6K 4A3IK 2ZUEA 2CFAB 2NVXC 1WORA 2V6TA 2RGRA 3S16K 3GIRA 2JA7A 1TWHK 3HOZC 3OREA 1Y1WA 4AH6A 4DDQA 2NVYA 2JA6C 4A3IC 4C3JK 4LR2A 3S15K 2XCOA 1J98A 1O2AA 4A3LK 1WOSA 1K83K 4Y52K 4GTDA 2E2IK 5E68A 1ZBSA 3DXJA 4YG2A 5EGEA 2B63A 4A3LC 2FQTA 4AYBD 4KB4A 3TFJA 5CHPA 1ISEA 3OEPA 4XCHA 1EK8A 4C3HK 5JVOA 4GTFA 4QIWD 3S14C 1TWFK 2JA5A 3S17C 2V6UA 4A3MC 3I4MK 4FM9A 4BLAA 1IE0A 1Y1WC 1TWFC 4XLNA 1TWCA 3ERED 1I6HK 3CQZK 3I4MC 1O2BA 1BGWA 1TWAA 1I6HC 2YU9A 5HL8A 4C45A 2RH6A 3CQZC 3IPJA 2R7ZA 1WOPA 1WSRA 3H0GA 3S1RC 3S2HK 4JK1A 5C3EC 3RZOC 1USOA 1XXAA 1ZXOA 2B63C 3GTLA 4A3JK 1USMA 5M5WK 4LLGA 3S2HC 3H3VD 4KMAA 3HOXK 3GTGK 1VLOA 2VUMK 1I50A 4ILDA 1O26A 2ZUFA 4XSXA 3HOXC 2NVXA 1IQ0A 3GTGC 5IYCK 1C0AA 2JA6A 3AQOA 4P5BA 1IW7A 5L46A 3CAGA 3SZZA 5IYCC 5FJ8K 2R92K 5M3MK 4WILA 4KM8A 1B4BA 3V4GA 3L4JA 4BY1C 3JSTA 1XPPA 5IP7K 1V5VA 4AYBL 3FHZA 4OIRA 4P9SA 3ADAC 5IOSA 2NVTC 4LK1A 3N3YA 1B4AA 4Q5SA 5FLMK 2E2HC 1BS2A 1HQMA 1SMYA 4KATA 4QIWL 3WODA 3GTQK 3GTMK 1EFWA 4KB2A 1ZYRA 3LAJA 1JVIA 1ZQ1C 2CW0A 4NOIA 3LPXA 4QJVA 1G51A 5D4DA 5C4XK 1O25A 3GEHA 3Q3QA 4YFKA 3PO3C 4A3FC 1TWFA 3GEIA 1RU0A 4GZYA 3S1QK 3S16C 4A3KK 1TWHC 4Y7NK 4GTEA 3BP8C 4A3GK 1F9NA 1WOOA 3S1QC 4GTBA 4C3JC 3HOUK 4A3KC 3CQZA 4P5AA 4G7OA 3BUEA 5EGHA 2PHCB 3GTPK 1PJ7A 3S15C 3LAPA 3H3VL 1K83C 4Y52C 2E2IC 4GTLA 3TFIA 4QJVB 1F93A 3TTGA 1WCMK 4A3BK 2GSNA 4PAAA 4A3DK 1DD5A 3GTJK 5M3FK 4A3BC 3GTGA 1I3QK 4ZH4A 4PABA 4RMFA 4C3HC 4BBRK 3K7AK 4KASA 4A93K 3GTJC 5M5XK 4O2DA 4KARA 4BBRC 2KWAA 2Y0SD 1KQ4A 4A93C 1WQHA 2R93K 2E2JK 2R92A 4MQ9A 3AD9C 5M5YK 1VGXA 3OPFA 3RZDK 2E2JC 2P8TA 3AH5A 3G4CA 1F7VA 2E2HA 4MEYA 5JFEA 5TJ3A 1XZQA 1BDFA 4BLBA 3HOYK 4A3JC 4Q4ZA 2JA8K 3GTKK 2PA8D 2XCQA 4XSZA 3I4NK 3GTMA 5TMFA 2ZFZA 2VUMC 1Y1VK 4KDDA 3QX3A 2JA8C 3T01A 2D6FC 4KAWX 4LJZA 3FOFA 4KC6A 1IS1A 1TWHA 2WB1D 4BBSK 4M1XA 3S0XA 1EQRA 1R9TK 2A69A 1DCHA 5CJ9A 1WQGA 2JA5K 4LK0A 4YFNA 4BBSC 4MEXA 5TMCA 2R92C 1XZQB 3S1MK 1HI9A 2A6EA 4OINA 1K83A 2E2IA 4OIQA 4BKWA 4C3IK 5IP7C 3GTPA 1YNJA 2YU9K 4KMUA 3TFHA 1XXBA 1YNNA 2R7ZK 2W7VA 3H0GK 2O5JA 3A8KA 5IOTA 3S2DK 4WJ3M 2WAQD 4BY7K 5FLMC 1AB4A 2XCRB 3HOVK 3GTQC 4A3CK 1JOEA 1GE9A 4GFQA 3GTMC 3GSIA 3GTOK 3S2DC 3MMLB 1IL2A 3HOWK 4BY7C 3GTJA 1VH2A 1I3QA 1DCOA 2O5IA 2Y0SL 4GTAA 4KMHA 3GTOC 1EI6A 1YX2A 1SFOK 5C4XC 3A8IA 1O29A 4XLPA 5IORA 2NVXK 3S1NK 1J6XA 2PMZD 4G0UA 2GSOA 1XZPA 1O2FB 4GTCA 1SFOC 4OIPA 3AD8C 4Y7NC 4KN7A 4A3GC 2GSUA 1XXCA 3S1NC 2R93A 3G4AA 3HOUC 4C2MK 2PPBA 5C44K 3GTPC 4C2MC 1ZVUA 2PA8L 3FKIK 2GAGC 4KM9A 4A3EK 5C44C 1WCMC 4BXXK 4G7HA 4KMDA 3FKIC 2VUMA 2A6HA 3M4OK 3GTKA 2WB1L 4A3EC 4A3DC 4BXXC 1X31C 1VRQC 3SZYA 4WJ4A 1I3QC 1XZPB 3BP3A 1Y1VA 3M4OC 3S14K 3N0BA 3K7AC 1TWGK 1IBAA 3S17K 3VA7A 4A3MK 3HKZD 2JA7K 1PJ5A 1WQFA 1Y1WK 1R9TA 1DCPA 5C4JK 3FOEA 1JQWA 4G0WA 2NVYK 1TWGC 3N0CA 5IYDK 2JA7C 2R93C 5C4JC 2FQOA 4J3NA 2NVYC 1YCLA 3HXAA 5IYDC 3RZDC 2WAQL 3S1RK 5C3EK 3RZOK 1WSVA 1J6VA 3GDZA 3T00A 3GTQA 2B63K 2NVQK 2P5MA 3A8JA 3HOYC 3PO2K 4G7ZA 3GTKC 4OIOA 5IYBK 2Y3PA 3I4NC 2NVQC 3GTOA 3AD7C 3AQPA 3PO2C 1Y1VC 2PMZL 2V6SA 2GAHC 5IYBC 4LOWA 2A68A 3T02A 1SFOA 1EH1A 3EQLA 3L4KA 2EBBA 1R9TC 1UV7A 1TWCK 2JA5C 1J6WA
chains in the Genus database with same CATH topology
1UV7A 5HL8A 2W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV7 A;  5HL8 A;  2W7V A; 
#chains in the Genus database with same CATH topology
 4G0V A;  3NUH A;  1TWA K;  1F7U A;  3S1M C;  3GEE A;  1TWC C;  3M3Y K;  1O28 A;  2CFA A;  1L0W A;  4BY1 K;  1VJE A;  4FZB A;  1TWA C;  4C3I C;  4YFX A;  1WCM A;  2YU9 C;  3M3Y C;  2NVT K;  5IP9 K;  4X6A K;  1PJ6 A;  3FKI A;  3GTL K;  2R7Z C;  3H0G C;  1I6V A;  2E2H K;  4KN4 A;  5IOQ A;  5IP9 C;  3HOV C;  4X6A C;  4A3C C;  1WIH A;  3GTL C;  1I50 K;  4LQY A;  1O24 A;  3HKZ L;  3HOW C;  2JH3 A;  1BJT A;  4GT9 A;  1INN A;  2BE5 A;  3HOZ K;  1I50 C;  3PO3 K;  1O27 A;  4A3F K;  1TWG A;  2JA6 K;  4A3I K;  2ZUE A;  2CFA B;  2NVX C;  1WOR A;  2V6T A;  2RGR A;  3S16 K;  3GIR A;  2JA7 A;  1TWH K;  3HOZ C;  3ORE A;  1Y1W A;  4AH6 A;  4DDQ A;  2NVY A;  2JA6 C;  4A3I C;  4C3J K;  4LR2 A;  3S15 K;  2XCO A;  1J98 A;  1O2A A;  4A3L K;  1WOS A;  1K83 K;  4Y52 K;  4GTD A;  2E2I K;  5E68 A;  1ZBS A;  3DXJ A;  4YG2 A;  5EGE A;  2B63 A;  4A3L C;  2FQT A;  4AYB D;  4KB4 A;  3TFJ A;  5CHP A;  1ISE A;  3OEP A;  4XCH A;  1EK8 A;  4C3H K;  5JVO A;  4GTF A;  4QIW D;  3S14 C;  1TWF K;  2JA5 A;  3S17 C;  2V6U A;  4A3M C;  3I4M K;  4FM9 A;  4BLA A;  1IE0 A;  1Y1W C;  1TWF C;  4XLN A;  1TWC A;  3ERE D;  1I6H K;  3CQZ K;  3I4M C;  1O2B A;  1BGW A;  1TWA A;  1I6H C;  2YU9 A;  5HL8 A;  4C45 A;  2RH6 A;  3CQZ C;  3IPJ A;  2R7Z A;  1WOP A;  1WSR A;  3H0G A;  3S1R C;  3S2H K;  4JK1 A;  5C3E C;  3RZO C;  1USO A;  1XXA A;  1ZXO A;  2B63 C;  3GTL A;  4A3J K;  1USM A;  5M5W K;  4LLG A;  3S2H C;  3H3V D;  4KMA A;  3HOX K;  3GTG K;  1VLO A;  2VUM K;  1I50 A;  4ILD A;  1O26 A;  2ZUF A;  4XSX A;  3HOX C;  2NVX A;  1IQ0 A;  3GTG C;  5IYC K;  1C0A A;  2JA6 A;  3AQO A;  4P5B A;  1IW7 A;  5L46 A;  3CAG A;  3SZZ A;  5IYC C;  5FJ8 K;  2R92 K;  5M3M K;  4WIL A;  4KM8 A;  1B4B A;  3V4G A;  3L4J A;  4BY1 C;  3JST A;  1XPP A;  5IP7 K;  1V5V A;  4AYB L;  3FHZ A;  4OIR A;  4P9S A;  3ADA C;  5IOS A;  2NVT C;  4LK1 A;  3N3Y A;  1B4A A;  4Q5S A;  5FLM K;  2E2H C;  1BS2 A;  1HQM A;  1SMY A;  4KAT A;  4QIW L;  3WOD A;  3GTQ K;  3GTM K;  1EFW A;  4KB2 A;  1ZYR A;  3LAJ A;  1JVI A;  1ZQ1 C;  2CW0 A;  4NOI A;  3LPX A;  4QJV A;  1G51 A;  5D4D A;  5C4X K;  1O25 A;  3GEH A;  3Q3Q A;  4YFK A;  3PO3 C;  4A3F C;  1TWF A;  3GEI A;  1RU0 A;  4GZY A;  3S1Q K;  3S16 C;  4A3K K;  1TWH C;  4Y7N K;  4GTE A;  3BP8 C;  4A3G K;  1F9N A;  1WOO A;  3S1Q C;  4GTB A;  4C3J C;  3HOU K;  4A3K C;  3CQZ A;  4P5A A;  4G7O A;  3BUE A;  5EGH A;  2PHC B;  3GTP K;  1PJ7 A;  3S15 C;  3LAP A;  3H3V L;  1K83 C;  4Y52 C;  2E2I C;  4GTL A;  3TFI A;  4QJV B;  1F93 A;  3TTG A;  1WCM K;  4A3B K;  2GSN A;  4PAA A;  4A3D K;  1DD5 A;  3GTJ K;  5M3F K;  4A3B C;  3GTG A;  1I3Q K;  4ZH4 A;  4PAB A;  4RMF A;  4C3H C;  4BBR K;  3K7A K;  4KAS A;  4A93 K;  3GTJ C;  5M5X K;  4O2D A;  4KAR A;  4BBR C;  2KWA A;  2Y0S D;  1KQ4 A;  4A93 C;  1WQH A;  2R93 K;  2E2J K;  2R92 A;  4MQ9 A;  3AD9 C;  5M5Y K;  1VGX A;  3OPF A;  3RZD K;  2E2J C;  2P8T A;  3AH5 A;  3G4C A;  1F7V A;  2E2H A;  4MEY A;  5JFE A;  5TJ3 A;  1XZQ A;  1BDF A;  4BLB A;  3HOY K;  4A3J C;  4Q4Z A;  2JA8 K;  3GTK K;  2PA8 D;  2XCQ A;  4XSZ A;  3I4N K;  3GTM A;  5TMF A;  2ZFZ A;  2VUM C;  1Y1V K;  4KDD A;  3QX3 A;  2JA8 C;  3T01 A;  2D6F C;  4KAW X;  4LJZ A;  3FOF A;  4KC6 A;  1IS1 A;  1TWH A;  2WB1 D;  4BBS K;  4M1X A;  3S0X A;  1EQR A;  1R9T K;  2A69 A;  1DCH A;  5CJ9 A;  1WQG A;  2JA5 K;  4LK0 A;  4YFN A;  4BBS C;  4MEX A;  5TMC A;  2R92 C;  1XZQ B;  3S1M K;  1HI9 A;  2A6E A;  4OIN A;  1K83 A;  2E2I A;  4OIQ A;  4BKW A;  4C3I K;  5IP7 C;  3GTP A;  1YNJ A;  2YU9 K;  4KMU A;  3TFH A;  1XXB A;  1YNN A;  2R7Z K;  2W7V A;  3H0G K;  2O5J A;  3A8K A;  5IOT A;  3S2D K;  4WJ3 M;  2WAQ D;  4BY7 K;  5FLM C;  1AB4 A;  2XCR B;  3HOV K;  3GTQ C;  4A3C K;  1JOE A;  1GE9 A;  4GFQ A;  3GTM C;  3GSI A;  3GTO K;  3S2D C;  3MML B;  1IL2 A;  3HOW K;  4BY7 C;  3GTJ A;  1VH2 A;  1I3Q A;  1DCO A;  2O5I A;  2Y0S L;  4GTA A;  4KMH A;  3GTO C;  1EI6 A;  1YX2 A;  1SFO K;  5C4X C;  3A8I A;  1O29 A;  4XLP A;  5IOR A;  2NVX K;  3S1N K;  1J6X A;  2PMZ D;  4G0U A;  2GSO A;  1XZP A;  1O2F B;  4GTC A;  1SFO C;  4OIP A;  3AD8 C;  4Y7N C;  4KN7 A;  4A3G C;  2GSU A;  1XXC A;  3S1N C;  2R93 A;  3G4A A;  3HOU C;  4C2M K;  2PPB A;  5C44 K;  3GTP C;  4C2M C;  1ZVU A;  2PA8 L;  3FKI K;  2GAG C;  4KM9 A;  4A3E K;  5C44 C;  1WCM C;  4BXX K;  4G7H A;  4KMD A;  3FKI C;  2VUM A;  2A6H A;  3M4O K;  3GTK A;  2WB1 L;  4A3E C;  4A3D C;  4BXX C;  1X31 C;  1VRQ C;  3SZY A;  4WJ4 A;  1I3Q C;  1XZP B;  3BP3 A;  1Y1V A;  3M4O C;  3S14 K;  3N0B A;  3K7A C;  1TWG K;  1IBA A;  3S17 K;  3VA7 A;  4A3M K;  3HKZ D;  2JA7 K;  1PJ5 A;  1WQF A;  1Y1W K;  1R9T A;  1DCP A;  5C4J K;  3FOE A;  1JQW A;  4G0W A;  2NVY K;  1TWG C;  3N0C A;  5IYD K;  2JA7 C;  2R93 C;  5C4J C;  2FQO A;  4J3N A;  2NVY C;  1YCL A;  3HXA A;  5IYD C;  3RZD C;  2WAQ L;  3S1R K;  5C3E K;  3RZO K;  1WSV A;  1J6V A;  3GDZ A;  3T00 A;  3GTQ A;  2B63 K;  2NVQ K;  2P5M A;  3A8J A;  3HOY C;  3PO2 K;  4G7Z A;  3GTK C;  4OIO A;  5IYB K;  2Y3P A;  3I4N C;  2NVQ C;  3GTO A;  3AD7 C;  3AQP A;  3PO2 C;  1Y1V C;  2PMZ L;  2V6S A;  2GAH C;  5IYB C;  4LOW A;  2A68 A;  3T02 A;  1SFO A;  1EH1 A;  3EQL A;  3L4K A;  2EBB A;  1R9T C;  1UV7 A;  1TWC K;  2JA5 C;  1J6W A; 
#chains in the Genus database with same CATH homology
 1UV7 A;  5HL8 A;  2W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...