5HL8A

1.93 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (c-terminal fragment; residues 309-397) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type II secretion system protein L
publication title 1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Protein transport
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 5hl8A00
2W7VA 1UV7A 5HL8A
chains in the Genus database with same CATH superfamily
4XLPA 3GTGA 1TWAK 4KM9A 2GSNA 3FOEA 5IP9K 5CHPA 3AD8C 2PPBA 3HOUK 1VH2A 2E2IC 1F9NA 1WCMC 2V6TA 1I6VA 3T01A 1ZYRA 2E2HC 2NVQK 3FKIA 1XZPB 3BUEA 2R92K 3GTOC 3HOVC 3S14C 3GTJA 1SFOK 3RZDC 2R7ZK 1VLOA 1USOA 4XSZA 4OIRA 4KB2A 3OPFA 3S2HC 3TTGA 1O26A 5IYBC 3OREA 2FQTA 3T02A 3LPXA 2JA6C 4A3BK 1XXBA 4A3KC 4A93K 1WCMA 2GSOA 4C2MC 4A3MK 4BXXK 1I50C 3S15C 2E2HA 3L4KA 3Q3QA 3GTGK 3GTOA 4C45A 1I3QA 1PJ5A 1WORA 1TWAC 3HOUC 5IP9C 4BBRK 3HKZD 5CJ9A 3FHZA 1VJEA 2P8TA 3GTQK 3S17K 2ZFZA 2NVQC 1GE9A 2R92C 4XSXA 4C3IK 2A6EA 4YFXA 4LQYA 1EQRA 3AH5A 1HI9A 1SFOC 2R7ZC 4G7ZA 3H3VL 3HOZK 1YCLA 3IPJA 1K83K 4C3HC 4ZH4A 4G0VA 1BGWA 1I50A 3L4JA 1R9TK 4JK1A 2YU9A 1WOSA 2Y3PA 3OEPA 4A3BC 2GAGC 3LAJA 1F7UA 3GEHA 3PO2C 4LR2A 4A93C 3QX3A 4RMFA 3EQLA 4A3MC 5E68A 4BXXC 3GTOK 4WILA 3HOYK 1DCPA 1I3QK 4AYBL 3HOVK 4WJ4A 3GTGC 1TWHK 5L46A 2R92A 3ERED 3A8KA 3HXAA 1XZPA 4KATA 3H0GA 1EFWA 2XCOA 4BBRC 4Y7NK 2PHCB 1SFOA 3GTQC 1O27A 2RH6A 2GSUA 5IOSA 4KC6A 2NVTC 1ZXOA 2D6FC 3GDZA 1TWFK 4C3IC 3GTMK 1J6WA 2NVYK 1K83C 5TJ3A 4GT9A 3GTPK 1PJ6A 4FZBA 4KMUA 3NUHA 3S15K 4YG2A 1O2FB 1DCOA 5M5WK 1V5VA 3A8JA 4AH6A 4AYBD 1R9TC 2YU9K 2JA8K 1ZVUA 3JSTA 4GFQA 2P5MA 5C4JC 3GTQA 4GTFA 1XXAA 1TWCK 3HOXK 2JA5A 2ZUFA 3HOYC 1I3QC 1TWHC 3I4MK 4O2DA 2RGRA 1O28A 3H0GK 3G4AA 4GTLA 3HKZL 2A6HA 1ZBSA 4Y7NC 4C3HK 5C44K 1EI6A 3CQZK 1K83A 4GZYA 1WQGA 2XCRB 4KASA 1XZQB 2GAHC 4XLNA 2CFAB 2VUMA 2O5JA 4KM8A 5IOQA 4LK0A 1TWFC 5EGEA 4GTAA 1R9TA 3GTMC 1WIHA 5EGHA 2NVYC 3PO2K 1JOEA 1JQWA 3GTPC 4P5BA 2B63C 4G0UA 4A3JC 2NVXK 1Y1VA 1WSVA 3G4CA 4PABA 1L0WA 1B4AA 1J98A 3N0CA 4X6AK 2YU9C 1TWHA 2WB1L 1F93A 2JA8C 3M4OC 2PMZL 2WAQL 3TFHA 1F7VA 4KAWX 1IW7A 1O29A 2EBBA 2NVTK 1IE0A 1XPPA 3GTKA 2JA5K 4QIWD 1TWCC 3HOXC 1IS1A 4KMDA 3I4MC 2Y0SD 4KB4A 1TWFA 3BP3A 4GTEA 1EK8A 3H0GC 2JH3A 1WQHA 3GTMA 1EH1A 1IQ0A 2NVYA 3S1NK 3AD7C 2BE5A 3SZYA 2A68A 3CQZC 5C44C 3S0XA 3GTPA 4YFNA 3WODA 2B63A 5TMFA 2VUMK 4GTBA 2O5IA 5FJ8K 4A3EK 4KN4A 1YNNA 4GTCA 1IL2A 1WOOA 2WB1D 2PMZD 2WAQD 1BDFA 3I4NK 2KWAA 1Y1VK 3S1QK 5C4JK 5IYCK 4A3IK 2NVXC 3DXJA 2V6SA 1I6HK 1TWCA 4MEXA 4X6AC 1USMA 5IYDK 4KDDA 3LAPA 4A3LK 3GTKK 2E2JK 3CQZA 4KN7A 2JA5C 3BP8C 4KARA 1XZQA 1VRQC 4KMAA 4OIOA 2CFAA 1JVIA 4BBSK 1VGXA 4G7OA 4MQ9A 3S1NC 4YFKA 4KMHA 2B63K 4A3JK 5JFEA 5IOTA 4G7HA 4A3DK 2VUMC 2NVXA 5C4XK 5FLMK 4A3EC 1BS2A 1TWGC 3M4OK 5M3MK 4ILDA 5JVOA 4Q5SA 1O2BA 1B4BA 4C3JK 3I4NC 4BY1C 1Y1VC 3S1QC 5IYCC 4A3IC 4M1XA 3V4GA 5M5XK 3S2DK 1I6HC 4GTDA 3PO3K 1ZQ1C 2R93K 1C0AA 1RU0A 5M5YK 2CW0A 4QJVB 5IYDC 3S16K 1UV7A 1ISEA 4LK1A 1INNA 4LLGA 4A3LC 3GTKC 4QIWL 4MEYA 4BLAA 2E2JC 5IP7K 2Y0SL 1YX2A 1TWGA 3HOWK 2JA7K 4P5AA 4BBSC 3MMLB 1O25A 1IBAA 4P9SA 1J6XA 1KQ4A 2ZUEA 3RZOK 4A3GK 3T00A 4A3DC 5C4XC 1SMYA 5FLMC 4OINA 3GSIA 3GTLA 1Y1WK 3S1MK 5C3EK 2FQOA 1AB4A 4C3JC 4Q4ZA 1WSRA 3S2DC 3TFJA 1O2AA 2E2IA 3PO3C 3N0BA 2R93C 2PA8L 3S1RK 5IORA 3S16C 3ADAC 4NOIA 4WJ3M 3K7AK 5IP7C 1TWGK 3FKIK 2W7VA 4Y52K 3HOWC 2JA7C 1WOPA 3N3YA 3GTJK 3M3YK 4BY7K 1J6VA 1DD5A 4LJZA 4PAAA 4BY1K 3GEIA 2JA6A 3RZOC 4A3GC 4A3FK 1HQMA 1X31C 4LOWA 4A3CK 3GTLK 2R93A 2PA8D 1Y1WC 3S1MC 5C3EC 4J3NA 1PJ7A 4XCHA 3SZZA 5D4DA 4QJVA 5HL8A 3GEEA 1TWAA 4BLBA 3TFIA 2E2IK 1WCMK 3AQPA 2V6UA 1G51A 2E2HK 4G0WA 5TMCA 3S1RC 2JA7A 3S14K 1XXCA 1YNJA 3K7AC 4FM9A 3RZDK 1WQFA 3AQOA 4OIPA 3A8IA 2R7ZA 4BKWA 3CAGA 3H3VD 3S2HK 3AD9C 3S17C 3FKIC 4Y52C 2XCQA 4DDQA 5IYBK 1BJTA 5M3FK 2A69A 3GTJC 3M3YC 4BY7C 1Y1WA 3FOFA 2JA6K 1O24A 3VA7A 4A3KK 3HOZC 4A3FC 4A3CC 4C2MK 4OIQA 1I50K 3GTLC 1DCHA 3GIRA
chains in the Genus database with same CATH topology
2W7VA 1UV7A 5HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7V A;  1UV7 A;  5HL8 A; 
#chains in the Genus database with same CATH topology
 4XLP A;  3GTG A;  1TWA K;  4KM9 A;  2GSN A;  3FOE A;  5IP9 K;  5CHP A;  3AD8 C;  2PPB A;  3HOU K;  1VH2 A;  2E2I C;  1F9N A;  1WCM C;  2V6T A;  1I6V A;  3T01 A;  1ZYR A;  2E2H C;  2NVQ K;  3FKI A;  1XZP B;  3BUE A;  2R92 K;  3GTO C;  3HOV C;  3S14 C;  3GTJ A;  1SFO K;  3RZD C;  2R7Z K;  1VLO A;  1USO A;  4XSZ A;  4OIR A;  4KB2 A;  3OPF A;  3S2H C;  3TTG A;  1O26 A;  5IYB C;  3ORE A;  2FQT A;  3T02 A;  3LPX A;  2JA6 C;  4A3B K;  1XXB A;  4A3K C;  4A93 K;  1WCM A;  2GSO A;  4C2M C;  4A3M K;  4BXX K;  1I50 C;  3S15 C;  2E2H A;  3L4K A;  3Q3Q A;  3GTG K;  3GTO A;  4C45 A;  1I3Q A;  1PJ5 A;  1WOR A;  1TWA C;  3HOU C;  5IP9 C;  4BBR K;  3HKZ D;  5CJ9 A;  3FHZ A;  1VJE A;  2P8T A;  3GTQ K;  3S17 K;  2ZFZ A;  2NVQ C;  1GE9 A;  2R92 C;  4XSX A;  4C3I K;  2A6E A;  4YFX A;  4LQY A;  1EQR A;  3AH5 A;  1HI9 A;  1SFO C;  2R7Z C;  4G7Z A;  3H3V L;  3HOZ K;  1YCL A;  3IPJ A;  1K83 K;  4C3H C;  4ZH4 A;  4G0V A;  1BGW A;  1I50 A;  3L4J A;  1R9T K;  4JK1 A;  2YU9 A;  1WOS A;  2Y3P A;  3OEP A;  4A3B C;  2GAG C;  3LAJ A;  1F7U A;  3GEH A;  3PO2 C;  4LR2 A;  4A93 C;  3QX3 A;  4RMF A;  3EQL A;  4A3M C;  5E68 A;  4BXX C;  3GTO K;  4WIL A;  3HOY K;  1DCP A;  1I3Q K;  4AYB L;  3HOV K;  4WJ4 A;  3GTG C;  1TWH K;  5L46 A;  2R92 A;  3ERE D;  3A8K A;  3HXA A;  1XZP A;  4KAT A;  3H0G A;  1EFW A;  2XCO A;  4BBR C;  4Y7N K;  2PHC B;  1SFO A;  3GTQ C;  1O27 A;  2RH6 A;  2GSU A;  5IOS A;  4KC6 A;  2NVT C;  1ZXO A;  2D6F C;  3GDZ A;  1TWF K;  4C3I C;  3GTM K;  1J6W A;  2NVY K;  1K83 C;  5TJ3 A;  4GT9 A;  3GTP K;  1PJ6 A;  4FZB A;  4KMU A;  3NUH A;  3S15 K;  4YG2 A;  1O2F B;  1DCO A;  5M5W K;  1V5V A;  3A8J A;  4AH6 A;  4AYB D;  1R9T C;  2YU9 K;  2JA8 K;  1ZVU A;  3JST A;  4GFQ A;  2P5M A;  5C4J C;  3GTQ A;  4GTF A;  1XXA A;  1TWC K;  3HOX K;  2JA5 A;  2ZUF A;  3HOY C;  1I3Q C;  1TWH C;  3I4M K;  4O2D A;  2RGR A;  1O28 A;  3H0G K;  3G4A A;  4GTL A;  3HKZ L;  2A6H A;  1ZBS A;  4Y7N C;  4C3H K;  5C44 K;  1EI6 A;  3CQZ K;  1K83 A;  4GZY A;  1WQG A;  2XCR B;  4KAS A;  1XZQ B;  2GAH C;  4XLN A;  2CFA B;  2VUM A;  2O5J A;  4KM8 A;  5IOQ A;  4LK0 A;  1TWF C;  5EGE A;  4GTA A;  1R9T A;  3GTM C;  1WIH A;  5EGH A;  2NVY C;  3PO2 K;  1JOE A;  1JQW A;  3GTP C;  4P5B A;  2B63 C;  4G0U A;  4A3J C;  2NVX K;  1Y1V A;  1WSV A;  3G4C A;  4PAB A;  1L0W A;  1B4A A;  1J98 A;  3N0C A;  4X6A K;  2YU9 C;  1TWH A;  2WB1 L;  1F93 A;  2JA8 C;  3M4O C;  2PMZ L;  2WAQ L;  3TFH A;  1F7V A;  4KAW X;  1IW7 A;  1O29 A;  2EBB A;  2NVT K;  1IE0 A;  1XPP A;  3GTK A;  2JA5 K;  4QIW D;  1TWC C;  3HOX C;  1IS1 A;  4KMD A;  3I4M C;  2Y0S D;  4KB4 A;  1TWF A;  3BP3 A;  4GTE A;  1EK8 A;  3H0G C;  2JH3 A;  1WQH A;  3GTM A;  1EH1 A;  1IQ0 A;  2NVY A;  3S1N K;  3AD7 C;  2BE5 A;  3SZY A;  2A68 A;  3CQZ C;  5C44 C;  3S0X A;  3GTP A;  4YFN A;  3WOD A;  2B63 A;  5TMF A;  2VUM K;  4GTB A;  2O5I A;  5FJ8 K;  4A3E K;  4KN4 A;  1YNN A;  4GTC A;  1IL2 A;  1WOO A;  2WB1 D;  2PMZ D;  2WAQ D;  1BDF A;  3I4N K;  2KWA A;  1Y1V K;  3S1Q K;  5C4J K;  5IYC K;  4A3I K;  2NVX C;  3DXJ A;  2V6S A;  1I6H K;  1TWC A;  4MEX A;  4X6A C;  1USM A;  5IYD K;  4KDD A;  3LAP A;  4A3L K;  3GTK K;  2E2J K;  3CQZ A;  4KN7 A;  2JA5 C;  3BP8 C;  4KAR A;  1XZQ A;  1VRQ C;  4KMA A;  4OIO A;  2CFA A;  1JVI A;  4BBS K;  1VGX A;  4G7O A;  4MQ9 A;  3S1N C;  4YFK A;  4KMH A;  2B63 K;  4A3J K;  5JFE A;  5IOT A;  4G7H A;  4A3D K;  2VUM C;  2NVX A;  5C4X K;  5FLM K;  4A3E C;  1BS2 A;  1TWG C;  3M4O K;  5M3M K;  4ILD A;  5JVO A;  4Q5S A;  1O2B A;  1B4B A;  4C3J K;  3I4N C;  4BY1 C;  1Y1V C;  3S1Q C;  5IYC C;  4A3I C;  4M1X A;  3V4G A;  5M5X K;  3S2D K;  1I6H C;  4GTD A;  3PO3 K;  1ZQ1 C;  2R93 K;  1C0A A;  1RU0 A;  5M5Y K;  2CW0 A;  4QJV B;  5IYD C;  3S16 K;  1UV7 A;  1ISE A;  4LK1 A;  1INN A;  4LLG A;  4A3L C;  3GTK C;  4QIW L;  4MEY A;  4BLA A;  2E2J C;  5IP7 K;  2Y0S L;  1YX2 A;  1TWG A;  3HOW K;  2JA7 K;  4P5A A;  4BBS C;  3MML B;  1O25 A;  1IBA A;  4P9S A;  1J6X A;  1KQ4 A;  2ZUE A;  3RZO K;  4A3G K;  3T00 A;  4A3D C;  5C4X C;  1SMY A;  5FLM C;  4OIN A;  3GSI A;  3GTL A;  1Y1W K;  3S1M K;  5C3E K;  2FQO A;  1AB4 A;  4C3J C;  4Q4Z A;  1WSR A;  3S2D C;  3TFJ A;  1O2A A;  2E2I A;  3PO3 C;  3N0B A;  2R93 C;  2PA8 L;  3S1R K;  5IOR A;  3S16 C;  3ADA C;  4NOI A;  4WJ3 M;  3K7A K;  5IP7 C;  1TWG K;  3FKI K;  2W7V A;  4Y52 K;  3HOW C;  2JA7 C;  1WOP A;  3N3Y A;  3GTJ K;  3M3Y K;  4BY7 K;  1J6V A;  1DD5 A;  4LJZ A;  4PAA A;  4BY1 K;  3GEI A;  2JA6 A;  3RZO C;  4A3G C;  4A3F K;  1HQM A;  1X31 C;  4LOW A;  4A3C K;  3GTL K;  2R93 A;  2PA8 D;  1Y1W C;  3S1M C;  5C3E C;  4J3N A;  1PJ7 A;  4XCH A;  3SZZ A;  5D4D A;  4QJV A;  5HL8 A;  3GEE A;  1TWA A;  4BLB A;  3TFI A;  2E2I K;  1WCM K;  3AQP A;  2V6U A;  1G51 A;  2E2H K;  4G0W A;  5TMC A;  3S1R C;  2JA7 A;  3S14 K;  1XXC A;  1YNJ A;  3K7A C;  4FM9 A;  3RZD K;  1WQF A;  3AQO A;  4OIP A;  3A8I A;  2R7Z A;  4BKW A;  3CAG A;  3H3V D;  3S2H K;  3AD9 C;  3S17 C;  3FKI C;  4Y52 C;  2XCQ A;  4DDQ A;  5IYB K;  1BJT A;  5M3F K;  2A69 A;  3GTJ C;  3M3Y C;  4BY7 C;  1Y1W A;  3FOF A;  2JA6 K;  1O24 A;  3VA7 A;  4A3K K;  3HOZ C;  4A3F C;  4A3C C;  4C2M K;  4OIQ A;  1I50 K;  3GTL C;  1DCH A;  3GIR A; 
#chains in the Genus database with same CATH homology
 2W7V A;  1UV7 A;  5HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...