5HL8A

1.93 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (c-terminal fragment; residues 309-397) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Protein transport
molecule keywords Type II secretion system protein L
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 5hl8A00
1UV7A 2W7VA 5HL8A
chains in the Genus database with same CATH superfamily
4QJVB 4GTBA 4XSZA 3GTOC 3HOYC 3M3YC 5IP9K 5CJ9A 1INNA 5FLMK 4P9SA 4Y7NC 3GTPA 4OIQA 1EFWA 2NVQK 1TWCK 4O2DA 1BGWA 3WODA 5IOQA 1K83A 3M4OK 2R93A 3ERED 4YFXA 2PHCB 2R92K 2VUMC 1JQWA 2CFAA 1EQRA 1JOEA 1TWHK 4RMFA 1TWAA 1DCHA 1Y1WK 3I4NC 3AQPA 4J3NA 3FOEA 2B63A 2E2HK 2KWAA 4BBRK 5C4XK 1O2AA 3HOVK 2PPBA 1B4AA 4BY7C 4KC6A 4P5AA 4KN7A 5IYCC 4JK1A 1J6WA 3S0XA 1IL2A 3HOXK 5IP9C 2JA5A 3TTGA 3GTJC 3GEHA 2CFAB 3RZDK 2YU9A 1YX2A 1HI9A 1I50C 1O25A 1WQHA 2E2HC 5E68A 4A3FK 1TWFK 1XZQB 5M5YK 1IE0A 1RU0A 2O5JA 1Y1WA 2V6SA 4GTLA 4A3BC 1R9TC 4BY1C 2JA7A 3N0CA 1Y1VC 4LOWA 2PMZD 3BP8C 4Q4ZA 4KB2A 3HOXC 4A3BK 1V5VA 5TMFA 1L0WA 4KAWX 1O28A 4GFQA 3GTQC 2WB1D 4QIWL 4C3JK 3GTKA 4BKWA 2WAQD 2A6EA 3T02A 1XPPA 5IOTA 4A3KC 1SFOK 3HOZK 3RZDC 4C3JC 1O26A 3L4JA 2E2IC 4LK0A 1I3QK 1WOOA 2ZUFA 3FKIC 3GEEA 2D6FC 2FQOA 1TWFC 4X6AK 3GSIA 4WJ3M 4C2MK 3S17C 2RH6A 4WILA 2V6UA 4ILDA 1WCMA 4YFKA 1R9TK 4BY1K 4BBRC 3HOVC 4QIWD 2E2HA 2WB1L 4BXXC 1J6XA 3T00A 4A3GK 3S1MC 3IPJA 2XCRB 3BUEA 1Y1VA 2P8TA 1VJEA 2Y0SL 5CHPA 5C44K 3V4GA 3TFHA 1SFOA 1O2FB 5C4XC 2YU9K 2JH3A 2A6HA 2A69A 1B4BA 3DXJA 1VGXA 4A3CK 3N0BA 1I3QA 4FM9A 4C3IK 3FKIK 1O27A 1O2BA 5IORA 4PABA 2FQTA 4KDDA 5IYCK 3A8JA 3S17K 4NOIA 4A3KK 1SFOC 2W7VA 3GEIA 3K7AK 2E2JK 1EI6A 4LQYA 1Y1WC 3LAPA 4C3HK 4G7HA 3H0GK 3AD8C 4BBSC 4GZYA 1IBAA 4QJVA 3GTKK 5IYBC 1EH1A 4KATA 3S2HC 2JA5K 4G7OA 1TWHC 1USMA 4KARA 3HXAA 4G7ZA 3FKIA 4GTDA 4G0WA 4WJ4A 3BP3A 4G0VA 3GIRA 3GTOK 1WSRA 5D4DA 3HOUC 3QX3A 2CW0A 4C3HC 4A3LC 2NVTK 3L4KA 1TWHA 1XXAA 1C0AA 3NUHA 2B63K 1O29A 3S2HK 3GTQA 3PO2C 3H0GA 2NVYK 3FOFA 2E2IK 1USOA 4BBSK 1WQGA 3S16C 1WQFA 2NVYC 4Y52C 4KMHA 3S1RC 3HKZL 1ZQ1C 3K7AC 2ZUEA 3CQZA 3RZOK 4OINA 1XXBA 5C44C 3GTOA 2NVQC 3PO2K 4FZBA 4P5BA 4BLBA 3S1MK 3H3VD 1F9NA 4KASA 3OPFA 2JA5C 4C45A 1G51A 4A93K 2VUMK 1WOSA 1AB4A 1BJTA 3TFIA 4BXXK 2E2IA 1YCLA 4XLNA 1BS2A 3HOWC 1DCOA 1PJ5A 3OEPA 3H3VL 4GTCA 1I6VA 3GTMA 4C3IC 1ZXOA 3T01A 4Q5SA 4X6AC 4ZH4A 1VH2A 3HOYK 1YNNA 5M5WK 2A68A 2R92C 5IYDK 1TWGC 3OREA 2PA8L 3JSTA 4GTAA 4KM9A 2NVXK 3I4NK 3GTJK 3AD9C 5IYDC 5IP7C 5M3MK 4A3CC 5C3EC 1J6VA 2GSNA 3LAJA 3HOWK 4Y52K 4MQ9A 1KQ4A 1F7VA 5HL8A 3GTLC 3N3YA 2JA8K 1EK8A 4KM8A 3GTKC 1TWCC 3HOUK 4A3MC 1X31C 4KN4A 4A3GC 2GAHC 5TJ3A 4A3JC 3S2DK 4GTFA 1J98A 3GTMK 4GTEA 1IW7A 3GTGA 1DCPA 4A3MK 3GTPK 1O24A 4KB4A 1ZYRA 4A3DC 3LPXA 2JA7C 3AH5A 1WSVA 3I4MC 5JVOA 3S1NK 2GSUA 3CQZK 5C4JC 2Y3PA 3GTPC 1F7UA 2NVXA 4AH6A 2R93K 4M1XA 3GTLK 5IOSA 3S1QC 2JA6K 2V6TA 2R92A 1F93A 5TMCA 4GT9A 5FJ8K 2RGRA 4A3FC 3S1RK 1I50A 1JVIA 3AQOA 5C3EK 2BE5A 4AYBD 2YU9C 4G0UA 2ZFZA 3S14K 3PO3K 2VUMA 1WORA 4LLGA 4BLAA 4A3EC 2NVYA 5FLMC 5M5XK 5IP7K 1BDFA 4MEYA 2JA6C 4YFNA 5EGHA 1WIHA 4AYBL 5IYBK 2NVTC 1IQ0A 2P5MA 2JA8C 1TWCA 3S15C 3G4AA 3S1NC 1PJ7A 4MEXA 1XZPA 1XZQA 3M3YK 3GTJA 4A93C 2JA6A 3S15K 2R93C 1VRQC 2R7ZA 2XCOA 4KMUA 5L46A 4KMAA 2JA7K 3I4MK 2GSOA 1ZVUA 1GE9A 3H0GC 2B63C 3VA7A 3GTQK 3SZYA 2XCQA 3MMLB 3S1QK 1I3QC 1WOPA 1WCMC 4LJZA 2E2JC 5JFEA 4A3LK 1DD5A 4XLPA 1XZPB 3CQZC 4LR2A 3HOZC 3PO3C 1K83C 3Q3QA 4A3EK 3EQLA 1K83K 4YG2A 2PA8D 3FHZA 1TWGA 1HQMA 2EBBA 4BY7K 4PAAA 4A3DK 1ZBSA 1I50K 2WAQL 3S14C 1WCMK 5C4JK 3CAGA 4Y7NK 1TWAK 1I6HC 1PJ6A 4XCHA 3GTMC 1UV7A 1VLOA 1XXCA 4A3JK 4OIOA 3S2DC 3G4CA 3A8KA 2PMZL 1YNJA 3S16K 2R7ZC 3A8IA 1Y1VK 4C2MC 5EGEA 4XSXA 4DDQA 3ADAC 3GTGK 3AD7C 3TFJA 3GDZA 4KMDA 1TWAC 1I6HK 1TWGK 4OIRA 2GAGC 3GTLA 1IS1A 2NVXC 1TWFA 3HKZD 2R7ZK 3RZOC 3SZZA 4A3IK 2Y0SD 1R9TA 1SMYA 1ISEA 4OIPA 3GTGC 4A3IC 2O5IA 3M4OC 5M3FK 4LK1A
chains in the Genus database with same CATH topology
1UV7A 2W7VA 5HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV7 A;  2W7V A;  5HL8 A; 
#chains in the Genus database with same CATH topology
 4QJV B;  4GTB A;  4XSZ A;  3GTO C;  3HOY C;  3M3Y C;  5IP9 K;  5CJ9 A;  1INN A;  5FLM K;  4P9S A;  4Y7N C;  3GTP A;  4OIQ A;  1EFW A;  2NVQ K;  1TWC K;  4O2D A;  1BGW A;  3WOD A;  5IOQ A;  1K83 A;  3M4O K;  2R93 A;  3ERE D;  4YFX A;  2PHC B;  2R92 K;  2VUM C;  1JQW A;  2CFA A;  1EQR A;  1JOE A;  1TWH K;  4RMF A;  1TWA A;  1DCH A;  1Y1W K;  3I4N C;  3AQP A;  4J3N A;  3FOE A;  2B63 A;  2E2H K;  2KWA A;  4BBR K;  5C4X K;  1O2A A;  3HOV K;  2PPB A;  1B4A A;  4BY7 C;  4KC6 A;  4P5A A;  4KN7 A;  5IYC C;  4JK1 A;  1J6W A;  3S0X A;  1IL2 A;  3HOX K;  5IP9 C;  2JA5 A;  3TTG A;  3GTJ C;  3GEH A;  2CFA B;  3RZD K;  2YU9 A;  1YX2 A;  1HI9 A;  1I50 C;  1O25 A;  1WQH A;  2E2H C;  5E68 A;  4A3F K;  1TWF K;  1XZQ B;  5M5Y K;  1IE0 A;  1RU0 A;  2O5J A;  1Y1W A;  2V6S A;  4GTL A;  4A3B C;  1R9T C;  4BY1 C;  2JA7 A;  3N0C A;  1Y1V C;  4LOW A;  2PMZ D;  3BP8 C;  4Q4Z A;  4KB2 A;  3HOX C;  4A3B K;  1V5V A;  5TMF A;  1L0W A;  4KAW X;  1O28 A;  4GFQ A;  3GTQ C;  2WB1 D;  4QIW L;  4C3J K;  3GTK A;  4BKW A;  2WAQ D;  2A6E A;  3T02 A;  1XPP A;  5IOT A;  4A3K C;  1SFO K;  3HOZ K;  3RZD C;  4C3J C;  1O26 A;  3L4J A;  2E2I C;  4LK0 A;  1I3Q K;  1WOO A;  2ZUF A;  3FKI C;  3GEE A;  2D6F C;  2FQO A;  1TWF C;  4X6A K;  3GSI A;  4WJ3 M;  4C2M K;  3S17 C;  2RH6 A;  4WIL A;  2V6U A;  4ILD A;  1WCM A;  4YFK A;  1R9T K;  4BY1 K;  4BBR C;  3HOV C;  4QIW D;  2E2H A;  2WB1 L;  4BXX C;  1J6X A;  3T00 A;  4A3G K;  3S1M C;  3IPJ A;  2XCR B;  3BUE A;  1Y1V A;  2P8T A;  1VJE A;  2Y0S L;  5CHP A;  5C44 K;  3V4G A;  3TFH A;  1SFO A;  1O2F B;  5C4X C;  2YU9 K;  2JH3 A;  2A6H A;  2A69 A;  1B4B A;  3DXJ A;  1VGX A;  4A3C K;  3N0B A;  1I3Q A;  4FM9 A;  4C3I K;  3FKI K;  1O27 A;  1O2B A;  5IOR A;  4PAB A;  2FQT A;  4KDD A;  5IYC K;  3A8J A;  3S17 K;  4NOI A;  4A3K K;  1SFO C;  2W7V A;  3GEI A;  3K7A K;  2E2J K;  1EI6 A;  4LQY A;  1Y1W C;  3LAP A;  4C3H K;  4G7H A;  3H0G K;  3AD8 C;  4BBS C;  4GZY A;  1IBA A;  4QJV A;  3GTK K;  5IYB C;  1EH1 A;  4KAT A;  3S2H C;  2JA5 K;  4G7O A;  1TWH C;  1USM A;  4KAR A;  3HXA A;  4G7Z A;  3FKI A;  4GTD A;  4G0W A;  4WJ4 A;  3BP3 A;  4G0V A;  3GIR A;  3GTO K;  1WSR A;  5D4D A;  3HOU C;  3QX3 A;  2CW0 A;  4C3H C;  4A3L C;  2NVT K;  3L4K A;  1TWH A;  1XXA A;  1C0A A;  3NUH A;  2B63 K;  1O29 A;  3S2H K;  3GTQ A;  3PO2 C;  3H0G A;  2NVY K;  3FOF A;  2E2I K;  1USO A;  4BBS K;  1WQG A;  3S16 C;  1WQF A;  2NVY C;  4Y52 C;  4KMH A;  3S1R C;  3HKZ L;  1ZQ1 C;  3K7A C;  2ZUE A;  3CQZ A;  3RZO K;  4OIN A;  1XXB A;  5C44 C;  3GTO A;  2NVQ C;  3PO2 K;  4FZB A;  4P5B A;  4BLB A;  3S1M K;  3H3V D;  1F9N A;  4KAS A;  3OPF A;  2JA5 C;  4C45 A;  1G51 A;  4A93 K;  2VUM K;  1WOS A;  1AB4 A;  1BJT A;  3TFI A;  4BXX K;  2E2I A;  1YCL A;  4XLN A;  1BS2 A;  3HOW C;  1DCO A;  1PJ5 A;  3OEP A;  3H3V L;  4GTC A;  1I6V A;  3GTM A;  4C3I C;  1ZXO A;  3T01 A;  4Q5S A;  4X6A C;  4ZH4 A;  1VH2 A;  3HOY K;  1YNN A;  5M5W K;  2A68 A;  2R92 C;  5IYD K;  1TWG C;  3ORE A;  2PA8 L;  3JST A;  4GTA A;  4KM9 A;  2NVX K;  3I4N K;  3GTJ K;  3AD9 C;  5IYD C;  5IP7 C;  5M3M K;  4A3C C;  5C3E C;  1J6V A;  2GSN A;  3LAJ A;  3HOW K;  4Y52 K;  4MQ9 A;  1KQ4 A;  1F7V A;  5HL8 A;  3GTL C;  3N3Y A;  2JA8 K;  1EK8 A;  4KM8 A;  3GTK C;  1TWC C;  3HOU K;  4A3M C;  1X31 C;  4KN4 A;  4A3G C;  2GAH C;  5TJ3 A;  4A3J C;  3S2D K;  4GTF A;  1J98 A;  3GTM K;  4GTE A;  1IW7 A;  3GTG A;  1DCP A;  4A3M K;  3GTP K;  1O24 A;  4KB4 A;  1ZYR A;  4A3D C;  3LPX A;  2JA7 C;  3AH5 A;  1WSV A;  3I4M C;  5JVO A;  3S1N K;  2GSU A;  3CQZ K;  5C4J C;  2Y3P A;  3GTP C;  1F7U A;  2NVX A;  4AH6 A;  2R93 K;  4M1X A;  3GTL K;  5IOS A;  3S1Q C;  2JA6 K;  2V6T A;  2R92 A;  1F93 A;  5TMC A;  4GT9 A;  5FJ8 K;  2RGR A;  4A3F C;  3S1R K;  1I50 A;  1JVI A;  3AQO A;  5C3E K;  2BE5 A;  4AYB D;  2YU9 C;  4G0U A;  2ZFZ A;  3S14 K;  3PO3 K;  2VUM A;  1WOR A;  4LLG A;  4BLA A;  4A3E C;  2NVY A;  5FLM C;  5M5X K;  5IP7 K;  1BDF A;  4MEY A;  2JA6 C;  4YFN A;  5EGH A;  1WIH A;  4AYB L;  5IYB K;  2NVT C;  1IQ0 A;  2P5M A;  2JA8 C;  1TWC A;  3S15 C;  3G4A A;  3S1N C;  1PJ7 A;  4MEX A;  1XZP A;  1XZQ A;  3M3Y K;  3GTJ A;  4A93 C;  2JA6 A;  3S15 K;  2R93 C;  1VRQ C;  2R7Z A;  2XCO A;  4KMU A;  5L46 A;  4KMA A;  2JA7 K;  3I4M K;  2GSO A;  1ZVU A;  1GE9 A;  3H0G C;  2B63 C;  3VA7 A;  3GTQ K;  3SZY A;  2XCQ A;  3MML B;  3S1Q K;  1I3Q C;  1WOP A;  1WCM C;  4LJZ A;  2E2J C;  5JFE A;  4A3L K;  1DD5 A;  4XLP A;  1XZP B;  3CQZ C;  4LR2 A;  3HOZ C;  3PO3 C;  1K83 C;  3Q3Q A;  4A3E K;  3EQL A;  1K83 K;  4YG2 A;  2PA8 D;  3FHZ A;  1TWG A;  1HQM A;  2EBB A;  4BY7 K;  4PAA A;  4A3D K;  1ZBS A;  1I50 K;  2WAQ L;  3S14 C;  1WCM K;  5C4J K;  3CAG A;  4Y7N K;  1TWA K;  1I6H C;  1PJ6 A;  4XCH A;  3GTM C;  1UV7 A;  1VLO A;  1XXC A;  4A3J K;  4OIO A;  3S2D C;  3G4C A;  3A8K A;  2PMZ L;  1YNJ A;  3S16 K;  2R7Z C;  3A8I A;  1Y1V K;  4C2M C;  5EGE A;  4XSX A;  4DDQ A;  3ADA C;  3GTG K;  3AD7 C;  3TFJ A;  3GDZ A;  4KMD A;  1TWA C;  1I6H K;  1TWG K;  4OIR A;  2GAG C;  3GTL A;  1IS1 A;  2NVX C;  1TWF A;  3HKZ D;  2R7Z K;  3RZO C;  3SZZ A;  4A3I K;  2Y0S D;  1R9T A;  1SMY A;  1ISE A;  4OIP A;  3GTG C;  4A3I C;  2O5I A;  3M4O C;  5M3F K;  4LK1 A; 
#chains in the Genus database with same CATH homology
 1UV7 A;  2W7V A;  5HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...