5HL8A

1.93 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (c-terminal fragment; residues 309-397) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRPGDMITKPDGIEGQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Type II secretion system protein L
publication title 1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 5hl8A00
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH superfamily
3PO3C 3GTMK 1J6XA 4A3BK 4A3GC 1YCLA 3OREA 4KDDA 4C45A 4YFXA 1WIHA 3OPFA 5D4DA 2R93K 1I50K 1INNA 1TWAK 3GTKK 2XCOA 1IW7A 1BS2A 3HOWC 5M5WK 3ADAC 3K7AK 3GTJK 3T02A 4A3CK 2VUMA 2ZUFA 2O5IA 3I4NK 4C2MC 3CQZC 2NVXC 3HOUK 2CFAB 2Y0SD 4BXXK 2JA5A 3G4AA 4OIOA 3HOZK 5EGEA 1O24A 3GDZA 4BY1K 2JA7K 2B63K 4G7ZA 3GTQK 3N3YA 5C4JK 1XXCA 2RH6A 1EQRA 5IYCK 2E2HK 5IYDC 1WQFA 2CFAA 4X6AC 1KQ4A 2R92A 4XLNA 3FKIA 3G4CA 3BUEA 3GTOK 2GSNA 2R7ZC 1EI6A 4LOWA 4C3JK 1TWGK 4JK1A 1I3QA 5M5XK 2E2JK 1TWHC 4KAWX 4G7HA 4XSXA 4FZBA 1VGXA 3S2HK 2E2IC 1R9TK 1O28A 3HKZD 3FOFA 5IOTA 2JA6A 3GTPC 3N0BA 5HL8A 2WAQL 3PO2C 3HOYK 1TWCA 3SZYA 3S2DK 1IE0A 4O2DA 3AD9C 1J98A 1SFOA 4MEYA 3RZDK 3SZZA 1USMA 4KN4A 2A6EA 3S16C 2NVQK 4WJ3M 1O29A 4G7OA 2V6UA 5E68A 4G0VA 2O5JA 2CW0A 5FLMK 5TJ3A 1I50C 4A3FC 3GTMC 3GTLK 4GZYA 2KWAA 1Y1VK 1WSVA 2R93C 4A3IK 4OIPA 2Y0SL 1TWAC 4C3HK 3GTKC 2A68A 3S1RC 3K7AC 3GTJC 2FQTA 2NVYK 4A3CC 4GTAA 4BBRK 1TWFK 3I4NC 1WORA 3AH5A 2A69A 5TMCA 3GTGA 3GEEA 4BXXC 1DCHA 3HOZC 4A3KC 3S0XA 3GTKA 2V6SA 1B4BA 2JA7C 4BY1C 2B63C 4GFQA 3GTQC 1WCMK 4KMAA 5C4JC 3H3VD 5IYCC 2E2HC 2YU9K 5IOQA 2P5MA 4GTEA 1ZBSA 3BP8C 3H0GA 3S17K 3L4KA 3AD8C 3S1RK 3GTOC 1WOSA 1YX2A 3HOVK 1GE9A 4C3JC 1WOOA 4KMHA 4A93C 1TWGC 5FJ8K 2GSUA 4BKWA 1I6HK 2PPBA 4Y52C 2E2JC 1O2AA 4A3KK 3S15K 1Y1WK 3S2HC 1IQ0A 4KN7A 1R9TC 4KM9A 2PMZL 4KM8A 5M5YK 5IP7K 3S1QK 3AD7C 5EGHA 5C3EK 1K83K 1UV7A 3CQZA 2NVXA 3A8JA 3HOYC 3L4JA 3AQOA 3NUHA 3S2DC 1F93A 1O2BA 4A3EK 4FM9A 2EBBA 4XLPA 2PA8L 2PHCB 3RZDC 1F7UA 4A93K 1ZQ1C 4BLBA 4P5AA 2NVQC 4Y52K 5IORA 1PJ5A 1JQWA 5C4XC 4P9SA 4A3FK 3RZOK 2JA5K 1YNNA 3GEHA 5FLMC 1VJEA 1HI9A 3M4OC 2R7ZA 1IS1A 3GTLC 3DXJA 4A3DK 1Y1VC 1J6VA 4A3IC 2R92K 4C3HC 4GTLA 4PABA 2W7VA 1TWHA 3LAJA 1WQHA 1RU0A 3AQPA 3FKIK 4P5BA 4AYBL 4Q4ZA 1ZVUA 2NVYC 5IYBK 3N0CA 4BBRC 1XZPB 1TWFC 2GSOA 2E2IA 1YNJA 4C3IC 4QJVB 1XPPA 3GTPA 1I3QK 5C4XK 5M3MK 4LQYA 3I4MK 3A8KA 1C0AA 1PJ7A 1EFWA 5IP9K 1WCMC 1XZPA 2JA8K 3M4OK 4LLGA 2ZUEA 2YU9C 4A3LC 5IOSA 4QJVA 4XCHA 4NOIA 3S1MK 2JA6K 4WJ4A 1IL2A 3JSTA 3S17C 4M1XA 3BP3A 1TWCK 3T00A 1JOEA 1DD5A 4LK1A 2GAGC 3LPXA 5CJ9A 3HOVC 1I50A 1SFOK 3GTMA 3LAPA 1BJTA 4C3IK 1I6HC 2R93A 3M3YK 3TFJA 1TWAA 3S15C 3S14K 1Y1WC 4ZH4A 4BLAA 4OINA 3GTJA 4BY7K 4A3JK 1X31C 5IP7C 3S1QC 1IBAA 4A3LK 4Q5SA 3GEIA 1K83C 5C3EC 5CHPA 3QX3A 1G51A 1VLOA 4PAAA 1EH1A 2WAQD 2WB1D 5L46A 4A3EC 1F9NA 5C44K 2XCRB 5M3FK 2JA7A 4A3MK 2B63A 3GTQA 2VUMC 3HKZL 2A6HA 3T01A 2E2HA 4WILA 4LK0A 4Y7NK 1K83A 3TFIA 3FHZA 3RZOC 1DCPA 3GTGK 2JA5C 3A8IA 4GTFA 4GTCA 4KASA 3GTOA 2FQOA 1ISEA 4A3DC 4LR2A 1HQMA 1TWGA 3S1NK 2R92C 2NVTK 4ILDA 3H0GK 4MEXA 3FKIC 1AB4A 4BBSK 1XZQB 4YG2A 5IYBC 3HOXK 2XCQA 1R9TA 2VUMK 1DCOA 3PO3K 4A3GK 5TMFA 3ERED 1I3QC 3I4MC 1WOPA 4GTBA 4QIWD 1XZQA 2JH3A 5IP9C 3IPJA 3HXAA 4KC6A 2JA8C 3FOEA 3HOWK 4J3NA 4KMDA 2D6FC 3S1MC 2JA6C 4GTDA 4G0UA 4C2MK 3CQZK 3TFHA 2NVXK 2RGRA 1TWCC 1XXAA 4KB4A 4GT9A 1J6WA 3TTGA 1SFOC 3H3VL 4AH6A 1WSRA 3GTLA 4RMFA 1ZXOA 1Y1VA 5IYDK 3GSIA 1EK8A 1O26A 3M3YC 4X6AK 3GIRA 3S14C 2WB1L 3WODA 2V6TA 1O25A 5JFEA 4BY7C 4A3JC 2NVYA 2R7ZK 2PMZD 1TWFA 4XSZA 3CAGA 4OIQA 1SMYA 4YFNA 2P8TA 1L0WA 5C44C 4OIRA 1VRQC 1BGWA 1TWHK 2ZFZA 4A3MC 1WQGA 1WCMA 4KMUA 2PA8D 2E2IK 1BDFA 1I6VA 4A3BC 2YU9A 1V5VA 2Y3PA 4Y7NC 4YFKA 3GTPK 3VA7A 3GTGC 4KARA 5JVOA 1F7VA 3PO2K 4KB2A 1O2FB 1VH2A 4KATA 1O27A 1B4AA 2GAHC 3OEPA 1PJ6A 4DDQA 1JVIA 1USOA 3S1NC 2NVTC 1XXBA 4G0WA 3S16K 3H0GC 3HOUC 3MMLB 4MQ9A 3EQLA 3V4GA 4QIWL 4BBSC 3Q3QA 3HOXC 1Y1WA 4AYBD 2BE5A 4LJZA 1ZYRA
chains in the Genus database with same CATH topology
2W7VA 5HL8A 1UV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7V A;  5HL8 A;  1UV7 A; 
#chains in the Genus database with same CATH topology
 3PO3 C;  3GTM K;  1J6X A;  4A3B K;  4A3G C;  1YCL A;  3ORE A;  4KDD A;  4C45 A;  4YFX A;  1WIH A;  3OPF A;  5D4D A;  2R93 K;  1I50 K;  1INN A;  1TWA K;  3GTK K;  2XCO A;  1IW7 A;  1BS2 A;  3HOW C;  5M5W K;  3ADA C;  3K7A K;  3GTJ K;  3T02 A;  4A3C K;  2VUM A;  2ZUF A;  2O5I A;  3I4N K;  4C2M C;  3CQZ C;  2NVX C;  3HOU K;  2CFA B;  2Y0S D;  4BXX K;  2JA5 A;  3G4A A;  4OIO A;  3HOZ K;  5EGE A;  1O24 A;  3GDZ A;  4BY1 K;  2JA7 K;  2B63 K;  4G7Z A;  3GTQ K;  3N3Y A;  5C4J K;  1XXC A;  2RH6 A;  1EQR A;  5IYC K;  2E2H K;  5IYD C;  1WQF A;  2CFA A;  4X6A C;  1KQ4 A;  2R92 A;  4XLN A;  3FKI A;  3G4C A;  3BUE A;  3GTO K;  2GSN A;  2R7Z C;  1EI6 A;  4LOW A;  4C3J K;  1TWG K;  4JK1 A;  1I3Q A;  5M5X K;  2E2J K;  1TWH C;  4KAW X;  4G7H A;  4XSX A;  4FZB A;  1VGX A;  3S2H K;  2E2I C;  1R9T K;  1O28 A;  3HKZ D;  3FOF A;  5IOT A;  2JA6 A;  3GTP C;  3N0B A;  5HL8 A;  2WAQ L;  3PO2 C;  3HOY K;  1TWC A;  3SZY A;  3S2D K;  1IE0 A;  4O2D A;  3AD9 C;  1J98 A;  1SFO A;  4MEY A;  3RZD K;  3SZZ A;  1USM A;  4KN4 A;  2A6E A;  3S16 C;  2NVQ K;  4WJ3 M;  1O29 A;  4G7O A;  2V6U A;  5E68 A;  4G0V A;  2O5J A;  2CW0 A;  5FLM K;  5TJ3 A;  1I50 C;  4A3F C;  3GTM C;  3GTL K;  4GZY A;  2KWA A;  1Y1V K;  1WSV A;  2R93 C;  4A3I K;  4OIP A;  2Y0S L;  1TWA C;  4C3H K;  3GTK C;  2A68 A;  3S1R C;  3K7A C;  3GTJ C;  2FQT A;  2NVY K;  4A3C C;  4GTA A;  4BBR K;  1TWF K;  3I4N C;  1WOR A;  3AH5 A;  2A69 A;  5TMC A;  3GTG A;  3GEE A;  4BXX C;  1DCH A;  3HOZ C;  4A3K C;  3S0X A;  3GTK A;  2V6S A;  1B4B A;  2JA7 C;  4BY1 C;  2B63 C;  4GFQ A;  3GTQ C;  1WCM K;  4KMA A;  5C4J C;  3H3V D;  5IYC C;  2E2H C;  2YU9 K;  5IOQ A;  2P5M A;  4GTE A;  1ZBS A;  3BP8 C;  3H0G A;  3S17 K;  3L4K A;  3AD8 C;  3S1R K;  3GTO C;  1WOS A;  1YX2 A;  3HOV K;  1GE9 A;  4C3J C;  1WOO A;  4KMH A;  4A93 C;  1TWG C;  5FJ8 K;  2GSU A;  4BKW A;  1I6H K;  2PPB A;  4Y52 C;  2E2J C;  1O2A A;  4A3K K;  3S15 K;  1Y1W K;  3S2H C;  1IQ0 A;  4KN7 A;  1R9T C;  4KM9 A;  2PMZ L;  4KM8 A;  5M5Y K;  5IP7 K;  3S1Q K;  3AD7 C;  5EGH A;  5C3E K;  1K83 K;  1UV7 A;  3CQZ A;  2NVX A;  3A8J A;  3HOY C;  3L4J A;  3AQO A;  3NUH A;  3S2D C;  1F93 A;  1O2B A;  4A3E K;  4FM9 A;  2EBB A;  4XLP A;  2PA8 L;  2PHC B;  3RZD C;  1F7U A;  4A93 K;  1ZQ1 C;  4BLB A;  4P5A A;  2NVQ C;  4Y52 K;  5IOR A;  1PJ5 A;  1JQW A;  5C4X C;  4P9S A;  4A3F K;  3RZO K;  2JA5 K;  1YNN A;  3GEH A;  5FLM C;  1VJE A;  1HI9 A;  3M4O C;  2R7Z A;  1IS1 A;  3GTL C;  3DXJ A;  4A3D K;  1Y1V C;  1J6V A;  4A3I C;  2R92 K;  4C3H C;  4GTL A;  4PAB A;  2W7V A;  1TWH A;  3LAJ A;  1WQH A;  1RU0 A;  3AQP A;  3FKI K;  4P5B A;  4AYB L;  4Q4Z A;  1ZVU A;  2NVY C;  5IYB K;  3N0C A;  4BBR C;  1XZP B;  1TWF C;  2GSO A;  2E2I A;  1YNJ A;  4C3I C;  4QJV B;  1XPP A;  3GTP A;  1I3Q K;  5C4X K;  5M3M K;  4LQY A;  3I4M K;  3A8K A;  1C0A A;  1PJ7 A;  1EFW A;  5IP9 K;  1WCM C;  1XZP A;  2JA8 K;  3M4O K;  4LLG A;  2ZUE A;  2YU9 C;  4A3L C;  5IOS A;  4QJV A;  4XCH A;  4NOI A;  3S1M K;  2JA6 K;  4WJ4 A;  1IL2 A;  3JST A;  3S17 C;  4M1X A;  3BP3 A;  1TWC K;  3T00 A;  1JOE A;  1DD5 A;  4LK1 A;  2GAG C;  3LPX A;  5CJ9 A;  3HOV C;  1I50 A;  1SFO K;  3GTM A;  3LAP A;  1BJT A;  4C3I K;  1I6H C;  2R93 A;  3M3Y K;  3TFJ A;  1TWA A;  3S15 C;  3S14 K;  1Y1W C;  4ZH4 A;  4BLA A;  4OIN A;  3GTJ A;  4BY7 K;  4A3J K;  1X31 C;  5IP7 C;  3S1Q C;  1IBA A;  4A3L K;  4Q5S A;  3GEI A;  1K83 C;  5C3E C;  5CHP A;  3QX3 A;  1G51 A;  1VLO A;  4PAA A;  1EH1 A;  2WAQ D;  2WB1 D;  5L46 A;  4A3E C;  1F9N A;  5C44 K;  2XCR B;  5M3F K;  2JA7 A;  4A3M K;  2B63 A;  3GTQ A;  2VUM C;  3HKZ L;  2A6H A;  3T01 A;  2E2H A;  4WIL A;  4LK0 A;  4Y7N K;  1K83 A;  3TFI A;  3FHZ A;  3RZO C;  1DCP A;  3GTG K;  2JA5 C;  3A8I A;  4GTF A;  4GTC A;  4KAS A;  3GTO A;  2FQO A;  1ISE A;  4A3D C;  4LR2 A;  1HQM A;  1TWG A;  3S1N K;  2R92 C;  2NVT K;  4ILD A;  3H0G K;  4MEX A;  3FKI C;  1AB4 A;  4BBS K;  1XZQ B;  4YG2 A;  5IYB C;  3HOX K;  2XCQ A;  1R9T A;  2VUM K;  1DCO A;  3PO3 K;  4A3G K;  5TMF A;  3ERE D;  1I3Q C;  3I4M C;  1WOP A;  4GTB A;  4QIW D;  1XZQ A;  2JH3 A;  5IP9 C;  3IPJ A;  3HXA A;  4KC6 A;  2JA8 C;  3FOE A;  3HOW K;  4J3N A;  4KMD A;  2D6F C;  3S1M C;  2JA6 C;  4GTD A;  4G0U A;  4C2M K;  3CQZ K;  3TFH A;  2NVX K;  2RGR A;  1TWC C;  1XXA A;  4KB4 A;  4GT9 A;  1J6W A;  3TTG A;  1SFO C;  3H3V L;  4AH6 A;  1WSR A;  3GTL A;  4RMF A;  1ZXO A;  1Y1V A;  5IYD K;  3GSI A;  1EK8 A;  1O26 A;  3M3Y C;  4X6A K;  3GIR A;  3S14 C;  2WB1 L;  3WOD A;  2V6T A;  1O25 A;  5JFE A;  4BY7 C;  4A3J C;  2NVY A;  2R7Z K;  2PMZ D;  1TWF A;  4XSZ A;  3CAG A;  4OIQ A;  1SMY A;  4YFN A;  2P8T A;  1L0W A;  5C44 C;  4OIR A;  1VRQ C;  1BGW A;  1TWH K;  2ZFZ A;  4A3M C;  1WQG A;  1WCM A;  4KMU A;  2PA8 D;  2E2I K;  1BDF A;  1I6V A;  4A3B C;  2YU9 A;  1V5V A;  2Y3P A;  4Y7N C;  4YFK A;  3GTP K;  3VA7 A;  3GTG C;  4KAR A;  5JVO A;  1F7V A;  3PO2 K;  4KB2 A;  1O2F B;  1VH2 A;  4KAT A;  1O27 A;  1B4A A;  2GAH C;  3OEP A;  1PJ6 A;  4DDQ A;  1JVI A;  1USO A;  3S1N C;  2NVT C;  1XXB A;  4G0W A;  3S16 K;  3H0G C;  3HOU C;  3MML B;  4MQ9 A;  3EQL A;  3V4G A;  4QIW L;  4BBS C;  3Q3Q A;  3HOX C;  1Y1W A;  4AYB D;  2BE5 A;  4LJZ A;  1ZYR A; 
#chains in the Genus database with same CATH homology
 2W7V A;  5HL8 A;  1UV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...