2NVXK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvxK00
4A3EK 3S15K 4A3JC 3RZOK 3HOVC 5IYBK 4A3BC 1K83K 5IP7K 1YNNA 4BY1K 4A3GK 3GTJK 3S14K 4YG2A 4NOIA 4A3CK 2WB1L 1Y1VC 5FJ8K 5C3EC 3GTKK 4Q4ZA 5D4DA 3S14C 2CW0A 2BE5A 3I4MC 1TWGC 3DXJA 4A3BK 3GTOC 3M4OK 3S1QK 2NVXC 1Y1WK 4YFNA 2VUMC 4BBRK 4X6AC 2A6HA 1SFOC 3S17K 4A93K 1SMYA 5IYCC 1IW7A 4LK0A 5IP9K 5C4JC 2E2JK 2JA5C 3HOZK 1BDFA 2PA8L 4KN4A 2B63K 3PO2C 2NVYC 2PMZL 5TMCA 3HOXC 3PO3C 4A3IC 3M3YK 3HOWC 2A68A 3GTQK 4BBSC 3S1MK 4A3KC 5IYBC 4QJVA 4OINA 4A3FK 4LLGA 1WCMK 4G7HA 3GTPC 5C44C 1R9TK 3PO3K 4MEYA 5FLMC 1I50C 4XLPA 3HOWK 4Y52K 5C4XK 2JA6K 4A3IK 4A3LK 3K7AC 2PMZD 3S1NC 4LJZA 4G7OA 1SFOK 5IYDC 4Y7NC 3S16C 4A93C 4C3IK 2JA8K 3GTGK 3HOZC 3S1RK 4BY7C 1I6HK 3S2DK 1I6VA 5C3EK 3K7AK 1Y1VK 2R93K 3I4MK 4Y7NK 3RZDC 5IYDK 3HOYK 2O5JA 5C44K 5M5XK 3RZOC 4A3EC 1I50K 4A3KK 3CQZK 3S15C 4BXXK 1HQMA 1R9TC 1K83C 5IP7C 4JK1A 2NVTK 3S2HK 4A3JK 4A3MK 3HOYC 4BXXC 4OIOA 3CQZC 5M3FK 3GTLK 2B63C 4Q5SA 4C3HK 2A69A 4MEXA 3HOXK 3HOUK 1ZYRA 4KMUA 5M5YK 2A6EA 1TWFK 2VUMK 4X6AK 2R93C 2YU9C 3EQLA 5IYCK 3GTOK 4QIWD 4OIPA 4ZH4A 4LK1A 1I3QC 4G7ZA 3S1NK 1TWHK 5M5WK 3H3VL 2JA8C 2JA6C 3GTGC 3S16K 4A3LC 2WAQL 4QJVB 2Y0SD 1TWHC 4YFKA 4A3FC 3GTPK 4XLNA 3H0GK 1I3QK 4MQ9A 3I4NK 2WAQD 4AYBD 3GTQC 2PA8D 1WCMC 3FKIC 3HOVK 3H3VD 2NVQK 2JA7C 2E2HC 4A3DK 1TWFC 3HKZL 1XPPA 5M3MK 1TWAK 3HOUC 3PO2K 2JA5K 2JA7K 2NVQC 2E2IK 2NVYK 3HKZD 4XSZA 4AYBL 3S2DC 1I6HC 2E2HK 1Y1WC 4GZYA 3M4OC 2NVTC 3S1RC 3S2HC 3S1QC 2R7ZK 3S17C 1TWGK 4C3JK 4BBRC 3GTMK 4OIRA 2NVXK 4OIQA 5TMFA 4A3CC 4Y52C 4YFXA 5FLMK 3GTJC 3RZDK 3GTKC 4BY1C 3GTMC 4A3GC 2R7ZC 2O5IA 4C2MK 2YU9K 3S1MC 3WODA 2R92K 4QIWL 3M3YC 4BBSK 4BY7K 2Y0SL 1YNJA 1TWAC 1TWCK 4A3MC 3GTLC 2PPBA 2E2IC 2WB1D 5IP9C 5C4JK 2E2JC 3I4NC 3FKIK 4XSXA 5C4XC 2R92C 1TWCC 4A3DC 3H0GC 4KN7A
chains in the Genus database with same CATH superfamily
3HOVC 5IYBK 4A3BC 4BY1K 3GTJK 4YG2A 4WJ3M 1Y1VC 5FJ8K 5C3EC 3GTKK 1TWHA 3TFJA 3AQPA 2XCQA 2EBBA 1X31C 3GTOC 2JA7A 1WQFA 2VUMC 4A93K 4G0UA 4LK0A 3PO2C 2CFAB 3GTGA 4A3IC 2ZUFA 3HOWC 2A68A 4BBSC 5IYBC 3OREA 1WCMK 3A8KA 3PO3K 3HOWK 5FLMC 4GFQA 2KWAA 4A3IK 4KAWX 2JH3A 4G7OA 5IYDC 2VUMA 2JA8K 2V6SA 1WSVA 3RZDC 1B4AA 1O28A 1L0WA 1J6WA 1I50K 4KMAA 3CQZK 4A3EC 4BXXK 2R7ZA 3LPXA 2NVTK 1DCHA 3FHZA 4C3HK 2A69A 1XZPA 1TWFA 4MEXA 4C45A 3HOUK 1BGWA 4X6AK 1TWFK 2R93C 4QIWD 3BP3A 5M5WK 1IE0A 2D6FC 2JA6C 4A3LC 4QJVB 2Y0SD 1K83A 1GE9A 4A3FC 3GTPK 2WAQD 4AYBD 3H3VD 2JA7C 5M3MK 1HI9A 4GTBA 4LQYA 3S2DC 2E2HK 1JOEA 3FOFA 2R7ZK 4BBRC 4GTDA 3A8IA 4GTLA 4GTFA 5TMFA 1WOOA 5FLMK 3GTJC 3GTMC 2RGRA 1KQ4A 4GTAA 4C2MK 1ZQ1C 1JQWA 2YU9K 2E2HA 1TWGA 3BP8C 4KB2A 4BBSK 2PHCB 2GSNA 5EGHA 3N3YA 1SFOA 3JSTA 1O2BA 1V5VA 3I4NC 3FKIK 4XSXA 2R92C 4A3MK 3S15K 4A3JC 1USOA 5IP7K 1YNNA 1EH1A 5L46A 4NOIA 4O2DA 4KMDA 2CW0A 1TWGC 3DXJA 4A3BK 5JFEA 4A3DC 4KM9A 3M4OK 3S1QK 2NVXC 1XZPB 1Y1WK 4YFNA 1ZVUA 2R93A 3S17K 1XXCA 5C4JC 2JA5C 2ZFZA 3AH5A 2B63K 1EQRA 3PO3C 1O26A 3H0GA 4C3HC 4XCHA 1J6XA 1JVIA 4A3KC 3Q3QA 5EGEA 4G7HA 4BLBA 5C44C 1WCMA 1G51A 4XLPA 1IBAA 5C4XK 1IL2A 1WOSA 3K7AC 1VH2A 4A93C 4KDDA 4Y7NC 3S16C 3S1RK 1F7VA 2P8TA 3L4JA 1I6HK 1DCPA 1USMA 3S2DK 5C3EK 3K7AK 4GT9A 1I3QA 4Y7NK 2O5JA 5C44K 5IORA 3G4AA 3S15C 1UV7A 4PABA 2P5MA 3CAGA 4A3KK 1ZXOA 3GTKA 1K83C 4GTCA 3HOYC 4OIOA 3GTLK 2V6UA 4FM9A 1ZYRA 4KMUA 3LAJA 3L4KA 1O2FB 2A6EA 2YU9C 4ZH4A 1EI6A 2ZUEA 3S1NK 1TWHK 1VJEA 1TWHC 3HXAA 4XLNA 3GTJA 3N0BA 3GTQC 3CQZA 1I50A 3HOVK 1XXBA 4A3DK 4G0WA 1J6VA 3HKZL 4KARA 1TWAK 4KATA 2JA7K 2NVYK 4AYBL 3QX3A 1B4BA 3T01A 1EFWA 1F9NA 3S17C 3OEPA 4C3JK 3AD9C 4Y52C 3IPJA 4A3GC 2R7ZC 1ISEA 4ILDA 1BJTA 3WODA 3M3YC 4BY7K 1WIHA 1TWAC 1TWCK 1O29A 1VRQC 2E2IC 2JA5A 3A8JA 5IP9C 2E2JC 5C4XC 3TFIA 1TWCC 4A3EK 2XCRB 4A3GK 4G0VA 4A3CK 2RH6A 2WB1L 4Q4ZA 3S14C 2BE5A 1YCLA 4C3IC 2GSUA 3OPFA 1TWAA 3T02A 5IYCC 3HOZK 1AB4A 2W7VA 2PA8L 4KN4A 2NVYC 2PMZL 5TMCA 1TWCA 3HOXC 4KB4A 3S1MK 4QJVA 4LLGA 1R9TA 4MEYA 1I50C 2PMZD 3S1NC 4LJZA 1WQGA 1SFOK 3HOZC 4LR2A 1J98A 4BY7C 3GEEA 2YU9A 1I6VA 3GTLA 2NVYA 1O2AA 2E2IA 1Y1VK 2R93K 3I4MK 5IYDK 3NUHA 2GAHC 3HOYK 5E68A 3RZOC 3AD7C 1HQMA 1R9TC 4JK1A 1EK8A 3TTGA 1DCOA 1XZQB 3CQZC 5M3FK 2B63C 5CHPA 1WQHA 5M5YK 3EQLA 3GTOK 1IQ0A 2V6TA 2CFAA 1RU0A 1Y1WA 3H3VL 2JA8C 3AQOA 1F7UA 3S16K 5IOSA 2WAQL 2XCOA 1XXAA 4WILA 4YFKA 3H0GK 3I4NK 3GTOA 2PA8D 1WCMC 3FKIC 2NVXA 2B63A 4GTEA 4WJ4A 1TWFC 3HOUC 2NVQC 3ADAC 3HKZD 4GZYA 3M4OC 2NVTC 3S1QC 4C2MC 3AD8C 4J3NA 1TWGK 3BUEA 3GTMK 4OIRA 2NVXK 1PJ5A 4FZBA 5HL8A 4A3CC 4YFXA 3RZDK 3FKIA 4RMFA 3S1MC 3GDZA 2R92K 4AH6A 2Y0SL 1YNJA 4A3MC 4P9SA 1WSRA 3T00A 3G4CA 5IOQA 3RZOK 1K83K 2JA6A 3S14K 3GTMA 5D4DA 3I4MC 3VA7A 3FOEA 3GTQA 3LAPA 4X6AC 4BBRK 2A6HA 1SFOC 1SMYA 4KASA 1IW7A 5IP9K 2E2JK 1BDFA 4P5AA 4KMHA 2GAGC 3M3YK 3GTQK 1WOPA 1INNA 4OINA 4A3FK 3GTPC 3GSIA 1R9TK 4Y52K 3GEIA 2JA6K 4A3LK 5CJ9A 1DD5A 4C3IK 3GTGK 4KC6A 3N0CA 1C0AA 5IOTA 2R92A 5M5XK 5IP7C 1PJ6A 1XZQA 3S2HK 4A3JK 1ZBSA 1PJ7A 1Y1VA 4BXXC 2FQOA 4Q5SA 3HOXK 2VUMK 5IYCK 4OIPA 4LK1A 1I3QC 4G7ZA 5JVOA 3GTGC 4M1XA 4C3JC 1IS1A 4LOWA 3GTPA 5TJ3A 1I3QK 4MQ9A 4KM8A 1VLOA 2NVQK 2E2HC 1XPPA 1O25A 3TFHA 3ERED 3PO2K 2JA5K 2E2IK 2FQTA 4XSZA 4PAAA 3SZZA 3S0XA 1I6HC 1Y1WC 3S2HC 3S1RC 2GSOA 1WORA 4BLAA 4OIQA 1F93A 1YX2A 3SZYA 3MMLB 1BS2A 1O27A 2Y3PA 4BY1C 3GTKC 1VGXA 2O5IA 4DDQA 3V4GA 4QIWL 3GEHA 1O24A 4BKWA 3GTLC 2PPBA 2WB1D 5C4JK 3GIRA 4P5BA 3H0GC 4KN7A
chains in the Genus database with same CATH topology
4A3EK 3S15K 4A3JC 3RZOK 3HOVC 5IYBK 4A3BC 1K83K 5IP7K 1YNNA 4BY1K 4A3GK 3GTJK 3S14K 4YG2A 4NOIA 4A3CK 2WB1L 1Y1VC 5FJ8K 5C3EC 3GTKK 4Q4ZA 5D4DA 3S14C 2CW0A 2BE5A 3I4MC 1TWGC 3DXJA 4A3BK 3GTOC 3M4OK 3S1QK 2NVXC 1Y1WK 4YFNA 2VUMC 4BBRK 4X6AC 2A6HA 1SFOC 3S17K 4A93K 1SMYA 5IYCC 1IW7A 4LK0A 5IP9K 5C4JC 2E2JK 2JA5C 3HOZK 1BDFA 2PA8L 4KN4A 2B63K 3PO2C 2NVYC 2PMZL 5TMCA 3HOXC 3PO3C 4A3IC 3M3YK 3HOWC 2A68A 3GTQK 4BBSC 3S1MK 4A3KC 5IYBC 4QJVA 4OINA 4A3FK 4LLGA 1WCMK 4G7HA 3GTPC 5C44C 1R9TK 3PO3K 4MEYA 5FLMC 1I50C 4XLPA 3HOWK 4Y52K 5C4XK 2JA6K 4A3IK 4A3LK 3K7AC 2PMZD 3S1NC 4LJZA 4G7OA 1SFOK 5IYDC 4Y7NC 3S16C 4A93C 4C3IK 2JA8K 3GTGK 3HOZC 3S1RK 4BY7C 1I6HK 3S2DK 1I6VA 5C3EK 3K7AK 1Y1VK 2R93K 3I4MK 4Y7NK 3RZDC 5IYDK 3HOYK 2O5JA 5C44K 5M5XK 3RZOC 4A3EC 1I50K 4A3KK 3CQZK 3S15C 4BXXK 1HQMA 1R9TC 1K83C 5IP7C 4JK1A 2NVTK 3S2HK 4A3JK 4A3MK 3HOYC 4BXXC 4OIOA 3CQZC 5M3FK 3GTLK 2B63C 4Q5SA 4C3HK 2A69A 4MEXA 3HOXK 3HOUK 1ZYRA 4KMUA 5M5YK 2A6EA 1TWFK 2VUMK 4X6AK 2R93C 2YU9C 3EQLA 5IYCK 3GTOK 4QIWD 4OIPA 4ZH4A 4LK1A 1I3QC 4G7ZA 3S1NK 1TWHK 5M5WK 3H3VL 2JA8C 2JA6C 3GTGC 3S16K 4A3LC 2WAQL 4QJVB 2Y0SD 1TWHC 4YFKA 4A3FC 3GTPK 4XLNA 3H0GK 1I3QK 4MQ9A 3I4NK 2WAQD 4AYBD 3GTQC 2PA8D 1WCMC 3FKIC 3HOVK 3H3VD 2NVQK 2JA7C 2E2HC 4A3DK 1TWFC 3HKZL 1XPPA 5M3MK 1TWAK 3HOUC 3PO2K 2JA5K 2JA7K 2NVQC 2E2IK 2NVYK 3HKZD 4XSZA 4AYBL 3S2DC 1I6HC 2E2HK 1Y1WC 4GZYA 3M4OC 2NVTC 3S1RC 3S2HC 3S1QC 2R7ZK 3S17C 1TWGK 4C3JK 4BBRC 3GTMK 4OIRA 2NVXK 4OIQA 5TMFA 4A3CC 4Y52C 4YFXA 5FLMK 3GTJC 3RZDK 3GTKC 4BY1C 3GTMC 4A3GC 2R7ZC 2O5IA 4C2MK 2YU9K 3S1MC 3WODA 2R92K 4QIWL 3M3YC 4BBSK 4BY7K 2Y0SL 1YNJA 1TWAC 1TWCK 4A3MC 3GTLC 2PPBA 2E2IC 2WB1D 5IP9C 5C4JK 2E2JC 3I4NC 3FKIK 4XSXA 5C4XC 2R92C 1TWCC 4A3DC 3H0GC 4KN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E K;  3S15 K;  4A3J C;  3RZO K;  3HOV C;  5IYB K;  4A3B C;  1K83 K;  5IP7 K;  1YNN A;  4BY1 K;  4A3G K;  3GTJ K;  3S14 K;  4YG2 A;  4NOI A;  4A3C K;  2WB1 L;  1Y1V C;  5FJ8 K;  5C3E C;  3GTK K;  4Q4Z A;  5D4D A;  3S14 C;  2CW0 A;  2BE5 A;  3I4M C;  1TWG C;  3DXJ A;  4A3B K;  3GTO C;  3M4O K;  3S1Q K;  2NVX C;  1Y1W K;  4YFN A;  2VUM C;  4BBR K;  4X6A C;  2A6H A;  1SFO C;  3S17 K;  4A93 K;  1SMY A;  5IYC C;  1IW7 A;  4LK0 A;  5IP9 K;  5C4J C;  2E2J K;  2JA5 C;  3HOZ K;  1BDF A;  2PA8 L;  4KN4 A;  2B63 K;  3PO2 C;  2NVY C;  2PMZ L;  5TMC A;  3HOX C;  3PO3 C;  4A3I C;  3M3Y K;  3HOW C;  2A68 A;  3GTQ K;  4BBS C;  3S1M K;  4A3K C;  5IYB C;  4QJV A;  4OIN A;  4A3F K;  4LLG A;  1WCM K;  4G7H A;  3GTP C;  5C44 C;  1R9T K;  3PO3 K;  4MEY A;  5FLM C;  1I50 C;  4XLP A;  3HOW K;  4Y52 K;  5C4X K;  2JA6 K;  4A3I K;  4A3L K;  3K7A C;  2PMZ D;  3S1N C;  4LJZ A;  4G7O A;  1SFO K;  5IYD C;  4Y7N C;  3S16 C;  4A93 C;  4C3I K;  2JA8 K;  3GTG K;  3HOZ C;  3S1R K;  4BY7 C;  1I6H K;  3S2D K;  1I6V A;  5C3E K;  3K7A K;  1Y1V K;  2R93 K;  3I4M K;  4Y7N K;  3RZD C;  5IYD K;  3HOY K;  2O5J A;  5C44 K;  5M5X K;  3RZO C;  4A3E C;  1I50 K;  4A3K K;  3CQZ K;  3S15 C;  4BXX K;  1HQM A;  1R9T C;  1K83 C;  5IP7 C;  4JK1 A;  2NVT K;  3S2H K;  4A3J K;  4A3M K;  3HOY C;  4BXX C;  4OIO A;  3CQZ C;  5M3F K;  3GTL K;  2B63 C;  4Q5S A;  4C3H K;  2A69 A;  4MEX A;  3HOX K;  3HOU K;  1ZYR A;  4KMU A;  5M5Y K;  2A6E A;  1TWF K;  2VUM K;  4X6A K;  2R93 C;  2YU9 C;  3EQL A;  5IYC K;  3GTO K;  4QIW D;  4OIP A;  4ZH4 A;  4LK1 A;  1I3Q C;  4G7Z A;  3S1N K;  1TWH K;  5M5W K;  3H3V L;  2JA8 C;  2JA6 C;  3GTG C;  3S16 K;  4A3L C;  2WAQ L;  4QJV B;  2Y0S D;  1TWH C;  4YFK A;  4A3F C;  3GTP K;  4XLN A;  3H0G K;  1I3Q K;  4MQ9 A;  3I4N K;  2WAQ D;  4AYB D;  3GTQ C;  2PA8 D;  1WCM C;  3FKI C;  3HOV K;  3H3V D;  2NVQ K;  2JA7 C;  2E2H C;  4A3D K;  1TWF C;  3HKZ L;  1XPP A;  5M3M K;  1TWA K;  3HOU C;  3PO2 K;  2JA5 K;  2JA7 K;  2NVQ C;  2E2I K;  2NVY K;  3HKZ D;  4XSZ A;  4AYB L;  3S2D C;  1I6H C;  2E2H K;  1Y1W C;  4GZY A;  3M4O C;  2NVT C;  3S1R C;  3S2H C;  3S1Q C;  2R7Z K;  3S17 C;  1TWG K;  4C3J K;  4BBR C;  3GTM K;  4OIR A;  2NVX K;  4OIQ A;  5TMF A;  4A3C C;  4Y52 C;  4YFX A;  5FLM K;  3GTJ C;  3RZD K;  3GTK C;  4BY1 C;  3GTM C;  4A3G C;  2R7Z C;  2O5I A;  4C2M K;  2YU9 K;  3S1M C;  3WOD A;  2R92 K;  4QIW L;  3M3Y C;  4BBS K;  4BY7 K;  2Y0S L;  1YNJ A;  1TWA C;  1TWC K;  4A3M C;  3GTL C;  2PPB A;  2E2I C;  2WB1 D;  5IP9 C;  5C4J K;  2E2J C;  3I4N C;  3FKI K;  4XSX A;  5C4X C;  2R92 C;  1TWC C;  4A3D C;  3H0G C;  4KN7 A; 
#chains in the Genus database with same CATH topology
 3HOV C;  5IYB K;  4A3B C;  4BY1 K;  3GTJ K;  4YG2 A;  4WJ3 M;  1Y1V C;  5FJ8 K;  5C3E C;  3GTK K;  1TWH A;  3TFJ A;  3AQP A;  2XCQ A;  2EBB A;  1X31 C;  3GTO C;  2JA7 A;  1WQF A;  2VUM C;  4A93 K;  4G0U A;  4LK0 A;  3PO2 C;  2CFA B;  3GTG A;  4A3I C;  2ZUF A;  3HOW C;  2A68 A;  4BBS C;  5IYB C;  3ORE A;  1WCM K;  3A8K A;  3PO3 K;  3HOW K;  5FLM C;  4GFQ A;  2KWA A;  4A3I K;  4KAW X;  2JH3 A;  4G7O A;  5IYD C;  2VUM A;  2JA8 K;  2V6S A;  1WSV A;  3RZD C;  1B4A A;  1O28 A;  1L0W A;  1J6W A;  1I50 K;  4KMA A;  3CQZ K;  4A3E C;  4BXX K;  2R7Z A;  3LPX A;  2NVT K;  1DCH A;  3FHZ A;  4C3H K;  2A69 A;  1XZP A;  1TWF A;  4MEX A;  4C45 A;  3HOU K;  1BGW A;  4X6A K;  1TWF K;  2R93 C;  4QIW D;  3BP3 A;  5M5W K;  1IE0 A;  2D6F C;  2JA6 C;  4A3L C;  4QJV B;  2Y0S D;  1K83 A;  1GE9 A;  4A3F C;  3GTP K;  2WAQ D;  4AYB D;  3H3V D;  2JA7 C;  5M3M K;  1HI9 A;  4GTB A;  4LQY A;  3S2D C;  2E2H K;  1JOE A;  3FOF A;  2R7Z K;  4BBR C;  4GTD A;  3A8I A;  4GTL A;  4GTF A;  5TMF A;  1WOO A;  5FLM K;  3GTJ C;  3GTM C;  2RGR A;  1KQ4 A;  4GTA A;  4C2M K;  1ZQ1 C;  1JQW A;  2YU9 K;  2E2H A;  1TWG A;  3BP8 C;  4KB2 A;  4BBS K;  2PHC B;  2GSN A;  5EGH A;  3N3Y A;  1SFO A;  3JST A;  1O2B A;  1V5V A;  3I4N C;  3FKI K;  4XSX A;  2R92 C;  4A3M K;  3S15 K;  4A3J C;  1USO A;  5IP7 K;  1YNN A;  1EH1 A;  5L46 A;  4NOI A;  4O2D A;  4KMD A;  2CW0 A;  1TWG C;  3DXJ A;  4A3B K;  5JFE A;  4A3D C;  4KM9 A;  3M4O K;  3S1Q K;  2NVX C;  1XZP B;  1Y1W K;  4YFN A;  1ZVU A;  2R93 A;  3S17 K;  1XXC A;  5C4J C;  2JA5 C;  2ZFZ A;  3AH5 A;  2B63 K;  1EQR A;  3PO3 C;  1O26 A;  3H0G A;  4C3H C;  4XCH A;  1J6X A;  1JVI A;  4A3K C;  3Q3Q A;  5EGE A;  4G7H A;  4BLB A;  5C44 C;  1WCM A;  1G51 A;  4XLP A;  1IBA A;  5C4X K;  1IL2 A;  1WOS A;  3K7A C;  1VH2 A;  4A93 C;  4KDD A;  4Y7N C;  3S16 C;  3S1R K;  1F7V A;  2P8T A;  3L4J A;  1I6H K;  1DCP A;  1USM A;  3S2D K;  5C3E K;  3K7A K;  4GT9 A;  1I3Q A;  4Y7N K;  2O5J A;  5C44 K;  5IOR A;  3G4A A;  3S15 C;  1UV7 A;  4PAB A;  2P5M A;  3CAG A;  4A3K K;  1ZXO A;  3GTK A;  1K83 C;  4GTC A;  3HOY C;  4OIO A;  3GTL K;  2V6U A;  4FM9 A;  1ZYR A;  4KMU A;  3LAJ A;  3L4K A;  1O2F B;  2A6E A;  2YU9 C;  4ZH4 A;  1EI6 A;  2ZUE A;  3S1N K;  1TWH K;  1VJE A;  1TWH C;  3HXA A;  4XLN A;  3GTJ A;  3N0B A;  3GTQ C;  3CQZ A;  1I50 A;  3HOV K;  1XXB A;  4A3D K;  4G0W A;  1J6V A;  3HKZ L;  4KAR A;  1TWA K;  4KAT A;  2JA7 K;  2NVY K;  4AYB L;  3QX3 A;  1B4B A;  3T01 A;  1EFW A;  1F9N A;  3S17 C;  3OEP A;  4C3J K;  3AD9 C;  4Y52 C;  3IPJ A;  4A3G C;  2R7Z C;  1ISE A;  4ILD A;  1BJT A;  3WOD A;  3M3Y C;  4BY7 K;  1WIH A;  1TWA C;  1TWC K;  1O29 A;  1VRQ C;  2E2I C;  2JA5 A;  3A8J A;  5IP9 C;  2E2J C;  5C4X C;  3TFI A;  1TWC C;  4A3E K;  2XCR B;  4A3G K;  4G0V A;  4A3C K;  2RH6 A;  2WB1 L;  4Q4Z A;  3S14 C;  2BE5 A;  1YCL A;  4C3I C;  2GSU A;  3OPF A;  1TWA A;  3T02 A;  5IYC C;  3HOZ K;  1AB4 A;  2W7V A;  2PA8 L;  4KN4 A;  2NVY C;  2PMZ L;  5TMC A;  1TWC A;  3HOX C;  4KB4 A;  3S1M K;  4QJV A;  4LLG A;  1R9T A;  4MEY A;  1I50 C;  2PMZ D;  3S1N C;  4LJZ A;  1WQG A;  1SFO K;  3HOZ C;  4LR2 A;  1J98 A;  4BY7 C;  3GEE A;  2YU9 A;  1I6V A;  3GTL A;  2NVY A;  1O2A A;  2E2I A;  1Y1V K;  2R93 K;  3I4M K;  5IYD K;  3NUH A;  2GAH C;  3HOY K;  5E68 A;  3RZO C;  3AD7 C;  1HQM A;  1R9T C;  4JK1 A;  1EK8 A;  3TTG A;  1DCO A;  1XZQ B;  3CQZ C;  5M3F K;  2B63 C;  5CHP A;  1WQH A;  5M5Y K;  3EQL A;  3GTO K;  1IQ0 A;  2V6T A;  2CFA A;  1RU0 A;  1Y1W A;  3H3V L;  2JA8 C;  3AQO A;  1F7U A;  3S16 K;  5IOS A;  2WAQ L;  2XCO A;  1XXA A;  4WIL A;  4YFK A;  3H0G K;  3I4N K;  3GTO A;  2PA8 D;  1WCM C;  3FKI C;  2NVX A;  2B63 A;  4GTE A;  4WJ4 A;  1TWF C;  3HOU C;  2NVQ C;  3ADA C;  3HKZ D;  4GZY A;  3M4O C;  2NVT C;  3S1Q C;  4C2M C;  3AD8 C;  4J3N A;  1TWG K;  3BUE A;  3GTM K;  4OIR A;  2NVX K;  1PJ5 A;  4FZB A;  5HL8 A;  4A3C C;  4YFX A;  3RZD K;  3FKI A;  4RMF A;  3S1M C;  3GDZ A;  2R92 K;  4AH6 A;  2Y0S L;  1YNJ A;  4A3M C;  4P9S A;  1WSR A;  3T00 A;  3G4C A;  5IOQ A;  3RZO K;  1K83 K;  2JA6 A;  3S14 K;  3GTM A;  5D4D A;  3I4M C;  3VA7 A;  3FOE A;  3GTQ A;  3LAP A;  4X6A C;  4BBR K;  2A6H A;  1SFO C;  1SMY A;  4KAS A;  1IW7 A;  5IP9 K;  2E2J K;  1BDF A;  4P5A A;  4KMH A;  2GAG C;  3M3Y K;  3GTQ K;  1WOP A;  1INN A;  4OIN A;  4A3F K;  3GTP C;  3GSI A;  1R9T K;  4Y52 K;  3GEI A;  2JA6 K;  4A3L K;  5CJ9 A;  1DD5 A;  4C3I K;  3GTG K;  4KC6 A;  3N0C A;  1C0A A;  5IOT A;  2R92 A;  5M5X K;  5IP7 C;  1PJ6 A;  1XZQ A;  3S2H K;  4A3J K;  1ZBS A;  1PJ7 A;  1Y1V A;  4BXX C;  2FQO A;  4Q5S A;  3HOX K;  2VUM K;  5IYC K;  4OIP A;  4LK1 A;  1I3Q C;  4G7Z A;  5JVO A;  3GTG C;  4M1X A;  4C3J C;  1IS1 A;  4LOW A;  3GTP A;  5TJ3 A;  1I3Q K;  4MQ9 A;  4KM8 A;  1VLO A;  2NVQ K;  2E2H C;  1XPP A;  1O25 A;  3TFH A;  3ERE D;  3PO2 K;  2JA5 K;  2E2I K;  2FQT A;  4XSZ A;  4PAA A;  3SZZ A;  3S0X A;  1I6H C;  1Y1W C;  3S2H C;  3S1R C;  2GSO A;  1WOR A;  4BLA A;  4OIQ A;  1F93 A;  1YX2 A;  3SZY A;  3MML B;  1BS2 A;  1O27 A;  2Y3P A;  4BY1 C;  3GTK C;  1VGX A;  2O5I A;  4DDQ A;  3V4G A;  4QIW L;  3GEH A;  1O24 A;  4BKW A;  3GTL C;  2PPB A;  2WB1 D;  5C4J K;  3GIR A;  4P5B A;  3H0G C;  4KN7 A; 
#chains in the Genus database with same CATH homology
 4A3E K;  3S15 K;  4A3J C;  3RZO K;  3HOV C;  5IYB K;  4A3B C;  1K83 K;  5IP7 K;  1YNN A;  4BY1 K;  4A3G K;  3GTJ K;  3S14 K;  4YG2 A;  4NOI A;  4A3C K;  2WB1 L;  1Y1V C;  5FJ8 K;  5C3E C;  3GTK K;  4Q4Z A;  5D4D A;  3S14 C;  2CW0 A;  2BE5 A;  3I4M C;  1TWG C;  3DXJ A;  4A3B K;  3GTO C;  3M4O K;  3S1Q K;  2NVX C;  1Y1W K;  4YFN A;  2VUM C;  4BBR K;  4X6A C;  2A6H A;  1SFO C;  3S17 K;  4A93 K;  1SMY A;  5IYC C;  1IW7 A;  4LK0 A;  5IP9 K;  5C4J C;  2E2J K;  2JA5 C;  3HOZ K;  1BDF A;  2PA8 L;  4KN4 A;  2B63 K;  3PO2 C;  2NVY C;  2PMZ L;  5TMC A;  3HOX C;  3PO3 C;  4A3I C;  3M3Y K;  3HOW C;  2A68 A;  3GTQ K;  4BBS C;  3S1M K;  4A3K C;  5IYB C;  4QJV A;  4OIN A;  4A3F K;  4LLG A;  1WCM K;  4G7H A;  3GTP C;  5C44 C;  1R9T K;  3PO3 K;  4MEY A;  5FLM C;  1I50 C;  4XLP A;  3HOW K;  4Y52 K;  5C4X K;  2JA6 K;  4A3I K;  4A3L K;  3K7A C;  2PMZ D;  3S1N C;  4LJZ A;  4G7O A;  1SFO K;  5IYD C;  4Y7N C;  3S16 C;  4A93 C;  4C3I K;  2JA8 K;  3GTG K;  3HOZ C;  3S1R K;  4BY7 C;  1I6H K;  3S2D K;  1I6V A;  5C3E K;  3K7A K;  1Y1V K;  2R93 K;  3I4M K;  4Y7N K;  3RZD C;  5IYD K;  3HOY K;  2O5J A;  5C44 K;  5M5X K;  3RZO C;  4A3E C;  1I50 K;  4A3K K;  3CQZ K;  3S15 C;  4BXX K;  1HQM A;  1R9T C;  1K83 C;  5IP7 C;  4JK1 A;  2NVT K;  3S2H K;  4A3J K;  4A3M K;  3HOY C;  4BXX C;  4OIO A;  3CQZ C;  5M3F K;  3GTL K;  2B63 C;  4Q5S A;  4C3H K;  2A69 A;  4MEX A;  3HOX K;  3HOU K;  1ZYR A;  4KMU A;  5M5Y K;  2A6E A;  1TWF K;  2VUM K;  4X6A K;  2R93 C;  2YU9 C;  3EQL A;  5IYC K;  3GTO K;  4QIW D;  4OIP A;  4ZH4 A;  4LK1 A;  1I3Q C;  4G7Z A;  3S1N K;  1TWH K;  5M5W K;  3H3V L;  2JA8 C;  2JA6 C;  3GTG C;  3S16 K;  4A3L C;  2WAQ L;  4QJV B;  2Y0S D;  1TWH C;  4YFK A;  4A3F C;  3GTP K;  4XLN A;  3H0G K;  1I3Q K;  4MQ9 A;  3I4N K;  2WAQ D;  4AYB D;  3GTQ C;  2PA8 D;  1WCM C;  3FKI C;  3HOV K;  3H3V D;  2NVQ K;  2JA7 C;  2E2H C;  4A3D K;  1TWF C;  3HKZ L;  1XPP A;  5M3M K;  1TWA K;  3HOU C;  3PO2 K;  2JA5 K;  2JA7 K;  2NVQ C;  2E2I K;  2NVY K;  3HKZ D;  4XSZ A;  4AYB L;  3S2D C;  1I6H C;  2E2H K;  1Y1W C;  4GZY A;  3M4O C;  2NVT C;  3S1R C;  3S2H C;  3S1Q C;  2R7Z K;  3S17 C;  1TWG K;  4C3J K;  4BBR C;  3GTM K;  4OIR A;  2NVX K;  4OIQ A;  5TMF A;  4A3C C;  4Y52 C;  4YFX A;  5FLM K;  3GTJ C;  3RZD K;  3GTK C;  4BY1 C;  3GTM C;  4A3G C;  2R7Z C;  2O5I A;  4C2M K;  2YU9 K;  3S1M C;  3WOD A;  2R92 K;  4QIW L;  3M3Y C;  4BBS K;  4BY7 K;  2Y0S L;  1YNJ A;  1TWA C;  1TWC K;  4A3M C;  3GTL C;  2PPB A;  2E2I C;  2WB1 D;  5IP9 C;  5C4J K;  2E2J C;  3I4N C;  3FKI K;  4XSX A;  5C4X C;  2R92 C;  1TWC C;  4A3D C;  3H0G C;  4KN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...