2NVXK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvxK00
3GTLC 4BBRC 2BE5A 4KMUA 4LJZA 4Y7NK 2NVTK 2R92K 4YFKA 3HKZL 3RZOK 1I6HK 3S16K 4Y7NC 2NVTC 2R92C 3PO2K 5TMFA 4Q4ZA 5IP9K 5M3FK 4A3KK 3RZOC 3S16C 1I6HC 3K7AK 3PO2C 3CQZK 3HOVK 5IP9C 4A3KC 2JA8K 1SFOK 2JA5K 3HOWK 3K7AC 1Y1WK 3HOZK 1BDFA 3CQZC 3HOVC 2JA8C 3GTMK 1SFOC 2JA5C 3HOWC 1Y1WC 3H3VL 3HOZC 1YNNA 1I3QK 4LK1A 1WCMK 3GTMC 2R93K 2A6HA 3S1QK 2R7ZK 4OIPA 1I3QC 1WCMC 5M5WK 4A3FK 2R93C 4A93C 3S1QC 2R7ZC 5D4DA 3I4MK 5FLMK 2JA7K 4A3FC 4AYBD 3S2DK 2O5IA 3M3YK 4G7HA 3I4MC 1TWFK 5FLMC 4A3JK 2JA7C 1TWCK 3S2DC 3M3YC 4C2MK 2PA8D 4BY1K 1TWFC 4A3JC 2O5JA 3S15K 3H0GK 2A68A 4AYBL 1TWCC 2PMZL 1ZYRA 4A3DK 4C3JK 3H3VD 4BY1C 3S15C 3H0GC 3S17K 4X6AK 4A3DC 4Y52K 2PA8L 1I6VA 4C3IK 5M5YK 3GTGK 3S17C 4X6AC 5IYBK 4JK1A 4XLNA 2Y0SD 2NVYK 3GTGC 3S1NK 5IYBC 1HQMA 3PO3K 3EQLA 3GTKK 1K83K 1IW7A 4OIOA 2B63K 2NVYC 3GTPK 4A93K 4G7OA 4GZYA 3DXJA 5M3MK 3GTJK 3GTQK 3S1NC 4MQ9A 3PO3C 4Y52C 1K83C 3S1RK 3GTKC 2Y0SL 2YU9K 2B63C 5M5XK 2WB1D 4NOIA 3GTJC 4G7ZA 4OIRA 3GTPC 3GTQC 4BBSK 2PMZD 4BY7K 3FKIK 3S1RC 2YU9C 4BBSC 4QJVA 4BY7C 3HOXK 3HOUK 3FKIC 3I4NK 4XSXA 4A3BK 4QIWD 2WB1L 3HOYK 2JA6K 3RZDK 3HOXC 3HOUC 2A6EA 4YFNA 3I4NC 4XSZA 4A3BC 4ZH4A 1XPPA 1TWAK 2WAQL 3HOYC 2JA6C 2CW0A 3RZDC 2A69A 1R9TK 3M4OK 1TWAC 4MEYA 2E2IK 4QIWL 5C4XK 1R9TC 3M4OC 2E2IC 4Q5SA 4A3IK 4A3MK 1TWHK 5C4XC 4YG2A 3S14K 4C3HK 4MEXA 1I50K 4A3IC 4QJVB 1TWHC 5C3EK 4A3MC 3S14C 4A3GK 4LLGA 3GTOK 5C4JK 4A3EK 1I50C 5C3EC 5C44K 4A3GC 3GTOC 5C4JC 4A3CK 4A3EC 2WAQD 5IP7K 4XLPA 2E2JK 2VUMK 4A3LK 5C44C 2NVXK 2PPBA 2NVQK 1YNJA 3S1MK 4BXXK 4A3CC 5TMCA 5IP7C 4OINA 1Y1VK 3WODA 5FJ8K 2E2JC 5IYCK 2VUMC 4A3LC 1TWGK 2NVXC 2NVQC 3S1MC 4BXXC 4OIQA 4LK0A 2E2HK 1Y1VC 5IYCC 1TWGC 5IYDK 1SMYA 4KN7A 2E2HC 4YFXA 3S2HK 3GTLK 3HKZD 4BBRK 5IYDC 4KN4A 3S2HC
chains in the Genus database with same CATH superfamily
3AQOA 1RU0A 4KMUA 4Y7NK 4Y7NC 1O27A 1O2BA 3PO2K 3G4CA 3PO2C 5EGHA 2P5MA 3ERED 4KDDA 4LOWA 3HOWK 1Y1WK 1GE9A 3HOWC 1Y1WC 3H3VL 2CFAA 3TFIA 2NVXA 4OIPA 4P9SA 1INNA 2KWAA 3AD9C 4KMDA 3Q3QA 1WCMA 2PHCB 2PA8D 1DCPA 3S15K 3QX3A 3H3VD 3S15C 3S17K 1EQRA 1WOOA 1XZPB 2GSUA 1TWFA 1B4BA 1I6VA 1TWCA 3S17C 4XLNA 4PAAA 3H0GA 3FOEA 4A93K 1K83K 1WQGA 4GTEA 5M3MK 1K83C 3S1RK 2YU9K 5M5XK 2WB1D 5L46A 3S1RC 2YU9C 3HOXK 3GTQA 1G51A 3HOXC 1PJ6A 4WJ3M 1XPPA 1TWAK 1XXCA 1ZQ1C 3FKIA 3T02A 1TWAC 3A8IA 3S14K 1WQFA 4C3HK 2GAGC 4QJVB 3S14C 4C3HC 4A3GK 2FQOA 4A3GC 5IP7K 4GTBA 4XLPA 2VUMK 2NVQK 3S1MK 4BXXK 5IP7C 4FZBA 2VUMC 3BP8C 2XCQA 2NVQC 3S1MC 4BXXC 2V6UA 3AQPA 2V6TA 4GTCA 3G4AA 3S2HK 3A8KA 1VH2A 3GTLK 1JQWA 3HKZD 1Y1VA 3S2HC 4FM9A 3GTLC 2NVTK 3JSTA 3RZOK 1I6HK 2P8TA 2GSOA 2NVTC 4PABA 4ILDA 3RZOC 1I6HC 3AD7C 3K7AK 3N0BA 1XXBA 3BUEA 3K7AC 3HOZK 1BDFA 3GTMK 4KMHA 4G0WA 3V4GA 3HOZC 1YNNA 4LK1A 5TJ3A 1WCMK 3GTMC 3N0CA 3CQZA 1WCMC 2JA5A 4A3FK 1WSRA 4M1XA 3I4MK 4A3FC 4AYBD 3I4MC 1TWFK 1TWCK 3GTLA 1TWFC 1J6VA 2O5JA 3H0GK 1TWCC 1ZYRA 2JA7A 4P5BA 3H0GC 4X6AK 2PA8L 1HI9A 1L0WA 5M5YK 4X6AC 5IYBK 1ISEA 4J3NA 1IE0A 1F93A 2Y0SD 4LR2A 5IOQA 3S1NK 5IYBC 3PO3K 1WSVA 4G0VA 1IW7A 4OIOA 3GTPK 1DCHA 4KB4A 3DXJA 3S1NC 3GTQK 5IOSA 4O2DA 3PO3C 4GTDA 3GTPC 3GTGA 4NOIA 3GTMA 3GTQC 3VA7A 3FKIK 2W7VA 4QJVA 1O29A 3GTKA 1JVIA 3HOUK 3FKIC 3I4NK 4XSXA 1IBAA 2WB1L 3HOUC 4YFNA 3MMLB 4XSZA 3I4NC 1EK8A 3GSIA 3BP3A 4DDQA 3SZYA 3M4OK 2E2IK 3NUHA 4GTLA 1F9NA 3M4OC 2JA6A 2E2IC 4A3MK 1O2AA 4YG2A 4KC6A 4A3MC 5C3EK 1EI6A 3TTGA 1R9TA 1O2FB 5C4JK 5C3EC 1C0AA 5C4JC 1TWHA 3AH5A 1YCLA 1UV7A 1J6WA 4A3LK 3GTPA 1I50A 2PPBA 1YNJA 1X31C 1Y1VK 3WODA 5FJ8K 4A3LC 4BLAA 1XZQB 4LK0A 1Y1VC 3LPXA 1SMYA 2V6SA 4P5AA 4BBRK 4GT9A 4BBRC 2BE5A 2E2HA 4LJZA 1WORA 3HKZL 2E2IA 3S16K 5TMFA 4Q4ZA 3S16C 3CQZK 2JA8K 3GIRA 1WQHA 2JA5K 1VRQC 3CQZC 2JA8C 2JA5C 1WIHA 2A6HA 1SFOA 5E68A 5D4DA 5FLMK 2JA7K 2O5IA 1I3QA 4G7HA 2Y3PA 5FLMC 4A3JK 2JA7C 2R93A 5HL8A 5JFEA 2R7ZA 4C2MK 4BY1K 4A3JC 2A68A 1J6XA 4AYBL 4C2MC 4C3JK 5IORA 4BY1C 4BLBA 5IOTA 4C3JC 3GTGK 4RMFA 4JK1A 3GEEA 3HXAA 2NVYK 1O28A 3GTGC 1HQMA 2ZUFA 3GTKK 4GZYA 2NVYC 4G7OA 4MQ9A 3GTKC 4GTAA 2Y0SL 4BBSK 3GDZA 1VLOA 4G7ZA 4BY7K 1DD5A 4BBSC 4BY7C 1JOEA 2B63A 3GTJA 4QIWD 4GTFA 2JA6K 3RZDK 2A6EA 1XXAA 2JA6C 2CW0A 2ZFZA 4WILA 1BS2A 3RZDC 1R9TK 4MEYA 1XZQA 1R9TC 4Q5SA 4A3IK 1TWHK 3S0XA 4MEXA 1I50K 3T00A 4A3IC 1TWHC 3GEHA 1IS1A 4KM8A 4LLGA 1O24A 1YX2A 1I50C 4A3EK 2NVYA 1AB4A 4KASA 3OREA 2GSNA 4A3EC 2RH6A 2E2JK 1ZBSA 1DCOA 1VGXA 4GFQA 1PJ5A 2E2JC 3GTOA 1TWGK 4KATA 4OIQA 2E2HK 5CHPA 4C45A 1TWGC 1J98A 3CAGA 4AH6A 4KN7A 2E2HC 1ZVUA 1EH1A 3L4JA 2R92K 4YFKA 1KQ4A 2R92C 2XCOA 3LAPA 1IQ0A 3L4KA 3SZZA 5IP9K 5M3FK 3IPJA 4A3KK 2JH3A 5EGEA 1B4AA 3HOVK 5IP9C 4A3KC 3FOFA 1SFOK 1F7VA 1BGWA 4G0UA 3HOVC 1SFOC 1ZXOA 1I3QK 2R93K 3S1QK 2R7ZK 1I3QC 5M5WK 4KM9A 2R93C 1Y1WA 4A93C 3S1QC 2R7ZC 3A8JA 1TWGA 3S2DK 3M3YK 5JVOA 3S2DC 3M3YC 3T01A 2PMZL 4A3DK 2RGRA 4A3DC 2R92A 2CFAB 4KMAA 1F7UA 1EFWA 4C3IK 4KB2A 3AD8C 2ZUEA 4C3IC 1V5VA 4KARA 3LAJA 3EQLA 1WOSA 4Y52K 2B63K 1BJTA 3GTJK 4Y52C 3TFHA 2B63C 3N3YA 5CJ9A 3GTJC 4OIRA 2PMZD 1USOA 3OPFA 1K83A 4A3BK 2GAHC 3HOYK 2YU9A 4A3BC 4ZH4A 2WAQL 3HOYC 1O26A 2A69A 2FQTA 4QIWL 5C4XK 1WOPA 4BKWA 1IL2A 3OEPA 5C4XC 2EBBA 3GEIA 1TWAA 4XCHA 4KAWX 4LQYA 1VJEA 3GTOK 1PJ7A 5C44K 3GTOC 4A3CK 1USMA 1O25A 2WAQD 3ADAC 5C44C 2NVXK 4A3CC 5TMCA 4OINA 5IYCK 2NVXC 2D6FC 5IYCC 3FHZA 4WJ4A 5IYDK 1XZPA 2VUMA 4YFXA 2XCRB 5IYDC 4KN4A 3TFJA
chains in the Genus database with same CATH topology
3GTLC 4BBRC 2BE5A 4KMUA 4LJZA 4Y7NK 2NVTK 2R92K 4YFKA 3HKZL 3RZOK 1I6HK 3S16K 4Y7NC 2NVTC 2R92C 3PO2K 5TMFA 4Q4ZA 5IP9K 5M3FK 4A3KK 3RZOC 3S16C 1I6HC 3K7AK 3PO2C 3CQZK 3HOVK 5IP9C 4A3KC 2JA8K 1SFOK 2JA5K 3HOWK 3K7AC 1Y1WK 3HOZK 1BDFA 3CQZC 3HOVC 2JA8C 3GTMK 1SFOC 2JA5C 3HOWC 1Y1WC 3H3VL 3HOZC 1YNNA 1I3QK 4LK1A 1WCMK 3GTMC 2R93K 2A6HA 3S1QK 2R7ZK 4OIPA 1I3QC 1WCMC 5M5WK 4A3FK 2R93C 4A93C 3S1QC 2R7ZC 5D4DA 3I4MK 5FLMK 2JA7K 4A3FC 4AYBD 3S2DK 2O5IA 3M3YK 4G7HA 3I4MC 1TWFK 5FLMC 4A3JK 2JA7C 1TWCK 3S2DC 3M3YC 4C2MK 2PA8D 4BY1K 1TWFC 4A3JC 2O5JA 3S15K 3H0GK 2A68A 4AYBL 1TWCC 2PMZL 1ZYRA 4A3DK 4C3JK 3H3VD 4BY1C 3S15C 3H0GC 3S17K 4X6AK 4A3DC 4Y52K 2PA8L 1I6VA 4C3IK 5M5YK 3GTGK 3S17C 4X6AC 5IYBK 4JK1A 4XLNA 2Y0SD 2NVYK 3GTGC 3S1NK 5IYBC 1HQMA 3PO3K 3EQLA 3GTKK 1K83K 1IW7A 4OIOA 2B63K 2NVYC 3GTPK 4A93K 4G7OA 4GZYA 3DXJA 5M3MK 3GTJK 3GTQK 3S1NC 4MQ9A 3PO3C 4Y52C 1K83C 3S1RK 3GTKC 2Y0SL 2YU9K 2B63C 5M5XK 2WB1D 4NOIA 3GTJC 4G7ZA 4OIRA 3GTPC 3GTQC 4BBSK 2PMZD 4BY7K 3FKIK 3S1RC 2YU9C 4BBSC 4QJVA 4BY7C 3HOXK 3HOUK 3FKIC 3I4NK 4XSXA 4A3BK 4QIWD 2WB1L 3HOYK 2JA6K 3RZDK 3HOXC 3HOUC 2A6EA 4YFNA 3I4NC 4XSZA 4A3BC 4ZH4A 1XPPA 1TWAK 2WAQL 3HOYC 2JA6C 2CW0A 3RZDC 2A69A 1R9TK 3M4OK 1TWAC 4MEYA 2E2IK 4QIWL 5C4XK 1R9TC 3M4OC 2E2IC 4Q5SA 4A3IK 4A3MK 1TWHK 5C4XC 4YG2A 3S14K 4C3HK 4MEXA 1I50K 4A3IC 4QJVB 1TWHC 5C3EK 4A3MC 3S14C 4A3GK 4LLGA 3GTOK 5C4JK 4A3EK 1I50C 5C3EC 5C44K 4A3GC 3GTOC 5C4JC 4A3CK 4A3EC 2WAQD 5IP7K 4XLPA 2E2JK 2VUMK 4A3LK 5C44C 2NVXK 2PPBA 2NVQK 1YNJA 3S1MK 4BXXK 4A3CC 5TMCA 5IP7C 4OINA 1Y1VK 3WODA 5FJ8K 2E2JC 5IYCK 2VUMC 4A3LC 1TWGK 2NVXC 2NVQC 3S1MC 4BXXC 4OIQA 4LK0A 2E2HK 1Y1VC 5IYCC 1TWGC 5IYDK 1SMYA 4KN7A 2E2HC 4YFXA 3S2HK 3GTLK 3HKZD 4BBRK 5IYDC 4KN4A 3S2HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL C;  4BBR C;  2BE5 A;  4KMU A;  4LJZ A;  4Y7N K;  2NVT K;  2R92 K;  4YFK A;  3HKZ L;  3RZO K;  1I6H K;  3S16 K;  4Y7N C;  2NVT C;  2R92 C;  3PO2 K;  5TMF A;  4Q4Z A;  5IP9 K;  5M3F K;  4A3K K;  3RZO C;  3S16 C;  1I6H C;  3K7A K;  3PO2 C;  3CQZ K;  3HOV K;  5IP9 C;  4A3K C;  2JA8 K;  1SFO K;  2JA5 K;  3HOW K;  3K7A C;  1Y1W K;  3HOZ K;  1BDF A;  3CQZ C;  3HOV C;  2JA8 C;  3GTM K;  1SFO C;  2JA5 C;  3HOW C;  1Y1W C;  3H3V L;  3HOZ C;  1YNN A;  1I3Q K;  4LK1 A;  1WCM K;  3GTM C;  2R93 K;  2A6H A;  3S1Q K;  2R7Z K;  4OIP A;  1I3Q C;  1WCM C;  5M5W K;  4A3F K;  2R93 C;  4A93 C;  3S1Q C;  2R7Z C;  5D4D A;  3I4M K;  5FLM K;  2JA7 K;  4A3F C;  4AYB D;  3S2D K;  2O5I A;  3M3Y K;  4G7H A;  3I4M C;  1TWF K;  5FLM C;  4A3J K;  2JA7 C;  1TWC K;  3S2D C;  3M3Y C;  4C2M K;  2PA8 D;  4BY1 K;  1TWF C;  4A3J C;  2O5J A;  3S15 K;  3H0G K;  2A68 A;  4AYB L;  1TWC C;  2PMZ L;  1ZYR A;  4A3D K;  4C3J K;  3H3V D;  4BY1 C;  3S15 C;  3H0G C;  3S17 K;  4X6A K;  4A3D C;  4Y52 K;  2PA8 L;  1I6V A;  4C3I K;  5M5Y K;  3GTG K;  3S17 C;  4X6A C;  5IYB K;  4JK1 A;  4XLN A;  2Y0S D;  2NVY K;  3GTG C;  3S1N K;  5IYB C;  1HQM A;  3PO3 K;  3EQL A;  3GTK K;  1K83 K;  1IW7 A;  4OIO A;  2B63 K;  2NVY C;  3GTP K;  4A93 K;  4G7O A;  4GZY A;  3DXJ A;  5M3M K;  3GTJ K;  3GTQ K;  3S1N C;  4MQ9 A;  3PO3 C;  4Y52 C;  1K83 C;  3S1R K;  3GTK C;  2Y0S L;  2YU9 K;  2B63 C;  5M5X K;  2WB1 D;  4NOI A;  3GTJ C;  4G7Z A;  4OIR A;  3GTP C;  3GTQ C;  4BBS K;  2PMZ D;  4BY7 K;  3FKI K;  3S1R C;  2YU9 C;  4BBS C;  4QJV A;  4BY7 C;  3HOX K;  3HOU K;  3FKI C;  3I4N K;  4XSX A;  4A3B K;  4QIW D;  2WB1 L;  3HOY K;  2JA6 K;  3RZD K;  3HOX C;  3HOU C;  2A6E A;  4YFN A;  3I4N C;  4XSZ A;  4A3B C;  4ZH4 A;  1XPP A;  1TWA K;  2WAQ L;  3HOY C;  2JA6 C;  2CW0 A;  3RZD C;  2A69 A;  1R9T K;  3M4O K;  1TWA C;  4MEY A;  2E2I K;  4QIW L;  5C4X K;  1R9T C;  3M4O C;  2E2I C;  4Q5S A;  4A3I K;  4A3M K;  1TWH K;  5C4X C;  4YG2 A;  3S14 K;  4C3H K;  4MEX A;  1I50 K;  4A3I C;  4QJV B;  1TWH C;  5C3E K;  4A3M C;  3S14 C;  4A3G K;  4LLG A;  3GTO K;  5C4J K;  4A3E K;  1I50 C;  5C3E C;  5C44 K;  4A3G C;  3GTO C;  5C4J C;  4A3C K;  4A3E C;  2WAQ D;  5IP7 K;  4XLP A;  2E2J K;  2VUM K;  4A3L K;  5C44 C;  2NVX K;  2PPB A;  2NVQ K;  1YNJ A;  3S1M K;  4BXX K;  4A3C C;  5TMC A;  5IP7 C;  4OIN A;  1Y1V K;  3WOD A;  5FJ8 K;  2E2J C;  5IYC K;  2VUM C;  4A3L C;  1TWG K;  2NVX C;  2NVQ C;  3S1M C;  4BXX C;  4OIQ A;  4LK0 A;  2E2H K;  1Y1V C;  5IYC C;  1TWG C;  5IYD K;  1SMY A;  4KN7 A;  2E2H C;  4YFX A;  3S2H K;  3GTL K;  3HKZ D;  4BBR K;  5IYD C;  4KN4 A;  3S2H C; 
#chains in the Genus database with same CATH topology
 3AQO A;  1RU0 A;  4KMU A;  4Y7N K;  4Y7N C;  1O27 A;  1O2B A;  3PO2 K;  3G4C A;  3PO2 C;  5EGH A;  2P5M A;  3ERE D;  4KDD A;  4LOW A;  3HOW K;  1Y1W K;  1GE9 A;  3HOW C;  1Y1W C;  3H3V L;  2CFA A;  3TFI A;  2NVX A;  4OIP A;  4P9S A;  1INN A;  2KWA A;  3AD9 C;  4KMD A;  3Q3Q A;  1WCM A;  2PHC B;  2PA8 D;  1DCP A;  3S15 K;  3QX3 A;  3H3V D;  3S15 C;  3S17 K;  1EQR A;  1WOO A;  1XZP B;  2GSU A;  1TWF A;  1B4B A;  1I6V A;  1TWC A;  3S17 C;  4XLN A;  4PAA A;  3H0G A;  3FOE A;  4A93 K;  1K83 K;  1WQG A;  4GTE A;  5M3M K;  1K83 C;  3S1R K;  2YU9 K;  5M5X K;  2WB1 D;  5L46 A;  3S1R C;  2YU9 C;  3HOX K;  3GTQ A;  1G51 A;  3HOX C;  1PJ6 A;  4WJ3 M;  1XPP A;  1TWA K;  1XXC A;  1ZQ1 C;  3FKI A;  3T02 A;  1TWA C;  3A8I A;  3S14 K;  1WQF A;  4C3H K;  2GAG C;  4QJV B;  3S14 C;  4C3H C;  4A3G K;  2FQO A;  4A3G C;  5IP7 K;  4GTB A;  4XLP A;  2VUM K;  2NVQ K;  3S1M K;  4BXX K;  5IP7 C;  4FZB A;  2VUM C;  3BP8 C;  2XCQ A;  2NVQ C;  3S1M C;  4BXX C;  2V6U A;  3AQP A;  2V6T A;  4GTC A;  3G4A A;  3S2H K;  3A8K A;  1VH2 A;  3GTL K;  1JQW A;  3HKZ D;  1Y1V A;  3S2H C;  4FM9 A;  3GTL C;  2NVT K;  3JST A;  3RZO K;  1I6H K;  2P8T A;  2GSO A;  2NVT C;  4PAB A;  4ILD A;  3RZO C;  1I6H C;  3AD7 C;  3K7A K;  3N0B A;  1XXB A;  3BUE A;  3K7A C;  3HOZ K;  1BDF A;  3GTM K;  4KMH A;  4G0W A;  3V4G A;  3HOZ C;  1YNN A;  4LK1 A;  5TJ3 A;  1WCM K;  3GTM C;  3N0C A;  3CQZ A;  1WCM C;  2JA5 A;  4A3F K;  1WSR A;  4M1X A;  3I4M K;  4A3F C;  4AYB D;  3I4M C;  1TWF K;  1TWC K;  3GTL A;  1TWF C;  1J6V A;  2O5J A;  3H0G K;  1TWC C;  1ZYR A;  2JA7 A;  4P5B A;  3H0G C;  4X6A K;  2PA8 L;  1HI9 A;  1L0W A;  5M5Y K;  4X6A C;  5IYB K;  1ISE A;  4J3N A;  1IE0 A;  1F93 A;  2Y0S D;  4LR2 A;  5IOQ A;  3S1N K;  5IYB C;  3PO3 K;  1WSV A;  4G0V A;  1IW7 A;  4OIO A;  3GTP K;  1DCH A;  4KB4 A;  3DXJ A;  3S1N C;  3GTQ K;  5IOS A;  4O2D A;  3PO3 C;  4GTD A;  3GTP C;  3GTG A;  4NOI A;  3GTM A;  3GTQ C;  3VA7 A;  3FKI K;  2W7V A;  4QJV A;  1O29 A;  3GTK A;  1JVI A;  3HOU K;  3FKI C;  3I4N K;  4XSX A;  1IBA A;  2WB1 L;  3HOU C;  4YFN A;  3MML B;  4XSZ A;  3I4N C;  1EK8 A;  3GSI A;  3BP3 A;  4DDQ A;  3SZY A;  3M4O K;  2E2I K;  3NUH A;  4GTL A;  1F9N A;  3M4O C;  2JA6 A;  2E2I C;  4A3M K;  1O2A A;  4YG2 A;  4KC6 A;  4A3M C;  5C3E K;  1EI6 A;  3TTG A;  1R9T A;  1O2F B;  5C4J K;  5C3E C;  1C0A A;  5C4J C;  1TWH A;  3AH5 A;  1YCL A;  1UV7 A;  1J6W A;  4A3L K;  3GTP A;  1I50 A;  2PPB A;  1YNJ A;  1X31 C;  1Y1V K;  3WOD A;  5FJ8 K;  4A3L C;  4BLA A;  1XZQ B;  4LK0 A;  1Y1V C;  3LPX A;  1SMY A;  2V6S A;  4P5A A;  4BBR K;  4GT9 A;  4BBR C;  2BE5 A;  2E2H A;  4LJZ A;  1WOR A;  3HKZ L;  2E2I A;  3S16 K;  5TMF A;  4Q4Z A;  3S16 C;  3CQZ K;  2JA8 K;  3GIR A;  1WQH A;  2JA5 K;  1VRQ C;  3CQZ C;  2JA8 C;  2JA5 C;  1WIH A;  2A6H A;  1SFO A;  5E68 A;  5D4D A;  5FLM K;  2JA7 K;  2O5I A;  1I3Q A;  4G7H A;  2Y3P A;  5FLM C;  4A3J K;  2JA7 C;  2R93 A;  5HL8 A;  5JFE A;  2R7Z A;  4C2M K;  4BY1 K;  4A3J C;  2A68 A;  1J6X A;  4AYB L;  4C2M C;  4C3J K;  5IOR A;  4BY1 C;  4BLB A;  5IOT A;  4C3J C;  3GTG K;  4RMF A;  4JK1 A;  3GEE A;  3HXA A;  2NVY K;  1O28 A;  3GTG C;  1HQM A;  2ZUF A;  3GTK K;  4GZY A;  2NVY C;  4G7O A;  4MQ9 A;  3GTK C;  4GTA A;  2Y0S L;  4BBS K;  3GDZ A;  1VLO A;  4G7Z A;  4BY7 K;  1DD5 A;  4BBS C;  4BY7 C;  1JOE A;  2B63 A;  3GTJ A;  4QIW D;  4GTF A;  2JA6 K;  3RZD K;  2A6E A;  1XXA A;  2JA6 C;  2CW0 A;  2ZFZ A;  4WIL A;  1BS2 A;  3RZD C;  1R9T K;  4MEY A;  1XZQ A;  1R9T C;  4Q5S A;  4A3I K;  1TWH K;  3S0X A;  4MEX A;  1I50 K;  3T00 A;  4A3I C;  1TWH C;  3GEH A;  1IS1 A;  4KM8 A;  4LLG A;  1O24 A;  1YX2 A;  1I50 C;  4A3E K;  2NVY A;  1AB4 A;  4KAS A;  3ORE A;  2GSN A;  4A3E C;  2RH6 A;  2E2J K;  1ZBS A;  1DCO A;  1VGX A;  4GFQ A;  1PJ5 A;  2E2J C;  3GTO A;  1TWG K;  4KAT A;  4OIQ A;  2E2H K;  5CHP A;  4C45 A;  1TWG C;  1J98 A;  3CAG A;  4AH6 A;  4KN7 A;  2E2H C;  1ZVU A;  1EH1 A;  3L4J A;  2R92 K;  4YFK A;  1KQ4 A;  2R92 C;  2XCO A;  3LAP A;  1IQ0 A;  3L4K A;  3SZZ A;  5IP9 K;  5M3F K;  3IPJ A;  4A3K K;  2JH3 A;  5EGE A;  1B4A A;  3HOV K;  5IP9 C;  4A3K C;  3FOF A;  1SFO K;  1F7V A;  1BGW A;  4G0U A;  3HOV C;  1SFO C;  1ZXO A;  1I3Q K;  2R93 K;  3S1Q K;  2R7Z K;  1I3Q C;  5M5W K;  4KM9 A;  2R93 C;  1Y1W A;  4A93 C;  3S1Q C;  2R7Z C;  3A8J A;  1TWG A;  3S2D K;  3M3Y K;  5JVO A;  3S2D C;  3M3Y C;  3T01 A;  2PMZ L;  4A3D K;  2RGR A;  4A3D C;  2R92 A;  2CFA B;  4KMA A;  1F7U A;  1EFW A;  4C3I K;  4KB2 A;  3AD8 C;  2ZUE A;  4C3I C;  1V5V A;  4KAR A;  3LAJ A;  3EQL A;  1WOS A;  4Y52 K;  2B63 K;  1BJT A;  3GTJ K;  4Y52 C;  3TFH A;  2B63 C;  3N3Y A;  5CJ9 A;  3GTJ C;  4OIR A;  2PMZ D;  1USO A;  3OPF A;  1K83 A;  4A3B K;  2GAH C;  3HOY K;  2YU9 A;  4A3B C;  4ZH4 A;  2WAQ L;  3HOY C;  1O26 A;  2A69 A;  2FQT A;  4QIW L;  5C4X K;  1WOP A;  4BKW A;  1IL2 A;  3OEP A;  5C4X C;  2EBB A;  3GEI A;  1TWA A;  4XCH A;  4KAW X;  4LQY A;  1VJE A;  3GTO K;  1PJ7 A;  5C44 K;  3GTO C;  4A3C K;  1USM A;  1O25 A;  2WAQ D;  3ADA C;  5C44 C;  2NVX K;  4A3C C;  5TMC A;  4OIN A;  5IYC K;  2NVX C;  2D6F C;  5IYC C;  3FHZ A;  4WJ4 A;  5IYD K;  1XZP A;  2VUM A;  4YFX A;  2XCR B;  5IYD C;  4KN4 A;  3TFJ A; 
#chains in the Genus database with same CATH homology
 3GTL C;  4BBR C;  2BE5 A;  4KMU A;  4LJZ A;  4Y7N K;  2NVT K;  2R92 K;  4YFK A;  3HKZ L;  3RZO K;  1I6H K;  3S16 K;  4Y7N C;  2NVT C;  2R92 C;  3PO2 K;  5TMF A;  4Q4Z A;  5IP9 K;  5M3F K;  4A3K K;  3RZO C;  3S16 C;  1I6H C;  3K7A K;  3PO2 C;  3CQZ K;  3HOV K;  5IP9 C;  4A3K C;  2JA8 K;  1SFO K;  2JA5 K;  3HOW K;  3K7A C;  1Y1W K;  3HOZ K;  1BDF A;  3CQZ C;  3HOV C;  2JA8 C;  3GTM K;  1SFO C;  2JA5 C;  3HOW C;  1Y1W C;  3H3V L;  3HOZ C;  1YNN A;  1I3Q K;  4LK1 A;  1WCM K;  3GTM C;  2R93 K;  2A6H A;  3S1Q K;  2R7Z K;  4OIP A;  1I3Q C;  1WCM C;  5M5W K;  4A3F K;  2R93 C;  4A93 C;  3S1Q C;  2R7Z C;  5D4D A;  3I4M K;  5FLM K;  2JA7 K;  4A3F C;  4AYB D;  3S2D K;  2O5I A;  3M3Y K;  4G7H A;  3I4M C;  1TWF K;  5FLM C;  4A3J K;  2JA7 C;  1TWC K;  3S2D C;  3M3Y C;  4C2M K;  2PA8 D;  4BY1 K;  1TWF C;  4A3J C;  2O5J A;  3S15 K;  3H0G K;  2A68 A;  4AYB L;  1TWC C;  2PMZ L;  1ZYR A;  4A3D K;  4C3J K;  3H3V D;  4BY1 C;  3S15 C;  3H0G C;  3S17 K;  4X6A K;  4A3D C;  4Y52 K;  2PA8 L;  1I6V A;  4C3I K;  5M5Y K;  3GTG K;  3S17 C;  4X6A C;  5IYB K;  4JK1 A;  4XLN A;  2Y0S D;  2NVY K;  3GTG C;  3S1N K;  5IYB C;  1HQM A;  3PO3 K;  3EQL A;  3GTK K;  1K83 K;  1IW7 A;  4OIO A;  2B63 K;  2NVY C;  3GTP K;  4A93 K;  4G7O A;  4GZY A;  3DXJ A;  5M3M K;  3GTJ K;  3GTQ K;  3S1N C;  4MQ9 A;  3PO3 C;  4Y52 C;  1K83 C;  3S1R K;  3GTK C;  2Y0S L;  2YU9 K;  2B63 C;  5M5X K;  2WB1 D;  4NOI A;  3GTJ C;  4G7Z A;  4OIR A;  3GTP C;  3GTQ C;  4BBS K;  2PMZ D;  4BY7 K;  3FKI K;  3S1R C;  2YU9 C;  4BBS C;  4QJV A;  4BY7 C;  3HOX K;  3HOU K;  3FKI C;  3I4N K;  4XSX A;  4A3B K;  4QIW D;  2WB1 L;  3HOY K;  2JA6 K;  3RZD K;  3HOX C;  3HOU C;  2A6E A;  4YFN A;  3I4N C;  4XSZ A;  4A3B C;  4ZH4 A;  1XPP A;  1TWA K;  2WAQ L;  3HOY C;  2JA6 C;  2CW0 A;  3RZD C;  2A69 A;  1R9T K;  3M4O K;  1TWA C;  4MEY A;  2E2I K;  4QIW L;  5C4X K;  1R9T C;  3M4O C;  2E2I C;  4Q5S A;  4A3I K;  4A3M K;  1TWH K;  5C4X C;  4YG2 A;  3S14 K;  4C3H K;  4MEX A;  1I50 K;  4A3I C;  4QJV B;  1TWH C;  5C3E K;  4A3M C;  3S14 C;  4A3G K;  4LLG A;  3GTO K;  5C4J K;  4A3E K;  1I50 C;  5C3E C;  5C44 K;  4A3G C;  3GTO C;  5C4J C;  4A3C K;  4A3E C;  2WAQ D;  5IP7 K;  4XLP A;  2E2J K;  2VUM K;  4A3L K;  5C44 C;  2NVX K;  2PPB A;  2NVQ K;  1YNJ A;  3S1M K;  4BXX K;  4A3C C;  5TMC A;  5IP7 C;  4OIN A;  1Y1V K;  3WOD A;  5FJ8 K;  2E2J C;  5IYC K;  2VUM C;  4A3L C;  1TWG K;  2NVX C;  2NVQ C;  3S1M C;  4BXX C;  4OIQ A;  4LK0 A;  2E2H K;  1Y1V C;  5IYC C;  1TWG C;  5IYD K;  1SMY A;  4KN7 A;  2E2H C;  4YFX A;  3S2H K;  3GTL K;  3HKZ D;  4BBR K;  5IYD C;  4KN4 A;  3S2H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...