2NVXK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvxK00
3K7AK 4BXXK 4OIOA 2O5IA 5M5XK 1YNJA 1I6HK 4BY7C 3HOVC 3FKIK 5M5WK 3HKZD 2VUMK 3PO2K 4QJVB 3H0GK 5IYCC 4BY1K 3S1QK 2R92C 5IP9C 2WB1L 3HOVK 4A3DC 4BY7K 5M3FK 3GTPC 1I50C 2JA6C 5IYCK 1Y1VC 2PA8D 2R92K 2NVYK 4A3IC 3HOUK 5IP9K 4X6AC 4A3DK 4YFKA 3GTLC 4A3FC 1TWFC 5TMCA 5D4DA 3GTPK 1I50K 2A68A 4YFNA 2JA6K 3HOWC 1Y1WC 1Y1VK 3M4OC 4X6AK 4A3IK 5FLMC 4A3JK 3GTLK 2A6EA 4A3FK 4MEXA 3DXJA 5IP7C 3GTQC 3EQLA 1R9TC 1Y1WK 3I4MC 1ZYRA 3M4OK 5FLMK 4Y52C 2R7ZC 5IP7K 3CQZC 4YFXA 1TWAC 1TWGC 1R9TK 5C44C 2Y0SL 3I4MK 3H3VL 4MEYA 2WB1D 4Y52K 4LLGA 4OIPA 3HOZC 4YG2A 2E2HC 2R7ZK 3CQZK 1TWAK 1TWGK 4Y7NC 5C44K 3S1RC 2E2IC 4C3JK 4AYBD 2JA5C 2WAQL 2PPBA 3PO3C 4NOIA 2NVTC 5C3EC 1WCMC 2E2HK 3GTGC 3HOZK 1SFOC 1I3QC 4ZH4A 4Y7NK 3S1RK 2E2IK 3PO3K 2JA5K 3S2DC 2PMZL 4XLPA 5C3EK 1WCMK 1K83C 2B63C 3GTGK 1SFOK 5M3MK 1I3QK 4MQ9A 5TMFA 1TWFK 4JK1A 2E2JC 3HOWK 4XSXA 1K83K 3WODA 4G7HA 2B63K 4OINA 2Y0SD 3S17C 2NVQC 3GTQK 3RZDC 2E2JK 3HKZL 1TWHC 2O5JA 3HOYC 3GTMC 4A3BC 4LK0A 4BBRC 5C4XC 3S17K 2NVQK 2WAQD 2R93C 3RZDK 1TWHK 3GTOC 3GTMK 3HOYK 4A3BK 4Q5SA 2PA8L 4BBRK 5C4XK 2BE5A 4A3KC 3GTKC 5IYDC 4C2MK 4KN7A 3RZOC 1XPPA 4A3GC 2R93K 1YNNA 4A3EC 3GTOK 3S16C 4BBSC 4KN4A 1SMYA 4A3CC 4A3KK 2NVTK 3GTKK 3S2HC 3S15C 4A3GK 1BDFA 4QIWL 4OIQA 4A3EK 3S16K 4BY1C 3S1QC 2NVXC 4KMUA 4A3MC 4A3CK 3S2DK 1I6VA 4BBSK 2JA8C 3S2HK 3S15K 3S14C 2CW0A 1HQMA 3H3VD 2A6HA 4GZYA 3HOXC 2NVXK 4A3MK 2NVYC 3HOUC 2JA7C 3I4NC 2JA8K 5IYBC 4Q4ZA 4QJVA 3GTJC 3S14K 2YU9C 4G7OA 3HOXK 4LJZA 1IW7A 2A69A 4XLNA 3S1NC 4A3JC 2JA7K 3I4NK 1TWCC 4AYBL 4A3LC 4OIRA 3M3YC 5IYBK 3GTJK 2YU9K 3S1MC 4XSZA 4LK1A 5C4JC 4A93C 2PMZD 3S1NK 1TWCK 4G7ZA 4A3LK 4QIWD 3M3YK 3K7AC 4BXXC 4C3HK 1I6HC 3S1MK 5FJ8K 5IYDK 5C4JK 3FKIC 2VUMC 3RZOK 4A93K 3PO2C 4C3IK 3H0GC 5M5YK
chains in the Genus database with same CATH superfamily
4BXXK 5M5XK 3FKIK 5M5WK 1VLOA 3PO2K 4QJVB 3FOFA 4KM8A 3FKIA 2JH3A 2WB1L 5IP9C 4BY7K 5M3FK 3GTPC 4XCHA 4GTAA 3CAGA 1XZQB 5IYCK 3IPJA 2R92K 4X6AC 2R92A 2A68A 1YCLA 4YFNA 2JA6K 4GTDA 3M4OC 4A3IK 4A3JK 2JA6A 2A6EA 5IP7C 2XCOA 3FOEA 1R9TC 4BKWA 1WQGA 1F93A 2GSUA 3V4GA 3TFHA 5C44C 1VJEA 2R7ZK 1JOEA 3CQZK 2R7ZA 1O25A 3CQZA 2WAQL 2PPBA 2NVTC 3HOZK 1USMA 3PO3K 5IOQA 3S2DC 2D6FC 1IE0A 2PMZL 4XLPA 1WCMK 1K83C 3GTGK 1I3QK 4KAWX 3GTGA 1WCMA 1TWFK 4LR2A 4G0UA 1I3QA 1TWFA 2B63K 4G7HA 4WILA 1IQ0A 1ZBSA 2NVQC 2B63A 3GTQK 2E2JK 4O2DA 3GTMC 3GTQA 3OREA 4LK0A 3FHZA 3AQOA 4Q5SA 4AH6A 4GTCA 1DD5A 4A3EC 3VA7A 4BBSC 1SMYA 2ZFZA 1XXCA 1ZXOA 1VH2A 5EGEA 4A3CK 3MMLB 3GEEA 3S2HK 2CFAA 3S14C 2A6HA 1F7UA 2NVXK 1O28A 2FQTA 2NVXA 1PJ7A 4GTEA 4G7OA 3HOXK 4LJZA 1IW7A 5JFEA 2V6TA 3S1NC 1ZVUA 4A3JC 2PHCB 4OIRA 3M3YC 5IYBK 4A3LC 3LPXA 1J6XA 4XSZA 1YX2A 2PMZD 1TWCK 3K7AC 5EGHA 3OEPA 3T00A 1XZPA 1TWCA 5FJ8K 1BS2A 2P5MA 1RU0A 4C3IK 3H0GC 5M5YK 4OIOA 2VUMK 2VUMA 4KMDA 2V6UA 3HOVK 1INNA 4A3DK 4KASA 3GIRA 3GTLC 4A3FC 1TWFC 4KARA 5TMCA 1I50K 1Y1VK 4KMHA 5FLMC 1Y1VA 3GTQC 3AD8C 1Y1WK 3I4MC 1ZYRA 1Y1WA 3N0BA 4YFXA 1TWGC 3H3VL 4C3JC 4Y52K 4LLGA 5L46A 2E2HC 2ZUEA 1TWAK 4Y7NC 3S1RC 1TWAA 1X31C 1G51A 4NOIA 3HXAA 5C3EC 1SFOC 4DDQA 2E2IK 2JA5K 2E2IA 1HI9A 2JA5A 4J3NA 3HOWK 4XSXA 3WODA 3HKZL 1TWHC 3HOYC 2P8TA 5C4XC 3S17K 3ERED 4C2MC 3RZDK 3AQPA 4KDDA 4KM9A 3GTOC 2V6SA 4GFQA 4A3BK 3AD7C 3L4JA 4BBRK 3GTKC 1L0WA 3G4AA 4A3GC 2R93K 1WORA 1YNNA 1O2FB 2R93A 3G4CA 4A3KK 3S15C 4KC6A 5HL8A 3S16K 5TJ3A 3BP3A 4KMUA 1I6VA 2JA8C 2CW0A 3BP8C 1O2AA 3H3VD 4P5AA 2XCRB 4A3MK 3GTJC 2Y3PA 3T02A 2YU9C 2A69A 4KB4A 2JA7K 3I4NK 4C3HC 4BLBA 2JA7A 3N0CA 4LK1A 5C4JC 3S0XA 4A93C 4QIWD 4BXXC 4G0WA 3S1MK 1BGWA 3SZZA 3FKIC 3RZOK 2CFAB 3PO2C 2O5IA 1F9NA 1I6HK 4BY7C 3HKZD 2GSOA 2FQOA 3NUHA 5IYCC 4BY1K 2R92C 4WJ3M 4GTBA 5IORA 4FM9A 2W7VA 2JA6C 3HOUK 4A3IC 1WIHA 5IP9K 1KQ4A 3TFIA 4YFKA 1XXAA 5D4DA 3GTPK 5E68A 1ISEA 3HOWC 1XZPB 4X6AK 3GTPA 1O27A 4MEXA 3DXJA 3EQLA 1USOA 3M4OK 2RH6A 2R7ZC 5IP7K 1WOPA 3CQZC 1R9TK 3L4KA 4MEYA 1EFWA 1R9TA 3OPFA 4ILDA 4YG2A 3HOZC 4C45A 5C44K 3PO3C 3GTGC 1WCMC 4KATA 1I3QC 4ZH4A 2B63C 1I50A 5M3MK 2E2JC 1K83K 2Y0SD 2GAHC 1PJ5A 1K83A 3QX3A 2O5JA 2NVQK 1J98A 4G0VA 1VRQC 5IOTA 3GTMK 3LAPA 2PA8L 3A8JA 3RZOC 4KN7A 1UV7A 1XPPA 4A3CC 2RGRA 1WOSA 3S2HC 1BDFA 4QIWL 5CHPA 4A3EK 4GTLA 1GE9A 4BY1C 2NVXC 4BBSK 1WQFA 1IS1A 3AD9C 4LOWA 1HQMA 3HOXC 3HOUC 5JVOA 5IYBC 3S14K 4QJVA 1EQRA 3GSIA 4XLNA 1TWCC 4AYBL 1J6VA 1XZQA 1WSVA 3S1NK 4C3IC 4G7ZA 4A3LK 3M3YK 5IYDK 2VUMC 4FZBA 1EK8A 2XCQA 1JVIA 3K7AK 1B4BA 1YNJA 3HOVC 1ZQ1C 3AH5A 3H0GK 3S1QK 1DCPA 1O26A 4A3DC 3H0GA 4GTFA 2GAGC 4BLAA 2KWAA 1I50C 1IL2A 1Y1VC 2PA8D 2NVYK 3Q3QA 4KB2A 2NVYA 1Y1WC 3GEHA 3ADAC 2ZUFA 3GTLK 4A3FK 3GTLA 1JQWA 5FLMK 4Y52C 1TWAC 1DCOA 2Y0SL 3I4MK 4P5BA 2WB1D 1VGXA 4OIPA 4PABA 1TWGK 5IOSA 2E2IC 4C3JK 2EBBA 3A8IA 1TWGA 4AYBD 2JA5C 2E2HK 1J6WA 3TFJA 4Y7NK 3S1RK 3TTGA 2E2HA 1EI6A 1O29A 5C3EK 1C0AA 1SFOK 4MQ9A 5TMFA 1AB4A 1SFOA 4JK1A 1XXBA 4OINA 1BJTA 3S17C 3LAJA 3RZDC 2GSNA 4A3BC 4BBRC 1DCHA 2WAQD 2R93C 1TWHK 1PJ6A 3HOYK 1TWHA 1O2BA 5C4XK 4A3KC 2BE5A 4KMAA 5CJ9A 5IYDC 4C2MK 4P9SA 3JSTA 3GTOK 3S16C 1WSRA 4KN4A 3N3YA 2NVTK 3GTOA 3GTKK 1WOOA 4A3GK 4OIQA 3SZYA 3GTKA 3S1QC 4WJ4A 4A3MC 3S2DK 1B4AA 3GDZA 4LQYA 3S15K 3BUEA 1V5VA 1F7VA 3A8KA 4GZYA 2NVYC 2JA7C 3I4NC 2JA8K 4Q4ZA 3GEIA 4PAAA 1WQHA 4GT9A 3GTJK 1IBAA 2YU9K 3S1MC 3GTMA 3GTJA 1EH1A 2YU9A 4M1XA 4RMFA 4C3HK 1I6HC 5C4JK 4A93K 3T01A 1O24A
chains in the Genus database with same CATH topology
3K7AK 4BXXK 4OIOA 2O5IA 5M5XK 1YNJA 1I6HK 4BY7C 3HOVC 3FKIK 5M5WK 3HKZD 2VUMK 3PO2K 4QJVB 3H0GK 5IYCC 4BY1K 3S1QK 2R92C 5IP9C 2WB1L 3HOVK 4A3DC 4BY7K 5M3FK 3GTPC 1I50C 2JA6C 5IYCK 1Y1VC 2PA8D 2R92K 2NVYK 4A3IC 3HOUK 5IP9K 4X6AC 4A3DK 4YFKA 3GTLC 4A3FC 1TWFC 5TMCA 5D4DA 3GTPK 1I50K 2A68A 4YFNA 2JA6K 3HOWC 1Y1WC 1Y1VK 3M4OC 4X6AK 4A3IK 5FLMC 4A3JK 3GTLK 2A6EA 4A3FK 4MEXA 3DXJA 5IP7C 3GTQC 3EQLA 1R9TC 1Y1WK 3I4MC 1ZYRA 3M4OK 5FLMK 4Y52C 2R7ZC 5IP7K 3CQZC 4YFXA 1TWAC 1TWGC 1R9TK 5C44C 2Y0SL 3I4MK 3H3VL 4MEYA 2WB1D 4Y52K 4LLGA 4OIPA 3HOZC 4YG2A 2E2HC 2R7ZK 3CQZK 1TWAK 1TWGK 4Y7NC 5C44K 3S1RC 2E2IC 4C3JK 4AYBD 2JA5C 2WAQL 2PPBA 3PO3C 4NOIA 2NVTC 5C3EC 1WCMC 2E2HK 3GTGC 3HOZK 1SFOC 1I3QC 4ZH4A 4Y7NK 3S1RK 2E2IK 3PO3K 2JA5K 3S2DC 2PMZL 4XLPA 5C3EK 1WCMK 1K83C 2B63C 3GTGK 1SFOK 5M3MK 1I3QK 4MQ9A 5TMFA 1TWFK 4JK1A 2E2JC 3HOWK 4XSXA 1K83K 3WODA 4G7HA 2B63K 4OINA 2Y0SD 3S17C 2NVQC 3GTQK 3RZDC 2E2JK 3HKZL 1TWHC 2O5JA 3HOYC 3GTMC 4A3BC 4LK0A 4BBRC 5C4XC 3S17K 2NVQK 2WAQD 2R93C 3RZDK 1TWHK 3GTOC 3GTMK 3HOYK 4A3BK 4Q5SA 2PA8L 4BBRK 5C4XK 2BE5A 4A3KC 3GTKC 5IYDC 4C2MK 4KN7A 3RZOC 1XPPA 4A3GC 2R93K 1YNNA 4A3EC 3GTOK 3S16C 4BBSC 4KN4A 1SMYA 4A3CC 4A3KK 2NVTK 3GTKK 3S2HC 3S15C 4A3GK 1BDFA 4QIWL 4OIQA 4A3EK 3S16K 4BY1C 3S1QC 2NVXC 4KMUA 4A3MC 4A3CK 3S2DK 1I6VA 4BBSK 2JA8C 3S2HK 3S15K 3S14C 2CW0A 1HQMA 3H3VD 2A6HA 4GZYA 3HOXC 2NVXK 4A3MK 2NVYC 3HOUC 2JA7C 3I4NC 2JA8K 5IYBC 4Q4ZA 4QJVA 3GTJC 3S14K 2YU9C 4G7OA 3HOXK 4LJZA 1IW7A 2A69A 4XLNA 3S1NC 4A3JC 2JA7K 3I4NK 1TWCC 4AYBL 4A3LC 4OIRA 3M3YC 5IYBK 3GTJK 2YU9K 3S1MC 4XSZA 4LK1A 5C4JC 4A93C 2PMZD 3S1NK 1TWCK 4G7ZA 4A3LK 4QIWD 3M3YK 3K7AC 4BXXC 4C3HK 1I6HC 3S1MK 5FJ8K 5IYDK 5C4JK 3FKIC 2VUMC 3RZOK 4A93K 3PO2C 4C3IK 3H0GC 5M5YK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A K;  4BXX K;  4OIO A;  2O5I A;  5M5X K;  1YNJ A;  1I6H K;  4BY7 C;  3HOV C;  3FKI K;  5M5W K;  3HKZ D;  2VUM K;  3PO2 K;  4QJV B;  3H0G K;  5IYC C;  4BY1 K;  3S1Q K;  2R92 C;  5IP9 C;  2WB1 L;  3HOV K;  4A3D C;  4BY7 K;  5M3F K;  3GTP C;  1I50 C;  2JA6 C;  5IYC K;  1Y1V C;  2PA8 D;  2R92 K;  2NVY K;  4A3I C;  3HOU K;  5IP9 K;  4X6A C;  4A3D K;  4YFK A;  3GTL C;  4A3F C;  1TWF C;  5TMC A;  5D4D A;  3GTP K;  1I50 K;  2A68 A;  4YFN A;  2JA6 K;  3HOW C;  1Y1W C;  1Y1V K;  3M4O C;  4X6A K;  4A3I K;  5FLM C;  4A3J K;  3GTL K;  2A6E A;  4A3F K;  4MEX A;  3DXJ A;  5IP7 C;  3GTQ C;  3EQL A;  1R9T C;  1Y1W K;  3I4M C;  1ZYR A;  3M4O K;  5FLM K;  4Y52 C;  2R7Z C;  5IP7 K;  3CQZ C;  4YFX A;  1TWA C;  1TWG C;  1R9T K;  5C44 C;  2Y0S L;  3I4M K;  3H3V L;  4MEY A;  2WB1 D;  4Y52 K;  4LLG A;  4OIP A;  3HOZ C;  4YG2 A;  2E2H C;  2R7Z K;  3CQZ K;  1TWA K;  1TWG K;  4Y7N C;  5C44 K;  3S1R C;  2E2I C;  4C3J K;  4AYB D;  2JA5 C;  2WAQ L;  2PPB A;  3PO3 C;  4NOI A;  2NVT C;  5C3E C;  1WCM C;  2E2H K;  3GTG C;  3HOZ K;  1SFO C;  1I3Q C;  4ZH4 A;  4Y7N K;  3S1R K;  2E2I K;  3PO3 K;  2JA5 K;  3S2D C;  2PMZ L;  4XLP A;  5C3E K;  1WCM K;  1K83 C;  2B63 C;  3GTG K;  1SFO K;  5M3M K;  1I3Q K;  4MQ9 A;  5TMF A;  1TWF K;  4JK1 A;  2E2J C;  3HOW K;  4XSX A;  1K83 K;  3WOD A;  4G7H A;  2B63 K;  4OIN A;  2Y0S D;  3S17 C;  2NVQ C;  3GTQ K;  3RZD C;  2E2J K;  3HKZ L;  1TWH C;  2O5J A;  3HOY C;  3GTM C;  4A3B C;  4LK0 A;  4BBR C;  5C4X C;  3S17 K;  2NVQ K;  2WAQ D;  2R93 C;  3RZD K;  1TWH K;  3GTO C;  3GTM K;  3HOY K;  4A3B K;  4Q5S A;  2PA8 L;  4BBR K;  5C4X K;  2BE5 A;  4A3K C;  3GTK C;  5IYD C;  4C2M K;  4KN7 A;  3RZO C;  1XPP A;  4A3G C;  2R93 K;  1YNN A;  4A3E C;  3GTO K;  3S16 C;  4BBS C;  4KN4 A;  1SMY A;  4A3C C;  4A3K K;  2NVT K;  3GTK K;  3S2H C;  3S15 C;  4A3G K;  1BDF A;  4QIW L;  4OIQ A;  4A3E K;  3S16 K;  4BY1 C;  3S1Q C;  2NVX C;  4KMU A;  4A3M C;  4A3C K;  3S2D K;  1I6V A;  4BBS K;  2JA8 C;  3S2H K;  3S15 K;  3S14 C;  2CW0 A;  1HQM A;  3H3V D;  2A6H A;  4GZY A;  3HOX C;  2NVX K;  4A3M K;  2NVY C;  3HOU C;  2JA7 C;  3I4N C;  2JA8 K;  5IYB C;  4Q4Z A;  4QJV A;  3GTJ C;  3S14 K;  2YU9 C;  4G7O A;  3HOX K;  4LJZ A;  1IW7 A;  2A69 A;  4XLN A;  3S1N C;  4A3J C;  2JA7 K;  3I4N K;  1TWC C;  4AYB L;  4A3L C;  4OIR A;  3M3Y C;  5IYB K;  3GTJ K;  2YU9 K;  3S1M C;  4XSZ A;  4LK1 A;  5C4J C;  4A93 C;  2PMZ D;  3S1N K;  1TWC K;  4G7Z A;  4A3L K;  4QIW D;  3M3Y K;  3K7A C;  4BXX C;  4C3H K;  1I6H C;  3S1M K;  5FJ8 K;  5IYD K;  5C4J K;  3FKI C;  2VUM C;  3RZO K;  4A93 K;  3PO2 C;  4C3I K;  3H0G C;  5M5Y K; 
#chains in the Genus database with same CATH topology
 4BXX K;  5M5X K;  3FKI K;  5M5W K;  1VLO A;  3PO2 K;  4QJV B;  3FOF A;  4KM8 A;  3FKI A;  2JH3 A;  2WB1 L;  5IP9 C;  4BY7 K;  5M3F K;  3GTP C;  4XCH A;  4GTA A;  3CAG A;  1XZQ B;  5IYC K;  3IPJ A;  2R92 K;  4X6A C;  2R92 A;  2A68 A;  1YCL A;  4YFN A;  2JA6 K;  4GTD A;  3M4O C;  4A3I K;  4A3J K;  2JA6 A;  2A6E A;  5IP7 C;  2XCO A;  3FOE A;  1R9T C;  4BKW A;  1WQG A;  1F93 A;  2GSU A;  3V4G A;  3TFH A;  5C44 C;  1VJE A;  2R7Z K;  1JOE A;  3CQZ K;  2R7Z A;  1O25 A;  3CQZ A;  2WAQ L;  2PPB A;  2NVT C;  3HOZ K;  1USM A;  3PO3 K;  5IOQ A;  3S2D C;  2D6F C;  1IE0 A;  2PMZ L;  4XLP A;  1WCM K;  1K83 C;  3GTG K;  1I3Q K;  4KAW X;  3GTG A;  1WCM A;  1TWF K;  4LR2 A;  4G0U A;  1I3Q A;  1TWF A;  2B63 K;  4G7H A;  4WIL A;  1IQ0 A;  1ZBS A;  2NVQ C;  2B63 A;  3GTQ K;  2E2J K;  4O2D A;  3GTM C;  3GTQ A;  3ORE A;  4LK0 A;  3FHZ A;  3AQO A;  4Q5S A;  4AH6 A;  4GTC A;  1DD5 A;  4A3E C;  3VA7 A;  4BBS C;  1SMY A;  2ZFZ A;  1XXC A;  1ZXO A;  1VH2 A;  5EGE A;  4A3C K;  3MML B;  3GEE A;  3S2H K;  2CFA A;  3S14 C;  2A6H A;  1F7U A;  2NVX K;  1O28 A;  2FQT A;  2NVX A;  1PJ7 A;  4GTE A;  4G7O A;  3HOX K;  4LJZ A;  1IW7 A;  5JFE A;  2V6T A;  3S1N C;  1ZVU A;  4A3J C;  2PHC B;  4OIR A;  3M3Y C;  5IYB K;  4A3L C;  3LPX A;  1J6X A;  4XSZ A;  1YX2 A;  2PMZ D;  1TWC K;  3K7A C;  5EGH A;  3OEP A;  3T00 A;  1XZP A;  1TWC A;  5FJ8 K;  1BS2 A;  2P5M A;  1RU0 A;  4C3I K;  3H0G C;  5M5Y K;  4OIO A;  2VUM K;  2VUM A;  4KMD A;  2V6U A;  3HOV K;  1INN A;  4A3D K;  4KAS A;  3GIR A;  3GTL C;  4A3F C;  1TWF C;  4KAR A;  5TMC A;  1I50 K;  1Y1V K;  4KMH A;  5FLM C;  1Y1V A;  3GTQ C;  3AD8 C;  1Y1W K;  3I4M C;  1ZYR A;  1Y1W A;  3N0B A;  4YFX A;  1TWG C;  3H3V L;  4C3J C;  4Y52 K;  4LLG A;  5L46 A;  2E2H C;  2ZUE A;  1TWA K;  4Y7N C;  3S1R C;  1TWA A;  1X31 C;  1G51 A;  4NOI A;  3HXA A;  5C3E C;  1SFO C;  4DDQ A;  2E2I K;  2JA5 K;  2E2I A;  1HI9 A;  2JA5 A;  4J3N A;  3HOW K;  4XSX A;  3WOD A;  3HKZ L;  1TWH C;  3HOY C;  2P8T A;  5C4X C;  3S17 K;  3ERE D;  4C2M C;  3RZD K;  3AQP A;  4KDD A;  4KM9 A;  3GTO C;  2V6S A;  4GFQ A;  4A3B K;  3AD7 C;  3L4J A;  4BBR K;  3GTK C;  1L0W A;  3G4A A;  4A3G C;  2R93 K;  1WOR A;  1YNN A;  1O2F B;  2R93 A;  3G4C A;  4A3K K;  3S15 C;  4KC6 A;  5HL8 A;  3S16 K;  5TJ3 A;  3BP3 A;  4KMU A;  1I6V A;  2JA8 C;  2CW0 A;  3BP8 C;  1O2A A;  3H3V D;  4P5A A;  2XCR B;  4A3M K;  3GTJ C;  2Y3P A;  3T02 A;  2YU9 C;  2A69 A;  4KB4 A;  2JA7 K;  3I4N K;  4C3H C;  4BLB A;  2JA7 A;  3N0C A;  4LK1 A;  5C4J C;  3S0X A;  4A93 C;  4QIW D;  4BXX C;  4G0W A;  3S1M K;  1BGW A;  3SZZ A;  3FKI C;  3RZO K;  2CFA B;  3PO2 C;  2O5I A;  1F9N A;  1I6H K;  4BY7 C;  3HKZ D;  2GSO A;  2FQO A;  3NUH A;  5IYC C;  4BY1 K;  2R92 C;  4WJ3 M;  4GTB A;  5IOR A;  4FM9 A;  2W7V A;  2JA6 C;  3HOU K;  4A3I C;  1WIH A;  5IP9 K;  1KQ4 A;  3TFI A;  4YFK A;  1XXA A;  5D4D A;  3GTP K;  5E68 A;  1ISE A;  3HOW C;  1XZP B;  4X6A K;  3GTP A;  1O27 A;  4MEX A;  3DXJ A;  3EQL A;  1USO A;  3M4O K;  2RH6 A;  2R7Z C;  5IP7 K;  1WOP A;  3CQZ C;  1R9T K;  3L4K A;  4MEY A;  1EFW A;  1R9T A;  3OPF A;  4ILD A;  4YG2 A;  3HOZ C;  4C45 A;  5C44 K;  3PO3 C;  3GTG C;  1WCM C;  4KAT A;  1I3Q C;  4ZH4 A;  2B63 C;  1I50 A;  5M3M K;  2E2J C;  1K83 K;  2Y0S D;  2GAH C;  1PJ5 A;  1K83 A;  3QX3 A;  2O5J A;  2NVQ K;  1J98 A;  4G0V A;  1VRQ C;  5IOT A;  3GTM K;  3LAP A;  2PA8 L;  3A8J A;  3RZO C;  4KN7 A;  1UV7 A;  1XPP A;  4A3C C;  2RGR A;  1WOS A;  3S2H C;  1BDF A;  4QIW L;  5CHP A;  4A3E K;  4GTL A;  1GE9 A;  4BY1 C;  2NVX C;  4BBS K;  1WQF A;  1IS1 A;  3AD9 C;  4LOW A;  1HQM A;  3HOX C;  3HOU C;  5JVO A;  5IYB C;  3S14 K;  4QJV A;  1EQR A;  3GSI A;  4XLN A;  1TWC C;  4AYB L;  1J6V A;  1XZQ A;  1WSV A;  3S1N K;  4C3I C;  4G7Z A;  4A3L K;  3M3Y K;  5IYD K;  2VUM C;  4FZB A;  1EK8 A;  2XCQ A;  1JVI A;  3K7A K;  1B4B A;  1YNJ A;  3HOV C;  1ZQ1 C;  3AH5 A;  3H0G K;  3S1Q K;  1DCP A;  1O26 A;  4A3D C;  3H0G A;  4GTF A;  2GAG C;  4BLA A;  2KWA A;  1I50 C;  1IL2 A;  1Y1V C;  2PA8 D;  2NVY K;  3Q3Q A;  4KB2 A;  2NVY A;  1Y1W C;  3GEH A;  3ADA C;  2ZUF A;  3GTL K;  4A3F K;  3GTL A;  1JQW A;  5FLM K;  4Y52 C;  1TWA C;  1DCO A;  2Y0S L;  3I4M K;  4P5B A;  2WB1 D;  1VGX A;  4OIP A;  4PAB A;  1TWG K;  5IOS A;  2E2I C;  4C3J K;  2EBB A;  3A8I A;  1TWG A;  4AYB D;  2JA5 C;  2E2H K;  1J6W A;  3TFJ A;  4Y7N K;  3S1R K;  3TTG A;  2E2H A;  1EI6 A;  1O29 A;  5C3E K;  1C0A A;  1SFO K;  4MQ9 A;  5TMF A;  1AB4 A;  1SFO A;  4JK1 A;  1XXB A;  4OIN A;  1BJT A;  3S17 C;  3LAJ A;  3RZD C;  2GSN A;  4A3B C;  4BBR C;  1DCH A;  2WAQ D;  2R93 C;  1TWH K;  1PJ6 A;  3HOY K;  1TWH A;  1O2B A;  5C4X K;  4A3K C;  2BE5 A;  4KMA A;  5CJ9 A;  5IYD C;  4C2M K;  4P9S A;  3JST A;  3GTO K;  3S16 C;  1WSR A;  4KN4 A;  3N3Y A;  2NVT K;  3GTO A;  3GTK K;  1WOO A;  4A3G K;  4OIQ A;  3SZY A;  3GTK A;  3S1Q C;  4WJ4 A;  4A3M C;  3S2D K;  1B4A A;  3GDZ A;  4LQY A;  3S15 K;  3BUE A;  1V5V A;  1F7V A;  3A8K A;  4GZY A;  2NVY C;  2JA7 C;  3I4N C;  2JA8 K;  4Q4Z A;  3GEI A;  4PAA A;  1WQH A;  4GT9 A;  3GTJ K;  1IBA A;  2YU9 K;  3S1M C;  3GTM A;  3GTJ A;  1EH1 A;  2YU9 A;  4M1X A;  4RMF A;  4C3H K;  1I6H C;  5C4J K;  4A93 K;  3T01 A;  1O24 A; 
#chains in the Genus database with same CATH homology
 3K7A K;  4BXX K;  4OIO A;  2O5I A;  5M5X K;  1YNJ A;  1I6H K;  4BY7 C;  3HOV C;  3FKI K;  5M5W K;  3HKZ D;  2VUM K;  3PO2 K;  4QJV B;  3H0G K;  5IYC C;  4BY1 K;  3S1Q K;  2R92 C;  5IP9 C;  2WB1 L;  3HOV K;  4A3D C;  4BY7 K;  5M3F K;  3GTP C;  1I50 C;  2JA6 C;  5IYC K;  1Y1V C;  2PA8 D;  2R92 K;  2NVY K;  4A3I C;  3HOU K;  5IP9 K;  4X6A C;  4A3D K;  4YFK A;  3GTL C;  4A3F C;  1TWF C;  5TMC A;  5D4D A;  3GTP K;  1I50 K;  2A68 A;  4YFN A;  2JA6 K;  3HOW C;  1Y1W C;  1Y1V K;  3M4O C;  4X6A K;  4A3I K;  5FLM C;  4A3J K;  3GTL K;  2A6E A;  4A3F K;  4MEX A;  3DXJ A;  5IP7 C;  3GTQ C;  3EQL A;  1R9T C;  1Y1W K;  3I4M C;  1ZYR A;  3M4O K;  5FLM K;  4Y52 C;  2R7Z C;  5IP7 K;  3CQZ C;  4YFX A;  1TWA C;  1TWG C;  1R9T K;  5C44 C;  2Y0S L;  3I4M K;  3H3V L;  4MEY A;  2WB1 D;  4Y52 K;  4LLG A;  4OIP A;  3HOZ C;  4YG2 A;  2E2H C;  2R7Z K;  3CQZ K;  1TWA K;  1TWG K;  4Y7N C;  5C44 K;  3S1R C;  2E2I C;  4C3J K;  4AYB D;  2JA5 C;  2WAQ L;  2PPB A;  3PO3 C;  4NOI A;  2NVT C;  5C3E C;  1WCM C;  2E2H K;  3GTG C;  3HOZ K;  1SFO C;  1I3Q C;  4ZH4 A;  4Y7N K;  3S1R K;  2E2I K;  3PO3 K;  2JA5 K;  3S2D C;  2PMZ L;  4XLP A;  5C3E K;  1WCM K;  1K83 C;  2B63 C;  3GTG K;  1SFO K;  5M3M K;  1I3Q K;  4MQ9 A;  5TMF A;  1TWF K;  4JK1 A;  2E2J C;  3HOW K;  4XSX A;  1K83 K;  3WOD A;  4G7H A;  2B63 K;  4OIN A;  2Y0S D;  3S17 C;  2NVQ C;  3GTQ K;  3RZD C;  2E2J K;  3HKZ L;  1TWH C;  2O5J A;  3HOY C;  3GTM C;  4A3B C;  4LK0 A;  4BBR C;  5C4X C;  3S17 K;  2NVQ K;  2WAQ D;  2R93 C;  3RZD K;  1TWH K;  3GTO C;  3GTM K;  3HOY K;  4A3B K;  4Q5S A;  2PA8 L;  4BBR K;  5C4X K;  2BE5 A;  4A3K C;  3GTK C;  5IYD C;  4C2M K;  4KN7 A;  3RZO C;  1XPP A;  4A3G C;  2R93 K;  1YNN A;  4A3E C;  3GTO K;  3S16 C;  4BBS C;  4KN4 A;  1SMY A;  4A3C C;  4A3K K;  2NVT K;  3GTK K;  3S2H C;  3S15 C;  4A3G K;  1BDF A;  4QIW L;  4OIQ A;  4A3E K;  3S16 K;  4BY1 C;  3S1Q C;  2NVX C;  4KMU A;  4A3M C;  4A3C K;  3S2D K;  1I6V A;  4BBS K;  2JA8 C;  3S2H K;  3S15 K;  3S14 C;  2CW0 A;  1HQM A;  3H3V D;  2A6H A;  4GZY A;  3HOX C;  2NVX K;  4A3M K;  2NVY C;  3HOU C;  2JA7 C;  3I4N C;  2JA8 K;  5IYB C;  4Q4Z A;  4QJV A;  3GTJ C;  3S14 K;  2YU9 C;  4G7O A;  3HOX K;  4LJZ A;  1IW7 A;  2A69 A;  4XLN A;  3S1N C;  4A3J C;  2JA7 K;  3I4N K;  1TWC C;  4AYB L;  4A3L C;  4OIR A;  3M3Y C;  5IYB K;  3GTJ K;  2YU9 K;  3S1M C;  4XSZ A;  4LK1 A;  5C4J C;  4A93 C;  2PMZ D;  3S1N K;  1TWC K;  4G7Z A;  4A3L K;  4QIW D;  3M3Y K;  3K7A C;  4BXX C;  4C3H K;  1I6H C;  3S1M K;  5FJ8 K;  5IYD K;  5C4J K;  3FKI C;  2VUM C;  3RZO K;  4A93 K;  3PO2 C;  4C3I K;  3H0G C;  5M5Y K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...