2NVXK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvxK00
3PO3C 3PO2K 3GTKK 5FLMC 1WCMC 1I6HK 5C4XK 3GTJC 3S2HK 3HOZC 1ZYRA 4LK1A 4MQ9A 4Q5SA 3CQZK 5C4XC 5TMCA 4JK1A 4BBSK 3GTLK 5C3EK 3S2HC 4C3IK 4NOIA 1TWFC 4KN4A 4C3HK 1Y1VC 4A3JK 2JA8K 3GTOK 3GTMC 4OIRA 3GTGK 4A3BK 4BXXK 5M3FK 5IYCC 3RZOK 4MEYA 4YG2A 1IW7A 3WODA 4A3KC 4A3FC 2JA8C 2O5IA 2R92K 3HOWC 2JA7K 3HOVK 3GTGC 3M4OK 4MEXA 4BXXC 4Y52K 2R93K 1TWAK 2YU9K 3S14K 4G7HA 4QJVA 3M3YK 2B63K 5IYBC 4Y7NK 3K7AK 4GZYA 4LJZA 4LK0A 3PO3K 2B63C 4ZH4A 2E2HC 5FLMK 1WCMK 3GTJK 2NVQC 4Q4ZA 2VUMC 3HOZK 5C44C 2R7ZC 4A3IC 3H0GC 2JA6C 2NVTC 3HOXC 2R93C 1TWFK 5IP9C 5M5XK 2NVXC 1TWCC 3S15C 3S1QC 1Y1VK 4BY1K 3S17C 4A3CC 5IP7C 3GTMK 3S1MC 5M5YK 5C4JC 4LLGA 5IYCK 4BY1C 4A3KK 4A3MC 3HOWK 1HQMA 4A3FK 4A3EC 4OIQA 3FKIC 3EQLA 5M5WK 4YFKA 3HKZD 4A3GC 5IYBK 3I4MC 4BBRC 2WB1D 3HOUC 2E2HK 2JA5C 3HKZL 4A3DC 2NVQK 4A93C 3RZDC 4BY7C 4QIWD 2NVYC 3S1RK 2VUMK 4XLNA 3GTPC 5C44K 3HOYC 2R7ZK 4A3IK 2WB1L 3H0GK 4OIPA 2JA6K 2NVTK 3S1RC 3HOXK 1SFOC 4C2MK 5M3MK 4XLPA 4QIWL 5IP9K 2NVXK 1TWCK 3S15K 3S1QK 2PMZD 3S17K 1BDFA 4A3CK 5IP7K 3S1MK 5C4JK 4KN7A 4A3MK 3S2DC 2PMZL 2CW0A 5IYDC 4A3EK 4AYBD 3I4NC 1Y1WC 1TWHC 1YNNA 3FKIK 1I3QC 4X6AC 1I50C 2A6HA 5FJ8K 4A3GK 2BE5A 3I4MK 2A68A 1I6VA 4AYBL 4BBRK 1TWGC 4YFNA 3HOUK 2JA5K 3S16C 4A3DK 4A93K 4BY7K 3RZDK 2E2JC 1R9TC 3HOYK 2NVYK 3GTPK 4A3LC 2O5JA 1K83C 1SFOK 2E2IC 4QJVB 3H3VD 3PO2C 2Y0SD 2PA8D 5TMFA 3GTKC 1I6HC 4OINA 4G7OA 4C3JK 2WAQD 5D4DA 3CQZC 4G7ZA 3H3VL 1SMYA 2PA8L 2Y0SL 3S2DK 4BBSC 5IYDK 4XSZA 5C3EC 1TWHK 1Y1WK 3GTLC 1I3QK 3I4NK 4X6AK 2WAQL 3GTQK 3S1NK 1I50K 4A3JC 3GTOC 1XPPA 2A6EA 4A3BC 3GTQC 3S1NC 3RZOC 1TWGK 2R92C 4KMUA 2PPBA 3S16K 3HOVC 4YFXA 2JA7C 2E2JK 4Y52C 1R9TK 3M4OC 4A3LK 2A69A 1TWAC 2YU9C 3S14C 4XSXA 1K83K 3DXJA 1YNJA 4OIOA 3M3YC 4Y7NC 3K7AC 2E2IK
chains in the Genus database with same CATH superfamily
3N0BA 3PO3C 4P9SA 3GTKK 1O24A 5C4XK 5CHPA 4Q5SA 5C4XC 3LPXA 4C3HK 1Y1VC 2JA8K 3GTOK 5HL8A 3GTMC 4KC6A 4KB4A 5IYCC 3WODA 2JA8C 1IW7A 1O29A 4MEXA 5IOSA 5IOTA 1INNA 4QJVA 3M3YK 2B63K 5IYBC 4LK0A 1TWAA 4G0WA 2B63C 1AB4A 1WCMK 1R9TA 3SZYA 2VUMC 5TJ3A 1O2BA 2E2IA 3GTJA 1XZQA 3TFIA 1X31C 5IP7C 4LLGA 1YCLA 4A3MC 3HOWK 4A3FK 4A3EC 4G0VA 3EQLA 4A3GC 4PAAA 4BBRC 2P5MA 2WB1D 3Q3QA 2NVQK 2R93A 2R7ZK 4A3IK 4FZBA 4KMDA 2E2HA 1EQRA 4C2MK 5M3MK 5IP9K 1TWCK 3H0GA 2PMZD 3S17K 1O28A 1J6XA 4LR2A 5IYDC 5CJ9A 3FKIK 1C0AA 3GTMA 3I4MK 4AYBL 1TWGC 4YFNA 2JA5K 4A93K 4BY7K 3RZDK 3GTPK 2KWAA 4LOWA 4ILDA 1SFOK 3AD9C 1I6HC 3BP8C 4J3NA 2WAQD 2V6TA 3H3VL 1SMYA 4BBSC 4KASA 4X6AK 3CAGA 1TWHA 1I3QA 2RGRA 1WORA 4GTAA 1I50A 2PPBA 3S16K 3M4OC 4YFXA 3T02A 1R9TK 1WSVA 1TWAC 2A69A 3S14C 3OREA 3K7AC 1VRQC 2E2IK 4DDQA 1WIHA 1F7VA 4KARA 5FLMC 4AH6A 3GTJC 3S2HK 3HOZC 1ZYRA 3CQZK 3MMLB 5TMCA 1PJ5A 3GTLK 5C3EK 3S2HC 3N3YA 3OEPA 1TWFC 3AD7C 4A3JK 2EBBA 4KB2A 4OIRA 4A3BK 4MEYA 4YG2A 4A3KC 2R92K 1VLOA 2O5IA 1USOA 4Y52K 2R93K 2YU9K 4G7HA 4WJ4A 2JA7A 3PO3K 4ZH4A 2E2HC 1BS2A 1IQ0A 4Q4ZA 1EI6A 3OPFA 5C44C 3LAJA 3V4GA 1VH2A 3H0GC 2XCRB 2NVTC 3HOXC 5M5XK 1Y1VK 4BY1K 1JQWA 3GEHA 4A3CC 2FQTA 3GTMK 4GTFA 1IBAA 5IYCK 4BY1C 4WJ3M 5JFEA 5E68A 5M5WK 2JH3A 5IYBK 3GTGA 4P5BA 3LAPA 4A3DC 2VUMK 3HOYC 3S1RK 2WB1L 1G51A 4OIPA 3S1RC 3NUHA 1BDFA 4C45A 2JA6A 5IP7K 2NVXA 4KN7A 4A3MK 2PMZL 4A3EK 4GTDA 1TWFA 1TWHC 3I4NC 1I3QC 5EGEA 1I50C 2A6HA 4A3GK 1PJ6A 1J98A 4BBRK 2E2JC 1J6WA 5L46A 1F9NA 2NVYA 1IE0A 1F93A 1USMA 3ADAC 4KM9A 3PO2C 5TMFA 1ZQ1C 1EFWA 4C3JK 1O26A 4RMFA 1B4BA 4G7ZA 5IYDK 4XSZA 4C3JC 4C3IC 4FM9A 2WAQL 1WQFA 3S1NK 2ZFZA 1Y1WA 3S1NC 3RZOC 1TWGK 2ZUEA 1BJTA 4KMUA 3HOVC 2JA7C 3L4KA 4Y7NC 1K83A 2V6UA 1I6HK 4LK1A 4MQ9A 4WILA 3GTKA 4JK1A 4BBSK 3TFHA 3GTGK 3IPJA 4BXXK 5M3FK 3JSTA 3GTOA 3M4OK 2FQOA 3GTGC 4BXXC 3GTQA 1DCHA 1TWAK 3S14K 1VGXA 3A8KA 3K7AK 4GZYA 1WOPA 2XCOA 2GSOA 5FLMK 3GDZA 4GTCA 3GTJK 1VJEA 3TTGA 3HOZK 4GTEA 1WCMA 2JA6C 3A8JA 1TWFK 2NVXC 3S15C 3S1QC 1F7UA 1WOOA 3S1MC 5M5YK 5C4JC 4A3KK 4OIQA 1RU0A 4YFKA 3HKZD 3HOUC 2E2HK 1ISEA 4QIWD 2NVYC 4XLNA 5C44K 4KMHA 3H0GK 2RH6A 2NVTK 3HOXK 3L4JA 4XLPA 2R7ZA 3A8IA 1B4AA 1WQGA 4A3CK 3GIRA 1TWCA 2ZUFA 1ZVUA 3S2DC 1O2AA 3BUEA 3FOFA 1Y1WC 2XCQA 5FJ8K 2BE5A 4LQYA 1I6VA 5EGHA 3FKIA 3SZZA 4A3DK 3HOYK 4A3LC 1K83C 2JA5A 2Y3PA 3GEEA 1YX2A 3GTPA 2Y0SD 2PA8D 3GTKC 4GT9A 1SFOA 4OINA 5D4DA 3I4NK 1TWHK 1I3QK 1ZBSA 3GTQK 3T01A 4C3HC 1I50K 1DCPA 1EK8A 4GTLA 3GTOC 3AQPA 2A6EA 2GAGC 4P5AA 3GTQC 1WSRA 1UV7A 1V5VA 1O27A 2E2JK 4XSXA 1YNJA 3M3YC 4BLBA 4O2DA 3PO2K 2GAHC 1WCMC 2V6SA 1GE9A 4C3IK 4NOIA 4KN4A 3CQZA 3FOEA 3GTLA 1HI9A 3VA7A 4G0UA 3RZOK 4PABA 3HOWC 4A3FC 3HOVK 2GSUA 2JA7K 4GFQA 3QX3A 2R92A 4Y7NK 3ERED 1O2FB 4BLAA 4LJZA 2YU9A 1XXBA 2W7VA 2NVQC 1WOSA 2R7ZC 4A3IC 1XXAA 2GSNA 1J6VA 4C2MC 5IP9C 1TWCC 3AD8C 3S17C 1DD5A 2CFAB 4GTBA 1L0WA 1O25A 3TFJA 1Y1VA 1HQMA 3FKIC 3I4MC 1BGWA 1ZXOA 3S0XA 2JA5C 3HKZL 1IS1A 4A93C 4KAWX 3RZDC 4BY7C 1XXCA 1WQHA 3GTPC 4M1XA 1EH1A 2B63A 3HXAA 5IOQA 2JA6K 1SFOC 2VUMA 1XZPB 4QIWL 2NVXK 1JVIA 3S15K 3S1QK 3S1MK 3AH5A 5C4JK 4KATA 4XCHA 2CW0A 4KDDA 4AYBD 1YNNA 4X6AC 4KM8A 2A68A 3GSIA 3HOUK 3S16C 1R9TC 2NVYK 2O5JA 3N0CA 1PJ7A 2E2IC 2CFAA 4BKWA 3BP3A 4QJVB 3H3VD 2P8TA 4G7OA 3CQZC 5IORA 3S2DK 2Y0SL 2PA8L 2PHCB 3GTLC 4KMAA 5C3EC 1Y1WK 3G4CA 3G4AA 3T00A 1XZQB 4A3JC 1XPPA 4A3BC 3FHZA 1JOEA 2R92C 4Y52C 1KQ4A 4A3LK 2R93C 1DCOA 3AQOA 3GEIA 4OIOA 1K83K 1TWGA 3DXJA 1XZPA 5JVOA 2YU9C 2D6FC 1IL2A
chains in the Genus database with same CATH topology
3PO3C 3PO2K 3GTKK 5FLMC 1WCMC 1I6HK 5C4XK 3GTJC 3S2HK 3HOZC 1ZYRA 4LK1A 4MQ9A 4Q5SA 3CQZK 5C4XC 5TMCA 4JK1A 4BBSK 3GTLK 5C3EK 3S2HC 4C3IK 4NOIA 1TWFC 4KN4A 4C3HK 1Y1VC 4A3JK 2JA8K 3GTOK 3GTMC 4OIRA 3GTGK 4A3BK 4BXXK 5M3FK 5IYCC 3RZOK 4MEYA 4YG2A 1IW7A 3WODA 4A3KC 4A3FC 2JA8C 2O5IA 2R92K 3HOWC 2JA7K 3HOVK 3GTGC 3M4OK 4MEXA 4BXXC 4Y52K 2R93K 1TWAK 2YU9K 3S14K 4G7HA 4QJVA 3M3YK 2B63K 5IYBC 4Y7NK 3K7AK 4GZYA 4LJZA 4LK0A 3PO3K 2B63C 4ZH4A 2E2HC 5FLMK 1WCMK 3GTJK 2NVQC 4Q4ZA 2VUMC 3HOZK 5C44C 2R7ZC 4A3IC 3H0GC 2JA6C 2NVTC 3HOXC 2R93C 1TWFK 5IP9C 5M5XK 2NVXC 1TWCC 3S15C 3S1QC 1Y1VK 4BY1K 3S17C 4A3CC 5IP7C 3GTMK 3S1MC 5M5YK 5C4JC 4LLGA 5IYCK 4BY1C 4A3KK 4A3MC 3HOWK 1HQMA 4A3FK 4A3EC 4OIQA 3FKIC 3EQLA 5M5WK 4YFKA 3HKZD 4A3GC 5IYBK 3I4MC 4BBRC 2WB1D 3HOUC 2E2HK 2JA5C 3HKZL 4A3DC 2NVQK 4A93C 3RZDC 4BY7C 4QIWD 2NVYC 3S1RK 2VUMK 4XLNA 3GTPC 5C44K 3HOYC 2R7ZK 4A3IK 2WB1L 3H0GK 4OIPA 2JA6K 2NVTK 3S1RC 3HOXK 1SFOC 4C2MK 5M3MK 4XLPA 4QIWL 5IP9K 2NVXK 1TWCK 3S15K 3S1QK 2PMZD 3S17K 1BDFA 4A3CK 5IP7K 3S1MK 5C4JK 4KN7A 4A3MK 3S2DC 2PMZL 2CW0A 5IYDC 4A3EK 4AYBD 3I4NC 1Y1WC 1TWHC 1YNNA 3FKIK 1I3QC 4X6AC 1I50C 2A6HA 5FJ8K 4A3GK 2BE5A 3I4MK 2A68A 1I6VA 4AYBL 4BBRK 1TWGC 4YFNA 3HOUK 2JA5K 3S16C 4A3DK 4A93K 4BY7K 3RZDK 2E2JC 1R9TC 3HOYK 2NVYK 3GTPK 4A3LC 2O5JA 1K83C 1SFOK 2E2IC 4QJVB 3H3VD 3PO2C 2Y0SD 2PA8D 5TMFA 3GTKC 1I6HC 4OINA 4G7OA 4C3JK 2WAQD 5D4DA 3CQZC 4G7ZA 3H3VL 1SMYA 2PA8L 2Y0SL 3S2DK 4BBSC 5IYDK 4XSZA 5C3EC 1TWHK 1Y1WK 3GTLC 1I3QK 3I4NK 4X6AK 2WAQL 3GTQK 3S1NK 1I50K 4A3JC 3GTOC 1XPPA 2A6EA 4A3BC 3GTQC 3S1NC 3RZOC 1TWGK 2R92C 4KMUA 2PPBA 3S16K 3HOVC 4YFXA 2JA7C 2E2JK 4Y52C 1R9TK 3M4OC 4A3LK 2A69A 1TWAC 2YU9C 3S14C 4XSXA 1K83K 3DXJA 1YNJA 4OIOA 3M3YC 4Y7NC 3K7AC 2E2IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 C;  3PO2 K;  3GTK K;  5FLM C;  1WCM C;  1I6H K;  5C4X K;  3GTJ C;  3S2H K;  3HOZ C;  1ZYR A;  4LK1 A;  4MQ9 A;  4Q5S A;  3CQZ K;  5C4X C;  5TMC A;  4JK1 A;  4BBS K;  3GTL K;  5C3E K;  3S2H C;  4C3I K;  4NOI A;  1TWF C;  4KN4 A;  4C3H K;  1Y1V C;  4A3J K;  2JA8 K;  3GTO K;  3GTM C;  4OIR A;  3GTG K;  4A3B K;  4BXX K;  5M3F K;  5IYC C;  3RZO K;  4MEY A;  4YG2 A;  1IW7 A;  3WOD A;  4A3K C;  4A3F C;  2JA8 C;  2O5I A;  2R92 K;  3HOW C;  2JA7 K;  3HOV K;  3GTG C;  3M4O K;  4MEX A;  4BXX C;  4Y52 K;  2R93 K;  1TWA K;  2YU9 K;  3S14 K;  4G7H A;  4QJV A;  3M3Y K;  2B63 K;  5IYB C;  4Y7N K;  3K7A K;  4GZY A;  4LJZ A;  4LK0 A;  3PO3 K;  2B63 C;  4ZH4 A;  2E2H C;  5FLM K;  1WCM K;  3GTJ K;  2NVQ C;  4Q4Z A;  2VUM C;  3HOZ K;  5C44 C;  2R7Z C;  4A3I C;  3H0G C;  2JA6 C;  2NVT C;  3HOX C;  2R93 C;  1TWF K;  5IP9 C;  5M5X K;  2NVX C;  1TWC C;  3S15 C;  3S1Q C;  1Y1V K;  4BY1 K;  3S17 C;  4A3C C;  5IP7 C;  3GTM K;  3S1M C;  5M5Y K;  5C4J C;  4LLG A;  5IYC K;  4BY1 C;  4A3K K;  4A3M C;  3HOW K;  1HQM A;  4A3F K;  4A3E C;  4OIQ A;  3FKI C;  3EQL A;  5M5W K;  4YFK A;  3HKZ D;  4A3G C;  5IYB K;  3I4M C;  4BBR C;  2WB1 D;  3HOU C;  2E2H K;  2JA5 C;  3HKZ L;  4A3D C;  2NVQ K;  4A93 C;  3RZD C;  4BY7 C;  4QIW D;  2NVY C;  3S1R K;  2VUM K;  4XLN A;  3GTP C;  5C44 K;  3HOY C;  2R7Z K;  4A3I K;  2WB1 L;  3H0G K;  4OIP A;  2JA6 K;  2NVT K;  3S1R C;  3HOX K;  1SFO C;  4C2M K;  5M3M K;  4XLP A;  4QIW L;  5IP9 K;  2NVX K;  1TWC K;  3S15 K;  3S1Q K;  2PMZ D;  3S17 K;  1BDF A;  4A3C K;  5IP7 K;  3S1M K;  5C4J K;  4KN7 A;  4A3M K;  3S2D C;  2PMZ L;  2CW0 A;  5IYD C;  4A3E K;  4AYB D;  3I4N C;  1Y1W C;  1TWH C;  1YNN A;  3FKI K;  1I3Q C;  4X6A C;  1I50 C;  2A6H A;  5FJ8 K;  4A3G K;  2BE5 A;  3I4M K;  2A68 A;  1I6V A;  4AYB L;  4BBR K;  1TWG C;  4YFN A;  3HOU K;  2JA5 K;  3S16 C;  4A3D K;  4A93 K;  4BY7 K;  3RZD K;  2E2J C;  1R9T C;  3HOY K;  2NVY K;  3GTP K;  4A3L C;  2O5J A;  1K83 C;  1SFO K;  2E2I C;  4QJV B;  3H3V D;  3PO2 C;  2Y0S D;  2PA8 D;  5TMF A;  3GTK C;  1I6H C;  4OIN A;  4G7O A;  4C3J K;  2WAQ D;  5D4D A;  3CQZ C;  4G7Z A;  3H3V L;  1SMY A;  2PA8 L;  2Y0S L;  3S2D K;  4BBS C;  5IYD K;  4XSZ A;  5C3E C;  1TWH K;  1Y1W K;  3GTL C;  1I3Q K;  3I4N K;  4X6A K;  2WAQ L;  3GTQ K;  3S1N K;  1I50 K;  4A3J C;  3GTO C;  1XPP A;  2A6E A;  4A3B C;  3GTQ C;  3S1N C;  3RZO C;  1TWG K;  2R92 C;  4KMU A;  2PPB A;  3S16 K;  3HOV C;  4YFX A;  2JA7 C;  2E2J K;  4Y52 C;  1R9T K;  3M4O C;  4A3L K;  2A69 A;  1TWA C;  2YU9 C;  3S14 C;  4XSX A;  1K83 K;  3DXJ A;  1YNJ A;  4OIO A;  3M3Y C;  4Y7N C;  3K7A C;  2E2I K; 
#chains in the Genus database with same CATH topology
 3N0B A;  3PO3 C;  4P9S A;  3GTK K;  1O24 A;  5C4X K;  5CHP A;  4Q5S A;  5C4X C;  3LPX A;  4C3H K;  1Y1V C;  2JA8 K;  3GTO K;  5HL8 A;  3GTM C;  4KC6 A;  4KB4 A;  5IYC C;  3WOD A;  2JA8 C;  1IW7 A;  1O29 A;  4MEX A;  5IOS A;  5IOT A;  1INN A;  4QJV A;  3M3Y K;  2B63 K;  5IYB C;  4LK0 A;  1TWA A;  4G0W A;  2B63 C;  1AB4 A;  1WCM K;  1R9T A;  3SZY A;  2VUM C;  5TJ3 A;  1O2B A;  2E2I A;  3GTJ A;  1XZQ A;  3TFI A;  1X31 C;  5IP7 C;  4LLG A;  1YCL A;  4A3M C;  3HOW K;  4A3F K;  4A3E C;  4G0V A;  3EQL A;  4A3G C;  4PAA A;  4BBR C;  2P5M A;  2WB1 D;  3Q3Q A;  2NVQ K;  2R93 A;  2R7Z K;  4A3I K;  4FZB A;  4KMD A;  2E2H A;  1EQR A;  4C2M K;  5M3M K;  5IP9 K;  1TWC K;  3H0G A;  2PMZ D;  3S17 K;  1O28 A;  1J6X A;  4LR2 A;  5IYD C;  5CJ9 A;  3FKI K;  1C0A A;  3GTM A;  3I4M K;  4AYB L;  1TWG C;  4YFN A;  2JA5 K;  4A93 K;  4BY7 K;  3RZD K;  3GTP K;  2KWA A;  4LOW A;  4ILD A;  1SFO K;  3AD9 C;  1I6H C;  3BP8 C;  4J3N A;  2WAQ D;  2V6T A;  3H3V L;  1SMY A;  4BBS C;  4KAS A;  4X6A K;  3CAG A;  1TWH A;  1I3Q A;  2RGR A;  1WOR A;  4GTA A;  1I50 A;  2PPB A;  3S16 K;  3M4O C;  4YFX A;  3T02 A;  1R9T K;  1WSV A;  1TWA C;  2A69 A;  3S14 C;  3ORE A;  3K7A C;  1VRQ C;  2E2I K;  4DDQ A;  1WIH A;  1F7V A;  4KAR A;  5FLM C;  4AH6 A;  3GTJ C;  3S2H K;  3HOZ C;  1ZYR A;  3CQZ K;  3MML B;  5TMC A;  1PJ5 A;  3GTL K;  5C3E K;  3S2H C;  3N3Y A;  3OEP A;  1TWF C;  3AD7 C;  4A3J K;  2EBB A;  4KB2 A;  4OIR A;  4A3B K;  4MEY A;  4YG2 A;  4A3K C;  2R92 K;  1VLO A;  2O5I A;  1USO A;  4Y52 K;  2R93 K;  2YU9 K;  4G7H A;  4WJ4 A;  2JA7 A;  3PO3 K;  4ZH4 A;  2E2H C;  1BS2 A;  1IQ0 A;  4Q4Z A;  1EI6 A;  3OPF A;  5C44 C;  3LAJ A;  3V4G A;  1VH2 A;  3H0G C;  2XCR B;  2NVT C;  3HOX C;  5M5X K;  1Y1V K;  4BY1 K;  1JQW A;  3GEH A;  4A3C C;  2FQT A;  3GTM K;  4GTF A;  1IBA A;  5IYC K;  4BY1 C;  4WJ3 M;  5JFE A;  5E68 A;  5M5W K;  2JH3 A;  5IYB K;  3GTG A;  4P5B A;  3LAP A;  4A3D C;  2VUM K;  3HOY C;  3S1R K;  2WB1 L;  1G51 A;  4OIP A;  3S1R C;  3NUH A;  1BDF A;  4C45 A;  2JA6 A;  5IP7 K;  2NVX A;  4KN7 A;  4A3M K;  2PMZ L;  4A3E K;  4GTD A;  1TWF A;  1TWH C;  3I4N C;  1I3Q C;  5EGE A;  1I50 C;  2A6H A;  4A3G K;  1PJ6 A;  1J98 A;  4BBR K;  2E2J C;  1J6W A;  5L46 A;  1F9N A;  2NVY A;  1IE0 A;  1F93 A;  1USM A;  3ADA C;  4KM9 A;  3PO2 C;  5TMF A;  1ZQ1 C;  1EFW A;  4C3J K;  1O26 A;  4RMF A;  1B4B A;  4G7Z A;  5IYD K;  4XSZ A;  4C3J C;  4C3I C;  4FM9 A;  2WAQ L;  1WQF A;  3S1N K;  2ZFZ A;  1Y1W A;  3S1N C;  3RZO C;  1TWG K;  2ZUE A;  1BJT A;  4KMU A;  3HOV C;  2JA7 C;  3L4K A;  4Y7N C;  1K83 A;  2V6U A;  1I6H K;  4LK1 A;  4MQ9 A;  4WIL A;  3GTK A;  4JK1 A;  4BBS K;  3TFH A;  3GTG K;  3IPJ A;  4BXX K;  5M3F K;  3JST A;  3GTO A;  3M4O K;  2FQO A;  3GTG C;  4BXX C;  3GTQ A;  1DCH A;  1TWA K;  3S14 K;  1VGX A;  3A8K A;  3K7A K;  4GZY A;  1WOP A;  2XCO A;  2GSO A;  5FLM K;  3GDZ A;  4GTC A;  3GTJ K;  1VJE A;  3TTG A;  3HOZ K;  4GTE A;  1WCM A;  2JA6 C;  3A8J A;  1TWF K;  2NVX C;  3S15 C;  3S1Q C;  1F7U A;  1WOO A;  3S1M C;  5M5Y K;  5C4J C;  4A3K K;  4OIQ A;  1RU0 A;  4YFK A;  3HKZ D;  3HOU C;  2E2H K;  1ISE A;  4QIW D;  2NVY C;  4XLN A;  5C44 K;  4KMH A;  3H0G K;  2RH6 A;  2NVT K;  3HOX K;  3L4J A;  4XLP A;  2R7Z A;  3A8I A;  1B4A A;  1WQG A;  4A3C K;  3GIR A;  1TWC A;  2ZUF A;  1ZVU A;  3S2D C;  1O2A A;  3BUE A;  3FOF A;  1Y1W C;  2XCQ A;  5FJ8 K;  2BE5 A;  4LQY A;  1I6V A;  5EGH A;  3FKI A;  3SZZ A;  4A3D K;  3HOY K;  4A3L C;  1K83 C;  2JA5 A;  2Y3P A;  3GEE A;  1YX2 A;  3GTP A;  2Y0S D;  2PA8 D;  3GTK C;  4GT9 A;  1SFO A;  4OIN A;  5D4D A;  3I4N K;  1TWH K;  1I3Q K;  1ZBS A;  3GTQ K;  3T01 A;  4C3H C;  1I50 K;  1DCP A;  1EK8 A;  4GTL A;  3GTO C;  3AQP A;  2A6E A;  2GAG C;  4P5A A;  3GTQ C;  1WSR A;  1UV7 A;  1V5V A;  1O27 A;  2E2J K;  4XSX A;  1YNJ A;  3M3Y C;  4BLB A;  4O2D A;  3PO2 K;  2GAH C;  1WCM C;  2V6S A;  1GE9 A;  4C3I K;  4NOI A;  4KN4 A;  3CQZ A;  3FOE A;  3GTL A;  1HI9 A;  3VA7 A;  4G0U A;  3RZO K;  4PAB A;  3HOW C;  4A3F C;  3HOV K;  2GSU A;  2JA7 K;  4GFQ A;  3QX3 A;  2R92 A;  4Y7N K;  3ERE D;  1O2F B;  4BLA A;  4LJZ A;  2YU9 A;  1XXB A;  2W7V A;  2NVQ C;  1WOS A;  2R7Z C;  4A3I C;  1XXA A;  2GSN A;  1J6V A;  4C2M C;  5IP9 C;  1TWC C;  3AD8 C;  3S17 C;  1DD5 A;  2CFA B;  4GTB A;  1L0W A;  1O25 A;  3TFJ A;  1Y1V A;  1HQM A;  3FKI C;  3I4M C;  1BGW A;  1ZXO A;  3S0X A;  2JA5 C;  3HKZ L;  1IS1 A;  4A93 C;  4KAW X;  3RZD C;  4BY7 C;  1XXC A;  1WQH A;  3GTP C;  4M1X A;  1EH1 A;  2B63 A;  3HXA A;  5IOQ A;  2JA6 K;  1SFO C;  2VUM A;  1XZP B;  4QIW L;  2NVX K;  1JVI A;  3S15 K;  3S1Q K;  3S1M K;  3AH5 A;  5C4J K;  4KAT A;  4XCH A;  2CW0 A;  4KDD A;  4AYB D;  1YNN A;  4X6A C;  4KM8 A;  2A68 A;  3GSI A;  3HOU K;  3S16 C;  1R9T C;  2NVY K;  2O5J A;  3N0C A;  1PJ7 A;  2E2I C;  2CFA A;  4BKW A;  3BP3 A;  4QJV B;  3H3V D;  2P8T A;  4G7O A;  3CQZ C;  5IOR A;  3S2D K;  2Y0S L;  2PA8 L;  2PHC B;  3GTL C;  4KMA A;  5C3E C;  1Y1W K;  3G4C A;  3G4A A;  3T00 A;  1XZQ B;  4A3J C;  1XPP A;  4A3B C;  3FHZ A;  1JOE A;  2R92 C;  4Y52 C;  1KQ4 A;  4A3L K;  2R93 C;  1DCO A;  3AQO A;  3GEI A;  4OIO A;  1K83 K;  1TWG A;  3DXJ A;  1XZP A;  5JVO A;  2YU9 C;  2D6F C;  1IL2 A; 
#chains in the Genus database with same CATH homology
 3PO3 C;  3PO2 K;  3GTK K;  5FLM C;  1WCM C;  1I6H K;  5C4X K;  3GTJ C;  3S2H K;  3HOZ C;  1ZYR A;  4LK1 A;  4MQ9 A;  4Q5S A;  3CQZ K;  5C4X C;  5TMC A;  4JK1 A;  4BBS K;  3GTL K;  5C3E K;  3S2H C;  4C3I K;  4NOI A;  1TWF C;  4KN4 A;  4C3H K;  1Y1V C;  4A3J K;  2JA8 K;  3GTO K;  3GTM C;  4OIR A;  3GTG K;  4A3B K;  4BXX K;  5M3F K;  5IYC C;  3RZO K;  4MEY A;  4YG2 A;  1IW7 A;  3WOD A;  4A3K C;  4A3F C;  2JA8 C;  2O5I A;  2R92 K;  3HOW C;  2JA7 K;  3HOV K;  3GTG C;  3M4O K;  4MEX A;  4BXX C;  4Y52 K;  2R93 K;  1TWA K;  2YU9 K;  3S14 K;  4G7H A;  4QJV A;  3M3Y K;  2B63 K;  5IYB C;  4Y7N K;  3K7A K;  4GZY A;  4LJZ A;  4LK0 A;  3PO3 K;  2B63 C;  4ZH4 A;  2E2H C;  5FLM K;  1WCM K;  3GTJ K;  2NVQ C;  4Q4Z A;  2VUM C;  3HOZ K;  5C44 C;  2R7Z C;  4A3I C;  3H0G C;  2JA6 C;  2NVT C;  3HOX C;  2R93 C;  1TWF K;  5IP9 C;  5M5X K;  2NVX C;  1TWC C;  3S15 C;  3S1Q C;  1Y1V K;  4BY1 K;  3S17 C;  4A3C C;  5IP7 C;  3GTM K;  3S1M C;  5M5Y K;  5C4J C;  4LLG A;  5IYC K;  4BY1 C;  4A3K K;  4A3M C;  3HOW K;  1HQM A;  4A3F K;  4A3E C;  4OIQ A;  3FKI C;  3EQL A;  5M5W K;  4YFK A;  3HKZ D;  4A3G C;  5IYB K;  3I4M C;  4BBR C;  2WB1 D;  3HOU C;  2E2H K;  2JA5 C;  3HKZ L;  4A3D C;  2NVQ K;  4A93 C;  3RZD C;  4BY7 C;  4QIW D;  2NVY C;  3S1R K;  2VUM K;  4XLN A;  3GTP C;  5C44 K;  3HOY C;  2R7Z K;  4A3I K;  2WB1 L;  3H0G K;  4OIP A;  2JA6 K;  2NVT K;  3S1R C;  3HOX K;  1SFO C;  4C2M K;  5M3M K;  4XLP A;  4QIW L;  5IP9 K;  2NVX K;  1TWC K;  3S15 K;  3S1Q K;  2PMZ D;  3S17 K;  1BDF A;  4A3C K;  5IP7 K;  3S1M K;  5C4J K;  4KN7 A;  4A3M K;  3S2D C;  2PMZ L;  2CW0 A;  5IYD C;  4A3E K;  4AYB D;  3I4N C;  1Y1W C;  1TWH C;  1YNN A;  3FKI K;  1I3Q C;  4X6A C;  1I50 C;  2A6H A;  5FJ8 K;  4A3G K;  2BE5 A;  3I4M K;  2A68 A;  1I6V A;  4AYB L;  4BBR K;  1TWG C;  4YFN A;  3HOU K;  2JA5 K;  3S16 C;  4A3D K;  4A93 K;  4BY7 K;  3RZD K;  2E2J C;  1R9T C;  3HOY K;  2NVY K;  3GTP K;  4A3L C;  2O5J A;  1K83 C;  1SFO K;  2E2I C;  4QJV B;  3H3V D;  3PO2 C;  2Y0S D;  2PA8 D;  5TMF A;  3GTK C;  1I6H C;  4OIN A;  4G7O A;  4C3J K;  2WAQ D;  5D4D A;  3CQZ C;  4G7Z A;  3H3V L;  1SMY A;  2PA8 L;  2Y0S L;  3S2D K;  4BBS C;  5IYD K;  4XSZ A;  5C3E C;  1TWH K;  1Y1W K;  3GTL C;  1I3Q K;  3I4N K;  4X6A K;  2WAQ L;  3GTQ K;  3S1N K;  1I50 K;  4A3J C;  3GTO C;  1XPP A;  2A6E A;  4A3B C;  3GTQ C;  3S1N C;  3RZO C;  1TWG K;  2R92 C;  4KMU A;  2PPB A;  3S16 K;  3HOV C;  4YFX A;  2JA7 C;  2E2J K;  4Y52 C;  1R9T K;  3M4O C;  4A3L K;  2A69 A;  1TWA C;  2YU9 C;  3S14 C;  4XSX A;  1K83 K;  3DXJ A;  1YNJ A;  4OIO A;  3M3Y C;  4Y7N C;  3K7A C;  2E2I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...