2NVXK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvxK00
5M5XK 4LLGA 3H3VD 4X6AK 1BDFA 1TWCK 2B63C 4A3DC 3S2DK 4XLNA 3S16K 5IYDK 3S1NK 1TWFK 5FJ8K 3I4MK 2R93K 2NVYC 5M5YK 2WAQD 4Q5SA 2E2IC 4QIWL 3S1RK 2O5IA 2Y0SL 3PO2C 1Y1VK 4A3FC 5TMFA 5IYCK 5C3EK 3GTQC 3I4NK 1R9TK 3HOYC 4QJVB 4GZYA 4A3GK 5C4XC 5IP9C 4KN4A 4A3JK 4LK1A 2JA5K 2JA7C 3S17C 4YFNA 4Y52C 4C3JK 3RZDK 3GTGC 5IP7K 1I50C 3M3YC 4OIOA 1TWHK 2YU9C 3GTMC 3WODA 4QJVA 4A3IK 4A3DK 3K7AK 3H0GK 4A3LC 2JA8C 3HOZC 3S14C 1HQMA 4BY7K 2PMZD 1IW7A 2NVYK 2R7ZC 3S1MK 3GTKC 3S15C 4A3CC 3HKZL 4A3BC 1TWGK 3EQLA 3M4OK 5IP9K 4Y7NK 4LK0A 3GTPK 2E2HC 2E2JK 2NVXC 2A68A 3GTLC 2PA8D 4ZH4A 5C4JK 4Y52K 2WB1D 3GTGK 1K83C 2A69A 3HOWC 4G7HA 3PO3C 3M3YK 4A93C 5IYBK 2YU9K 2WAQL 3GTMK 4BXXC 3GTJK 4XLPA 1I6HC 3HOXC 3FKIC 5FLMK 4C2MK 1WCMC 2JA8K 3S1QC 2VUMC 3RZOC 4BY1C 1ZYRA 4OIQA 3S2HK 4A3CK 2A6EA 2B63K 1I3QC 1SMYA 4C3HK 3HOUC 1TWAC 4G7ZA 2NVXK 4QIWD 4MEYA 5C44C 1Y1WC 4AYBD 3GTLK 2E2IK 3DXJA 3PO3K 2JA6C 3PO2K 4A3FK 2PMZL 3GTQK 4A3KC 3HOYK 2NVTC 4A93K 1I6HK 5C4XK 4BXXK 4JK1A 3GTOC 1TWCC 3FKIK 3HOXK 3H3VL 3CQZC 3S2DC 1SFOC 4A3MC 5IYDC 2JA7K 3S17K 1WCMK 3S16C 4NOIA 1TWFC 4C3IK 4Q4ZA 4YFXA 1I50K 5D4DA 3HOVC 2PA8L 3S1RC 4BBSC 1Y1VC 2WB1L 5IYCC 3I4NC 4A3GC 4A3LK 1I3QK 1I6VA 4KMUA 4A3JC 3HOZK 3S14K 4MEXA 2JA5C 2BE5A 4OINA 3RZDC 1Y1WK 4MQ9A 2R7ZK 3S15K 3GTKK 5IP7C 1TWHC 4BBRC 4A3BK 4A3KK 1YNNA 2NVTK 2PPBA 4KN7A 4A3IC 3K7AC 3H0GC 2E2HK 4A3EC 3CQZK 3GTOK 1SFOK 4A3MK 2O5JA 2Y0SD 1YNJA 4BY7C 2NVQC 1K83K 5M3FK 2R92C 4LJZA 3HOWK 4OIPA 4OIRA 3HOVK 3S1MC 4BBSK 4AYBL 4X6AC 1TWGC 4XSXA 1XPPA 3M4OC 4Y7NC 3GTPC 3S1NC 2E2JC 3S1QK 2VUMK 3I4MC 2R93C 3RZOK 5C4JC 4BY1K 5TMCA 4G7OA 4YFKA 5C3EC 1R9TC 5IYBC 4BBRK 3GTJC 4XSZA 3HOUK 5FLMC 1TWAK 4A3EK 2A6HA 5C44K 3HKZD 4YG2A 2NVQK 5M5WK 2R92K 2JA6K 5M3MK 3S2HC 2CW0A
chains in the Genus database with same CATH superfamily
3H3VD 1EFWA 2P8TA 3S2DK 5IYDK 3LAJA 5M5YK 2E2IC 4QIWL 3S1RK 2O5IA 2Y0SL 1VLOA 2ZFZA 5TMFA 4GZYA 5E68A 5C4XC 5IP9C 1Y1WA 4WJ4A 2JA5K 2JA7C 4YFNA 4C3JK 1O2FB 2JH3A 4GTBA 3LAPA 5IP7K 1I50C 3M3YC 3GTOA 2YU9C 2E2HA 1SFOA 4M1XA 2GSNA 3A8KA 4QJVA 4A3LC 1USMA 3L4KA 3HXAA 2ZUFA 3S15C 5CHPA 4A3CC 3HKZL 1O2AA 1INNA 3EQLA 3M4OK 5IP9K 4Y7NK 4ILDA 2A68A 2PA8D 3FOEA 1K83C 1IQ0A 3HOWC 1XZQB 3M3YK 2YU9K 2WAQL 4BXXC 3GTJK 3FKIC 3TFHA 1YX2A 5IOTA 3RZOC 4A3CK 2A6EA 1TWFA 5TJ3A 1WOOA 1TWAC 1WQFA 1Y1VA 1Y1WC 1R9TA 2JA6C 4A3FK 2PMZL 2NVTC 4BXXK 3GTOC 4PAAA 3FKIK 1VH2A 4KMHA 3H3VL 1SFOC 4Q4ZA 1F7VA 3SZYA 5D4DA 1JOEA 1ISEA 1WOPA 3OEPA 3T01A 3GSIA 4A3GC 1XZPB 3S14K 4MEXA 3RZDC 1Y1WK 1X31C 1TWGA 4KM9A 1XXAA 4A3BK 2NVTK 3G4CA 2PPBA 3GTOK 3K7AC 3H0GC 2E2HK 5EGHA 4FM9A 1SFOK 2Y0SD 4DDQA 1J6WA 4LJZA 4OIRA 4X6AC 1O27A 3S1NC 3BP3A 4G7OA 1R9TC 2RH6A 4KB2A 5IYBC 3FOFA 5FLMC 2E2IA 3AD7C 5C44K 1IBAA 1O2BA 3HKZD 3VA7A 4YG2A 3S2HC 2CW0A 2JA7A 4X6AK 4KATA 2B63C 1IS1A 1JVIA 2XCOA 4XLNA 1I50A 3S1NK 1TWFK 2WAQD 4Q5SA 1Y1VK 3I4NK 3HOYC 1R9TK 5JVOA 4KN4A 5IORA 4A3JK 3S17C 4Y52C 2GAHC 4OIOA 4KARA 2V6UA 3WODA 1WQHA 3BP8C 4A3IK 1K83A 4C2MC 3HOZC 1HQMA 4BY7K 2PMZD 2V6SA 2R7ZC 3S1MK 1TWGK 4GTAA 2D6FC 1J6VA 1WOSA 1J6XA 4Y52K 1DCPA 1BJTA 3N0BA 3PO3C 1TWAA 3GEEA 4KMAA 4C2MK 4KASA 2JA6A 4C3IC 2KWAA 2V6TA 1O28A 1ZQ1C 4GTFA 3V4GA 4P5AA 2R93A 1PJ7A 3HOUC 4G7ZA 4MEYA 4XCHA 4GTCA 3AH5A 2E2IK 3PO3K 1ZVUA 1EH1A 5HL8A 4A3KC 5C4XK 1O25A 1TWCC 1XXCA 3S16C 2JA7K 4BLBA 4C3IK 3MMLB 1O24A 1I50K 3H0GA 2WB1L 5IYCC 3GEIA 4A3LK 4GFQA 4WJ3M 1ZXOA 1UV7A 3S15K 1TWHC 4BBRC 4A3KK 4G0WA 1YNJA 5IOSA 1K83K 3HOWK 5CJ9A 5EGEA 1C0AA 4AH6A 3GTPC 2E2JC 2R93C 3RZOK 5C4JC 4LQYA 1VGXA 1VJEA 2B63A 5TMCA 4YFKA 5C3EC 4BBRK 1IL2A 2NVXA 4XSZA 1TWAK 2XCQA 4PABA 4BLAA 2GSOA 3OPFA 5M5WK 2JA6K 2XCRB 5M5XK 1WCMA 1EK8A 1AB4A 4KAWX 1USOA 4C3HC 5FJ8K 4LOWA 2R93K 2NVYC 3PO2C 1HI9A 5C3EK 3GTQC 4A3GK 4KC6A 4QJVB 1WIHA 2R7ZA 4KDDA 4LK1A 3RZDK 1RU0A 4KM8A 3GDZA 3CQZA 3JSTA 4FZBA 4J3NA 3K7AK 3H0GK 2JA8C 2GAGC 1DCOA 3NUHA 3L4JA 3ADAC 2NVYK 3CAGA 3GTKC 3BUEA 1GE9A 3GIRA 4LK0A 5JFEA 2NVXC 2WB1D 2A69A 4G0UA 5IYBK 3HOXC 5FLMK 2R92A 3T00A 2JA8K 1WCMC 3S1QC 2VUMC 4GTDA 4BY1C 1ZYRA 1TWCA 3S2HK 3QX3A 1WQGA 2B63K 3A8JA 2NVXK 2FQOA 3DXJA 3N0CA 1YCLA 3HOYK 3FHZA 3LPXA 3HOXK 3S2DC 3CQZC 3TFIA 5IYDC 3S17K 1WCMK 1TWHA 1JQWA 4YFXA 3AQPA 5IOQA 3S1RC 3HOVC 4BBSC 1J98A 3HOZK 2JA5C 2BE5A 1O29A 4MQ9A 2R7ZK 2P5MA 5IP7C 3ERED 3GTPA 1YNNA 1DD5A 1F93A 1XZPA 4KN7A 1B4AA 3GTGA 1B4BA 3CQZK 2O5JA 1BGWA 3GTMA 2NVQC 3A8IA 2R92C 4OIPA 3HOVK 4BBSK 4AYBL 4WILA 4XSXA 1XPPA 3M4OC 4Y7NC 3I4MC 1F9NA 2EBBA 1EI6A 4P9SA 3GTJC 3GTLA 2NVYA 3HOUK 5L46A 3GTQA 2NVQK 2R92K 4LR2A 4LLGA 2RGRA 1L0WA 4BKWA 1BDFA 1TWCK 4A3DC 2Y3PA 3S16K 3TTGA 2ZUEA 3I4MK 4O2DA 4KMDA 1I3QA 4A3FC 5IYCK 3IPJA 3GTKA 3GTGC 2FQTA 4G0VA 1TWHK 3GTMC 4P5BA 4A3DK 3S14C 1BS2A 1IW7A 2W7VA 1V5VA 3GEHA 4A3BC 2VUMA 3AD9C 2CFAA 3GTPK 2E2HC 2E2JK 4GTEA 3GTLC 4ZH4A 2GSUA 2PHCB 5C4JK 3GTGK 1KQ4A 4G7HA 1O26A 1WORA 4A93C 1I6HC 4KB4A 3GTMK 4XLPA 1DCHA 4OIQA 4C45A 4GT9A 1I3QC 1SMYA 1EQRA 4C3HK 3AQOA 4QIWD 5C44C 3GTLK 4AYBD 3G4AA 3PO2K 1G51A 1IE0A 3GTQK 4A93K 1I6HK 2JA5A 4JK1A 1WSRA 4A3MC 4NOIA 1TWFC 1VRQC 1PJ6A 1ZBSA 2PA8L 3AD8C 1Y1VC 3I4NC 1I3QK 1I6VA 3OREA 4KMUA 4A3JC 3SZZA 4OINA 3GTKK 1XZQA 3T02A 1F7UA 4RMFA 4A3IC 4A3EC 3S0XA 4A3MK 4BY7C 2YU9A 5M3FK 3GTJA 3S1MC 3Q3QA 1TWGC 1XXBA 3S1QK 2VUMK 4BY1K 3N3YA 4GTLA 1WSVA 2CFAB 4A3EK 2A6HA 4C3JC 3TFJA 5M3MK 3FKIA 1PJ5A
chains in the Genus database with same CATH topology
5M5XK 4LLGA 3H3VD 4X6AK 1BDFA 1TWCK 2B63C 4A3DC 3S2DK 4XLNA 3S16K 5IYDK 3S1NK 1TWFK 5FJ8K 3I4MK 2R93K 2NVYC 5M5YK 2WAQD 4Q5SA 2E2IC 4QIWL 3S1RK 2O5IA 2Y0SL 3PO2C 1Y1VK 4A3FC 5TMFA 5IYCK 5C3EK 3GTQC 3I4NK 1R9TK 3HOYC 4QJVB 4GZYA 4A3GK 5C4XC 5IP9C 4KN4A 4A3JK 4LK1A 2JA5K 2JA7C 3S17C 4YFNA 4Y52C 4C3JK 3RZDK 3GTGC 5IP7K 1I50C 3M3YC 4OIOA 1TWHK 2YU9C 3GTMC 3WODA 4QJVA 4A3IK 4A3DK 3K7AK 3H0GK 4A3LC 2JA8C 3HOZC 3S14C 1HQMA 4BY7K 2PMZD 1IW7A 2NVYK 2R7ZC 3S1MK 3GTKC 3S15C 4A3CC 3HKZL 4A3BC 1TWGK 3EQLA 3M4OK 5IP9K 4Y7NK 4LK0A 3GTPK 2E2HC 2E2JK 2NVXC 2A68A 3GTLC 2PA8D 4ZH4A 5C4JK 4Y52K 2WB1D 3GTGK 1K83C 2A69A 3HOWC 4G7HA 3PO3C 3M3YK 4A93C 5IYBK 2YU9K 2WAQL 3GTMK 4BXXC 3GTJK 4XLPA 1I6HC 3HOXC 3FKIC 5FLMK 4C2MK 1WCMC 2JA8K 3S1QC 2VUMC 3RZOC 4BY1C 1ZYRA 4OIQA 3S2HK 4A3CK 2A6EA 2B63K 1I3QC 1SMYA 4C3HK 3HOUC 1TWAC 4G7ZA 2NVXK 4QIWD 4MEYA 5C44C 1Y1WC 4AYBD 3GTLK 2E2IK 3DXJA 3PO3K 2JA6C 3PO2K 4A3FK 2PMZL 3GTQK 4A3KC 3HOYK 2NVTC 4A93K 1I6HK 5C4XK 4BXXK 4JK1A 3GTOC 1TWCC 3FKIK 3HOXK 3H3VL 3CQZC 3S2DC 1SFOC 4A3MC 5IYDC 2JA7K 3S17K 1WCMK 3S16C 4NOIA 1TWFC 4C3IK 4Q4ZA 4YFXA 1I50K 5D4DA 3HOVC 2PA8L 3S1RC 4BBSC 1Y1VC 2WB1L 5IYCC 3I4NC 4A3GC 4A3LK 1I3QK 1I6VA 4KMUA 4A3JC 3HOZK 3S14K 4MEXA 2JA5C 2BE5A 4OINA 3RZDC 1Y1WK 4MQ9A 2R7ZK 3S15K 3GTKK 5IP7C 1TWHC 4BBRC 4A3BK 4A3KK 1YNNA 2NVTK 2PPBA 4KN7A 4A3IC 3K7AC 3H0GC 2E2HK 4A3EC 3CQZK 3GTOK 1SFOK 4A3MK 2O5JA 2Y0SD 1YNJA 4BY7C 2NVQC 1K83K 5M3FK 2R92C 4LJZA 3HOWK 4OIPA 4OIRA 3HOVK 3S1MC 4BBSK 4AYBL 4X6AC 1TWGC 4XSXA 1XPPA 3M4OC 4Y7NC 3GTPC 3S1NC 2E2JC 3S1QK 2VUMK 3I4MC 2R93C 3RZOK 5C4JC 4BY1K 5TMCA 4G7OA 4YFKA 5C3EC 1R9TC 5IYBC 4BBRK 3GTJC 4XSZA 3HOUK 5FLMC 1TWAK 4A3EK 2A6HA 5C44K 3HKZD 4YG2A 2NVQK 5M5WK 2R92K 2JA6K 5M3MK 3S2HC 2CW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X K;  4LLG A;  3H3V D;  4X6A K;  1BDF A;  1TWC K;  2B63 C;  4A3D C;  3S2D K;  4XLN A;  3S16 K;  5IYD K;  3S1N K;  1TWF K;  5FJ8 K;  3I4M K;  2R93 K;  2NVY C;  5M5Y K;  2WAQ D;  4Q5S A;  2E2I C;  4QIW L;  3S1R K;  2O5I A;  2Y0S L;  3PO2 C;  1Y1V K;  4A3F C;  5TMF A;  5IYC K;  5C3E K;  3GTQ C;  3I4N K;  1R9T K;  3HOY C;  4QJV B;  4GZY A;  4A3G K;  5C4X C;  5IP9 C;  4KN4 A;  4A3J K;  4LK1 A;  2JA5 K;  2JA7 C;  3S17 C;  4YFN A;  4Y52 C;  4C3J K;  3RZD K;  3GTG C;  5IP7 K;  1I50 C;  3M3Y C;  4OIO A;  1TWH K;  2YU9 C;  3GTM C;  3WOD A;  4QJV A;  4A3I K;  4A3D K;  3K7A K;  3H0G K;  4A3L C;  2JA8 C;  3HOZ C;  3S14 C;  1HQM A;  4BY7 K;  2PMZ D;  1IW7 A;  2NVY K;  2R7Z C;  3S1M K;  3GTK C;  3S15 C;  4A3C C;  3HKZ L;  4A3B C;  1TWG K;  3EQL A;  3M4O K;  5IP9 K;  4Y7N K;  4LK0 A;  3GTP K;  2E2H C;  2E2J K;  2NVX C;  2A68 A;  3GTL C;  2PA8 D;  4ZH4 A;  5C4J K;  4Y52 K;  2WB1 D;  3GTG K;  1K83 C;  2A69 A;  3HOW C;  4G7H A;  3PO3 C;  3M3Y K;  4A93 C;  5IYB K;  2YU9 K;  2WAQ L;  3GTM K;  4BXX C;  3GTJ K;  4XLP A;  1I6H C;  3HOX C;  3FKI C;  5FLM K;  4C2M K;  1WCM C;  2JA8 K;  3S1Q C;  2VUM C;  3RZO C;  4BY1 C;  1ZYR A;  4OIQ A;  3S2H K;  4A3C K;  2A6E A;  2B63 K;  1I3Q C;  1SMY A;  4C3H K;  3HOU C;  1TWA C;  4G7Z A;  2NVX K;  4QIW D;  4MEY A;  5C44 C;  1Y1W C;  4AYB D;  3GTL K;  2E2I K;  3DXJ A;  3PO3 K;  2JA6 C;  3PO2 K;  4A3F K;  2PMZ L;  3GTQ K;  4A3K C;  3HOY K;  2NVT C;  4A93 K;  1I6H K;  5C4X K;  4BXX K;  4JK1 A;  3GTO C;  1TWC C;  3FKI K;  3HOX K;  3H3V L;  3CQZ C;  3S2D C;  1SFO C;  4A3M C;  5IYD C;  2JA7 K;  3S17 K;  1WCM K;  3S16 C;  4NOI A;  1TWF C;  4C3I K;  4Q4Z A;  4YFX A;  1I50 K;  5D4D A;  3HOV C;  2PA8 L;  3S1R C;  4BBS C;  1Y1V C;  2WB1 L;  5IYC C;  3I4N C;  4A3G C;  4A3L K;  1I3Q K;  1I6V A;  4KMU A;  4A3J C;  3HOZ K;  3S14 K;  4MEX A;  2JA5 C;  2BE5 A;  4OIN A;  3RZD C;  1Y1W K;  4MQ9 A;  2R7Z K;  3S15 K;  3GTK K;  5IP7 C;  1TWH C;  4BBR C;  4A3B K;  4A3K K;  1YNN A;  2NVT K;  2PPB A;  4KN7 A;  4A3I C;  3K7A C;  3H0G C;  2E2H K;  4A3E C;  3CQZ K;  3GTO K;  1SFO K;  4A3M K;  2O5J A;  2Y0S D;  1YNJ A;  4BY7 C;  2NVQ C;  1K83 K;  5M3F K;  2R92 C;  4LJZ A;  3HOW K;  4OIP A;  4OIR A;  3HOV K;  3S1M C;  4BBS K;  4AYB L;  4X6A C;  1TWG C;  4XSX A;  1XPP A;  3M4O C;  4Y7N C;  3GTP C;  3S1N C;  2E2J C;  3S1Q K;  2VUM K;  3I4M C;  2R93 C;  3RZO K;  5C4J C;  4BY1 K;  5TMC A;  4G7O A;  4YFK A;  5C3E C;  1R9T C;  5IYB C;  4BBR K;  3GTJ C;  4XSZ A;  3HOU K;  5FLM C;  1TWA K;  4A3E K;  2A6H A;  5C44 K;  3HKZ D;  4YG2 A;  2NVQ K;  5M5W K;  2R92 K;  2JA6 K;  5M3M K;  3S2H C;  2CW0 A; 
#chains in the Genus database with same CATH topology
 3H3V D;  1EFW A;  2P8T A;  3S2D K;  5IYD K;  3LAJ A;  5M5Y K;  2E2I C;  4QIW L;  3S1R K;  2O5I A;  2Y0S L;  1VLO A;  2ZFZ A;  5TMF A;  4GZY A;  5E68 A;  5C4X C;  5IP9 C;  1Y1W A;  4WJ4 A;  2JA5 K;  2JA7 C;  4YFN A;  4C3J K;  1O2F B;  2JH3 A;  4GTB A;  3LAP A;  5IP7 K;  1I50 C;  3M3Y C;  3GTO A;  2YU9 C;  2E2H A;  1SFO A;  4M1X A;  2GSN A;  3A8K A;  4QJV A;  4A3L C;  1USM A;  3L4K A;  3HXA A;  2ZUF A;  3S15 C;  5CHP A;  4A3C C;  3HKZ L;  1O2A A;  1INN A;  3EQL A;  3M4O K;  5IP9 K;  4Y7N K;  4ILD A;  2A68 A;  2PA8 D;  3FOE A;  1K83 C;  1IQ0 A;  3HOW C;  1XZQ B;  3M3Y K;  2YU9 K;  2WAQ L;  4BXX C;  3GTJ K;  3FKI C;  3TFH A;  1YX2 A;  5IOT A;  3RZO C;  4A3C K;  2A6E A;  1TWF A;  5TJ3 A;  1WOO A;  1TWA C;  1WQF A;  1Y1V A;  1Y1W C;  1R9T A;  2JA6 C;  4A3F K;  2PMZ L;  2NVT C;  4BXX K;  3GTO C;  4PAA A;  3FKI K;  1VH2 A;  4KMH A;  3H3V L;  1SFO C;  4Q4Z A;  1F7V A;  3SZY A;  5D4D A;  1JOE A;  1ISE A;  1WOP A;  3OEP A;  3T01 A;  3GSI A;  4A3G C;  1XZP B;  3S14 K;  4MEX A;  3RZD C;  1Y1W K;  1X31 C;  1TWG A;  4KM9 A;  1XXA A;  4A3B K;  2NVT K;  3G4C A;  2PPB A;  3GTO K;  3K7A C;  3H0G C;  2E2H K;  5EGH A;  4FM9 A;  1SFO K;  2Y0S D;  4DDQ A;  1J6W A;  4LJZ A;  4OIR A;  4X6A C;  1O27 A;  3S1N C;  3BP3 A;  4G7O A;  1R9T C;  2RH6 A;  4KB2 A;  5IYB C;  3FOF A;  5FLM C;  2E2I A;  3AD7 C;  5C44 K;  1IBA A;  1O2B A;  3HKZ D;  3VA7 A;  4YG2 A;  3S2H C;  2CW0 A;  2JA7 A;  4X6A K;  4KAT A;  2B63 C;  1IS1 A;  1JVI A;  2XCO A;  4XLN A;  1I50 A;  3S1N K;  1TWF K;  2WAQ D;  4Q5S A;  1Y1V K;  3I4N K;  3HOY C;  1R9T K;  5JVO A;  4KN4 A;  5IOR A;  4A3J K;  3S17 C;  4Y52 C;  2GAH C;  4OIO A;  4KAR A;  2V6U A;  3WOD A;  1WQH A;  3BP8 C;  4A3I K;  1K83 A;  4C2M C;  3HOZ C;  1HQM A;  4BY7 K;  2PMZ D;  2V6S A;  2R7Z C;  3S1M K;  1TWG K;  4GTA A;  2D6F C;  1J6V A;  1WOS A;  1J6X A;  4Y52 K;  1DCP A;  1BJT A;  3N0B A;  3PO3 C;  1TWA A;  3GEE A;  4KMA A;  4C2M K;  4KAS A;  2JA6 A;  4C3I C;  2KWA A;  2V6T A;  1O28 A;  1ZQ1 C;  4GTF A;  3V4G A;  4P5A A;  2R93 A;  1PJ7 A;  3HOU C;  4G7Z A;  4MEY A;  4XCH A;  4GTC A;  3AH5 A;  2E2I K;  3PO3 K;  1ZVU A;  1EH1 A;  5HL8 A;  4A3K C;  5C4X K;  1O25 A;  1TWC C;  1XXC A;  3S16 C;  2JA7 K;  4BLB A;  4C3I K;  3MML B;  1O24 A;  1I50 K;  3H0G A;  2WB1 L;  5IYC C;  3GEI A;  4A3L K;  4GFQ A;  4WJ3 M;  1ZXO A;  1UV7 A;  3S15 K;  1TWH C;  4BBR C;  4A3K K;  4G0W A;  1YNJ A;  5IOS A;  1K83 K;  3HOW K;  5CJ9 A;  5EGE A;  1C0A A;  4AH6 A;  3GTP C;  2E2J C;  2R93 C;  3RZO K;  5C4J C;  4LQY A;  1VGX A;  1VJE A;  2B63 A;  5TMC A;  4YFK A;  5C3E C;  4BBR K;  1IL2 A;  2NVX A;  4XSZ A;  1TWA K;  2XCQ A;  4PAB A;  4BLA A;  2GSO A;  3OPF A;  5M5W K;  2JA6 K;  2XCR B;  5M5X K;  1WCM A;  1EK8 A;  1AB4 A;  4KAW X;  1USO A;  4C3H C;  5FJ8 K;  4LOW A;  2R93 K;  2NVY C;  3PO2 C;  1HI9 A;  5C3E K;  3GTQ C;  4A3G K;  4KC6 A;  4QJV B;  1WIH A;  2R7Z A;  4KDD A;  4LK1 A;  3RZD K;  1RU0 A;  4KM8 A;  3GDZ A;  3CQZ A;  3JST A;  4FZB A;  4J3N A;  3K7A K;  3H0G K;  2JA8 C;  2GAG C;  1DCO A;  3NUH A;  3L4J A;  3ADA C;  2NVY K;  3CAG A;  3GTK C;  3BUE A;  1GE9 A;  3GIR A;  4LK0 A;  5JFE A;  2NVX C;  2WB1 D;  2A69 A;  4G0U A;  5IYB K;  3HOX C;  5FLM K;  2R92 A;  3T00 A;  2JA8 K;  1WCM C;  3S1Q C;  2VUM C;  4GTD A;  4BY1 C;  1ZYR A;  1TWC A;  3S2H K;  3QX3 A;  1WQG A;  2B63 K;  3A8J A;  2NVX K;  2FQO A;  3DXJ A;  3N0C A;  1YCL A;  3HOY K;  3FHZ A;  3LPX A;  3HOX K;  3S2D C;  3CQZ C;  3TFI A;  5IYD C;  3S17 K;  1WCM K;  1TWH A;  1JQW A;  4YFX A;  3AQP A;  5IOQ A;  3S1R C;  3HOV C;  4BBS C;  1J98 A;  3HOZ K;  2JA5 C;  2BE5 A;  1O29 A;  4MQ9 A;  2R7Z K;  2P5M A;  5IP7 C;  3ERE D;  3GTP A;  1YNN A;  1DD5 A;  1F93 A;  1XZP A;  4KN7 A;  1B4A A;  3GTG A;  1B4B A;  3CQZ K;  2O5J A;  1BGW A;  3GTM A;  2NVQ C;  3A8I A;  2R92 C;  4OIP A;  3HOV K;  4BBS K;  4AYB L;  4WIL A;  4XSX A;  1XPP A;  3M4O C;  4Y7N C;  3I4M C;  1F9N A;  2EBB A;  1EI6 A;  4P9S A;  3GTJ C;  3GTL A;  2NVY A;  3HOU K;  5L46 A;  3GTQ A;  2NVQ K;  2R92 K;  4LR2 A;  4LLG A;  2RGR A;  1L0W A;  4BKW A;  1BDF A;  1TWC K;  4A3D C;  2Y3P A;  3S16 K;  3TTG A;  2ZUE A;  3I4M K;  4O2D A;  4KMD A;  1I3Q A;  4A3F C;  5IYC K;  3IPJ A;  3GTK A;  3GTG C;  2FQT A;  4G0V A;  1TWH K;  3GTM C;  4P5B A;  4A3D K;  3S14 C;  1BS2 A;  1IW7 A;  2W7V A;  1V5V A;  3GEH A;  4A3B C;  2VUM A;  3AD9 C;  2CFA A;  3GTP K;  2E2H C;  2E2J K;  4GTE A;  3GTL C;  4ZH4 A;  2GSU A;  2PHC B;  5C4J K;  3GTG K;  1KQ4 A;  4G7H A;  1O26 A;  1WOR A;  4A93 C;  1I6H C;  4KB4 A;  3GTM K;  4XLP A;  1DCH A;  4OIQ A;  4C45 A;  4GT9 A;  1I3Q C;  1SMY A;  1EQR A;  4C3H K;  3AQO A;  4QIW D;  5C44 C;  3GTL K;  4AYB D;  3G4A A;  3PO2 K;  1G51 A;  1IE0 A;  3GTQ K;  4A93 K;  1I6H K;  2JA5 A;  4JK1 A;  1WSR A;  4A3M C;  4NOI A;  1TWF C;  1VRQ C;  1PJ6 A;  1ZBS A;  2PA8 L;  3AD8 C;  1Y1V C;  3I4N C;  1I3Q K;  1I6V A;  3ORE A;  4KMU A;  4A3J C;  3SZZ A;  4OIN A;  3GTK K;  1XZQ A;  3T02 A;  1F7U A;  4RMF A;  4A3I C;  4A3E C;  3S0X A;  4A3M K;  4BY7 C;  2YU9 A;  5M3F K;  3GTJ A;  3S1M C;  3Q3Q A;  1TWG C;  1XXB A;  3S1Q K;  2VUM K;  4BY1 K;  3N3Y A;  4GTL A;  1WSV A;  2CFA B;  4A3E K;  2A6H A;  4C3J C;  3TFJ A;  5M3M K;  3FKI A;  1PJ5 A; 
#chains in the Genus database with same CATH homology
 5M5X K;  4LLG A;  3H3V D;  4X6A K;  1BDF A;  1TWC K;  2B63 C;  4A3D C;  3S2D K;  4XLN A;  3S16 K;  5IYD K;  3S1N K;  1TWF K;  5FJ8 K;  3I4M K;  2R93 K;  2NVY C;  5M5Y K;  2WAQ D;  4Q5S A;  2E2I C;  4QIW L;  3S1R K;  2O5I A;  2Y0S L;  3PO2 C;  1Y1V K;  4A3F C;  5TMF A;  5IYC K;  5C3E K;  3GTQ C;  3I4N K;  1R9T K;  3HOY C;  4QJV B;  4GZY A;  4A3G K;  5C4X C;  5IP9 C;  4KN4 A;  4A3J K;  4LK1 A;  2JA5 K;  2JA7 C;  3S17 C;  4YFN A;  4Y52 C;  4C3J K;  3RZD K;  3GTG C;  5IP7 K;  1I50 C;  3M3Y C;  4OIO A;  1TWH K;  2YU9 C;  3GTM C;  3WOD A;  4QJV A;  4A3I K;  4A3D K;  3K7A K;  3H0G K;  4A3L C;  2JA8 C;  3HOZ C;  3S14 C;  1HQM A;  4BY7 K;  2PMZ D;  1IW7 A;  2NVY K;  2R7Z C;  3S1M K;  3GTK C;  3S15 C;  4A3C C;  3HKZ L;  4A3B C;  1TWG K;  3EQL A;  3M4O K;  5IP9 K;  4Y7N K;  4LK0 A;  3GTP K;  2E2H C;  2E2J K;  2NVX C;  2A68 A;  3GTL C;  2PA8 D;  4ZH4 A;  5C4J K;  4Y52 K;  2WB1 D;  3GTG K;  1K83 C;  2A69 A;  3HOW C;  4G7H A;  3PO3 C;  3M3Y K;  4A93 C;  5IYB K;  2YU9 K;  2WAQ L;  3GTM K;  4BXX C;  3GTJ K;  4XLP A;  1I6H C;  3HOX C;  3FKI C;  5FLM K;  4C2M K;  1WCM C;  2JA8 K;  3S1Q C;  2VUM C;  3RZO C;  4BY1 C;  1ZYR A;  4OIQ A;  3S2H K;  4A3C K;  2A6E A;  2B63 K;  1I3Q C;  1SMY A;  4C3H K;  3HOU C;  1TWA C;  4G7Z A;  2NVX K;  4QIW D;  4MEY A;  5C44 C;  1Y1W C;  4AYB D;  3GTL K;  2E2I K;  3DXJ A;  3PO3 K;  2JA6 C;  3PO2 K;  4A3F K;  2PMZ L;  3GTQ K;  4A3K C;  3HOY K;  2NVT C;  4A93 K;  1I6H K;  5C4X K;  4BXX K;  4JK1 A;  3GTO C;  1TWC C;  3FKI K;  3HOX K;  3H3V L;  3CQZ C;  3S2D C;  1SFO C;  4A3M C;  5IYD C;  2JA7 K;  3S17 K;  1WCM K;  3S16 C;  4NOI A;  1TWF C;  4C3I K;  4Q4Z A;  4YFX A;  1I50 K;  5D4D A;  3HOV C;  2PA8 L;  3S1R C;  4BBS C;  1Y1V C;  2WB1 L;  5IYC C;  3I4N C;  4A3G C;  4A3L K;  1I3Q K;  1I6V A;  4KMU A;  4A3J C;  3HOZ K;  3S14 K;  4MEX A;  2JA5 C;  2BE5 A;  4OIN A;  3RZD C;  1Y1W K;  4MQ9 A;  2R7Z K;  3S15 K;  3GTK K;  5IP7 C;  1TWH C;  4BBR C;  4A3B K;  4A3K K;  1YNN A;  2NVT K;  2PPB A;  4KN7 A;  4A3I C;  3K7A C;  3H0G C;  2E2H K;  4A3E C;  3CQZ K;  3GTO K;  1SFO K;  4A3M K;  2O5J A;  2Y0S D;  1YNJ A;  4BY7 C;  2NVQ C;  1K83 K;  5M3F K;  2R92 C;  4LJZ A;  3HOW K;  4OIP A;  4OIR A;  3HOV K;  3S1M C;  4BBS K;  4AYB L;  4X6A C;  1TWG C;  4XSX A;  1XPP A;  3M4O C;  4Y7N C;  3GTP C;  3S1N C;  2E2J C;  3S1Q K;  2VUM K;  3I4M C;  2R93 C;  3RZO K;  5C4J C;  4BY1 K;  5TMC A;  4G7O A;  4YFK A;  5C3E C;  1R9T C;  5IYB C;  4BBR K;  3GTJ C;  4XSZ A;  3HOU K;  5FLM C;  1TWA K;  4A3E K;  2A6H A;  5C44 K;  3HKZ D;  4YG2 A;  2NVQ K;  5M5W K;  2R92 K;  2JA6 K;  5M3M K;  3S2H C;  2CW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...