3S1MK

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/rna/dna
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1mK00
3GTLK 2YU9K 2CW0A 1TWGC 3RZDK 2WB1D 5C4JK 2NVXC 4OIQA 1I6VA 1TWCK 3GTJK 3EQLA 5IP7C 4YG2A 2NVTC 5C44K 3H3VD 1I6HC 1ZYRA 4MQ9A 5C4XC 5C4XK 4OINA 2NVTK 1TWAC 3H0GC 4BY1K 3GTPC 3S15K 4C3JK 2PPBA 3HOYK 5M3FK 2PMZL 4Y52C 3PO3K 4A93K 3HOZC 3I4MC 5FLMK 2O5JA 2A6EA 4OIOA 3GTJC 2E2JK 4A3MK 4A3KC 4QJVB 3PO2C 4LLGA 4BBSK 5IYDC 2WB1L 1TWFC 4BBSC 4A3EC 3M3YK 1Y1VK 4QJVA 3S1MK 2NVQC 2JA8C 1I3QK 4A3CC 2R93K 2PA8D 3HOZK 3FKIC 4A3JK 3CQZC 2JA5C 3GTKK 3CQZK 2R92C 1I50C 1K83K 3DXJA 3RZOC 3S14K 4A3FK 3HOWK 4A3DK 3HOYC 3S15C 2E2HK 4LK0A 4XLNA 1TWAK 3GTQC 3M3YC 4A3EK 4A3DC 5IYCC 4QIWL 4OIPA 4Y7NK 3S17C 1SFOC 4Q4ZA 3HKZL 5IP9C 4C3IK 1R9TK 1I3QC 3S1QC 2WAQL 1WCMK 4AYBL 5M5XK 4XSZA 5IYBK 2R7ZC 4X6AK 4G7HA 1TWFK 3HOUC 4C2MK 2O5IA 3K7AC 3S1RC 3H3VL 3S2HK 4MEXA 3S1NK 3I4MK 4YFKA 5C44C 3WODA 3M4OK 3S2DK 1I6HK 2E2IK 2A69A 2Y0SD 4XSXA 4LJZA 4LK1A 2PMZD 4JK1A 3S1QK 4MEYA 4ZH4A 2BE5A 3GTLC 4YFNA 2A68A 3HKZD 4Y7NC 4OIRA 3S17K 3S2DC 2NVQK 3S1MC 5IP7K 2JA6K 4A3IK 3HOWC 3GTMC 2NVYK 5M5WK 3S14C 3GTMK 1I50K 3RZOK 3PO2K 2YU9C 2E2JC 5IYBC 4X6AC 3GTOC 3HOVC 2JA8K 2R93C 1Y1WK 1YNJA 5FLMC 1IW7A 3PO3C 1SFOK 4A93C 5C3EC 4Y52K 2Y0SL 4A3IC 5M5YK 1HQMA 3H0GK 3GTPK 1BDFA 4C3HK 2JA7C 4A3GK 5D4DA 4BBRC 3I4NK 2VUMK 3FKIK 4KMUA 2WAQD 2B63K 4A3CK 5C4JC 4AYBD 4A3LK 5C3EK 4YFXA 2E2IC 4GZYA 1TWHK 4BXXC 2R7ZK 3M4OC 4G7ZA 5IYDK 3S16K 1XPPA 4A3KK 3GTGK 4A3BC 3GTOK 3K7AK 3S1RK 2VUMC 4G7OA 3I4NC 5TMCA 3S16C 2JA7K 4A3GC 2A6HA 5IYCK 1TWGK 5TMFA 3RZDC 1TWHC 4BXXK 1WCMC 4A3LC 4Q5SA 2B63C 4BY7C 4A3FC 1R9TC 3HOXC 4KN4A 1K83C 5IP9K 2PA8L 5M3MK 4BY1C 3GTKC 4BBRK 3HOXK 1Y1WC 5FJ8K 2E2HC 1TWCC 4KN7A 3GTQK 2NVXK 1SMYA 2NVYC 3S1NC 4QIWD 2R92K 3S2HC 1YNNA 4A3MC 2JA6C 4A3JC 2JA5K 3GTGC 4XLPA 4A3BK 4BY7K 4NOIA 3HOVK 3HOUK 1Y1VC
chains in the Genus database with same CATH superfamily
3GTLK 1VLOA 2CW0A 3GSIA 5C4JK 1TWHA 5C44K 2GAHC 1PJ5A 5C4XK 3BP3A 1TWAC 3H0GC 3GTPC 1WIHA 3CQZA 4GTBA 2PPBA 4G0UA 3S15K 5M3FK 4KDDA 4A93K 4GTDA 5FLMK 5L46A 2O5JA 4OIOA 1WORA 1O29A 4QJVB 4LOWA 4BBSC 1TWFC 4A3EC 4J3NA 4A3CC 2JA8C 1I3QK 1WOPA 1WSVA 4C3IC 4G0VA 3FKIC 3HOZK 3CQZK 1I50C 3S14K 3FKIA 3S15C 4LK0A 4XLNA 1ZBSA 1F9NA 5IP9C 1I3QC 1ISEA 5M5XK 2V6SA 3FHZA 4KAWX 4KM9A 3S1RC 3H3VL 4MEXA 3I4MK 4YFKA 3M4OK 3WODA 1I6HK 2E2IK 2Y0SD 4LJZA 2PMZD 4JK1A 3V4GA 4WILA 1XXAA 1WQFA 2E2IA 2NVQK 3S1MC 4GTLA 1IE0A 4A3IK 1EI6A 3GTMK 2R93A 3PO2K 2XCQA 5FLMC 1WOOA 3GEHA 1B4BA 4GTAA 3GDZA 2JA7C 5D4DA 3I4NK 3GIRA 2VUMK 3FKIK 3OREA 2EBBA 2WAQD 4AYBD 4A3LK 3AH5A 4YFXA 1EK8A 1I3QA 2NVYA 3K7AK 2JA7K 2A6HA 4BLAA 1ZVUA 5TMFA 3ERED 1WQGA 4Q5SA 3HOXC 2NVXA 1K83C 2PA8L 3GTQA 1BS2A 1Y1WC 1PJ7A 4FZBA 5CHPA 1TWCC 1ZXOA 2NVYC 4GTFA 3S1NC 2R92K 1YNNA 3L4JA 4A3BK 3HOUK 2JA6A 3G4CA 4LR2A 1J6VA 1XXCA 3FOFA 1TWCK 2ZUFA 5IP7C 4YG2A 1O27A 2NVTC 2A6EA 4G0WA 1TWGA 1B4AA 2V6TA 4KB2A 3M3YK 4A3JK 2JA5C 3GTKK 3A8KA 3RZOC 4A3DK 1WQHA 3GTKA 1IS1A 2E2HK 4A3EK 1O25A 4QIWL 4Y7NK 3S17C 1SFOC 4PAAA 4GFQA 1VGXA 4C3IK 1SFOA 3S1QC 1DD5A 3SZZA 4C2MK 2O5IA 1HI9A 3S1NK 5C44C 4ILDA 4LK1A 3S1QK 4GT9A 1EH1A 2Y3PA 4MEYA 5EGHA 4ZH4A 3A8IA 5JFEA 4YFNA 4Y7NC 4OIRA 1DCHA 3S17K 1USOA 5IP7K 2JA6K 1ZQ1C 4C45A 3HOWC 4KMDA 5IYBC 4X6AC 3HOVC 2GSNA 1O2BA 2JA8K 1C0AA 3PO3C 4A3IC 3T02A 4DDQA 1BDFA 4C3HK 1O2AA 4A3GK 4LQYA 4FM9A 5C4JC 1DCOA 4BXXC 1TWCA 4BLBA 1Y1VA 4A3KK 4A3BC 3S1RK 2VUMC 4G7OA 3I4NC 5TMCA 1JOEA 3G4AA 4A3GC 5IYCK 1IBAA 4A3LC 4KM8A 4BY7C 4A3FC 1R9TC 2R92A 5HL8A 4BBRK 1XZPA 3HOXK 4KC6A 2KWAA 3ADAC 1VRQC 4KN7A 5FJ8K 3GTQK 4GTCA 2NVXK 3OPFA 1X31C 5IOQA 1VH2A 2JA6C 4BY7K 1JVIA 4KMAA 3BUEA 3RZDK 2WB1D 5IOSA 2RGRA 2JA5A 1I6VA 3GTJK 1VJEA 3EQLA 1DCPA 5JVOA 2FQOA 3H3VD 5C4XC 4RMFA 4OINA 3T00A 2NVTK 1K83A 4BY1K 4C3JK 3L4KA 2PMZL 5E68A 1XZPB 3PO3K 3I4MC 1XXBA 3GTJC 1O2FB 4A3MK 4BBSK 5EGEA 2WB1L 3AD8C 3MMLB 3S1MK 2NVQC 2R93K 3CQZC 1PJ6A 2XCRB 1F7VA 2B63A 1K83K 4A3FK 3HOYC 3M3YC 3AD9C 4A3DC 5IYCC 1KQ4A 4WJ3M 1IL2A 1R9TK 1J6WA 5IYBK 4X6AK 2R7ZC 2V6UA 3OEPA 3HOUC 2ZFZA 2JH3A 1I50A 4AH6A 3N3YA 3AQOA 2A69A 4O2DA 4XSXA 4P5BA 3TFIA 2BE5A 2A68A 3HKZD 1J6XA 4KASA 3GTLA 4KATA 3GTMC 5M5WK 2ZUEA 3S14C 1I50K 2YU9C 4P9SA 5CJ9A 2P5MA 1Y1WK 1IW7A 2GSUA 5C3EC 1R9TA 4Y52K 4KMHA 4BBRC 4KMUA 2B63K 2E2IC 3GTOA 1TWHK 3GTGA 3M4OC 4G7ZA 5IYDK 3S16K 2R7ZA 3RZDC 4BXXK 2B63C 2P8TA 3H0GA 4KN4A 4BY1C 3GTPA 1YCLA 1WSRA 2W7VA 1F7UA 3GEIA 3GTJA 4QIWD 2GAGC 3S2HC 4A3MC 4A3JC 2JA5K 3GTGC 3N0BA 4NOIA 1BJTA 3A8JA 3HOVK 1O28A 2YU9K 3N0CA 1TWGC 1O26A 2NVXC 4OIQA 4P5AA 2CFAB 5IOTA 1I6HC 1ZYRA 4MQ9A 3LAPA 3HOYK 1USMA 4C2MC 4Y52C 2RH6A 3HOZC 3T01A 1RU0A 1YX2A 2GSOA 2E2JK 3Q3QA 2PHCB 4A3KC 3PO2C 1GE9A 4LLGA 5IYDC 5IORA 2FQTA 3IPJA 1Y1VK 4QJVA 1TWAA 2PA8D 1XZQA 1L0WA 1AB4A 2R92C 3DXJA 3TFHA 3HOWK 3BP8C 3GTQC 1TWAK 1F93A 1UV7A 4OIPA 4Q4ZA 3HKZL 2WAQL 1WCMK 4GTEA 4AYBL 4XSZA 4G7HA 1TWFK 3AQPA 1WOSA 1TWFA 3K7AC 1O24A 3S2HK 1WCMA 5TJ3A 2XCOA 3LAJA 1INNA 4WJ4A 3QX3A 4C3JC 3LPXA 3CAGA 3GTLC 3HXAA 3S2DC 3TTGA 3AD7C 2JA7A 2NVYK 4KB4A 3RZOK 2E2JC 3GTOC 1EFWA 2R93C 1YNJA 4A93C 1SFOK 2VUMA 2Y0SL 1G51A 5M5YK 1HQMA 3NUHA 3H0GK 3GTPK 3JSTA 4PABA 1IQ0A 4C3HC 3S0XA 2E2HA 1JQWA 3SZYA 1V5VA 4A3CK 4GZYA 4BKWA 5C3EK 2R7ZK 4M1XA 3GTMA 1XPPA 3GTGK 1XZQB 3GTOK 1EQRA 2YU9A 2CFAA 3S16C 1TWGK 4XCHA 1TWHC 1WCMC 5M3MK 5IP9K 2D6FC 3GTKC 3TFJA 1BGWA 4KARA 3VA7A 2E2HC 3GEEA 1Y1WA 1SMYA 1J98A 4XLPA 3S2DK 3FOEA 1Y1VC
chains in the Genus database with same CATH topology
3GTLK 2YU9K 2CW0A 1TWGC 3RZDK 2WB1D 5C4JK 2NVXC 4OIQA 1I6VA 1TWCK 3GTJK 3EQLA 5IP7C 4YG2A 2NVTC 5C44K 3H3VD 1I6HC 1ZYRA 4MQ9A 5C4XC 5C4XK 4OINA 2NVTK 1TWAC 3H0GC 4BY1K 3GTPC 3S15K 4C3JK 2PPBA 3HOYK 5M3FK 2PMZL 4Y52C 3PO3K 4A93K 3HOZC 3I4MC 5FLMK 2O5JA 2A6EA 4OIOA 3GTJC 2E2JK 4A3MK 4A3KC 4QJVB 3PO2C 4LLGA 4BBSK 5IYDC 2WB1L 1TWFC 4BBSC 4A3EC 3M3YK 1Y1VK 4QJVA 3S1MK 2NVQC 2JA8C 1I3QK 4A3CC 2R93K 2PA8D 3HOZK 3FKIC 4A3JK 3CQZC 2JA5C 3GTKK 3CQZK 2R92C 1I50C 1K83K 3DXJA 3RZOC 3S14K 4A3FK 3HOWK 4A3DK 3HOYC 3S15C 2E2HK 4LK0A 4XLNA 1TWAK 3GTQC 3M3YC 4A3EK 4A3DC 5IYCC 4QIWL 4OIPA 4Y7NK 3S17C 1SFOC 4Q4ZA 3HKZL 5IP9C 4C3IK 1R9TK 1I3QC 3S1QC 2WAQL 1WCMK 4AYBL 5M5XK 4XSZA 5IYBK 2R7ZC 4X6AK 4G7HA 1TWFK 3HOUC 4C2MK 2O5IA 3K7AC 3S1RC 3H3VL 3S2HK 4MEXA 3S1NK 3I4MK 4YFKA 5C44C 3WODA 3M4OK 3S2DK 1I6HK 2E2IK 2A69A 2Y0SD 4XSXA 4LJZA 4LK1A 2PMZD 4JK1A 3S1QK 4MEYA 4ZH4A 2BE5A 3GTLC 4YFNA 2A68A 3HKZD 4Y7NC 4OIRA 3S17K 3S2DC 2NVQK 3S1MC 5IP7K 2JA6K 4A3IK 3HOWC 3GTMC 2NVYK 5M5WK 3S14C 3GTMK 1I50K 3RZOK 3PO2K 2YU9C 2E2JC 5IYBC 4X6AC 3GTOC 3HOVC 2JA8K 2R93C 1Y1WK 1YNJA 5FLMC 1IW7A 3PO3C 1SFOK 4A93C 5C3EC 4Y52K 2Y0SL 4A3IC 5M5YK 1HQMA 3H0GK 3GTPK 1BDFA 4C3HK 2JA7C 4A3GK 5D4DA 4BBRC 3I4NK 2VUMK 3FKIK 4KMUA 2WAQD 2B63K 4A3CK 5C4JC 4AYBD 4A3LK 5C3EK 4YFXA 2E2IC 4GZYA 1TWHK 4BXXC 2R7ZK 3M4OC 4G7ZA 5IYDK 3S16K 1XPPA 4A3KK 3GTGK 4A3BC 3GTOK 3K7AK 3S1RK 2VUMC 4G7OA 3I4NC 5TMCA 3S16C 2JA7K 4A3GC 2A6HA 5IYCK 1TWGK 5TMFA 3RZDC 1TWHC 4BXXK 1WCMC 4A3LC 4Q5SA 2B63C 4BY7C 4A3FC 1R9TC 3HOXC 4KN4A 1K83C 5IP9K 2PA8L 5M3MK 4BY1C 3GTKC 4BBRK 3HOXK 1Y1WC 5FJ8K 2E2HC 1TWCC 4KN7A 3GTQK 2NVXK 1SMYA 2NVYC 3S1NC 4QIWD 2R92K 3S2HC 1YNNA 4A3MC 2JA6C 4A3JC 2JA5K 3GTGC 4XLPA 4A3BK 4BY7K 4NOIA 3HOVK 3HOUK 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL K;  2YU9 K;  2CW0 A;  1TWG C;  3RZD K;  2WB1 D;  5C4J K;  2NVX C;  4OIQ A;  1I6V A;  1TWC K;  3GTJ K;  3EQL A;  5IP7 C;  4YG2 A;  2NVT C;  5C44 K;  3H3V D;  1I6H C;  1ZYR A;  4MQ9 A;  5C4X C;  5C4X K;  4OIN A;  2NVT K;  1TWA C;  3H0G C;  4BY1 K;  3GTP C;  3S15 K;  4C3J K;  2PPB A;  3HOY K;  5M3F K;  2PMZ L;  4Y52 C;  3PO3 K;  4A93 K;  3HOZ C;  3I4M C;  5FLM K;  2O5J A;  2A6E A;  4OIO A;  3GTJ C;  2E2J K;  4A3M K;  4A3K C;  4QJV B;  3PO2 C;  4LLG A;  4BBS K;  5IYD C;  2WB1 L;  1TWF C;  4BBS C;  4A3E C;  3M3Y K;  1Y1V K;  4QJV A;  3S1M K;  2NVQ C;  2JA8 C;  1I3Q K;  4A3C C;  2R93 K;  2PA8 D;  3HOZ K;  3FKI C;  4A3J K;  3CQZ C;  2JA5 C;  3GTK K;  3CQZ K;  2R92 C;  1I50 C;  1K83 K;  3DXJ A;  3RZO C;  3S14 K;  4A3F K;  3HOW K;  4A3D K;  3HOY C;  3S15 C;  2E2H K;  4LK0 A;  4XLN A;  1TWA K;  3GTQ C;  3M3Y C;  4A3E K;  4A3D C;  5IYC C;  4QIW L;  4OIP A;  4Y7N K;  3S17 C;  1SFO C;  4Q4Z A;  3HKZ L;  5IP9 C;  4C3I K;  1R9T K;  1I3Q C;  3S1Q C;  2WAQ L;  1WCM K;  4AYB L;  5M5X K;  4XSZ A;  5IYB K;  2R7Z C;  4X6A K;  4G7H A;  1TWF K;  3HOU C;  4C2M K;  2O5I A;  3K7A C;  3S1R C;  3H3V L;  3S2H K;  4MEX A;  3S1N K;  3I4M K;  4YFK A;  5C44 C;  3WOD A;  3M4O K;  3S2D K;  1I6H K;  2E2I K;  2A69 A;  2Y0S D;  4XSX A;  4LJZ A;  4LK1 A;  2PMZ D;  4JK1 A;  3S1Q K;  4MEY A;  4ZH4 A;  2BE5 A;  3GTL C;  4YFN A;  2A68 A;  3HKZ D;  4Y7N C;  4OIR A;  3S17 K;  3S2D C;  2NVQ K;  3S1M C;  5IP7 K;  2JA6 K;  4A3I K;  3HOW C;  3GTM C;  2NVY K;  5M5W K;  3S14 C;  3GTM K;  1I50 K;  3RZO K;  3PO2 K;  2YU9 C;  2E2J C;  5IYB C;  4X6A C;  3GTO C;  3HOV C;  2JA8 K;  2R93 C;  1Y1W K;  1YNJ A;  5FLM C;  1IW7 A;  3PO3 C;  1SFO K;  4A93 C;  5C3E C;  4Y52 K;  2Y0S L;  4A3I C;  5M5Y K;  1HQM A;  3H0G K;  3GTP K;  1BDF A;  4C3H K;  2JA7 C;  4A3G K;  5D4D A;  4BBR C;  3I4N K;  2VUM K;  3FKI K;  4KMU A;  2WAQ D;  2B63 K;  4A3C K;  5C4J C;  4AYB D;  4A3L K;  5C3E K;  4YFX A;  2E2I C;  4GZY A;  1TWH K;  4BXX C;  2R7Z K;  3M4O C;  4G7Z A;  5IYD K;  3S16 K;  1XPP A;  4A3K K;  3GTG K;  4A3B C;  3GTO K;  3K7A K;  3S1R K;  2VUM C;  4G7O A;  3I4N C;  5TMC A;  3S16 C;  2JA7 K;  4A3G C;  2A6H A;  5IYC K;  1TWG K;  5TMF A;  3RZD C;  1TWH C;  4BXX K;  1WCM C;  4A3L C;  4Q5S A;  2B63 C;  4BY7 C;  4A3F C;  1R9T C;  3HOX C;  4KN4 A;  1K83 C;  5IP9 K;  2PA8 L;  5M3M K;  4BY1 C;  3GTK C;  4BBR K;  3HOX K;  1Y1W C;  5FJ8 K;  2E2H C;  1TWC C;  4KN7 A;  3GTQ K;  2NVX K;  1SMY A;  2NVY C;  3S1N C;  4QIW D;  2R92 K;  3S2H C;  1YNN A;  4A3M C;  2JA6 C;  4A3J C;  2JA5 K;  3GTG C;  4XLP A;  4A3B K;  4BY7 K;  4NOI A;  3HOV K;  3HOU K;  1Y1V C; 
#chains in the Genus database with same CATH topology
 3GTL K;  1VLO A;  2CW0 A;  3GSI A;  5C4J K;  1TWH A;  5C44 K;  2GAH C;  1PJ5 A;  5C4X K;  3BP3 A;  1TWA C;  3H0G C;  3GTP C;  1WIH A;  3CQZ A;  4GTB A;  2PPB A;  4G0U A;  3S15 K;  5M3F K;  4KDD A;  4A93 K;  4GTD A;  5FLM K;  5L46 A;  2O5J A;  4OIO A;  1WOR A;  1O29 A;  4QJV B;  4LOW A;  4BBS C;  1TWF C;  4A3E C;  4J3N A;  4A3C C;  2JA8 C;  1I3Q K;  1WOP A;  1WSV A;  4C3I C;  4G0V A;  3FKI C;  3HOZ K;  3CQZ K;  1I50 C;  3S14 K;  3FKI A;  3S15 C;  4LK0 A;  4XLN A;  1ZBS A;  1F9N A;  5IP9 C;  1I3Q C;  1ISE A;  5M5X K;  2V6S A;  3FHZ A;  4KAW X;  4KM9 A;  3S1R C;  3H3V L;  4MEX A;  3I4M K;  4YFK A;  3M4O K;  3WOD A;  1I6H K;  2E2I K;  2Y0S D;  4LJZ A;  2PMZ D;  4JK1 A;  3V4G A;  4WIL A;  1XXA A;  1WQF A;  2E2I A;  2NVQ K;  3S1M C;  4GTL A;  1IE0 A;  4A3I K;  1EI6 A;  3GTM K;  2R93 A;  3PO2 K;  2XCQ A;  5FLM C;  1WOO A;  3GEH A;  1B4B A;  4GTA A;  3GDZ A;  2JA7 C;  5D4D A;  3I4N K;  3GIR A;  2VUM K;  3FKI K;  3ORE A;  2EBB A;  2WAQ D;  4AYB D;  4A3L K;  3AH5 A;  4YFX A;  1EK8 A;  1I3Q A;  2NVY A;  3K7A K;  2JA7 K;  2A6H A;  4BLA A;  1ZVU A;  5TMF A;  3ERE D;  1WQG A;  4Q5S A;  3HOX C;  2NVX A;  1K83 C;  2PA8 L;  3GTQ A;  1BS2 A;  1Y1W C;  1PJ7 A;  4FZB A;  5CHP A;  1TWC C;  1ZXO A;  2NVY C;  4GTF A;  3S1N C;  2R92 K;  1YNN A;  3L4J A;  4A3B K;  3HOU K;  2JA6 A;  3G4C A;  4LR2 A;  1J6V A;  1XXC A;  3FOF A;  1TWC K;  2ZUF A;  5IP7 C;  4YG2 A;  1O27 A;  2NVT C;  2A6E A;  4G0W A;  1TWG A;  1B4A A;  2V6T A;  4KB2 A;  3M3Y K;  4A3J K;  2JA5 C;  3GTK K;  3A8K A;  3RZO C;  4A3D K;  1WQH A;  3GTK A;  1IS1 A;  2E2H K;  4A3E K;  1O25 A;  4QIW L;  4Y7N K;  3S17 C;  1SFO C;  4PAA A;  4GFQ A;  1VGX A;  4C3I K;  1SFO A;  3S1Q C;  1DD5 A;  3SZZ A;  4C2M K;  2O5I A;  1HI9 A;  3S1N K;  5C44 C;  4ILD A;  4LK1 A;  3S1Q K;  4GT9 A;  1EH1 A;  2Y3P A;  4MEY A;  5EGH A;  4ZH4 A;  3A8I A;  5JFE A;  4YFN A;  4Y7N C;  4OIR A;  1DCH A;  3S17 K;  1USO A;  5IP7 K;  2JA6 K;  1ZQ1 C;  4C45 A;  3HOW C;  4KMD A;  5IYB C;  4X6A C;  3HOV C;  2GSN A;  1O2B A;  2JA8 K;  1C0A A;  3PO3 C;  4A3I C;  3T02 A;  4DDQ A;  1BDF A;  4C3H K;  1O2A A;  4A3G K;  4LQY A;  4FM9 A;  5C4J C;  1DCO A;  4BXX C;  1TWC A;  4BLB A;  1Y1V A;  4A3K K;  4A3B C;  3S1R K;  2VUM C;  4G7O A;  3I4N C;  5TMC A;  1JOE A;  3G4A A;  4A3G C;  5IYC K;  1IBA A;  4A3L C;  4KM8 A;  4BY7 C;  4A3F C;  1R9T C;  2R92 A;  5HL8 A;  4BBR K;  1XZP A;  3HOX K;  4KC6 A;  2KWA A;  3ADA C;  1VRQ C;  4KN7 A;  5FJ8 K;  3GTQ K;  4GTC A;  2NVX K;  3OPF A;  1X31 C;  5IOQ A;  1VH2 A;  2JA6 C;  4BY7 K;  1JVI A;  4KMA A;  3BUE A;  3RZD K;  2WB1 D;  5IOS A;  2RGR A;  2JA5 A;  1I6V A;  3GTJ K;  1VJE A;  3EQL A;  1DCP A;  5JVO A;  2FQO A;  3H3V D;  5C4X C;  4RMF A;  4OIN A;  3T00 A;  2NVT K;  1K83 A;  4BY1 K;  4C3J K;  3L4K A;  2PMZ L;  5E68 A;  1XZP B;  3PO3 K;  3I4M C;  1XXB A;  3GTJ C;  1O2F B;  4A3M K;  4BBS K;  5EGE A;  2WB1 L;  3AD8 C;  3MML B;  3S1M K;  2NVQ C;  2R93 K;  3CQZ C;  1PJ6 A;  2XCR B;  1F7V A;  2B63 A;  1K83 K;  4A3F K;  3HOY C;  3M3Y C;  3AD9 C;  4A3D C;  5IYC C;  1KQ4 A;  4WJ3 M;  1IL2 A;  1R9T K;  1J6W A;  5IYB K;  4X6A K;  2R7Z C;  2V6U A;  3OEP A;  3HOU C;  2ZFZ A;  2JH3 A;  1I50 A;  4AH6 A;  3N3Y A;  3AQO A;  2A69 A;  4O2D A;  4XSX A;  4P5B A;  3TFI A;  2BE5 A;  2A68 A;  3HKZ D;  1J6X A;  4KAS A;  3GTL A;  4KAT A;  3GTM C;  5M5W K;  2ZUE A;  3S14 C;  1I50 K;  2YU9 C;  4P9S A;  5CJ9 A;  2P5M A;  1Y1W K;  1IW7 A;  2GSU A;  5C3E C;  1R9T A;  4Y52 K;  4KMH A;  4BBR C;  4KMU A;  2B63 K;  2E2I C;  3GTO A;  1TWH K;  3GTG A;  3M4O C;  4G7Z A;  5IYD K;  3S16 K;  2R7Z A;  3RZD C;  4BXX K;  2B63 C;  2P8T A;  3H0G A;  4KN4 A;  4BY1 C;  3GTP A;  1YCL A;  1WSR A;  2W7V A;  1F7U A;  3GEI A;  3GTJ A;  4QIW D;  2GAG C;  3S2H C;  4A3M C;  4A3J C;  2JA5 K;  3GTG C;  3N0B A;  4NOI A;  1BJT A;  3A8J A;  3HOV K;  1O28 A;  2YU9 K;  3N0C A;  1TWG C;  1O26 A;  2NVX C;  4OIQ A;  4P5A A;  2CFA B;  5IOT A;  1I6H C;  1ZYR A;  4MQ9 A;  3LAP A;  3HOY K;  1USM A;  4C2M C;  4Y52 C;  2RH6 A;  3HOZ C;  3T01 A;  1RU0 A;  1YX2 A;  2GSO A;  2E2J K;  3Q3Q A;  2PHC B;  4A3K C;  3PO2 C;  1GE9 A;  4LLG A;  5IYD C;  5IOR A;  2FQT A;  3IPJ A;  1Y1V K;  4QJV A;  1TWA A;  2PA8 D;  1XZQ A;  1L0W A;  1AB4 A;  2R92 C;  3DXJ A;  3TFH A;  3HOW K;  3BP8 C;  3GTQ C;  1TWA K;  1F93 A;  1UV7 A;  4OIP A;  4Q4Z A;  3HKZ L;  2WAQ L;  1WCM K;  4GTE A;  4AYB L;  4XSZ A;  4G7H A;  1TWF K;  3AQP A;  1WOS A;  1TWF A;  3K7A C;  1O24 A;  3S2H K;  1WCM A;  5TJ3 A;  2XCO A;  3LAJ A;  1INN A;  4WJ4 A;  3QX3 A;  4C3J C;  3LPX A;  3CAG A;  3GTL C;  3HXA A;  3S2D C;  3TTG A;  3AD7 C;  2JA7 A;  2NVY K;  4KB4 A;  3RZO K;  2E2J C;  3GTO C;  1EFW A;  2R93 C;  1YNJ A;  4A93 C;  1SFO K;  2VUM A;  2Y0S L;  1G51 A;  5M5Y K;  1HQM A;  3NUH A;  3H0G K;  3GTP K;  3JST A;  4PAB A;  1IQ0 A;  4C3H C;  3S0X A;  2E2H A;  1JQW A;  3SZY A;  1V5V A;  4A3C K;  4GZY A;  4BKW A;  5C3E K;  2R7Z K;  4M1X A;  3GTM A;  1XPP A;  3GTG K;  1XZQ B;  3GTO K;  1EQR A;  2YU9 A;  2CFA A;  3S16 C;  1TWG K;  4XCH A;  1TWH C;  1WCM C;  5M3M K;  5IP9 K;  2D6F C;  3GTK C;  3TFJ A;  1BGW A;  4KAR A;  3VA7 A;  2E2H C;  3GEE A;  1Y1W A;  1SMY A;  1J98 A;  4XLP A;  3S2D K;  3FOE A;  1Y1V C; 
#chains in the Genus database with same CATH homology
 3GTL K;  2YU9 K;  2CW0 A;  1TWG C;  3RZD K;  2WB1 D;  5C4J K;  2NVX C;  4OIQ A;  1I6V A;  1TWC K;  3GTJ K;  3EQL A;  5IP7 C;  4YG2 A;  2NVT C;  5C44 K;  3H3V D;  1I6H C;  1ZYR A;  4MQ9 A;  5C4X C;  5C4X K;  4OIN A;  2NVT K;  1TWA C;  3H0G C;  4BY1 K;  3GTP C;  3S15 K;  4C3J K;  2PPB A;  3HOY K;  5M3F K;  2PMZ L;  4Y52 C;  3PO3 K;  4A93 K;  3HOZ C;  3I4M C;  5FLM K;  2O5J A;  2A6E A;  4OIO A;  3GTJ C;  2E2J K;  4A3M K;  4A3K C;  4QJV B;  3PO2 C;  4LLG A;  4BBS K;  5IYD C;  2WB1 L;  1TWF C;  4BBS C;  4A3E C;  3M3Y K;  1Y1V K;  4QJV A;  3S1M K;  2NVQ C;  2JA8 C;  1I3Q K;  4A3C C;  2R93 K;  2PA8 D;  3HOZ K;  3FKI C;  4A3J K;  3CQZ C;  2JA5 C;  3GTK K;  3CQZ K;  2R92 C;  1I50 C;  1K83 K;  3DXJ A;  3RZO C;  3S14 K;  4A3F K;  3HOW K;  4A3D K;  3HOY C;  3S15 C;  2E2H K;  4LK0 A;  4XLN A;  1TWA K;  3GTQ C;  3M3Y C;  4A3E K;  4A3D C;  5IYC C;  4QIW L;  4OIP A;  4Y7N K;  3S17 C;  1SFO C;  4Q4Z A;  3HKZ L;  5IP9 C;  4C3I K;  1R9T K;  1I3Q C;  3S1Q C;  2WAQ L;  1WCM K;  4AYB L;  5M5X K;  4XSZ A;  5IYB K;  2R7Z C;  4X6A K;  4G7H A;  1TWF K;  3HOU C;  4C2M K;  2O5I A;  3K7A C;  3S1R C;  3H3V L;  3S2H K;  4MEX A;  3S1N K;  3I4M K;  4YFK A;  5C44 C;  3WOD A;  3M4O K;  3S2D K;  1I6H K;  2E2I K;  2A69 A;  2Y0S D;  4XSX A;  4LJZ A;  4LK1 A;  2PMZ D;  4JK1 A;  3S1Q K;  4MEY A;  4ZH4 A;  2BE5 A;  3GTL C;  4YFN A;  2A68 A;  3HKZ D;  4Y7N C;  4OIR A;  3S17 K;  3S2D C;  2NVQ K;  3S1M C;  5IP7 K;  2JA6 K;  4A3I K;  3HOW C;  3GTM C;  2NVY K;  5M5W K;  3S14 C;  3GTM K;  1I50 K;  3RZO K;  3PO2 K;  2YU9 C;  2E2J C;  5IYB C;  4X6A C;  3GTO C;  3HOV C;  2JA8 K;  2R93 C;  1Y1W K;  1YNJ A;  5FLM C;  1IW7 A;  3PO3 C;  1SFO K;  4A93 C;  5C3E C;  4Y52 K;  2Y0S L;  4A3I C;  5M5Y K;  1HQM A;  3H0G K;  3GTP K;  1BDF A;  4C3H K;  2JA7 C;  4A3G K;  5D4D A;  4BBR C;  3I4N K;  2VUM K;  3FKI K;  4KMU A;  2WAQ D;  2B63 K;  4A3C K;  5C4J C;  4AYB D;  4A3L K;  5C3E K;  4YFX A;  2E2I C;  4GZY A;  1TWH K;  4BXX C;  2R7Z K;  3M4O C;  4G7Z A;  5IYD K;  3S16 K;  1XPP A;  4A3K K;  3GTG K;  4A3B C;  3GTO K;  3K7A K;  3S1R K;  2VUM C;  4G7O A;  3I4N C;  5TMC A;  3S16 C;  2JA7 K;  4A3G C;  2A6H A;  5IYC K;  1TWG K;  5TMF A;  3RZD C;  1TWH C;  4BXX K;  1WCM C;  4A3L C;  4Q5S A;  2B63 C;  4BY7 C;  4A3F C;  1R9T C;  3HOX C;  4KN4 A;  1K83 C;  5IP9 K;  2PA8 L;  5M3M K;  4BY1 C;  3GTK C;  4BBR K;  3HOX K;  1Y1W C;  5FJ8 K;  2E2H C;  1TWC C;  4KN7 A;  3GTQ K;  2NVX K;  1SMY A;  2NVY C;  3S1N C;  4QIW D;  2R92 K;  3S2H C;  1YNN A;  4A3M C;  2JA6 C;  4A3J C;  2JA5 K;  3GTG C;  4XLP A;  4A3B K;  4BY7 K;  4NOI A;  3HOV K;  3HOU K;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...