3S1MK

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1mK00
2PPBA 4MEXA 4A3IC 4YFKA 5IYCC 5C4JC 4A3MK 4BY7C 4A3CC 2WB1L 4OIRA 1ZYRA 1TWAK 3HOWK 5TMCA 3S1MK 4A3BC 3HKZL 2E2HC 1Y1WK 3GTMC 5IYDK 5M5XK 3HOXC 1SFOK 4X6AC 2PMZD 5FLMK 3GTLK 1I3QK 2JA5C 2A6HA 4BY1K 1TWHK 5C44K 3S1NK 4A93C 3I4MK 4QJVA 2A6EA 2VUMC 1HQMA 4A3KK 3S17C 3M4OC 3K7AC 4GZYA 4A3EK 2NVXC 5C3EK 3S2HK 2A69A 1TWFK 5IYBC 4A3JK 5M3MK 2R7ZC 1YNNA 5IP7C 3H3VD 3GTOC 5IP9K 4KMUA 4JK1A 2NVQK 2R93K 4Q4ZA 3S1QK 4Y52K 3HOZC 4BBRK 4Y7NK 1K83K 3RZOC 2NVTC 3S1RC 4G7ZA 2YU9C 4A3IK 5IYCK 4AYBL 1TWGC 5C4JK 3GTGK 4BY7K 2E2JC 4A3CK 3I4NC 4QJVB 4QIWL 1YNJA 3FKIK 1Y1VC 2B63C 1IW7A 2Y0SL 4A3BK 2E2HK 3GTJK 3S2DC 4X6AK 1I6VA 3GTKC 2PA8L 2JA5K 1WCMC 4BBSC 4A93K 4XLNA 2VUMK 3S17K 3HOVK 3GTQC 4YFXA 2JA7C 3K7AK 3M4OK 3H0GC 4OINA 4ZH4A 4A3DC 1XPPA 4OIOA 3DXJA 5IYBK 5C4XC 2JA6C 2R7ZK 1BDFA 2WAQD 5IP7K 1SMYA 2R92C 5FJ8K 3GTOK 3S15C 3S16K 3HOWC 3HOZK 4A3GK 4NOIA 2NVYC 5M5YK 4YG2A 3RZOK 2NVTK 3S1RK 4LK0A 3CQZC 2YU9K 1TWGK 1TWCC 3S14C 4A3FC 3HOUC 1TWHC 5C44C 2E2IC 3PO3C 3PO2C 1I50C 3H3VL 4G7HA 2B63K 3GTMK 3M3YC 3HOXK 4KN4A 4C3JK 4LLGA 2WB1D 3S2DK 3EQLA 4XSXA 4C2MK 3GTKK 4A3LC 4A3JC 4KN7A 3GTPC 1WCMK 1R9TC 4BBSK 2O5JA 3HKZD 4BXXC 4OIPA 5IP9C 2NVQC 4Q5SA 2JA8C 3GTQK 4XLPA 2JA7K 2NVXK 2O5IA 2R93C 3HOYC 4Y52C 4OIQA 3RZDC 4A3DK 1K83C 4LK1A 5C4XK 4A3MC 2JA6K 3GTGC 2PMZL 4MEYA 2R92K 3S15K 4LJZA 1TWAC 5M5WK 1I6HK 5TMFA 3FKIC 3S1MC 2NVYK 1Y1WC 5IYDC 5M3FK 5D4DA 3GTJC 1SFOC 3CQZK 5FLMC 3GTLC 1I3QC 4XSZA 1TWCK 2E2JK 3WODA 4BY1C 3S14K 3I4NK 3S1NC 4YFNA 4C3IK 4A3FK 3HOUK 3PO3K 2BE5A 2E2IK 3I4MC 1I6HC 3PO2K 1Y1VK 4C3HK 4A3KC 1I50K 2WAQL 3HOVC 4A3EC 3S2HC 4AYBD 5C3EC 3M3YK 1TWFC 2CW0A 4A3LK 4QIWD 3GTPK 1R9TK 2Y0SD 4BXXK 2JA8K 3H0GK 3S1QC 4G7OA 4BBRC 4Y7NC 3HOYK 3S16C 2PA8D 4A3GC 4MQ9A 3RZDK 2A68A
chains in the Genus database with same CATH superfamily
2PPBA 5IYCC 1IQ0A 2GAHC 3AD8C 3FOFA 5L46A 4DDQA 3HOWK 2E2HC 5IYDK 1SFOK 4X6AC 5FLMK 1VJEA 4A93C 1J6WA 1I6HK 1TWGA 2A6EA 4QJVA 4A3KK 1INNA 2W7VA 3S2HK 1J6XA 1DCPA 1WOPA 3AQPA 5IP7C 3H3VD 5IP9K 5JVOA 2V6SA 1K83K 3RZOC 3A8IA 4G7ZA 5C4JK 1TWGC 4KAWX 4A3CK 4QIWL 3GTJK 1JVIA 1BGWA 1I6VA 1TWAA 3S0XA 4FZBA 3FOEA 4PAAA 4M1XA 2VUMK 3S17K 3M4OK 2JA7C 1J98A 1TWHA 1DCOA 3DXJA 5IYBK 4KM8A 1BDFA 5IOSA 1O27A 3GTOK 4G0WA 1EI6A 1DD5A 1ZBSA 3S16K 2ZFZA 4YG2A 3T01A 3S1RK 3L4JA 2YU9K 1TWCC 3S14C 1USOA 2RH6A 3PO3C 1TWHC 2E2IC 3GTGA 3ERED 4G7HA 3H3VL 3GTMK 4O2DA 4LOWA 3EQLA 3FKIA 3GTPC 3A8KA 1WCMK 4P5BA 4BBSK 4GTBA 2JA8C 2JA5A 2EBBA 4XLPA 2O5IA 4GTDA 2KWAA 4LK1A 1B4AA 2JA6K 1JOEA 3AD7C 2PMZL 3GTGC 1WIHA 5TMFA 3FKIC 3AD9C 2NVYK 5JFEA 3CQZK 1C0AA 2E2JK 4BY1C 3S1NC 4YFNA 4C3IK 4WILA 4A3FK 3HOUK 2BE5A 1Y1VK 1I50K 5C3EC 1XZPB 1TWFC 4WJ3M 2B63A 1DCHA 4KB4A 2Y0SD 3HOYK 3RZDK 2NVXA 4A3IC 4YFKA 2GSUA 4BY7C 2GSNA 3LAJA 4OIRA 1WQFA 1EK8A 3S1MK 2R92A 1Y1WK 5M5XK 3HOXC 1I3QK 4GTLA 5C44K 4P9SA 1HQMA 5HL8A 4BLAA 4A3EK 2NVXC 3G4AA 2A69A 2RGRA 3FHZA 3OPFA 4A3JK 5M3MK 3VA7A 2R7ZC 3BP3A 2NVQK 4KMUA 4BLBA 4Q4ZA 3S1QK 4KC6A 4Y52K 3HOZC 4Y7NK 1R9TA 3GTQA 2NVTC 1WQGA 4KATA 4FM9A 5IYCK 1WOOA 2GAGC 3I4NC 2Y0SL 2XCOA 2E2HK 4GTEA 4X6AK 3TFHA 4C2MC 3GTKC 1XZQA 1SFOA 4A93K 3HOVK 3GTQC 4YFXA 5CHPA 4A3DC 2CFAB 1VH2A 5C4XC 2P5MA 5IP7K 3OREA 1SMYA 3S15C 5FJ8K 1O28A 3HOWC 3RZOK 3GIRA 4LK0A 4KASA 1TWGK 1K83A 1XXBA 4AH6A 1IBAA 1WORA 2V6TA 4KDDA 3M3YC 4KN4A 2WB1D 4XSXA 4A3LC 3GTJA 2O5JA 3GTLA 4OIPA 5IP9C 4BXXC 4GTCA 4Q5SA 2JA7K 1IL2A 4OIQA 2VUMA 1K83C 4A3MC 3SZYA 4MEYA 3SZZA 4LJZA 1TWAC 3BP8C 2ZUEA 2V6UA 3GTJC 3TFIA 3GTLC 1TWCK 4KMAA 3S14K 3PO3K 2E2IK 3I4MC 2P8TA 2YU9A 1GE9A 3BUEA 4J3NA 2CW0A 1AB4A 3GTMA 3GTPK 2JA8K 3H0GK 1VRQC 4BBRC 1WCMA 3S16C 2PA8D 3IPJA 3NUHA 2WB1L 1ZYRA 4A3BC 3GTMC 2JA5C 4KARA 4BY1K 1BS2A 3S1NK 4KMDA 1IE0A 1PJ5A 3CQZA 1EFWA 3K7AC 1O25A 4WJ4A 5C3EK 4ILDA 1TWFK 1Y1VA 3T00A 1I50A 1WSVA 1YNNA 2FQTA 4JK1A 2R93K 4C45A 1XXCA 4A3IK 4BY7K 2E2JC 1V5VA 1X31C 3ADAC 4QJVB 4XCHA 1YNJA 1Y1VC 2B63C 1IW7A 4C3JC 3S2DC 1RU0A 2PA8L 1I3QA 3HXAA 4ZH4A 1XPPA 1YCLA 2R7ZK 3AH5A 2WAQD 2R92C 5IORA 1EH1A 5EGEA 1YX2A 3N3YA 3HOZK 4A3GK 2NVTK 1ZQ1C 3N0CA 3AQOA 4LR2A 5C44C 1UV7A 3PO2C 4C3HC 1O29A 1PJ7A 1BJTA 1WQHA 4LLGA 4C2MK 3GTKK 1IS1A 4A3JC 1WOSA 4KN7A 1O24A 2E2HA 4GTFA 1R9TC 3HKZD 2NVQC 3GTQK 4Y52C 3L4KA 1XZPA 4A3DK 3G4CA 5E68A 5C4XK 1O2BA 3S15K 4KMHA 1PJ6A 5M5WK 5IYDC 1SFOC 1VLOA 3LAPA 5FLMC 4XSZA 3WODA 3TFJA 3GEEA 5TJ3A 1I6HC 1KQ4A 4A3KC 2WAQL 1ZXOA 3HOVC 3S2HC 4AYBD 5EGHA 3M3YK 4GT9A 4A3LK 4BXXK 4KM9A 2JH3A 1WSRA 2JA7A 4MEXA 5C4JC 4A3MK 4A3CC 5IOQA 2Y3PA 1TWAK 5TMCA 3GTOA 3HKZL 2ZUFA 1F9NA 2XCQA 2PMZD 3TTGA 3GTLK 2A6HA 1TWHK 3I4MK 3GEHA 2VUMC 3S17C 4GZYA 3M4OC 1USMA 1TWCA 4GFQA 2E2IA 5IOTA 1O2AA 5IYBC 3LPXA 3GTOC 2D6FC 1ZVUA 3GTPA 4BBRK 3OEPA 4GTAA 3MMLB 2CFAA 3S1RC 3H0GA 2YU9C 4AYBL 1F7UA 3GTGK 3Q3QA 2JA6A 3GSIA 3FKIK 4A3BK 4BKWA 3N0BA 1VGXA 2NVYA 2JA5K 4PABA 1WCMC 4BBSC 4XLNA 3QX3A 3K7AK 3H0GC 4OINA 1O26A 4OIOA 2JA6C 1TWFA 4NOIA 2NVYC 1HI9A 5M5YK 2R93A 3JSTA 3CQZC 1XZQB 4G0VA 3V4GA 4C3IC 4A3FC 3HOUC 3T02A 3A8JA 4RMFA 1J6VA 1I50C 2B63K 1F93A 2FQOA 3HOXK 4G0UA 4C3JK 3S2DK 1Y1WA 1O2FB 2R93C 2NVXK 1JQWA 3GEIA 1EQRA 3HOYC 3RZDC 1G51A 2XCRB 3GDZA 2PHCB 2R92K 2R7ZA 3S1MC 1L0WA 1Y1WC 5M3FK 5D4DA 1XXAA 1I3QC 3I4NK 4LQYA 2GSOA 1B4BA 3PO2K 4C3HK 4A3EC 5CJ9A 1ISEA 1F7VA 4QIWD 4P5AA 4KB2A 3CAGA 1R9TK 3GTKA 3S1QC 4G7OA 4Y7NC 4A3GC 4MQ9A 2A68A
chains in the Genus database with same CATH topology
2PPBA 4MEXA 4A3IC 4YFKA 5IYCC 5C4JC 4A3MK 4BY7C 4A3CC 2WB1L 4OIRA 1ZYRA 1TWAK 3HOWK 5TMCA 3S1MK 4A3BC 3HKZL 2E2HC 1Y1WK 3GTMC 5IYDK 5M5XK 3HOXC 1SFOK 4X6AC 2PMZD 5FLMK 3GTLK 1I3QK 2JA5C 2A6HA 4BY1K 1TWHK 5C44K 3S1NK 4A93C 3I4MK 4QJVA 2A6EA 2VUMC 1HQMA 4A3KK 3S17C 3M4OC 3K7AC 4GZYA 4A3EK 2NVXC 5C3EK 3S2HK 2A69A 1TWFK 5IYBC 4A3JK 5M3MK 2R7ZC 1YNNA 5IP7C 3H3VD 3GTOC 5IP9K 4KMUA 4JK1A 2NVQK 2R93K 4Q4ZA 3S1QK 4Y52K 3HOZC 4BBRK 4Y7NK 1K83K 3RZOC 2NVTC 3S1RC 4G7ZA 2YU9C 4A3IK 5IYCK 4AYBL 1TWGC 5C4JK 3GTGK 4BY7K 2E2JC 4A3CK 3I4NC 4QJVB 4QIWL 1YNJA 3FKIK 1Y1VC 2B63C 1IW7A 2Y0SL 4A3BK 2E2HK 3GTJK 3S2DC 4X6AK 1I6VA 3GTKC 2PA8L 2JA5K 1WCMC 4BBSC 4A93K 4XLNA 2VUMK 3S17K 3HOVK 3GTQC 4YFXA 2JA7C 3K7AK 3M4OK 3H0GC 4OINA 4ZH4A 4A3DC 1XPPA 4OIOA 3DXJA 5IYBK 5C4XC 2JA6C 2R7ZK 1BDFA 2WAQD 5IP7K 1SMYA 2R92C 5FJ8K 3GTOK 3S15C 3S16K 3HOWC 3HOZK 4A3GK 4NOIA 2NVYC 5M5YK 4YG2A 3RZOK 2NVTK 3S1RK 4LK0A 3CQZC 2YU9K 1TWGK 1TWCC 3S14C 4A3FC 3HOUC 1TWHC 5C44C 2E2IC 3PO3C 3PO2C 1I50C 3H3VL 4G7HA 2B63K 3GTMK 3M3YC 3HOXK 4KN4A 4C3JK 4LLGA 2WB1D 3S2DK 3EQLA 4XSXA 4C2MK 3GTKK 4A3LC 4A3JC 4KN7A 3GTPC 1WCMK 1R9TC 4BBSK 2O5JA 3HKZD 4BXXC 4OIPA 5IP9C 2NVQC 4Q5SA 2JA8C 3GTQK 4XLPA 2JA7K 2NVXK 2O5IA 2R93C 3HOYC 4Y52C 4OIQA 3RZDC 4A3DK 1K83C 4LK1A 5C4XK 4A3MC 2JA6K 3GTGC 2PMZL 4MEYA 2R92K 3S15K 4LJZA 1TWAC 5M5WK 1I6HK 5TMFA 3FKIC 3S1MC 2NVYK 1Y1WC 5IYDC 5M3FK 5D4DA 3GTJC 1SFOC 3CQZK 5FLMC 3GTLC 1I3QC 4XSZA 1TWCK 2E2JK 3WODA 4BY1C 3S14K 3I4NK 3S1NC 4YFNA 4C3IK 4A3FK 3HOUK 3PO3K 2BE5A 2E2IK 3I4MC 1I6HC 3PO2K 1Y1VK 4C3HK 4A3KC 1I50K 2WAQL 3HOVC 4A3EC 3S2HC 4AYBD 5C3EC 3M3YK 1TWFC 2CW0A 4A3LK 4QIWD 3GTPK 1R9TK 2Y0SD 4BXXK 2JA8K 3H0GK 3S1QC 4G7OA 4BBRC 4Y7NC 3HOYK 3S16C 2PA8D 4A3GC 4MQ9A 3RZDK 2A68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPB A;  4MEX A;  4A3I C;  4YFK A;  5IYC C;  5C4J C;  4A3M K;  4BY7 C;  4A3C C;  2WB1 L;  4OIR A;  1ZYR A;  1TWA K;  3HOW K;  5TMC A;  3S1M K;  4A3B C;  3HKZ L;  2E2H C;  1Y1W K;  3GTM C;  5IYD K;  5M5X K;  3HOX C;  1SFO K;  4X6A C;  2PMZ D;  5FLM K;  3GTL K;  1I3Q K;  2JA5 C;  2A6H A;  4BY1 K;  1TWH K;  5C44 K;  3S1N K;  4A93 C;  3I4M K;  4QJV A;  2A6E A;  2VUM C;  1HQM A;  4A3K K;  3S17 C;  3M4O C;  3K7A C;  4GZY A;  4A3E K;  2NVX C;  5C3E K;  3S2H K;  2A69 A;  1TWF K;  5IYB C;  4A3J K;  5M3M K;  2R7Z C;  1YNN A;  5IP7 C;  3H3V D;  3GTO C;  5IP9 K;  4KMU A;  4JK1 A;  2NVQ K;  2R93 K;  4Q4Z A;  3S1Q K;  4Y52 K;  3HOZ C;  4BBR K;  4Y7N K;  1K83 K;  3RZO C;  2NVT C;  3S1R C;  4G7Z A;  2YU9 C;  4A3I K;  5IYC K;  4AYB L;  1TWG C;  5C4J K;  3GTG K;  4BY7 K;  2E2J C;  4A3C K;  3I4N C;  4QJV B;  4QIW L;  1YNJ A;  3FKI K;  1Y1V C;  2B63 C;  1IW7 A;  2Y0S L;  4A3B K;  2E2H K;  3GTJ K;  3S2D C;  4X6A K;  1I6V A;  3GTK C;  2PA8 L;  2JA5 K;  1WCM C;  4BBS C;  4A93 K;  4XLN A;  2VUM K;  3S17 K;  3HOV K;  3GTQ C;  4YFX A;  2JA7 C;  3K7A K;  3M4O K;  3H0G C;  4OIN A;  4ZH4 A;  4A3D C;  1XPP A;  4OIO A;  3DXJ A;  5IYB K;  5C4X C;  2JA6 C;  2R7Z K;  1BDF A;  2WAQ D;  5IP7 K;  1SMY A;  2R92 C;  5FJ8 K;  3GTO K;  3S15 C;  3S16 K;  3HOW C;  3HOZ K;  4A3G K;  4NOI A;  2NVY C;  5M5Y K;  4YG2 A;  3RZO K;  2NVT K;  3S1R K;  4LK0 A;  3CQZ C;  2YU9 K;  1TWG K;  1TWC C;  3S14 C;  4A3F C;  3HOU C;  1TWH C;  5C44 C;  2E2I C;  3PO3 C;  3PO2 C;  1I50 C;  3H3V L;  4G7H A;  2B63 K;  3GTM K;  3M3Y C;  3HOX K;  4KN4 A;  4C3J K;  4LLG A;  2WB1 D;  3S2D K;  3EQL A;  4XSX A;  4C2M K;  3GTK K;  4A3L C;  4A3J C;  4KN7 A;  3GTP C;  1WCM K;  1R9T C;  4BBS K;  2O5J A;  3HKZ D;  4BXX C;  4OIP A;  5IP9 C;  2NVQ C;  4Q5S A;  2JA8 C;  3GTQ K;  4XLP A;  2JA7 K;  2NVX K;  2O5I A;  2R93 C;  3HOY C;  4Y52 C;  4OIQ A;  3RZD C;  4A3D K;  1K83 C;  4LK1 A;  5C4X K;  4A3M C;  2JA6 K;  3GTG C;  2PMZ L;  4MEY A;  2R92 K;  3S15 K;  4LJZ A;  1TWA C;  5M5W K;  1I6H K;  5TMF A;  3FKI C;  3S1M C;  2NVY K;  1Y1W C;  5IYD C;  5M3F K;  5D4D A;  3GTJ C;  1SFO C;  3CQZ K;  5FLM C;  3GTL C;  1I3Q C;  4XSZ A;  1TWC K;  2E2J K;  3WOD A;  4BY1 C;  3S14 K;  3I4N K;  3S1N C;  4YFN A;  4C3I K;  4A3F K;  3HOU K;  3PO3 K;  2BE5 A;  2E2I K;  3I4M C;  1I6H C;  3PO2 K;  1Y1V K;  4C3H K;  4A3K C;  1I50 K;  2WAQ L;  3HOV C;  4A3E C;  3S2H C;  4AYB D;  5C3E C;  3M3Y K;  1TWF C;  2CW0 A;  4A3L K;  4QIW D;  3GTP K;  1R9T K;  2Y0S D;  4BXX K;  2JA8 K;  3H0G K;  3S1Q C;  4G7O A;  4BBR C;  4Y7N C;  3HOY K;  3S16 C;  2PA8 D;  4A3G C;  4MQ9 A;  3RZD K;  2A68 A; 
#chains in the Genus database with same CATH topology
 2PPB A;  5IYC C;  1IQ0 A;  2GAH C;  3AD8 C;  3FOF A;  5L46 A;  4DDQ A;  3HOW K;  2E2H C;  5IYD K;  1SFO K;  4X6A C;  5FLM K;  1VJE A;  4A93 C;  1J6W A;  1I6H K;  1TWG A;  2A6E A;  4QJV A;  4A3K K;  1INN A;  2W7V A;  3S2H K;  1J6X A;  1DCP A;  1WOP A;  3AQP A;  5IP7 C;  3H3V D;  5IP9 K;  5JVO A;  2V6S A;  1K83 K;  3RZO C;  3A8I A;  4G7Z A;  5C4J K;  1TWG C;  4KAW X;  4A3C K;  4QIW L;  3GTJ K;  1JVI A;  1BGW A;  1I6V A;  1TWA A;  3S0X A;  4FZB A;  3FOE A;  4PAA A;  4M1X A;  2VUM K;  3S17 K;  3M4O K;  2JA7 C;  1J98 A;  1TWH A;  1DCO A;  3DXJ A;  5IYB K;  4KM8 A;  1BDF A;  5IOS A;  1O27 A;  3GTO K;  4G0W A;  1EI6 A;  1DD5 A;  1ZBS A;  3S16 K;  2ZFZ A;  4YG2 A;  3T01 A;  3S1R K;  3L4J A;  2YU9 K;  1TWC C;  3S14 C;  1USO A;  2RH6 A;  3PO3 C;  1TWH C;  2E2I C;  3GTG A;  3ERE D;  4G7H A;  3H3V L;  3GTM K;  4O2D A;  4LOW A;  3EQL A;  3FKI A;  3GTP C;  3A8K A;  1WCM K;  4P5B A;  4BBS K;  4GTB A;  2JA8 C;  2JA5 A;  2EBB A;  4XLP A;  2O5I A;  4GTD A;  2KWA A;  4LK1 A;  1B4A A;  2JA6 K;  1JOE A;  3AD7 C;  2PMZ L;  3GTG C;  1WIH A;  5TMF A;  3FKI C;  3AD9 C;  2NVY K;  5JFE A;  3CQZ K;  1C0A A;  2E2J K;  4BY1 C;  3S1N C;  4YFN A;  4C3I K;  4WIL A;  4A3F K;  3HOU K;  2BE5 A;  1Y1V K;  1I50 K;  5C3E C;  1XZP B;  1TWF C;  4WJ3 M;  2B63 A;  1DCH A;  4KB4 A;  2Y0S D;  3HOY K;  3RZD K;  2NVX A;  4A3I C;  4YFK A;  2GSU A;  4BY7 C;  2GSN A;  3LAJ A;  4OIR A;  1WQF A;  1EK8 A;  3S1M K;  2R92 A;  1Y1W K;  5M5X K;  3HOX C;  1I3Q K;  4GTL A;  5C44 K;  4P9S A;  1HQM A;  5HL8 A;  4BLA A;  4A3E K;  2NVX C;  3G4A A;  2A69 A;  2RGR A;  3FHZ A;  3OPF A;  4A3J K;  5M3M K;  3VA7 A;  2R7Z C;  3BP3 A;  2NVQ K;  4KMU A;  4BLB A;  4Q4Z A;  3S1Q K;  4KC6 A;  4Y52 K;  3HOZ C;  4Y7N K;  1R9T A;  3GTQ A;  2NVT C;  1WQG A;  4KAT A;  4FM9 A;  5IYC K;  1WOO A;  2GAG C;  3I4N C;  2Y0S L;  2XCO A;  2E2H K;  4GTE A;  4X6A K;  3TFH A;  4C2M C;  3GTK C;  1XZQ A;  1SFO A;  4A93 K;  3HOV K;  3GTQ C;  4YFX A;  5CHP A;  4A3D C;  2CFA B;  1VH2 A;  5C4X C;  2P5M A;  5IP7 K;  3ORE A;  1SMY A;  3S15 C;  5FJ8 K;  1O28 A;  3HOW C;  3RZO K;  3GIR A;  4LK0 A;  4KAS A;  1TWG K;  1K83 A;  1XXB A;  4AH6 A;  1IBA A;  1WOR A;  2V6T A;  4KDD A;  3M3Y C;  4KN4 A;  2WB1 D;  4XSX A;  4A3L C;  3GTJ A;  2O5J A;  3GTL A;  4OIP A;  5IP9 C;  4BXX C;  4GTC A;  4Q5S A;  2JA7 K;  1IL2 A;  4OIQ A;  2VUM A;  1K83 C;  4A3M C;  3SZY A;  4MEY A;  3SZZ A;  4LJZ A;  1TWA C;  3BP8 C;  2ZUE A;  2V6U A;  3GTJ C;  3TFI A;  3GTL C;  1TWC K;  4KMA A;  3S14 K;  3PO3 K;  2E2I K;  3I4M C;  2P8T A;  2YU9 A;  1GE9 A;  3BUE A;  4J3N A;  2CW0 A;  1AB4 A;  3GTM A;  3GTP K;  2JA8 K;  3H0G K;  1VRQ C;  4BBR C;  1WCM A;  3S16 C;  2PA8 D;  3IPJ A;  3NUH A;  2WB1 L;  1ZYR A;  4A3B C;  3GTM C;  2JA5 C;  4KAR A;  4BY1 K;  1BS2 A;  3S1N K;  4KMD A;  1IE0 A;  1PJ5 A;  3CQZ A;  1EFW A;  3K7A C;  1O25 A;  4WJ4 A;  5C3E K;  4ILD A;  1TWF K;  1Y1V A;  3T00 A;  1I50 A;  1WSV A;  1YNN A;  2FQT A;  4JK1 A;  2R93 K;  4C45 A;  1XXC A;  4A3I K;  4BY7 K;  2E2J C;  1V5V A;  1X31 C;  3ADA C;  4QJV B;  4XCH A;  1YNJ A;  1Y1V C;  2B63 C;  1IW7 A;  4C3J C;  3S2D C;  1RU0 A;  2PA8 L;  1I3Q A;  3HXA A;  4ZH4 A;  1XPP A;  1YCL A;  2R7Z K;  3AH5 A;  2WAQ D;  2R92 C;  5IOR A;  1EH1 A;  5EGE A;  1YX2 A;  3N3Y A;  3HOZ K;  4A3G K;  2NVT K;  1ZQ1 C;  3N0C A;  3AQO A;  4LR2 A;  5C44 C;  1UV7 A;  3PO2 C;  4C3H C;  1O29 A;  1PJ7 A;  1BJT A;  1WQH A;  4LLG A;  4C2M K;  3GTK K;  1IS1 A;  4A3J C;  1WOS A;  4KN7 A;  1O24 A;  2E2H A;  4GTF A;  1R9T C;  3HKZ D;  2NVQ C;  3GTQ K;  4Y52 C;  3L4K A;  1XZP A;  4A3D K;  3G4C A;  5E68 A;  5C4X K;  1O2B A;  3S15 K;  4KMH A;  1PJ6 A;  5M5W K;  5IYD C;  1SFO C;  1VLO A;  3LAP A;  5FLM C;  4XSZ A;  3WOD A;  3TFJ A;  3GEE A;  5TJ3 A;  1I6H C;  1KQ4 A;  4A3K C;  2WAQ L;  1ZXO A;  3HOV C;  3S2H C;  4AYB D;  5EGH A;  3M3Y K;  4GT9 A;  4A3L K;  4BXX K;  4KM9 A;  2JH3 A;  1WSR A;  2JA7 A;  4MEX A;  5C4J C;  4A3M K;  4A3C C;  5IOQ A;  2Y3P A;  1TWA K;  5TMC A;  3GTO A;  3HKZ L;  2ZUF A;  1F9N A;  2XCQ A;  2PMZ D;  3TTG A;  3GTL K;  2A6H A;  1TWH K;  3I4M K;  3GEH A;  2VUM C;  3S17 C;  4GZY A;  3M4O C;  1USM A;  1TWC A;  4GFQ A;  2E2I A;  5IOT A;  1O2A A;  5IYB C;  3LPX A;  3GTO C;  2D6F C;  1ZVU A;  3GTP A;  4BBR K;  3OEP A;  4GTA A;  3MML B;  2CFA A;  3S1R C;  3H0G A;  2YU9 C;  4AYB L;  1F7U A;  3GTG K;  3Q3Q A;  2JA6 A;  3GSI A;  3FKI K;  4A3B K;  4BKW A;  3N0B A;  1VGX A;  2NVY A;  2JA5 K;  4PAB A;  1WCM C;  4BBS C;  4XLN A;  3QX3 A;  3K7A K;  3H0G C;  4OIN A;  1O26 A;  4OIO A;  2JA6 C;  1TWF A;  4NOI A;  2NVY C;  1HI9 A;  5M5Y K;  2R93 A;  3JST A;  3CQZ C;  1XZQ B;  4G0V A;  3V4G A;  4C3I C;  4A3F C;  3HOU C;  3T02 A;  3A8J A;  4RMF A;  1J6V A;  1I50 C;  2B63 K;  1F93 A;  2FQO A;  3HOX K;  4G0U A;  4C3J K;  3S2D K;  1Y1W A;  1O2F B;  2R93 C;  2NVX K;  1JQW A;  3GEI A;  1EQR A;  3HOY C;  3RZD C;  1G51 A;  2XCR B;  3GDZ A;  2PHC B;  2R92 K;  2R7Z A;  3S1M C;  1L0W A;  1Y1W C;  5M3F K;  5D4D A;  1XXA A;  1I3Q C;  3I4N K;  4LQY A;  2GSO A;  1B4B A;  3PO2 K;  4C3H K;  4A3E C;  5CJ9 A;  1ISE A;  1F7V A;  4QIW D;  4P5A A;  4KB2 A;  3CAG A;  1R9T K;  3GTK A;  3S1Q C;  4G7O A;  4Y7N C;  4A3G C;  4MQ9 A;  2A68 A; 
#chains in the Genus database with same CATH homology
 2PPB A;  4MEX A;  4A3I C;  4YFK A;  5IYC C;  5C4J C;  4A3M K;  4BY7 C;  4A3C C;  2WB1 L;  4OIR A;  1ZYR A;  1TWA K;  3HOW K;  5TMC A;  3S1M K;  4A3B C;  3HKZ L;  2E2H C;  1Y1W K;  3GTM C;  5IYD K;  5M5X K;  3HOX C;  1SFO K;  4X6A C;  2PMZ D;  5FLM K;  3GTL K;  1I3Q K;  2JA5 C;  2A6H A;  4BY1 K;  1TWH K;  5C44 K;  3S1N K;  4A93 C;  3I4M K;  4QJV A;  2A6E A;  2VUM C;  1HQM A;  4A3K K;  3S17 C;  3M4O C;  3K7A C;  4GZY A;  4A3E K;  2NVX C;  5C3E K;  3S2H K;  2A69 A;  1TWF K;  5IYB C;  4A3J K;  5M3M K;  2R7Z C;  1YNN A;  5IP7 C;  3H3V D;  3GTO C;  5IP9 K;  4KMU A;  4JK1 A;  2NVQ K;  2R93 K;  4Q4Z A;  3S1Q K;  4Y52 K;  3HOZ C;  4BBR K;  4Y7N K;  1K83 K;  3RZO C;  2NVT C;  3S1R C;  4G7Z A;  2YU9 C;  4A3I K;  5IYC K;  4AYB L;  1TWG C;  5C4J K;  3GTG K;  4BY7 K;  2E2J C;  4A3C K;  3I4N C;  4QJV B;  4QIW L;  1YNJ A;  3FKI K;  1Y1V C;  2B63 C;  1IW7 A;  2Y0S L;  4A3B K;  2E2H K;  3GTJ K;  3S2D C;  4X6A K;  1I6V A;  3GTK C;  2PA8 L;  2JA5 K;  1WCM C;  4BBS C;  4A93 K;  4XLN A;  2VUM K;  3S17 K;  3HOV K;  3GTQ C;  4YFX A;  2JA7 C;  3K7A K;  3M4O K;  3H0G C;  4OIN A;  4ZH4 A;  4A3D C;  1XPP A;  4OIO A;  3DXJ A;  5IYB K;  5C4X C;  2JA6 C;  2R7Z K;  1BDF A;  2WAQ D;  5IP7 K;  1SMY A;  2R92 C;  5FJ8 K;  3GTO K;  3S15 C;  3S16 K;  3HOW C;  3HOZ K;  4A3G K;  4NOI A;  2NVY C;  5M5Y K;  4YG2 A;  3RZO K;  2NVT K;  3S1R K;  4LK0 A;  3CQZ C;  2YU9 K;  1TWG K;  1TWC C;  3S14 C;  4A3F C;  3HOU C;  1TWH C;  5C44 C;  2E2I C;  3PO3 C;  3PO2 C;  1I50 C;  3H3V L;  4G7H A;  2B63 K;  3GTM K;  3M3Y C;  3HOX K;  4KN4 A;  4C3J K;  4LLG A;  2WB1 D;  3S2D K;  3EQL A;  4XSX A;  4C2M K;  3GTK K;  4A3L C;  4A3J C;  4KN7 A;  3GTP C;  1WCM K;  1R9T C;  4BBS K;  2O5J A;  3HKZ D;  4BXX C;  4OIP A;  5IP9 C;  2NVQ C;  4Q5S A;  2JA8 C;  3GTQ K;  4XLP A;  2JA7 K;  2NVX K;  2O5I A;  2R93 C;  3HOY C;  4Y52 C;  4OIQ A;  3RZD C;  4A3D K;  1K83 C;  4LK1 A;  5C4X K;  4A3M C;  2JA6 K;  3GTG C;  2PMZ L;  4MEY A;  2R92 K;  3S15 K;  4LJZ A;  1TWA C;  5M5W K;  1I6H K;  5TMF A;  3FKI C;  3S1M C;  2NVY K;  1Y1W C;  5IYD C;  5M3F K;  5D4D A;  3GTJ C;  1SFO C;  3CQZ K;  5FLM C;  3GTL C;  1I3Q C;  4XSZ A;  1TWC K;  2E2J K;  3WOD A;  4BY1 C;  3S14 K;  3I4N K;  3S1N C;  4YFN A;  4C3I K;  4A3F K;  3HOU K;  3PO3 K;  2BE5 A;  2E2I K;  3I4M C;  1I6H C;  3PO2 K;  1Y1V K;  4C3H K;  4A3K C;  1I50 K;  2WAQ L;  3HOV C;  4A3E C;  3S2H C;  4AYB D;  5C3E C;  3M3Y K;  1TWF C;  2CW0 A;  4A3L K;  4QIW D;  3GTP K;  1R9T K;  2Y0S D;  4BXX K;  2JA8 K;  3H0G K;  3S1Q C;  4G7O A;  4BBR C;  4Y7N C;  3HOY K;  3S16 C;  2PA8 D;  4A3G C;  4MQ9 A;  3RZD K;  2A68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...