3S1MK

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1mK00
4C3JK 2E2IK 5TMFA 3M3YK 3GTOK 4A3LC 4A3DC 1BDFA 4A3EC 1SMYA 1TWGC 4LK1A 3GTGK 4A3BK 1TWHK 5M5WK 3GTJC 1I3QC 5M3MK 2O5IA 3S1MK 4C3IK 3M4OK 5C4JK 2JA7C 3GTPK 3EQLA 4KN7A 3HOZK 1WCMK 3S2HK 3HKZL 1TWAC 4XLPA 4A3FK 4A3KK 4MEXA 2JA5C 3S15K 4A93C 1YNJA 3GTMK 4OIOA 3S1RK 3S16C 5IYBK 3S17C 4AYBD 4AYBL 1Y1VK 4A3MK 3I4NK 3PO2C 3HOVK 5IP7C 3CQZK 3HOWC 1TWFK 4OIQA 4JK1A 2E2HK 2PA8D 5C4XK 1I50C 5C44C 4BY1C 3GTKC 2R7ZC 4A3CK 4A3EK 3RZOC 3FKIK 3HOXC 4BBSK 4OIRA 3S1NK 2NVXC 2VUMC 5FLMC 4Y52C 3K7AC 3GTLC 3HOUC 3I4MK 5FJ8K 2NVTC 4BBRC 1TWCK 3S14K 5IP9C 1K83K 4A3GC 4A3JC 4A3IK 4G7HA 3RZDK 2R93C 4X6AK 5M3FK 2B63C 1R9TK 4YFXA 4BXXK 2R92K 4GZYA 3GTQC 1Y1WK 2JA5K 3HKZD 3PO3C 2NVYK 2JA6K 2A69A 4QJVB 5C3EC 2A6EA 4QJVA 4OIPA 3WODA 1SFOC 2CW0A 2JA8C 2A6HA 2NVQC 4BY7C 2O5JA 5IYDK 1YNNA 5IP7K 3S1QC 4G7ZA 2E2JC 4C3HK 4G7OA 3M3YC 1I6HK 3GTOC 1I50K 2YU9K 2Y0SL 4YG2A 5TMCA 4BY1K 4A3LK 4MEYA 4A3DK 2WB1L 4NOIA 4Q4ZA 3GTGC 4A3BC 3HOYC 3K7AK 1TWHC 3GTLK 1TWGK 3S1MC 4BBRK 4ZH4A 3GTJK 5C4JC 1I3QK 3H3VD 4XSZA 5IP9K 3H3VL 4Y7NC 2JA7K 3HOZC 1ZYRA 3S2HC 4LLGA 4A3KC 4A3FC 3GTQK 5IYCC 4LK0A 3S15C 1TWAK 4KN4A 3GTMC 3S1RC 4YFKA 4C2MK 5IYBC 3H0GC 5C3EK 4A93K 3S2DC 1Y1VC 4A3MC 3S16K 3I4NC 4XLNA 5M5XK 3S17K 2PMZD 2PMZL 4OINA 2A68A 3PO2K 1TWFC 2E2JK 2E2HC 5M5YK 1XPPA 3HOWK 5C4XC 2E2IC 4BBSC 4A3CC 3FKIC 2Y0SD 1HQMA 5C44K 3GTKK 2R7ZK 3S1NC 3RZOK 2WB1D 3HOXK 1IW7A 3HOYK 2NVXK 3I4MC 2VUMK 5FLMK 5D4DA 4Y52K 2BE5A 1TWCC 3HOUK 2NVTK 3S14C 3M4OC 1K83C 4A3IC 3DXJA 3RZDC 4X6AC 4A3GK 4A3JK 4Y7NK 1I6VA 1R9TC 2R93K 3GTPC 4BXXC 2R92C 2B63K 1WCMC 1Y1WC 5IYCK 2NVYC 2JA6C 3PO3K 4KMUA 3H0GK 4YFNA 3S2DK 2PPBA 5IYDC 3CQZC 4Q5SA 4QIWD 4QIWL 1SFOK 2WAQD 2JA8K 2WAQL 2NVQK 4BY7K 3HOVC 4XSXA 3S1QK 4LJZA 2PA8L 1I6HC 4MQ9A 2YU9C
chains in the Genus database with same CATH superfamily
5TMFA 4A3LC 4A3DC 1O27A 3OREA 1SMYA 4PABA 1TWHK 1ZQ1C 1Y1VA 2W7VA 4KN7A 3NUHA 3QX3A 3A8JA 4A3FK 4P5AA 4OIOA 1XZPA 3T00A 5IYBK 2CFAB 1Y1VK 1I3QA 1XZQB 3SZZA 1J6WA 3HOVK 3T02A 1K83A 3MMLB 5IOQA 4OIQA 4GTAA 5C4XK 4BY1C 1BS2A 4A3CK 1RU0A 3HOXC 1X31C 3L4KA 5TJ3A 2JA6A 2VUMC 5FLMC 4PAAA 4GTLA 2GSNA 3S14K 1K83K 4BLAA 1I50A 4GZYA 3GEEA 3GTQC 3HKZD 3N0BA 2JA6K 4C2MC 2JA8C 1IS1A 1BGWA 3TFJA 1GE9A 2E2JC 4C3HK 4C3JC 2B63A 3AD9C 1I6HK 1I50K 3SZYA 4MEYA 3GIRA 2D6FC 5IORA 3S0XA 3GTJK 3GDZA 5C4JC 3H3VD 4Y7NC 3HOZC 1C0AA 3S2HC 1YCLA 4LLGA 2V6UA 2R7ZA 3GTMC 1O24A 1EFWA 3S16K 2PMZL 3PO2K 2E2HC 2E2IC 5JFEA 4KB4A 2R7ZK 2WB1D 2BE5A 3AD7C 1IBAA 1SFOA 3M4OC 4KMAA 4AH6A 1JOEA 4X6AC 4A3GK 5HL8A 1VRQC 3GTOA 3OPFA 1V5VA 3GTGA 3S2DK 2PPBA 5IYDC 4QIWD 1F93A 5IOSA 1SFOK 4GTCA 3LPXA 2YU9C 2GAGC 2R92A 1WCMA 3GTOK 4BKWA 1XXAA 1IQ0A 1TWGC 4LK1A 3GTGK 5M5WK 5M3MK 3S1MK 3A8IA 3CQZA 4WJ4A 1EI6A 1TWFA 1WCMK 4KATA 3HKZL 1TWAC 4A3KK 2JA5C 3FKIA 2XCQA 3S15K 1YNJA 3S1RK 1BJTA 2XCRB 4AYBD 4A3MK 1TWCA 3BP3A 5IP7C 3CQZK 3HOWC 1TWFK 1DCHA 2PA8D 5C44C 3RZOC 3FKIK 2NVXC 3TTGA 4Y52C 3HOUC 3I4MK 3GEIA 4GTBA 1TWCK 1WSVA 4C45A 2PHCB 4A3JC 4A3IK 2R93C 3GEHA 1R9TK 4BXXK 3PO3C 2VUMA 2NVQC 4BY7C 2A6HA 3S1QC 4G7ZA 2RGRA 1AB4A 1EH1A 2JA7A 1G51A 4BY1K 3GTQA 2GSOA 2WB1L 1F7VA 4G0VA 1TWHC 4GFQA 1I3QK 5CJ9A 2JA7K 4A3FC 3GTQK 5IYCC 4LK0A 4G0UA 3GTKA 4KN4A 4A93K 4C2MK 2V6TA 3H0GC 5IYBC 1Y1VC 3L4JA 5CHPA 3S17K 2P8TA 4KM8A 4OINA 2E2JK 1WORA 5M5YK 1XPPA 5C4XC 4KMDA 3JSTA 1WQGA 4A3CC 4FZBA 1B4BA 4GTEA 1KQ4A 3GTKK 1IW7A 1WOOA 5D4DA 1O28A 1J6XA 2NVTK 3S14C 1K83C 4Y7NK 1I6VA 3GTPC 2E2IA 2B63K 1O29A 1J98A 2JA6C 1USMA 4KMUA 4Q5SA 2CFAA 1XZQA 2WAQL 4XSXA 4C3HC 2PA8L 1I6HC 4MQ9A 2E2IK 3M3YK 3FOEA 1BDFA 4GTFA 3VA7A 4A3EC 4M1XA 3HXAA 5EGEA 4A3BK 3GTJC 2O5IA 3M4OK 4C3IK 1YX2A 3S16C 3FOFA 3I4NK 1VH2A 4GT9A 3PO2C 4DDQA 4O2DA 2GSUA 1VJEA 2ZUFA 4JK1A 1WIHA 4LQYA 1PJ5A 4BBSK 2R7ZC 1Y1WA 2JA5A 2NVYA 3S1NK 3K7AC 3GTLC 2FQTA 5FJ8K 3G4CA 4BBRC 1HI9A 2GAHC 3LAPA 5IP9C 4A3GC 4WJ3M 4KAWX 3CAGA 3RZDK 1O2BA 1J6VA 2R92K 3AQPA 1Y1WK 2JA5K 2NVYK 5C3EC 1XZPB 4QJVA 1SFOC 1WOSA 3AH5A 1IL2A 1YNNA 5IP7K 4WILA 2R93A 3T01A 3GTOC 4FM9A 5TMCA 4YG2A 4A3LK 4A3DK 4Q4ZA 3GTGC 3HOYC 3OEPA 3S1MC 1WOPA 4ZH4A 4ILDA 4RMFA 4XSZA 3H3VL 4KMHA 1VGXA 2KWAA 1F7UA 1ZYRA 1O2AA 3N0CA 4A3KC 1EQRA 3S15C 5EGHA 3S1RC 4YFKA 3IPJA 4A3MC 1UV7A 2PMZD 2A68A 1TWFC 3AQOA 4G0WA 3G4AA 1VLOA 1JQWA 2Y0SD 2Y3PA 3FKIC 3HOXK 3H0GA 3I4MC 2RH6A 5FLMK 2VUMK 1TWCC 4A3IC 4GTDA 3DXJA 1R9TC 4BXXC 4KM9A 5IYCK 2V6SA 3H0GK 4YFNA 4LOWA 4QIWL 2JA8K 1XXBA 1EK8A 3HOVC 5IOTA 3GTPA 4C3JK 3ADAC 1USOA 4XCHA 4KB2A 3GTMA 1IE0A 1I3QC 5C4JK 2ZFZA 2JA7C 3V4GA 2E2HA 3GTPK 3EQLA 1WQFA 3HOZK 3TFHA 3S2HK 4XLPA 4MEXA 1PJ6A 4A93C 3GTMK 3S17C 3GTJA 4AYBL 1PJ7A 1ISEA 1DCOA 3BUEA 1WSRA 2E2HK 1I50C 1O25A 3GTKC 4A3EK 4BLBA 4OIRA 4KDDA 1L0WA 4P9SA 1B4AA 3LAJA 2NVTC 3N3YA 4LR2A 2JH3A 3ERED 4G7HA 4X6AK 5M3FK 2B63C 1ZVUA 3Q3QA 4KC6A 4YFXA 2YU9A 1O2FB 2A69A 4QJVB 3GTLA 1TWGA 2A6EA 3WODA 4OIPA 2O5JA 5IYDK 2CW0A 3GSIA 5E68A 5L46A 4G7OA 3M3YC 1DD5A 1JVIA 2YU9K 2Y0SL 4KASA 4NOIA 1TWAA 4A3BC 3K7AK 3GTLK 1TWGK 1F9NA 4BBRK 4C3IC 1WQHA 5IP9K 4KARA 3A8KA 1INNA 1O26A 4P5BA 1TWAK 5C3EK 2NVXA 3S2DC 3I4NC 4XLNA 5M5XK 2XCOA 3HOWK 4BBSC 2P5MA 1ZXOA 1HQMA 5C44K 1XXCA 3S1NC 3AD8C 3RZOK 3HOYK 1DCPA 2NVXK 3TFIA 3FHZA 4Y52K 3HOUK 4J3NA 5JVOA 3BP8C 3RZDC 4A3JK 2R93K 2R92C 1WCMC 1Y1WC 2EBBA 2NVYC 1ZBSA 3PO3K 1TWHA 2FQOA 2WAQD 2NVQK 4BY7K 3S1QK 4LJZA 3CQZC 1R9TA 2ZUEA
chains in the Genus database with same CATH topology
4C3JK 2E2IK 5TMFA 3M3YK 3GTOK 4A3LC 4A3DC 1BDFA 4A3EC 1SMYA 1TWGC 4LK1A 3GTGK 4A3BK 1TWHK 5M5WK 3GTJC 1I3QC 5M3MK 2O5IA 3S1MK 4C3IK 3M4OK 5C4JK 2JA7C 3GTPK 3EQLA 4KN7A 3HOZK 1WCMK 3S2HK 3HKZL 1TWAC 4XLPA 4A3FK 4A3KK 4MEXA 2JA5C 3S15K 4A93C 1YNJA 3GTMK 4OIOA 3S1RK 3S16C 5IYBK 3S17C 4AYBD 4AYBL 1Y1VK 4A3MK 3I4NK 3PO2C 3HOVK 5IP7C 3CQZK 3HOWC 1TWFK 4OIQA 4JK1A 2E2HK 2PA8D 5C4XK 1I50C 5C44C 4BY1C 3GTKC 2R7ZC 4A3CK 4A3EK 3RZOC 3FKIK 3HOXC 4BBSK 4OIRA 3S1NK 2NVXC 2VUMC 5FLMC 4Y52C 3K7AC 3GTLC 3HOUC 3I4MK 5FJ8K 2NVTC 4BBRC 1TWCK 3S14K 5IP9C 1K83K 4A3GC 4A3JC 4A3IK 4G7HA 3RZDK 2R93C 4X6AK 5M3FK 2B63C 1R9TK 4YFXA 4BXXK 2R92K 4GZYA 3GTQC 1Y1WK 2JA5K 3HKZD 3PO3C 2NVYK 2JA6K 2A69A 4QJVB 5C3EC 2A6EA 4QJVA 4OIPA 3WODA 1SFOC 2CW0A 2JA8C 2A6HA 2NVQC 4BY7C 2O5JA 5IYDK 1YNNA 5IP7K 3S1QC 4G7ZA 2E2JC 4C3HK 4G7OA 3M3YC 1I6HK 3GTOC 1I50K 2YU9K 2Y0SL 4YG2A 5TMCA 4BY1K 4A3LK 4MEYA 4A3DK 2WB1L 4NOIA 4Q4ZA 3GTGC 4A3BC 3HOYC 3K7AK 1TWHC 3GTLK 1TWGK 3S1MC 4BBRK 4ZH4A 3GTJK 5C4JC 1I3QK 3H3VD 4XSZA 5IP9K 3H3VL 4Y7NC 2JA7K 3HOZC 1ZYRA 3S2HC 4LLGA 4A3KC 4A3FC 3GTQK 5IYCC 4LK0A 3S15C 1TWAK 4KN4A 3GTMC 3S1RC 4YFKA 4C2MK 5IYBC 3H0GC 5C3EK 4A93K 3S2DC 1Y1VC 4A3MC 3S16K 3I4NC 4XLNA 5M5XK 3S17K 2PMZD 2PMZL 4OINA 2A68A 3PO2K 1TWFC 2E2JK 2E2HC 5M5YK 1XPPA 3HOWK 5C4XC 2E2IC 4BBSC 4A3CC 3FKIC 2Y0SD 1HQMA 5C44K 3GTKK 2R7ZK 3S1NC 3RZOK 2WB1D 3HOXK 1IW7A 3HOYK 2NVXK 3I4MC 2VUMK 5FLMK 5D4DA 4Y52K 2BE5A 1TWCC 3HOUK 2NVTK 3S14C 3M4OC 1K83C 4A3IC 3DXJA 3RZDC 4X6AC 4A3GK 4A3JK 4Y7NK 1I6VA 1R9TC 2R93K 3GTPC 4BXXC 2R92C 2B63K 1WCMC 1Y1WC 5IYCK 2NVYC 2JA6C 3PO3K 4KMUA 3H0GK 4YFNA 3S2DK 2PPBA 5IYDC 3CQZC 4Q5SA 4QIWD 4QIWL 1SFOK 2WAQD 2JA8K 2WAQL 2NVQK 4BY7K 3HOVC 4XSXA 3S1QK 4LJZA 2PA8L 1I6HC 4MQ9A 2YU9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J K;  2E2I K;  5TMF A;  3M3Y K;  3GTO K;  4A3L C;  4A3D C;  1BDF A;  4A3E C;  1SMY A;  1TWG C;  4LK1 A;  3GTG K;  4A3B K;  1TWH K;  5M5W K;  3GTJ C;  1I3Q C;  5M3M K;  2O5I A;  3S1M K;  4C3I K;  3M4O K;  5C4J K;  2JA7 C;  3GTP K;  3EQL A;  4KN7 A;  3HOZ K;  1WCM K;  3S2H K;  3HKZ L;  1TWA C;  4XLP A;  4A3F K;  4A3K K;  4MEX A;  2JA5 C;  3S15 K;  4A93 C;  1YNJ A;  3GTM K;  4OIO A;  3S1R K;  3S16 C;  5IYB K;  3S17 C;  4AYB D;  4AYB L;  1Y1V K;  4A3M K;  3I4N K;  3PO2 C;  3HOV K;  5IP7 C;  3CQZ K;  3HOW C;  1TWF K;  4OIQ A;  4JK1 A;  2E2H K;  2PA8 D;  5C4X K;  1I50 C;  5C44 C;  4BY1 C;  3GTK C;  2R7Z C;  4A3C K;  4A3E K;  3RZO C;  3FKI K;  3HOX C;  4BBS K;  4OIR A;  3S1N K;  2NVX C;  2VUM C;  5FLM C;  4Y52 C;  3K7A C;  3GTL C;  3HOU C;  3I4M K;  5FJ8 K;  2NVT C;  4BBR C;  1TWC K;  3S14 K;  5IP9 C;  1K83 K;  4A3G C;  4A3J C;  4A3I K;  4G7H A;  3RZD K;  2R93 C;  4X6A K;  5M3F K;  2B63 C;  1R9T K;  4YFX A;  4BXX K;  2R92 K;  4GZY A;  3GTQ C;  1Y1W K;  2JA5 K;  3HKZ D;  3PO3 C;  2NVY K;  2JA6 K;  2A69 A;  4QJV B;  5C3E C;  2A6E A;  4QJV A;  4OIP A;  3WOD A;  1SFO C;  2CW0 A;  2JA8 C;  2A6H A;  2NVQ C;  4BY7 C;  2O5J A;  5IYD K;  1YNN A;  5IP7 K;  3S1Q C;  4G7Z A;  2E2J C;  4C3H K;  4G7O A;  3M3Y C;  1I6H K;  3GTO C;  1I50 K;  2YU9 K;  2Y0S L;  4YG2 A;  5TMC A;  4BY1 K;  4A3L K;  4MEY A;  4A3D K;  2WB1 L;  4NOI A;  4Q4Z A;  3GTG C;  4A3B C;  3HOY C;  3K7A K;  1TWH C;  3GTL K;  1TWG K;  3S1M C;  4BBR K;  4ZH4 A;  3GTJ K;  5C4J C;  1I3Q K;  3H3V D;  4XSZ A;  5IP9 K;  3H3V L;  4Y7N C;  2JA7 K;  3HOZ C;  1ZYR A;  3S2H C;  4LLG A;  4A3K C;  4A3F C;  3GTQ K;  5IYC C;  4LK0 A;  3S15 C;  1TWA K;  4KN4 A;  3GTM C;  3S1R C;  4YFK A;  4C2M K;  5IYB C;  3H0G C;  5C3E K;  4A93 K;  3S2D C;  1Y1V C;  4A3M C;  3S16 K;  3I4N C;  4XLN A;  5M5X K;  3S17 K;  2PMZ D;  2PMZ L;  4OIN A;  2A68 A;  3PO2 K;  1TWF C;  2E2J K;  2E2H C;  5M5Y K;  1XPP A;  3HOW K;  5C4X C;  2E2I C;  4BBS C;  4A3C C;  3FKI C;  2Y0S D;  1HQM A;  5C44 K;  3GTK K;  2R7Z K;  3S1N C;  3RZO K;  2WB1 D;  3HOX K;  1IW7 A;  3HOY K;  2NVX K;  3I4M C;  2VUM K;  5FLM K;  5D4D A;  4Y52 K;  2BE5 A;  1TWC C;  3HOU K;  2NVT K;  3S14 C;  3M4O C;  1K83 C;  4A3I C;  3DXJ A;  3RZD C;  4X6A C;  4A3G K;  4A3J K;  4Y7N K;  1I6V A;  1R9T C;  2R93 K;  3GTP C;  4BXX C;  2R92 C;  2B63 K;  1WCM C;  1Y1W C;  5IYC K;  2NVY C;  2JA6 C;  3PO3 K;  4KMU A;  3H0G K;  4YFN A;  3S2D K;  2PPB A;  5IYD C;  3CQZ C;  4Q5S A;  4QIW D;  4QIW L;  1SFO K;  2WAQ D;  2JA8 K;  2WAQ L;  2NVQ K;  4BY7 K;  3HOV C;  4XSX A;  3S1Q K;  4LJZ A;  2PA8 L;  1I6H C;  4MQ9 A;  2YU9 C; 
#chains in the Genus database with same CATH topology
 5TMF A;  4A3L C;  4A3D C;  1O27 A;  3ORE A;  1SMY A;  4PAB A;  1TWH K;  1ZQ1 C;  1Y1V A;  2W7V A;  4KN7 A;  3NUH A;  3QX3 A;  3A8J A;  4A3F K;  4P5A A;  4OIO A;  1XZP A;  3T00 A;  5IYB K;  2CFA B;  1Y1V K;  1I3Q A;  1XZQ B;  3SZZ A;  1J6W A;  3HOV K;  3T02 A;  1K83 A;  3MML B;  5IOQ A;  4OIQ A;  4GTA A;  5C4X K;  4BY1 C;  1BS2 A;  4A3C K;  1RU0 A;  3HOX C;  1X31 C;  3L4K A;  5TJ3 A;  2JA6 A;  2VUM C;  5FLM C;  4PAA A;  4GTL A;  2GSN A;  3S14 K;  1K83 K;  4BLA A;  1I50 A;  4GZY A;  3GEE A;  3GTQ C;  3HKZ D;  3N0B A;  2JA6 K;  4C2M C;  2JA8 C;  1IS1 A;  1BGW A;  3TFJ A;  1GE9 A;  2E2J C;  4C3H K;  4C3J C;  2B63 A;  3AD9 C;  1I6H K;  1I50 K;  3SZY A;  4MEY A;  3GIR A;  2D6F C;  5IOR A;  3S0X A;  3GTJ K;  3GDZ A;  5C4J C;  3H3V D;  4Y7N C;  3HOZ C;  1C0A A;  3S2H C;  1YCL A;  4LLG A;  2V6U A;  2R7Z A;  3GTM C;  1O24 A;  1EFW A;  3S16 K;  2PMZ L;  3PO2 K;  2E2H C;  2E2I C;  5JFE A;  4KB4 A;  2R7Z K;  2WB1 D;  2BE5 A;  3AD7 C;  1IBA A;  1SFO A;  3M4O C;  4KMA A;  4AH6 A;  1JOE A;  4X6A C;  4A3G K;  5HL8 A;  1VRQ C;  3GTO A;  3OPF A;  1V5V A;  3GTG A;  3S2D K;  2PPB A;  5IYD C;  4QIW D;  1F93 A;  5IOS A;  1SFO K;  4GTC A;  3LPX A;  2YU9 C;  2GAG C;  2R92 A;  1WCM A;  3GTO K;  4BKW A;  1XXA A;  1IQ0 A;  1TWG C;  4LK1 A;  3GTG K;  5M5W K;  5M3M K;  3S1M K;  3A8I A;  3CQZ A;  4WJ4 A;  1EI6 A;  1TWF A;  1WCM K;  4KAT A;  3HKZ L;  1TWA C;  4A3K K;  2JA5 C;  3FKI A;  2XCQ A;  3S15 K;  1YNJ A;  3S1R K;  1BJT A;  2XCR B;  4AYB D;  4A3M K;  1TWC A;  3BP3 A;  5IP7 C;  3CQZ K;  3HOW C;  1TWF K;  1DCH A;  2PA8 D;  5C44 C;  3RZO C;  3FKI K;  2NVX C;  3TTG A;  4Y52 C;  3HOU C;  3I4M K;  3GEI A;  4GTB A;  1TWC K;  1WSV A;  4C45 A;  2PHC B;  4A3J C;  4A3I K;  2R93 C;  3GEH A;  1R9T K;  4BXX K;  3PO3 C;  2VUM A;  2NVQ C;  4BY7 C;  2A6H A;  3S1Q C;  4G7Z A;  2RGR A;  1AB4 A;  1EH1 A;  2JA7 A;  1G51 A;  4BY1 K;  3GTQ A;  2GSO A;  2WB1 L;  1F7V A;  4G0V A;  1TWH C;  4GFQ A;  1I3Q K;  5CJ9 A;  2JA7 K;  4A3F C;  3GTQ K;  5IYC C;  4LK0 A;  4G0U A;  3GTK A;  4KN4 A;  4A93 K;  4C2M K;  2V6T A;  3H0G C;  5IYB C;  1Y1V C;  3L4J A;  5CHP A;  3S17 K;  2P8T A;  4KM8 A;  4OIN A;  2E2J K;  1WOR A;  5M5Y K;  1XPP A;  5C4X C;  4KMD A;  3JST A;  1WQG A;  4A3C C;  4FZB A;  1B4B A;  4GTE A;  1KQ4 A;  3GTK K;  1IW7 A;  1WOO A;  5D4D A;  1O28 A;  1J6X A;  2NVT K;  3S14 C;  1K83 C;  4Y7N K;  1I6V A;  3GTP C;  2E2I A;  2B63 K;  1O29 A;  1J98 A;  2JA6 C;  1USM A;  4KMU A;  4Q5S A;  2CFA A;  1XZQ A;  2WAQ L;  4XSX A;  4C3H C;  2PA8 L;  1I6H C;  4MQ9 A;  2E2I K;  3M3Y K;  3FOE A;  1BDF A;  4GTF A;  3VA7 A;  4A3E C;  4M1X A;  3HXA A;  5EGE A;  4A3B K;  3GTJ C;  2O5I A;  3M4O K;  4C3I K;  1YX2 A;  3S16 C;  3FOF A;  3I4N K;  1VH2 A;  4GT9 A;  3PO2 C;  4DDQ A;  4O2D A;  2GSU A;  1VJE A;  2ZUF A;  4JK1 A;  1WIH A;  4LQY A;  1PJ5 A;  4BBS K;  2R7Z C;  1Y1W A;  2JA5 A;  2NVY A;  3S1N K;  3K7A C;  3GTL C;  2FQT A;  5FJ8 K;  3G4C A;  4BBR C;  1HI9 A;  2GAH C;  3LAP A;  5IP9 C;  4A3G C;  4WJ3 M;  4KAW X;  3CAG A;  3RZD K;  1O2B A;  1J6V A;  2R92 K;  3AQP A;  1Y1W K;  2JA5 K;  2NVY K;  5C3E C;  1XZP B;  4QJV A;  1SFO C;  1WOS A;  3AH5 A;  1IL2 A;  1YNN A;  5IP7 K;  4WIL A;  2R93 A;  3T01 A;  3GTO C;  4FM9 A;  5TMC A;  4YG2 A;  4A3L K;  4A3D K;  4Q4Z A;  3GTG C;  3HOY C;  3OEP A;  3S1M C;  1WOP A;  4ZH4 A;  4ILD A;  4RMF A;  4XSZ A;  3H3V L;  4KMH A;  1VGX A;  2KWA A;  1F7U A;  1ZYR A;  1O2A A;  3N0C A;  4A3K C;  1EQR A;  3S15 C;  5EGH A;  3S1R C;  4YFK A;  3IPJ A;  4A3M C;  1UV7 A;  2PMZ D;  2A68 A;  1TWF C;  3AQO A;  4G0W A;  3G4A A;  1VLO A;  1JQW A;  2Y0S D;  2Y3P A;  3FKI C;  3HOX K;  3H0G A;  3I4M C;  2RH6 A;  5FLM K;  2VUM K;  1TWC C;  4A3I C;  4GTD A;  3DXJ A;  1R9T C;  4BXX C;  4KM9 A;  5IYC K;  2V6S A;  3H0G K;  4YFN A;  4LOW A;  4QIW L;  2JA8 K;  1XXB A;  1EK8 A;  3HOV C;  5IOT A;  3GTP A;  4C3J K;  3ADA C;  1USO A;  4XCH A;  4KB2 A;  3GTM A;  1IE0 A;  1I3Q C;  5C4J K;  2ZFZ A;  2JA7 C;  3V4G A;  2E2H A;  3GTP K;  3EQL A;  1WQF A;  3HOZ K;  3TFH A;  3S2H K;  4XLP A;  4MEX A;  1PJ6 A;  4A93 C;  3GTM K;  3S17 C;  3GTJ A;  4AYB L;  1PJ7 A;  1ISE A;  1DCO A;  3BUE A;  1WSR A;  2E2H K;  1I50 C;  1O25 A;  3GTK C;  4A3E K;  4BLB A;  4OIR A;  4KDD A;  1L0W A;  4P9S A;  1B4A A;  3LAJ A;  2NVT C;  3N3Y A;  4LR2 A;  2JH3 A;  3ERE D;  4G7H A;  4X6A K;  5M3F K;  2B63 C;  1ZVU A;  3Q3Q A;  4KC6 A;  4YFX A;  2YU9 A;  1O2F B;  2A69 A;  4QJV B;  3GTL A;  1TWG A;  2A6E A;  3WOD A;  4OIP A;  2O5J A;  5IYD K;  2CW0 A;  3GSI A;  5E68 A;  5L46 A;  4G7O A;  3M3Y C;  1DD5 A;  1JVI A;  2YU9 K;  2Y0S L;  4KAS A;  4NOI A;  1TWA A;  4A3B C;  3K7A K;  3GTL K;  1TWG K;  1F9N A;  4BBR K;  4C3I C;  1WQH A;  5IP9 K;  4KAR A;  3A8K A;  1INN A;  1O26 A;  4P5B A;  1TWA K;  5C3E K;  2NVX A;  3S2D C;  3I4N C;  4XLN A;  5M5X K;  2XCO A;  3HOW K;  4BBS C;  2P5M A;  1ZXO A;  1HQM A;  5C44 K;  1XXC A;  3S1N C;  3AD8 C;  3RZO K;  3HOY K;  1DCP A;  2NVX K;  3TFI A;  3FHZ A;  4Y52 K;  3HOU K;  4J3N A;  5JVO A;  3BP8 C;  3RZD C;  4A3J K;  2R93 K;  2R92 C;  1WCM C;  1Y1W C;  2EBB A;  2NVY C;  1ZBS A;  3PO3 K;  1TWH A;  2FQO A;  2WAQ D;  2NVQ K;  4BY7 K;  3S1Q K;  4LJZ A;  3CQZ C;  1R9T A;  2ZUE A; 
#chains in the Genus database with same CATH homology
 4C3J K;  2E2I K;  5TMF A;  3M3Y K;  3GTO K;  4A3L C;  4A3D C;  1BDF A;  4A3E C;  1SMY A;  1TWG C;  4LK1 A;  3GTG K;  4A3B K;  1TWH K;  5M5W K;  3GTJ C;  1I3Q C;  5M3M K;  2O5I A;  3S1M K;  4C3I K;  3M4O K;  5C4J K;  2JA7 C;  3GTP K;  3EQL A;  4KN7 A;  3HOZ K;  1WCM K;  3S2H K;  3HKZ L;  1TWA C;  4XLP A;  4A3F K;  4A3K K;  4MEX A;  2JA5 C;  3S15 K;  4A93 C;  1YNJ A;  3GTM K;  4OIO A;  3S1R K;  3S16 C;  5IYB K;  3S17 C;  4AYB D;  4AYB L;  1Y1V K;  4A3M K;  3I4N K;  3PO2 C;  3HOV K;  5IP7 C;  3CQZ K;  3HOW C;  1TWF K;  4OIQ A;  4JK1 A;  2E2H K;  2PA8 D;  5C4X K;  1I50 C;  5C44 C;  4BY1 C;  3GTK C;  2R7Z C;  4A3C K;  4A3E K;  3RZO C;  3FKI K;  3HOX C;  4BBS K;  4OIR A;  3S1N K;  2NVX C;  2VUM C;  5FLM C;  4Y52 C;  3K7A C;  3GTL C;  3HOU C;  3I4M K;  5FJ8 K;  2NVT C;  4BBR C;  1TWC K;  3S14 K;  5IP9 C;  1K83 K;  4A3G C;  4A3J C;  4A3I K;  4G7H A;  3RZD K;  2R93 C;  4X6A K;  5M3F K;  2B63 C;  1R9T K;  4YFX A;  4BXX K;  2R92 K;  4GZY A;  3GTQ C;  1Y1W K;  2JA5 K;  3HKZ D;  3PO3 C;  2NVY K;  2JA6 K;  2A69 A;  4QJV B;  5C3E C;  2A6E A;  4QJV A;  4OIP A;  3WOD A;  1SFO C;  2CW0 A;  2JA8 C;  2A6H A;  2NVQ C;  4BY7 C;  2O5J A;  5IYD K;  1YNN A;  5IP7 K;  3S1Q C;  4G7Z A;  2E2J C;  4C3H K;  4G7O A;  3M3Y C;  1I6H K;  3GTO C;  1I50 K;  2YU9 K;  2Y0S L;  4YG2 A;  5TMC A;  4BY1 K;  4A3L K;  4MEY A;  4A3D K;  2WB1 L;  4NOI A;  4Q4Z A;  3GTG C;  4A3B C;  3HOY C;  3K7A K;  1TWH C;  3GTL K;  1TWG K;  3S1M C;  4BBR K;  4ZH4 A;  3GTJ K;  5C4J C;  1I3Q K;  3H3V D;  4XSZ A;  5IP9 K;  3H3V L;  4Y7N C;  2JA7 K;  3HOZ C;  1ZYR A;  3S2H C;  4LLG A;  4A3K C;  4A3F C;  3GTQ K;  5IYC C;  4LK0 A;  3S15 C;  1TWA K;  4KN4 A;  3GTM C;  3S1R C;  4YFK A;  4C2M K;  5IYB C;  3H0G C;  5C3E K;  4A93 K;  3S2D C;  1Y1V C;  4A3M C;  3S16 K;  3I4N C;  4XLN A;  5M5X K;  3S17 K;  2PMZ D;  2PMZ L;  4OIN A;  2A68 A;  3PO2 K;  1TWF C;  2E2J K;  2E2H C;  5M5Y K;  1XPP A;  3HOW K;  5C4X C;  2E2I C;  4BBS C;  4A3C C;  3FKI C;  2Y0S D;  1HQM A;  5C44 K;  3GTK K;  2R7Z K;  3S1N C;  3RZO K;  2WB1 D;  3HOX K;  1IW7 A;  3HOY K;  2NVX K;  3I4M C;  2VUM K;  5FLM K;  5D4D A;  4Y52 K;  2BE5 A;  1TWC C;  3HOU K;  2NVT K;  3S14 C;  3M4O C;  1K83 C;  4A3I C;  3DXJ A;  3RZD C;  4X6A C;  4A3G K;  4A3J K;  4Y7N K;  1I6V A;  1R9T C;  2R93 K;  3GTP C;  4BXX C;  2R92 C;  2B63 K;  1WCM C;  1Y1W C;  5IYC K;  2NVY C;  2JA6 C;  3PO3 K;  4KMU A;  3H0G K;  4YFN A;  3S2D K;  2PPB A;  5IYD C;  3CQZ C;  4Q5S A;  4QIW D;  4QIW L;  1SFO K;  2WAQ D;  2JA8 K;  2WAQ L;  2NVQ K;  4BY7 K;  3HOV C;  4XSX A;  3S1Q K;  4LJZ A;  2PA8 L;  1I6H C;  4MQ9 A;  2YU9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...