3S1MK

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1mK00
3M3YK 2WB1L 3GTKC 1WCMK 4OINA 2A69A 5IYDC 3HKZD 4GZYA 4A3CC 4QJVA 3H3VL 2B63C 1TWHC 2Y0SD 4BBSC 4Y52K 4QJVB 5IYDK 3HOZC 4A3CK 5FLMK 3HOXC 2R92C 4BY1C 3HOUK 4C3IK 5C3EK 4Y7NC 3GTPC 3S2HC 3FKIK 5M3FK 1I6HK 2NVYC 2JA6C 4A3GK 4BXXC 2PA8L 3DXJA 2CW0A 3M4OK 3WODA 1Y1VK 3S15K 4A93C 3GTQK 4KN7A 4A3FC 3HOVK 3HOYK 1TWGC 4A93K 1I3QC 1HQMA 2JA5C 5M5YK 4AYBD 4G7OA 5C4XC 4X6AK 4A3JK 1I3QK 1R9TK 2NVTC 3CQZC 4C3HK 4JK1A 1IW7A 5C4XK 4KMUA 3GTJC 2E2IK 5IYCC 2PMZD 4A3EC 3S1RK 4OIRA 1I50C 1K83C 3GTMC 3S17C 3S1NK 4A3LC 3I4NC 4NOIA 2NVXC 4A3MC 3H3VD 3GTKK 3EQLA 3S2DC 3S1MC 4YFXA 4A3MK 1TWCC 4ZH4A 1TWHK 4MEYA 2B63K 4A3IC 3GTGC 5TMFA 3S16C 3S1MK 4BBSK 2YU9C 3HOZK 2O5IA 3K7AC 1TWAC 5C4JC 3HOXK 1Y1WC 4YG2A 2JA7C 4XSXA 4BY1K 2R92K 1I6VA 4QIWL 4Y7NK 1BDFA 3GTPK 5M5XK 3S14C 3S2HK 5C4JK 2NVYK 2E2HC 2JA6K 2JA7K 4BXXK 4XSZA 2BE5A 5IYBC 5M5WK 3HOWC 3H0GC 4BBRC 1TWFC 4A3FK 3GTLC 4LJZA 1TWGK 3GTOC 5IYBK 3PO3C 4A3DC 4Q5SA 3H0GK 5IP9C 2WAQD 4BBRK 4C2MK 4XLNA 2E2JC 2JA5K 3I4MC 3PO2C 3HKZL 2NVTK 3CQZK 2WB1D 3GTJK 1SFOC 2Y0SL 1YNNA 5IYCK 4A3EK 4G7HA 3RZOC 4XLPA 1I50K 1K83K 3GTMK 3S17K 4A3LK 3I4NK 5IP7C 2NVXK 3RZOK 4A3BC 4BY7C 4A3KC 5FJ8K 3S2DK 4A3BK 5D4DA 2R7ZC 1TWCK 3S16K 2PA8D 4Q4ZA 4C3JK 4A3IK 3GTGK 5C44C 2NVQC 2O5JA 2YU9K 3K7AK 1TWAK 4AYBL 2R93C 1Y1WK 1ZYRA 2VUMC 2NVQK 4OIPA 3S14K 1WCMC 3RZDC 4KN4A 2E2HK 2PMZL 3S1QC 4LLGA 3HOWK 3RZDK 1TWFK 4Y52C 3S1QK 3GTLK 3GTOK 5FLMC 3PO3K 4LK1A 4A3DK 4LK0A 5IP9K 4OIQA 2PPBA 3I4MK 2E2JK 3HOUC 5C3EC 4MEXA 2JA8C 3PO2K 3FKIC 1I6HC 4OIOA 1SFOK 4A3GC 2JA8K 4G7ZA 2A68A 1Y1VC 3M4OC 3S15C 3GTQC 4MQ9A 2A6HA 3HOVC 3HOYC 1XPPA 4YFNA 4YFKA 5IP7K 4BY7K 1YNJA 4X6AC 4A3JC 4A3KK 4QIWD 5TMCA 5M3MK 1R9TC 2E2IC 1SMYA 2R7ZK 3S1RC 2A6EA 5C44K 3M3YC 2WAQL 2R93K 3S1NC 2VUMK
chains in the Genus database with same CATH superfamily
3GTKC 1EQRA 2A69A 2JH3A 5IYDC 3HKZD 4GZYA 4GTCA 1TWHC 2B63C 5IYDK 3HOZC 4P5AA 2JA5A 3HOUK 1O28A 3S15K 5E68A 4GTFA 1I50A 3TFHA 1PJ6A 4LOWA 1HQMA 2JA5C 2ZUFA 1USOA 4A3JK 1R9TK 2NVTC 2E2IK 1O27A 4KM9A 4A3EC 3GTGA 1IQ0A 3N0CA 2YU9A 2W7VA 1I50C 3S17C 3GTMC 1Y1WA 3I4NC 1WOSA 5L46A 2CFAA 4GTAA 4YFXA 2CFAB 4BBSK 3GTGC 2YU9C 4KM8A 5C4JC 1Y1WC 1I6VA 2XCOA 4QIWL 1BDFA 4Y7NK 5M5XK 5C4JK 2E2HC 2JA6K 4M1XA 4BXXK 5IOTA 3H0GC 4BBRC 1IBAA 4LJZA 1TWGK 3FOFA 3H0GK 5IP9C 4BBRK 1BS2A 2V6TA 3PO2C 1EFWA 2WB1D 3G4CA 1YCLA 5IYCK 3RZOC 4XLPA 1ZBSA 1J6WA 3RZOK 3AD8C 2NVXK 1VH2A 1C0AA 5FJ8K 3FHZA 3S2DK 5D4DA 1TWCK 3S16K 3NUHA 5C44C 4GTBA 1ZYRA 4OIPA 3FKIA 1Y1VA 1TWFK 3A8JA 3GTLK 3GTOK 4A3DK 4LK1A 4LK0A 3BP3A 4C3IC 2JA8C 4C45A 3FKIC 4OIOA 1ZXOA 5TJ3A 2RH6A 2JA8K 3M4OC 1Y1VC 4LQYA 5JVOA 3SZYA 3HOVC 3GIRA 5IP7K 2GAGC 1YNJA 4X6AC 4P9SA 4KMAA 3GEIA 5TMCA 4C3HC 3IPJA 5EGHA 2R7ZK 3TFIA 1JQWA 2R93K 2R92A 2VUMK 1B4BA 1WCMK 2NVYA 2JA7A 4A3CC 2Y0SD 4Y52K 2EBBA 4A3CK 5FLMK 2FQTA 1O2BA 4BY1C 2R92C 5C3EK 3S2HC 1I6HK 4G0WA 2NVYC 4A3GK 3DXJA 3N3YA 4KN7A 3S0XA 3HOYK 1VGXA 1F7VA 3GTJC 4KMUA 1O25A 3S1RK 1F7UA 4KB2A 4G0UA 1TWAA 4PABA 3VA7A 4NOIA 1DCHA 3LAJA 4A3MC 3GTKK 4KARA 4A3MK 4ZH4A 1TWHK 4MEYA 3AQPA 2B63K 3N0BA 3HOZK 1TWAC 4XSXA 1XZQA 3S14C 3JSTA 1XZQB 4XSZA 1IL2A 1O2FB 3HOWC 2ZFZA 4Q5SA 4WILA 3I4MC 2JA5K 2WAQD 2E2JC 5IOSA 2NVTK 2ZUEA 1WQFA 4A3EK 4G7HA 1I50K 3S17K 3GTMK 3I4NK 4GTLA 4O2DA 4A3BC 5EGEA 4BY7C 1ISEA 1J6VA 1DD5A 3A8IA 1VRQC 4A3KC 4A3BK 4KATA 1WOPA 3GTGK 2O5JA 1F9NA 1BGWA 2YU9K 4AYBL 1Y1WK 2D6FC 1XZPA 2E2HK 1WQGA 2PMZL 1XZPB 3GTQA 5IP9K 3PO2K 4MEXA 1I3QA 3AQOA 1PJ5A 3GTQC 4MQ9A 3T00A 4YFKA 5IORA 4QIWD 3AH5A 4BLBA 1B4AA 5IOQA 5C44K 3AD7C 3S1NC 3GTPA 1EK8A 4FM9A 3Q3QA 1JVIA 1F93A 4QJVA 3H3VL 2XCRB 4QJVB 2V6UA 3HOXC 3GTLA 4C3IK 2PHCB 3GTPC 3FKIK 3CQZA 2FQOA 2PA8L 3M4OK 1Y1VK 4A93C 1X31C 1XXCA 4A3FC 1K83A 3HOVK 4A93K 1G51A 5C4XC 2Y3PA 4X6AK 3CQZC 4C3HK 4JK1A 5C4XK 3OPFA 4OIRA 3GSIA 4DDQA 1K83C 3OREA 3LAPA 4A3LC 2V6SA 3A8KA 3H3VD 2R93A 3EQLA 1DCPA 2VUMA 1XXAA 4C3JC 4A3IC 3K7AC 3T01A 4YG2A 2JA7C 2R92K 4BY1K 3S2HK 1SFOA 2NVYK 2JA7K 4GTDA 1UV7A 2P8TA 1EI6A 1PJ7A 3PO3C 4KC6A 3T02A 3HKZL 3QX3A 3GTJK 1SFOC 1J6XA 1YNNA 1O26A 1BJTA 4KB4A 4BLAA 4PAAA 3G4AA 1INNA 1WIHA 2GAHC 2NVQC 1TWAK 4KAWX 5CJ9A 4GFQA 2NVQK 4LR2A 3S14K 3RZDC 4KN4A 4P5BA 4LLGA 1YX2A 3HOWK 3RZDK 3GDZA 1VLOA 3I4MK 2GSOA 2E2JK 3HOUC 1R9TA 2E2IA 4ILDA 4J3NA 3LPXA 4GT9A 3S15C 1WQHA 2A6HA 1XPPA 3GTMA 4BY7K 4A3JC 4A3KK 1R9TC 1IE0A 2E2IC 1KQ4A 1SMYA 1ZVUA 2GSUA 4G0VA 3V4GA 2RGRA 3M3YC 1O2AA 3AD9C 2XCQA 2WB1L 3M3YK 3ERED 2JA6A 4OINA 4GTEA 4KMDA 1RU0A 2E2HA 4BBSC 4WJ3M 1EH1A 1TWGA 1HI9A 4KDDA 3H0GA 3GEEA 4Y7NC 5M3FK 2JA6C 3L4JA 3MMLB 4BXXC 2CW0A 3WODA 3GTQK 1WSVA 3GEHA 4WJ4A 1TWGC 3BP8C 1I3QC 2NVXA 5M5YK 4AYBD 4G7OA 4KMHA 1I3QK 1DCOA 1IW7A 1TWCA 1WOOA 5IYCC 2PMZD 1AB4A 4KASA 2GSNA 3S1NK 1WSRA 2NVXC 3FOEA 3HXAA 4BKWA 2P5MA 3S2DC 3S1MC 5CHPA 1TWCC 1TWFA 3S16C 5TMFA 3S1MK 3GTOA 1GE9A 2O5IA 3HOXK 3GTPK 3SZZA 3ADAC 1XXBA 2BE5A 5HL8A 1JOEA 3TTGA 5IYBC 5M5WK 4A3FK 1TWFC 4C2MC 3GTLC 3GTOC 5IYBK 4A3DC 4XLNA 4C2MK 1J98A 3CQZK 2Y0SL 5JFEA 2R7ZA 3OEPA 1K83K 4A3LK 4RMFA 5IP7C 1WCMA 1O24A 2KWAA 2R7ZC 2PA8D 4Q4ZA 4C3JK 3BUEA 4A3IK 3K7AK 2R93C 4XCHA 2VUMC 3CAGA 1VJEA 1WCMC 3S1QC 1WORA 1IS1A 4Y52C 3L4KA 3S1QK 5FLMC 3PO3K 4OIQA 2PPBA 5C3EC 1I6HC 1ZQ1C 1SFOK 4A3GC 4G7ZA 2A68A 3TFJA 3GTJA 4FZBA 3HOYC 4YFNA 1O29A 1V5VA 3GTKA 4AH6A 1L0WA 5M3MK 2B63A 1TWHA 3S1RC 2A6EA 1USMA 2WAQL
chains in the Genus database with same CATH topology
3M3YK 2WB1L 3GTKC 1WCMK 4OINA 2A69A 5IYDC 3HKZD 4GZYA 4A3CC 4QJVA 3H3VL 2B63C 1TWHC 2Y0SD 4BBSC 4Y52K 4QJVB 5IYDK 3HOZC 4A3CK 5FLMK 3HOXC 2R92C 4BY1C 3HOUK 4C3IK 5C3EK 4Y7NC 3GTPC 3S2HC 3FKIK 5M3FK 1I6HK 2NVYC 2JA6C 4A3GK 4BXXC 2PA8L 3DXJA 2CW0A 3M4OK 3WODA 1Y1VK 3S15K 4A93C 3GTQK 4KN7A 4A3FC 3HOVK 3HOYK 1TWGC 4A93K 1I3QC 1HQMA 2JA5C 5M5YK 4AYBD 4G7OA 5C4XC 4X6AK 4A3JK 1I3QK 1R9TK 2NVTC 3CQZC 4C3HK 4JK1A 1IW7A 5C4XK 4KMUA 3GTJC 2E2IK 5IYCC 2PMZD 4A3EC 3S1RK 4OIRA 1I50C 1K83C 3GTMC 3S17C 3S1NK 4A3LC 3I4NC 4NOIA 2NVXC 4A3MC 3H3VD 3GTKK 3EQLA 3S2DC 3S1MC 4YFXA 4A3MK 1TWCC 4ZH4A 1TWHK 4MEYA 2B63K 4A3IC 3GTGC 5TMFA 3S16C 3S1MK 4BBSK 2YU9C 3HOZK 2O5IA 3K7AC 1TWAC 5C4JC 3HOXK 1Y1WC 4YG2A 2JA7C 4XSXA 4BY1K 2R92K 1I6VA 4QIWL 4Y7NK 1BDFA 3GTPK 5M5XK 3S14C 3S2HK 5C4JK 2NVYK 2E2HC 2JA6K 2JA7K 4BXXK 4XSZA 2BE5A 5IYBC 5M5WK 3HOWC 3H0GC 4BBRC 1TWFC 4A3FK 3GTLC 4LJZA 1TWGK 3GTOC 5IYBK 3PO3C 4A3DC 4Q5SA 3H0GK 5IP9C 2WAQD 4BBRK 4C2MK 4XLNA 2E2JC 2JA5K 3I4MC 3PO2C 3HKZL 2NVTK 3CQZK 2WB1D 3GTJK 1SFOC 2Y0SL 1YNNA 5IYCK 4A3EK 4G7HA 3RZOC 4XLPA 1I50K 1K83K 3GTMK 3S17K 4A3LK 3I4NK 5IP7C 2NVXK 3RZOK 4A3BC 4BY7C 4A3KC 5FJ8K 3S2DK 4A3BK 5D4DA 2R7ZC 1TWCK 3S16K 2PA8D 4Q4ZA 4C3JK 4A3IK 3GTGK 5C44C 2NVQC 2O5JA 2YU9K 3K7AK 1TWAK 4AYBL 2R93C 1Y1WK 1ZYRA 2VUMC 2NVQK 4OIPA 3S14K 1WCMC 3RZDC 4KN4A 2E2HK 2PMZL 3S1QC 4LLGA 3HOWK 3RZDK 1TWFK 4Y52C 3S1QK 3GTLK 3GTOK 5FLMC 3PO3K 4LK1A 4A3DK 4LK0A 5IP9K 4OIQA 2PPBA 3I4MK 2E2JK 3HOUC 5C3EC 4MEXA 2JA8C 3PO2K 3FKIC 1I6HC 4OIOA 1SFOK 4A3GC 2JA8K 4G7ZA 2A68A 1Y1VC 3M4OC 3S15C 3GTQC 4MQ9A 2A6HA 3HOVC 3HOYC 1XPPA 4YFNA 4YFKA 5IP7K 4BY7K 1YNJA 4X6AC 4A3JC 4A3KK 4QIWD 5TMCA 5M3MK 1R9TC 2E2IC 1SMYA 2R7ZK 3S1RC 2A6EA 5C44K 3M3YC 2WAQL 2R93K 3S1NC 2VUMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  2WB1 L;  3GTK C;  1WCM K;  4OIN A;  2A69 A;  5IYD C;  3HKZ D;  4GZY A;  4A3C C;  4QJV A;  3H3V L;  2B63 C;  1TWH C;  2Y0S D;  4BBS C;  4Y52 K;  4QJV B;  5IYD K;  3HOZ C;  4A3C K;  5FLM K;  3HOX C;  2R92 C;  4BY1 C;  3HOU K;  4C3I K;  5C3E K;  4Y7N C;  3GTP C;  3S2H C;  3FKI K;  5M3F K;  1I6H K;  2NVY C;  2JA6 C;  4A3G K;  4BXX C;  2PA8 L;  3DXJ A;  2CW0 A;  3M4O K;  3WOD A;  1Y1V K;  3S15 K;  4A93 C;  3GTQ K;  4KN7 A;  4A3F C;  3HOV K;  3HOY K;  1TWG C;  4A93 K;  1I3Q C;  1HQM A;  2JA5 C;  5M5Y K;  4AYB D;  4G7O A;  5C4X C;  4X6A K;  4A3J K;  1I3Q K;  1R9T K;  2NVT C;  3CQZ C;  4C3H K;  4JK1 A;  1IW7 A;  5C4X K;  4KMU A;  3GTJ C;  2E2I K;  5IYC C;  2PMZ D;  4A3E C;  3S1R K;  4OIR A;  1I50 C;  1K83 C;  3GTM C;  3S17 C;  3S1N K;  4A3L C;  3I4N C;  4NOI A;  2NVX C;  4A3M C;  3H3V D;  3GTK K;  3EQL A;  3S2D C;  3S1M C;  4YFX A;  4A3M K;  1TWC C;  4ZH4 A;  1TWH K;  4MEY A;  2B63 K;  4A3I C;  3GTG C;  5TMF A;  3S16 C;  3S1M K;  4BBS K;  2YU9 C;  3HOZ K;  2O5I A;  3K7A C;  1TWA C;  5C4J C;  3HOX K;  1Y1W C;  4YG2 A;  2JA7 C;  4XSX A;  4BY1 K;  2R92 K;  1I6V A;  4QIW L;  4Y7N K;  1BDF A;  3GTP K;  5M5X K;  3S14 C;  3S2H K;  5C4J K;  2NVY K;  2E2H C;  2JA6 K;  2JA7 K;  4BXX K;  4XSZ A;  2BE5 A;  5IYB C;  5M5W K;  3HOW C;  3H0G C;  4BBR C;  1TWF C;  4A3F K;  3GTL C;  4LJZ A;  1TWG K;  3GTO C;  5IYB K;  3PO3 C;  4A3D C;  4Q5S A;  3H0G K;  5IP9 C;  2WAQ D;  4BBR K;  4C2M K;  4XLN A;  2E2J C;  2JA5 K;  3I4M C;  3PO2 C;  3HKZ L;  2NVT K;  3CQZ K;  2WB1 D;  3GTJ K;  1SFO C;  2Y0S L;  1YNN A;  5IYC K;  4A3E K;  4G7H A;  3RZO C;  4XLP A;  1I50 K;  1K83 K;  3GTM K;  3S17 K;  4A3L K;  3I4N K;  5IP7 C;  2NVX K;  3RZO K;  4A3B C;  4BY7 C;  4A3K C;  5FJ8 K;  3S2D K;  4A3B K;  5D4D A;  2R7Z C;  1TWC K;  3S16 K;  2PA8 D;  4Q4Z A;  4C3J K;  4A3I K;  3GTG K;  5C44 C;  2NVQ C;  2O5J A;  2YU9 K;  3K7A K;  1TWA K;  4AYB L;  2R93 C;  1Y1W K;  1ZYR A;  2VUM C;  2NVQ K;  4OIP A;  3S14 K;  1WCM C;  3RZD C;  4KN4 A;  2E2H K;  2PMZ L;  3S1Q C;  4LLG A;  3HOW K;  3RZD K;  1TWF K;  4Y52 C;  3S1Q K;  3GTL K;  3GTO K;  5FLM C;  3PO3 K;  4LK1 A;  4A3D K;  4LK0 A;  5IP9 K;  4OIQ A;  2PPB A;  3I4M K;  2E2J K;  3HOU C;  5C3E C;  4MEX A;  2JA8 C;  3PO2 K;  3FKI C;  1I6H C;  4OIO A;  1SFO K;  4A3G C;  2JA8 K;  4G7Z A;  2A68 A;  1Y1V C;  3M4O C;  3S15 C;  3GTQ C;  4MQ9 A;  2A6H A;  3HOV C;  3HOY C;  1XPP A;  4YFN A;  4YFK A;  5IP7 K;  4BY7 K;  1YNJ A;  4X6A C;  4A3J C;  4A3K K;  4QIW D;  5TMC A;  5M3M K;  1R9T C;  2E2I C;  1SMY A;  2R7Z K;  3S1R C;  2A6E A;  5C44 K;  3M3Y C;  2WAQ L;  2R93 K;  3S1N C;  2VUM K; 
#chains in the Genus database with same CATH topology
 3GTK C;  1EQR A;  2A69 A;  2JH3 A;  5IYD C;  3HKZ D;  4GZY A;  4GTC A;  1TWH C;  2B63 C;  5IYD K;  3HOZ C;  4P5A A;  2JA5 A;  3HOU K;  1O28 A;  3S15 K;  5E68 A;  4GTF A;  1I50 A;  3TFH A;  1PJ6 A;  4LOW A;  1HQM A;  2JA5 C;  2ZUF A;  1USO A;  4A3J K;  1R9T K;  2NVT C;  2E2I K;  1O27 A;  4KM9 A;  4A3E C;  3GTG A;  1IQ0 A;  3N0C A;  2YU9 A;  2W7V A;  1I50 C;  3S17 C;  3GTM C;  1Y1W A;  3I4N C;  1WOS A;  5L46 A;  2CFA A;  4GTA A;  4YFX A;  2CFA B;  4BBS K;  3GTG C;  2YU9 C;  4KM8 A;  5C4J C;  1Y1W C;  1I6V A;  2XCO A;  4QIW L;  1BDF A;  4Y7N K;  5M5X K;  5C4J K;  2E2H C;  2JA6 K;  4M1X A;  4BXX K;  5IOT A;  3H0G C;  4BBR C;  1IBA A;  4LJZ A;  1TWG K;  3FOF A;  3H0G K;  5IP9 C;  4BBR K;  1BS2 A;  2V6T A;  3PO2 C;  1EFW A;  2WB1 D;  3G4C A;  1YCL A;  5IYC K;  3RZO C;  4XLP A;  1ZBS A;  1J6W A;  3RZO K;  3AD8 C;  2NVX K;  1VH2 A;  1C0A A;  5FJ8 K;  3FHZ A;  3S2D K;  5D4D A;  1TWC K;  3S16 K;  3NUH A;  5C44 C;  4GTB A;  1ZYR A;  4OIP A;  3FKI A;  1Y1V A;  1TWF K;  3A8J A;  3GTL K;  3GTO K;  4A3D K;  4LK1 A;  4LK0 A;  3BP3 A;  4C3I C;  2JA8 C;  4C45 A;  3FKI C;  4OIO A;  1ZXO A;  5TJ3 A;  2RH6 A;  2JA8 K;  3M4O C;  1Y1V C;  4LQY A;  5JVO A;  3SZY A;  3HOV C;  3GIR A;  5IP7 K;  2GAG C;  1YNJ A;  4X6A C;  4P9S A;  4KMA A;  3GEI A;  5TMC A;  4C3H C;  3IPJ A;  5EGH A;  2R7Z K;  3TFI A;  1JQW A;  2R93 K;  2R92 A;  2VUM K;  1B4B A;  1WCM K;  2NVY A;  2JA7 A;  4A3C C;  2Y0S D;  4Y52 K;  2EBB A;  4A3C K;  5FLM K;  2FQT A;  1O2B A;  4BY1 C;  2R92 C;  5C3E K;  3S2H C;  1I6H K;  4G0W A;  2NVY C;  4A3G K;  3DXJ A;  3N3Y A;  4KN7 A;  3S0X A;  3HOY K;  1VGX A;  1F7V A;  3GTJ C;  4KMU A;  1O25 A;  3S1R K;  1F7U A;  4KB2 A;  4G0U A;  1TWA A;  4PAB A;  3VA7 A;  4NOI A;  1DCH A;  3LAJ A;  4A3M C;  3GTK K;  4KAR A;  4A3M K;  4ZH4 A;  1TWH K;  4MEY A;  3AQP A;  2B63 K;  3N0B A;  3HOZ K;  1TWA C;  4XSX A;  1XZQ A;  3S14 C;  3JST A;  1XZQ B;  4XSZ A;  1IL2 A;  1O2F B;  3HOW C;  2ZFZ A;  4Q5S A;  4WIL A;  3I4M C;  2JA5 K;  2WAQ D;  2E2J C;  5IOS A;  2NVT K;  2ZUE A;  1WQF A;  4A3E K;  4G7H A;  1I50 K;  3S17 K;  3GTM K;  3I4N K;  4GTL A;  4O2D A;  4A3B C;  5EGE A;  4BY7 C;  1ISE A;  1J6V A;  1DD5 A;  3A8I A;  1VRQ C;  4A3K C;  4A3B K;  4KAT A;  1WOP A;  3GTG K;  2O5J A;  1F9N A;  1BGW A;  2YU9 K;  4AYB L;  1Y1W K;  2D6F C;  1XZP A;  2E2H K;  1WQG A;  2PMZ L;  1XZP B;  3GTQ A;  5IP9 K;  3PO2 K;  4MEX A;  1I3Q A;  3AQO A;  1PJ5 A;  3GTQ C;  4MQ9 A;  3T00 A;  4YFK A;  5IOR A;  4QIW D;  3AH5 A;  4BLB A;  1B4A A;  5IOQ A;  5C44 K;  3AD7 C;  3S1N C;  3GTP A;  1EK8 A;  4FM9 A;  3Q3Q A;  1JVI A;  1F93 A;  4QJV A;  3H3V L;  2XCR B;  4QJV B;  2V6U A;  3HOX C;  3GTL A;  4C3I K;  2PHC B;  3GTP C;  3FKI K;  3CQZ A;  2FQO A;  2PA8 L;  3M4O K;  1Y1V K;  4A93 C;  1X31 C;  1XXC A;  4A3F C;  1K83 A;  3HOV K;  4A93 K;  1G51 A;  5C4X C;  2Y3P A;  4X6A K;  3CQZ C;  4C3H K;  4JK1 A;  5C4X K;  3OPF A;  4OIR A;  3GSI A;  4DDQ A;  1K83 C;  3ORE A;  3LAP A;  4A3L C;  2V6S A;  3A8K A;  3H3V D;  2R93 A;  3EQL A;  1DCP A;  2VUM A;  1XXA A;  4C3J C;  4A3I C;  3K7A C;  3T01 A;  4YG2 A;  2JA7 C;  2R92 K;  4BY1 K;  3S2H K;  1SFO A;  2NVY K;  2JA7 K;  4GTD A;  1UV7 A;  2P8T A;  1EI6 A;  1PJ7 A;  3PO3 C;  4KC6 A;  3T02 A;  3HKZ L;  3QX3 A;  3GTJ K;  1SFO C;  1J6X A;  1YNN A;  1O26 A;  1BJT A;  4KB4 A;  4BLA A;  4PAA A;  3G4A A;  1INN A;  1WIH A;  2GAH C;  2NVQ C;  1TWA K;  4KAW X;  5CJ9 A;  4GFQ A;  2NVQ K;  4LR2 A;  3S14 K;  3RZD C;  4KN4 A;  4P5B A;  4LLG A;  1YX2 A;  3HOW K;  3RZD K;  3GDZ A;  1VLO A;  3I4M K;  2GSO A;  2E2J K;  3HOU C;  1R9T A;  2E2I A;  4ILD A;  4J3N A;  3LPX A;  4GT9 A;  3S15 C;  1WQH A;  2A6H A;  1XPP A;  3GTM A;  4BY7 K;  4A3J C;  4A3K K;  1R9T C;  1IE0 A;  2E2I C;  1KQ4 A;  1SMY A;  1ZVU A;  2GSU A;  4G0V A;  3V4G A;  2RGR A;  3M3Y C;  1O2A A;  3AD9 C;  2XCQ A;  2WB1 L;  3M3Y K;  3ERE D;  2JA6 A;  4OIN A;  4GTE A;  4KMD A;  1RU0 A;  2E2H A;  4BBS C;  4WJ3 M;  1EH1 A;  1TWG A;  1HI9 A;  4KDD A;  3H0G A;  3GEE A;  4Y7N C;  5M3F K;  2JA6 C;  3L4J A;  3MML B;  4BXX C;  2CW0 A;  3WOD A;  3GTQ K;  1WSV A;  3GEH A;  4WJ4 A;  1TWG C;  3BP8 C;  1I3Q C;  2NVX A;  5M5Y K;  4AYB D;  4G7O A;  4KMH A;  1I3Q K;  1DCO A;  1IW7 A;  1TWC A;  1WOO A;  5IYC C;  2PMZ D;  1AB4 A;  4KAS A;  2GSN A;  3S1N K;  1WSR A;  2NVX C;  3FOE A;  3HXA A;  4BKW A;  2P5M A;  3S2D C;  3S1M C;  5CHP A;  1TWC C;  1TWF A;  3S16 C;  5TMF A;  3S1M K;  3GTO A;  1GE9 A;  2O5I A;  3HOX K;  3GTP K;  3SZZ A;  3ADA C;  1XXB A;  2BE5 A;  5HL8 A;  1JOE A;  3TTG A;  5IYB C;  5M5W K;  4A3F K;  1TWF C;  4C2M C;  3GTL C;  3GTO C;  5IYB K;  4A3D C;  4XLN A;  4C2M K;  1J98 A;  3CQZ K;  2Y0S L;  5JFE A;  2R7Z A;  3OEP A;  1K83 K;  4A3L K;  4RMF A;  5IP7 C;  1WCM A;  1O24 A;  2KWA A;  2R7Z C;  2PA8 D;  4Q4Z A;  4C3J K;  3BUE A;  4A3I K;  3K7A K;  2R93 C;  4XCH A;  2VUM C;  3CAG A;  1VJE A;  1WCM C;  3S1Q C;  1WOR A;  1IS1 A;  4Y52 C;  3L4K A;  3S1Q K;  5FLM C;  3PO3 K;  4OIQ A;  2PPB A;  5C3E C;  1I6H C;  1ZQ1 C;  1SFO K;  4A3G C;  4G7Z A;  2A68 A;  3TFJ A;  3GTJ A;  4FZB A;  3HOY C;  4YFN A;  1O29 A;  1V5V A;  3GTK A;  4AH6 A;  1L0W A;  5M3M K;  2B63 A;  1TWH A;  3S1R C;  2A6E A;  1USM A;  2WAQ L; 
#chains in the Genus database with same CATH homology
 3M3Y K;  2WB1 L;  3GTK C;  1WCM K;  4OIN A;  2A69 A;  5IYD C;  3HKZ D;  4GZY A;  4A3C C;  4QJV A;  3H3V L;  2B63 C;  1TWH C;  2Y0S D;  4BBS C;  4Y52 K;  4QJV B;  5IYD K;  3HOZ C;  4A3C K;  5FLM K;  3HOX C;  2R92 C;  4BY1 C;  3HOU K;  4C3I K;  5C3E K;  4Y7N C;  3GTP C;  3S2H C;  3FKI K;  5M3F K;  1I6H K;  2NVY C;  2JA6 C;  4A3G K;  4BXX C;  2PA8 L;  3DXJ A;  2CW0 A;  3M4O K;  3WOD A;  1Y1V K;  3S15 K;  4A93 C;  3GTQ K;  4KN7 A;  4A3F C;  3HOV K;  3HOY K;  1TWG C;  4A93 K;  1I3Q C;  1HQM A;  2JA5 C;  5M5Y K;  4AYB D;  4G7O A;  5C4X C;  4X6A K;  4A3J K;  1I3Q K;  1R9T K;  2NVT C;  3CQZ C;  4C3H K;  4JK1 A;  1IW7 A;  5C4X K;  4KMU A;  3GTJ C;  2E2I K;  5IYC C;  2PMZ D;  4A3E C;  3S1R K;  4OIR A;  1I50 C;  1K83 C;  3GTM C;  3S17 C;  3S1N K;  4A3L C;  3I4N C;  4NOI A;  2NVX C;  4A3M C;  3H3V D;  3GTK K;  3EQL A;  3S2D C;  3S1M C;  4YFX A;  4A3M K;  1TWC C;  4ZH4 A;  1TWH K;  4MEY A;  2B63 K;  4A3I C;  3GTG C;  5TMF A;  3S16 C;  3S1M K;  4BBS K;  2YU9 C;  3HOZ K;  2O5I A;  3K7A C;  1TWA C;  5C4J C;  3HOX K;  1Y1W C;  4YG2 A;  2JA7 C;  4XSX A;  4BY1 K;  2R92 K;  1I6V A;  4QIW L;  4Y7N K;  1BDF A;  3GTP K;  5M5X K;  3S14 C;  3S2H K;  5C4J K;  2NVY K;  2E2H C;  2JA6 K;  2JA7 K;  4BXX K;  4XSZ A;  2BE5 A;  5IYB C;  5M5W K;  3HOW C;  3H0G C;  4BBR C;  1TWF C;  4A3F K;  3GTL C;  4LJZ A;  1TWG K;  3GTO C;  5IYB K;  3PO3 C;  4A3D C;  4Q5S A;  3H0G K;  5IP9 C;  2WAQ D;  4BBR K;  4C2M K;  4XLN A;  2E2J C;  2JA5 K;  3I4M C;  3PO2 C;  3HKZ L;  2NVT K;  3CQZ K;  2WB1 D;  3GTJ K;  1SFO C;  2Y0S L;  1YNN A;  5IYC K;  4A3E K;  4G7H A;  3RZO C;  4XLP A;  1I50 K;  1K83 K;  3GTM K;  3S17 K;  4A3L K;  3I4N K;  5IP7 C;  2NVX K;  3RZO K;  4A3B C;  4BY7 C;  4A3K C;  5FJ8 K;  3S2D K;  4A3B K;  5D4D A;  2R7Z C;  1TWC K;  3S16 K;  2PA8 D;  4Q4Z A;  4C3J K;  4A3I K;  3GTG K;  5C44 C;  2NVQ C;  2O5J A;  2YU9 K;  3K7A K;  1TWA K;  4AYB L;  2R93 C;  1Y1W K;  1ZYR A;  2VUM C;  2NVQ K;  4OIP A;  3S14 K;  1WCM C;  3RZD C;  4KN4 A;  2E2H K;  2PMZ L;  3S1Q C;  4LLG A;  3HOW K;  3RZD K;  1TWF K;  4Y52 C;  3S1Q K;  3GTL K;  3GTO K;  5FLM C;  3PO3 K;  4LK1 A;  4A3D K;  4LK0 A;  5IP9 K;  4OIQ A;  2PPB A;  3I4M K;  2E2J K;  3HOU C;  5C3E C;  4MEX A;  2JA8 C;  3PO2 K;  3FKI C;  1I6H C;  4OIO A;  1SFO K;  4A3G C;  2JA8 K;  4G7Z A;  2A68 A;  1Y1V C;  3M4O C;  3S15 C;  3GTQ C;  4MQ9 A;  2A6H A;  3HOV C;  3HOY C;  1XPP A;  4YFN A;  4YFK A;  5IP7 K;  4BY7 K;  1YNJ A;  4X6A C;  4A3J C;  4A3K K;  4QIW D;  5TMC A;  5M3M K;  1R9T C;  2E2I C;  1SMY A;  2R7Z K;  3S1R C;  2A6E A;  5C44 K;  3M3Y C;  2WAQ L;  2R93 K;  3S1N C;  2VUM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...