3S1MK

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1mK00
4A3DC 5TMFA 4C3IK 1WCMC 1I3QK 3RZDK 3PO3K 3HOZK 4OIPA 4A3CC 2E2IC 1K83K 2PPBA 1TWFC 4A3FC 4YFXA 3S15K 3GTKK 3GTOK 4Y52K 4KMUA 4MEXA 4A3KC 3GTLC 1Y1VK 4X6AC 5IYDK 1R9TC 1Y1WC 3K7AC 3H3VD 1I6HC 2WAQL 3H0GC 4AYBL 2E2HC 4BY1C 3HOVC 3PO2C 3GTQC 3S14C 5IP9K 3PO2K 2WB1D 3S14K 3H0GK 1TWHC 2E2HK 2YU9C 1YNJA 4XSXA 3M3YC 4A3IK 4MQ9A 5C3EC 3S1MK 4GZYA 2NVYK 1TWCC 1TWAK 4Y7NC 4A3JK 2A68A 3RZOK 4A3BC 4BXXK 2R7ZK 4BY7K 4NOIA 3S1QK 1K83C 4KN4A 2E2JC 4Q4ZA 2R7ZC 2PMZD 3RZOC 4A93C 4BY7C 1TWCK 2NVYC 4A3BK 4BXXC 4A93K 1BDFA 5C3EK 2E2JK 4G7ZA 1I3QC 1TWAC 4Y7NK 3S1QC 3S17K 3S2HK 4G7OA 3HOYC 3HKZD 2O5JA 4A3MC 4BBSC 2NVTK 4A3GK 5C4JC 1TWGC 4OIOA 4C3JK 2JA7K 2NVTC 4A3MK 4BBSK 4OIRA 2VUMC 2Y0SD 3S2DK 1TWGK 1YNNA 4A3EK 4XSZA 3S15C 5M5XK 4QJVB 2A69A 3HOYK 3S2DC 4A3LK 4A3GC 1R9TK 4X6AK 3I4NC 5IYCK 3GTMC 4MEYA 3GTKC 3S17C 5TMCA 3S2HC 5M3FK 4A3CK 3RZDC 2NVQC 4YFNA 4AYBD 4A3DK 5C44K 4LLGA 4A3JC 1ZYRA 4BBRC 3I4NK 3WODA 5D4DA 4A3IC 1I50K 4A3LC 1WCMK 3S16K 2PA8L 1TWHK 4C3HK 2YU9K 4BY1K 2PA8D 5IP9C 3GTPC 4YFKA 3M3YK 3HOVK 4Q5SA 5IP7K 3K7AK 2R92K 3CQZC 2PMZL 4A3KK 3GTLK 4Y52C 5IYDC 3GTQK 4A3FK 1I6HK 1Y1WK 1TWFK 1Y1VC 4OIQA 2NVXC 3GTOC 3CQZK 1HQMA 1IW7A 4JK1A 3I4MK 5C4XC 4OINA 4YG2A 3DXJA 3GTJK 3S1NC 4QIWD 4LJZA 3FKIC 3HOXK 2B63C 2A6EA 2Y0SL 5M3MK 3HOUK 3HOXC 2WAQD 2B63K 3S1MC 3H3VL 4KN7A 3GTJC 3S1NK 3EQLA 2JA8C 3I4MC 3M4OK 3FKIK 3HKZL 2NVQK 3HOUC 2A6HA 4LK1A 2NVXK 5IYBC 5FJ8K 4XLNA 5M5YK 5C4XK 2JA5C 3S1RK 1XPPA 5M5WK 3HOWK 2O5IA 1SFOK 5IYCC 3GTGC 3S1RC 3GTMK 2R93C 4XLPA 2JA6K 4C2MK 1SFOC 2CW0A 5FLMC 1I6VA 4ZH4A 2R93K 1SMYA 5FLMK 3GTPK 4QIWL 2JA6C 2BE5A 4A3EC 2E2IK 3GTGK 4LK0A 5IP7C 2R92C 3HOWC 2VUMK 4G7HA 2JA8K 4QJVA 2JA5K 2JA7C 3HOZC 3M4OC 5C4JK 4BBRK 3PO3C 2WB1L 5IYBK 3S16C 5C44C 1I50C
chains in the Genus database with same CATH superfamily
5TMFA 4C3IK 1I3QK 3PO3K 1ZVUA 3GTKA 3BP8C 1C0AA 2NVYA 4A3CC 1GE9A 1EI6A 3TFHA 4A3FC 1EFWA 3L4KA 4FZBA 5IYDK 1TWGA 4MEXA 1ZXOA 1JVIA 1Y1WC 3H3VD 3HOVC 4BY1C 3GTQC 5IP9K 3GSIA 1SFOA 3M3YC 5IOSA 3OEPA 4P5AA 3GTGA 4A3BC 4BXXK 1TWAK 5IORA 3LPXA 4KB4A 4NOIA 5TJ3A 4G0VA 2R7ZC 4A93C 5EGEA 4A93K 1BDFA 3AQOA 1Y1VA 4Y7NK 4G7OA 1WQFA 3HOYC 2O5JA 2NVTK 4A3GK 4C3JK 2NVTC 2XCRB 2RH6A 1IE0A 5M5XK 3GTQA 1HI9A 1O2FB 3SZZA 5IYCK 1VLOA 3JSTA 1WOPA 3S2HC 2B63A 5JVOA 4A3DK 1BGWA 5C44K 3GTJA 3I4NK 3WODA 5D4DA 4A3LC 4C3IC 1PJ5A 4C3HK 2YU9K 1DCPA 4BY1K 2PA8D 3ERED 1O28A 3GTPC 1UV7A 2R93A 2CFAB 5CJ9A 2V6SA 4A3FK 3N0CA 3GTOC 4KARA 1IW7A 4JK1A 3S1NC 2JA5A 4KC6A 3GTPA 3T00A 4LJZA 1YX2A 2Y0SL 2WAQD 3S1MC 1WSVA 3GTJC 3I4MC 4DDQA 4LQYA 4G0UA 4LK1A 1AB4A 4GTAA 5HL8A 3S1RK 3SZYA 5M5WK 2R93C 5IYCC 2JA6K 5FLMC 4ZH4A 5FLMK 2JA6C 4G7HA 2JA8K 4QJVA 3HOZC 1IBAA 4BBRK 3S16C 4KM8A 2EBBA 1O27A 3RZDK 2XCOA 1EQRA 2RGRA 3FOFA 1TWFC 4YFXA 3S15K 3CQZA 1F9NA 3GTOK 3GTLC 1KQ4A 1O2AA 2WAQL 4AYBL 4KMDA 2JH3A 1YNJA 1IL2A 4A3IK 4MQ9A 1TWCC 3RZOK 2A68A 3S1QK 4KMHA 4Q4ZA 3TFJA 1IS1A 4BY7C 2NVYC 1O29A 5C3EK 2GSOA 2E2JK 1I3QC 3FHZA 3S2HK 3BP3A 5C4JC 1TWGC 2JA7K 3GTMA 4OIRA 2VUMC 3T02A 1TWGK 1YNNA 4XSZA 1PJ7A 4C2MC 4A3GC 3GTKC 3OREA 3HXAA 4YFNA 4AYBD 1WSRA 4LLGA 1XXCA 2V6UA 3FOEA 3QX3A 4A3IC 1K83A 3S16K 2PA8L 1J6WA 1O25A 2FQTA 1USMA 3M3YK 4Q5SA 4XCHA 3GTLK 3GTQK 3Q3QA 1Y1WK 1F7UA 1WOOA 4J3NA 2NVXC 1INNA 3CQZK 1XZQA 4OINA 1ISEA 1XZQB 3HOXK 2B63C 1BJTA 3HOUK 3HOXC 2B63K 4KN7A 3N0BA 3EQLA 4G0WA 2R92A 5EGHA 2NVXK 4XLNA 5M5YK 1G51A 2GAHC 3GDZA 1XPPA 3GEIA 2O5IA 1USOA 4X6AC 1VJEA 1I6VA 2R93K 4QIWL 3GEHA 2BE5A 4KM9A 4A3EC 2E2IK 1XXAA 3AD7C 3GEEA 3S0XA 5L46A 2JA5K 4C45A 1BS2A 2P8TA 1WQGA 3TFIA 3FKIA 1WCMC 4KAWX 4LR2A 2E2IC 1WOSA 4KMUA 1PJ6A 1Y1VK 4GTEA 2XCQA 1R9TC 1I6HC 2JA6A 3PO2K 3S14K 3H0GK 4C3HC 2E2HK 2YU9C 4XSXA 2ZFZA 5C3EC 2NVYK 3LAJA 1O24A 4Y7NC 4BY7K 3CAGA 1JQWA 1I50A 1K83C 4BLAA 2PMZD 3RZOC 1TWCK 1F93A 1TWHA 4G7ZA 1TWAC 3S17K 1EK8A 1O26A 1XZPA 4A3MC 4BBSC 4KMAA 3N3YA 4A3MK 4BBSK 3T01A 4C3JC 3GTOA 1X31C 3S2DC 1TWAA 3S15C 2A69A 3HOYK 1R9TK 1R9TA 3BUEA 4KASA 4KATA 3GTMC 3GIRA 5JFEA 4A3CK 3RZDC 2NVQC 2E2IA 4GTFA 1J98A 1ZYRA 4P5BA 4BBRC 4WJ4A 1VGXA 1I50K 1WCMK 2GSNA 5IP9C 1L0WA 3HOVK 5IP7K 3AQPA 5IYDC 1DCHA 1EH1A 3A8IA 3MMLB 1HQMA 3A8KA 3I4MK 4GT9A 3GTJK 3FKIC 1B4BA 1VRQC 3TTGA 5IOQA 2A6EA 1TWFA 3H3VL 2CFAA 3S1NK 5E68A 2ZUEA 3HKZL 2NVQK 1J6VA 1WQHA 2A6HA 3HOUC 5IYBC 5FJ8K 5C4XK 3GTLA 3HOWK 3GTMK 3GTGC 4XLPA 4FM9A 4P9SA 1SFOC 3GTPK 3GTGK 1XXBA 4LK0A 1V5VA 2R92C 3HOWC 1ZBSA 3M4OC 1RU0A 5IYBK 5C44C 4A3DC 2KWAA 2Y3PA 3HOZK 3G4CA 4OIPA 1WIHA 2NVXA 2PPBA 1K83K 3H0GA 4BKWA 2E2HA 4GFQA 3GTKK 4Y52K 2ZUFA 4AH6A 4A3KC 3AD9C 3K7AC 3H0GC 2E2HC 3PO2C 4WILA 3S14C 2WB1D 2FQOA 1TWHC 4RMFA 3S1MK 4GZYA 4A3JK 2R7ZK 4M1XA 4KN4A 1B4AA 2E2JC 1J6XA 3OPFA 3VA7A 4A3BK 4BXXC 2PHCB 3L4JA 2YU9A 3S1QC 3NUHA 3A8JA 4BLBA 2V6TA 3V4GA 3HKZD 4OIOA 4GTCA 4KB2A 2Y0SD 3S2DK 4A3EK 1IQ0A 4QJVB 1I3QA 4WJ3M 4A3LK 4GTBA 4X6AK 3I4NC 1YCLA 4MEYA 3S17C 5TMCA 1WCMA 3G4AA 4GTLA 5M3FK 4KDDA 1DCOA 1DD5A 1JOEA 2GSUA 1TWCA 1VH2A 4A3JC 4LOWA 4O2DA 2R7ZA 1TWHK 1ZQ1C 4PAAA 4YFKA 5CHPA 2R92K 3K7AK 3CQZC 4PABA 2PMZL 4A3KK 4Y52C 1I6HK 1TWFK 1Y1VC 4OIQA 3AD8C 4ILDA 5C4XC 4YG2A 3DXJA 1O2BA 4QIWD 2GAGC 3ADAC 5M3MK 2P5MA 2JA8C 3M4OK 4GTDA 2W7VA 3FKIK 1XZPB 3LAPA 1Y1WA 2JA5C 1SFOK 3S1RC 2JA7A 4C2MK 2CW0A 2D6FC 1SMYA 5IOTA 3AH5A 5IP7C 2VUMK 2VUMA 2JA7C 1F7VA 1WORA 5C4JK 3IPJA 3PO3C 2WB1L 1I50C
chains in the Genus database with same CATH topology
4A3DC 5TMFA 4C3IK 1WCMC 1I3QK 3RZDK 3PO3K 3HOZK 4OIPA 4A3CC 2E2IC 1K83K 2PPBA 1TWFC 4A3FC 4YFXA 3S15K 3GTKK 3GTOK 4Y52K 4KMUA 4MEXA 4A3KC 3GTLC 1Y1VK 4X6AC 5IYDK 1R9TC 1Y1WC 3K7AC 3H3VD 1I6HC 2WAQL 3H0GC 4AYBL 2E2HC 4BY1C 3HOVC 3PO2C 3GTQC 3S14C 5IP9K 3PO2K 2WB1D 3S14K 3H0GK 1TWHC 2E2HK 2YU9C 1YNJA 4XSXA 3M3YC 4A3IK 4MQ9A 5C3EC 3S1MK 4GZYA 2NVYK 1TWCC 1TWAK 4Y7NC 4A3JK 2A68A 3RZOK 4A3BC 4BXXK 2R7ZK 4BY7K 4NOIA 3S1QK 1K83C 4KN4A 2E2JC 4Q4ZA 2R7ZC 2PMZD 3RZOC 4A93C 4BY7C 1TWCK 2NVYC 4A3BK 4BXXC 4A93K 1BDFA 5C3EK 2E2JK 4G7ZA 1I3QC 1TWAC 4Y7NK 3S1QC 3S17K 3S2HK 4G7OA 3HOYC 3HKZD 2O5JA 4A3MC 4BBSC 2NVTK 4A3GK 5C4JC 1TWGC 4OIOA 4C3JK 2JA7K 2NVTC 4A3MK 4BBSK 4OIRA 2VUMC 2Y0SD 3S2DK 1TWGK 1YNNA 4A3EK 4XSZA 3S15C 5M5XK 4QJVB 2A69A 3HOYK 3S2DC 4A3LK 4A3GC 1R9TK 4X6AK 3I4NC 5IYCK 3GTMC 4MEYA 3GTKC 3S17C 5TMCA 3S2HC 5M3FK 4A3CK 3RZDC 2NVQC 4YFNA 4AYBD 4A3DK 5C44K 4LLGA 4A3JC 1ZYRA 4BBRC 3I4NK 3WODA 5D4DA 4A3IC 1I50K 4A3LC 1WCMK 3S16K 2PA8L 1TWHK 4C3HK 2YU9K 4BY1K 2PA8D 5IP9C 3GTPC 4YFKA 3M3YK 3HOVK 4Q5SA 5IP7K 3K7AK 2R92K 3CQZC 2PMZL 4A3KK 3GTLK 4Y52C 5IYDC 3GTQK 4A3FK 1I6HK 1Y1WK 1TWFK 1Y1VC 4OIQA 2NVXC 3GTOC 3CQZK 1HQMA 1IW7A 4JK1A 3I4MK 5C4XC 4OINA 4YG2A 3DXJA 3GTJK 3S1NC 4QIWD 4LJZA 3FKIC 3HOXK 2B63C 2A6EA 2Y0SL 5M3MK 3HOUK 3HOXC 2WAQD 2B63K 3S1MC 3H3VL 4KN7A 3GTJC 3S1NK 3EQLA 2JA8C 3I4MC 3M4OK 3FKIK 3HKZL 2NVQK 3HOUC 2A6HA 4LK1A 2NVXK 5IYBC 5FJ8K 4XLNA 5M5YK 5C4XK 2JA5C 3S1RK 1XPPA 5M5WK 3HOWK 2O5IA 1SFOK 5IYCC 3GTGC 3S1RC 3GTMK 2R93C 4XLPA 2JA6K 4C2MK 1SFOC 2CW0A 5FLMC 1I6VA 4ZH4A 2R93K 1SMYA 5FLMK 3GTPK 4QIWL 2JA6C 2BE5A 4A3EC 2E2IK 3GTGK 4LK0A 5IP7C 2R92C 3HOWC 2VUMK 4G7HA 2JA8K 4QJVA 2JA5K 2JA7C 3HOZC 3M4OC 5C4JK 4BBRK 3PO3C 2WB1L 5IYBK 3S16C 5C44C 1I50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D C;  5TMF A;  4C3I K;  1WCM C;  1I3Q K;  3RZD K;  3PO3 K;  3HOZ K;  4OIP A;  4A3C C;  2E2I C;  1K83 K;  2PPB A;  1TWF C;  4A3F C;  4YFX A;  3S15 K;  3GTK K;  3GTO K;  4Y52 K;  4KMU A;  4MEX A;  4A3K C;  3GTL C;  1Y1V K;  4X6A C;  5IYD K;  1R9T C;  1Y1W C;  3K7A C;  3H3V D;  1I6H C;  2WAQ L;  3H0G C;  4AYB L;  2E2H C;  4BY1 C;  3HOV C;  3PO2 C;  3GTQ C;  3S14 C;  5IP9 K;  3PO2 K;  2WB1 D;  3S14 K;  3H0G K;  1TWH C;  2E2H K;  2YU9 C;  1YNJ A;  4XSX A;  3M3Y C;  4A3I K;  4MQ9 A;  5C3E C;  3S1M K;  4GZY A;  2NVY K;  1TWC C;  1TWA K;  4Y7N C;  4A3J K;  2A68 A;  3RZO K;  4A3B C;  4BXX K;  2R7Z K;  4BY7 K;  4NOI A;  3S1Q K;  1K83 C;  4KN4 A;  2E2J C;  4Q4Z A;  2R7Z C;  2PMZ D;  3RZO C;  4A93 C;  4BY7 C;  1TWC K;  2NVY C;  4A3B K;  4BXX C;  4A93 K;  1BDF A;  5C3E K;  2E2J K;  4G7Z A;  1I3Q C;  1TWA C;  4Y7N K;  3S1Q C;  3S17 K;  3S2H K;  4G7O A;  3HOY C;  3HKZ D;  2O5J A;  4A3M C;  4BBS C;  2NVT K;  4A3G K;  5C4J C;  1TWG C;  4OIO A;  4C3J K;  2JA7 K;  2NVT C;  4A3M K;  4BBS K;  4OIR A;  2VUM C;  2Y0S D;  3S2D K;  1TWG K;  1YNN A;  4A3E K;  4XSZ A;  3S15 C;  5M5X K;  4QJV B;  2A69 A;  3HOY K;  3S2D C;  4A3L K;  4A3G C;  1R9T K;  4X6A K;  3I4N C;  5IYC K;  3GTM C;  4MEY A;  3GTK C;  3S17 C;  5TMC A;  3S2H C;  5M3F K;  4A3C K;  3RZD C;  2NVQ C;  4YFN A;  4AYB D;  4A3D K;  5C44 K;  4LLG A;  4A3J C;  1ZYR A;  4BBR C;  3I4N K;  3WOD A;  5D4D A;  4A3I C;  1I50 K;  4A3L C;  1WCM K;  3S16 K;  2PA8 L;  1TWH K;  4C3H K;  2YU9 K;  4BY1 K;  2PA8 D;  5IP9 C;  3GTP C;  4YFK A;  3M3Y K;  3HOV K;  4Q5S A;  5IP7 K;  3K7A K;  2R92 K;  3CQZ C;  2PMZ L;  4A3K K;  3GTL K;  4Y52 C;  5IYD C;  3GTQ K;  4A3F K;  1I6H K;  1Y1W K;  1TWF K;  1Y1V C;  4OIQ A;  2NVX C;  3GTO C;  3CQZ K;  1HQM A;  1IW7 A;  4JK1 A;  3I4M K;  5C4X C;  4OIN A;  4YG2 A;  3DXJ A;  3GTJ K;  3S1N C;  4QIW D;  4LJZ A;  3FKI C;  3HOX K;  2B63 C;  2A6E A;  2Y0S L;  5M3M K;  3HOU K;  3HOX C;  2WAQ D;  2B63 K;  3S1M C;  3H3V L;  4KN7 A;  3GTJ C;  3S1N K;  3EQL A;  2JA8 C;  3I4M C;  3M4O K;  3FKI K;  3HKZ L;  2NVQ K;  3HOU C;  2A6H A;  4LK1 A;  2NVX K;  5IYB C;  5FJ8 K;  4XLN A;  5M5Y K;  5C4X K;  2JA5 C;  3S1R K;  1XPP A;  5M5W K;  3HOW K;  2O5I A;  1SFO K;  5IYC C;  3GTG C;  3S1R C;  3GTM K;  2R93 C;  4XLP A;  2JA6 K;  4C2M K;  1SFO C;  2CW0 A;  5FLM C;  1I6V A;  4ZH4 A;  2R93 K;  1SMY A;  5FLM K;  3GTP K;  4QIW L;  2JA6 C;  2BE5 A;  4A3E C;  2E2I K;  3GTG K;  4LK0 A;  5IP7 C;  2R92 C;  3HOW C;  2VUM K;  4G7H A;  2JA8 K;  4QJV A;  2JA5 K;  2JA7 C;  3HOZ C;  3M4O C;  5C4J K;  4BBR K;  3PO3 C;  2WB1 L;  5IYB K;  3S16 C;  5C44 C;  1I50 C; 
#chains in the Genus database with same CATH topology
 5TMF A;  4C3I K;  1I3Q K;  3PO3 K;  1ZVU A;  3GTK A;  3BP8 C;  1C0A A;  2NVY A;  4A3C C;  1GE9 A;  1EI6 A;  3TFH A;  4A3F C;  1EFW A;  3L4K A;  4FZB A;  5IYD K;  1TWG A;  4MEX A;  1ZXO A;  1JVI A;  1Y1W C;  3H3V D;  3HOV C;  4BY1 C;  3GTQ C;  5IP9 K;  3GSI A;  1SFO A;  3M3Y C;  5IOS A;  3OEP A;  4P5A A;  3GTG A;  4A3B C;  4BXX K;  1TWA K;  5IOR A;  3LPX A;  4KB4 A;  4NOI A;  5TJ3 A;  4G0V A;  2R7Z C;  4A93 C;  5EGE A;  4A93 K;  1BDF A;  3AQO A;  1Y1V A;  4Y7N K;  4G7O A;  1WQF A;  3HOY C;  2O5J A;  2NVT K;  4A3G K;  4C3J K;  2NVT C;  2XCR B;  2RH6 A;  1IE0 A;  5M5X K;  3GTQ A;  1HI9 A;  1O2F B;  3SZZ A;  5IYC K;  1VLO A;  3JST A;  1WOP A;  3S2H C;  2B63 A;  5JVO A;  4A3D K;  1BGW A;  5C44 K;  3GTJ A;  3I4N K;  3WOD A;  5D4D A;  4A3L C;  4C3I C;  1PJ5 A;  4C3H K;  2YU9 K;  1DCP A;  4BY1 K;  2PA8 D;  3ERE D;  1O28 A;  3GTP C;  1UV7 A;  2R93 A;  2CFA B;  5CJ9 A;  2V6S A;  4A3F K;  3N0C A;  3GTO C;  4KAR A;  1IW7 A;  4JK1 A;  3S1N C;  2JA5 A;  4KC6 A;  3GTP A;  3T00 A;  4LJZ A;  1YX2 A;  2Y0S L;  2WAQ D;  3S1M C;  1WSV A;  3GTJ C;  3I4M C;  4DDQ A;  4LQY A;  4G0U A;  4LK1 A;  1AB4 A;  4GTA A;  5HL8 A;  3S1R K;  3SZY A;  5M5W K;  2R93 C;  5IYC C;  2JA6 K;  5FLM C;  4ZH4 A;  5FLM K;  2JA6 C;  4G7H A;  2JA8 K;  4QJV A;  3HOZ C;  1IBA A;  4BBR K;  3S16 C;  4KM8 A;  2EBB A;  1O27 A;  3RZD K;  2XCO A;  1EQR A;  2RGR A;  3FOF A;  1TWF C;  4YFX A;  3S15 K;  3CQZ A;  1F9N A;  3GTO K;  3GTL C;  1KQ4 A;  1O2A A;  2WAQ L;  4AYB L;  4KMD A;  2JH3 A;  1YNJ A;  1IL2 A;  4A3I K;  4MQ9 A;  1TWC C;  3RZO K;  2A68 A;  3S1Q K;  4KMH A;  4Q4Z A;  3TFJ A;  1IS1 A;  4BY7 C;  2NVY C;  1O29 A;  5C3E K;  2GSO A;  2E2J K;  1I3Q C;  3FHZ A;  3S2H K;  3BP3 A;  5C4J C;  1TWG C;  2JA7 K;  3GTM A;  4OIR A;  2VUM C;  3T02 A;  1TWG K;  1YNN A;  4XSZ A;  1PJ7 A;  4C2M C;  4A3G C;  3GTK C;  3ORE A;  3HXA A;  4YFN A;  4AYB D;  1WSR A;  4LLG A;  1XXC A;  2V6U A;  3FOE A;  3QX3 A;  4A3I C;  1K83 A;  3S16 K;  2PA8 L;  1J6W A;  1O25 A;  2FQT A;  1USM A;  3M3Y K;  4Q5S A;  4XCH A;  3GTL K;  3GTQ K;  3Q3Q A;  1Y1W K;  1F7U A;  1WOO A;  4J3N A;  2NVX C;  1INN A;  3CQZ K;  1XZQ A;  4OIN A;  1ISE A;  1XZQ B;  3HOX K;  2B63 C;  1BJT A;  3HOU K;  3HOX C;  2B63 K;  4KN7 A;  3N0B A;  3EQL A;  4G0W A;  2R92 A;  5EGH A;  2NVX K;  4XLN A;  5M5Y K;  1G51 A;  2GAH C;  3GDZ A;  1XPP A;  3GEI A;  2O5I A;  1USO A;  4X6A C;  1VJE A;  1I6V A;  2R93 K;  4QIW L;  3GEH A;  2BE5 A;  4KM9 A;  4A3E C;  2E2I K;  1XXA A;  3AD7 C;  3GEE A;  3S0X A;  5L46 A;  2JA5 K;  4C45 A;  1BS2 A;  2P8T A;  1WQG A;  3TFI A;  3FKI A;  1WCM C;  4KAW X;  4LR2 A;  2E2I C;  1WOS A;  4KMU A;  1PJ6 A;  1Y1V K;  4GTE A;  2XCQ A;  1R9T C;  1I6H C;  2JA6 A;  3PO2 K;  3S14 K;  3H0G K;  4C3H C;  2E2H K;  2YU9 C;  4XSX A;  2ZFZ A;  5C3E C;  2NVY K;  3LAJ A;  1O24 A;  4Y7N C;  4BY7 K;  3CAG A;  1JQW A;  1I50 A;  1K83 C;  4BLA A;  2PMZ D;  3RZO C;  1TWC K;  1F93 A;  1TWH A;  4G7Z A;  1TWA C;  3S17 K;  1EK8 A;  1O26 A;  1XZP A;  4A3M C;  4BBS C;  4KMA A;  3N3Y A;  4A3M K;  4BBS K;  3T01 A;  4C3J C;  3GTO A;  1X31 C;  3S2D C;  1TWA A;  3S15 C;  2A69 A;  3HOY K;  1R9T K;  1R9T A;  3BUE A;  4KAS A;  4KAT A;  3GTM C;  3GIR A;  5JFE A;  4A3C K;  3RZD C;  2NVQ C;  2E2I A;  4GTF A;  1J98 A;  1ZYR A;  4P5B A;  4BBR C;  4WJ4 A;  1VGX A;  1I50 K;  1WCM K;  2GSN A;  5IP9 C;  1L0W A;  3HOV K;  5IP7 K;  3AQP A;  5IYD C;  1DCH A;  1EH1 A;  3A8I A;  3MML B;  1HQM A;  3A8K A;  3I4M K;  4GT9 A;  3GTJ K;  3FKI C;  1B4B A;  1VRQ C;  3TTG A;  5IOQ A;  2A6E A;  1TWF A;  3H3V L;  2CFA A;  3S1N K;  5E68 A;  2ZUE A;  3HKZ L;  2NVQ K;  1J6V A;  1WQH A;  2A6H A;  3HOU C;  5IYB C;  5FJ8 K;  5C4X K;  3GTL A;  3HOW K;  3GTM K;  3GTG C;  4XLP A;  4FM9 A;  4P9S A;  1SFO C;  3GTP K;  3GTG K;  1XXB A;  4LK0 A;  1V5V A;  2R92 C;  3HOW C;  1ZBS A;  3M4O C;  1RU0 A;  5IYB K;  5C44 C;  4A3D C;  2KWA A;  2Y3P A;  3HOZ K;  3G4C A;  4OIP A;  1WIH A;  2NVX A;  2PPB A;  1K83 K;  3H0G A;  4BKW A;  2E2H A;  4GFQ A;  3GTK K;  4Y52 K;  2ZUF A;  4AH6 A;  4A3K C;  3AD9 C;  3K7A C;  3H0G C;  2E2H C;  3PO2 C;  4WIL A;  3S14 C;  2WB1 D;  2FQO A;  1TWH C;  4RMF A;  3S1M K;  4GZY A;  4A3J K;  2R7Z K;  4M1X A;  4KN4 A;  1B4A A;  2E2J C;  1J6X A;  3OPF A;  3VA7 A;  4A3B K;  4BXX C;  2PHC B;  3L4J A;  2YU9 A;  3S1Q C;  3NUH A;  3A8J A;  4BLB A;  2V6T A;  3V4G A;  3HKZ D;  4OIO A;  4GTC A;  4KB2 A;  2Y0S D;  3S2D K;  4A3E K;  1IQ0 A;  4QJV B;  1I3Q A;  4WJ3 M;  4A3L K;  4GTB A;  4X6A K;  3I4N C;  1YCL A;  4MEY A;  3S17 C;  5TMC A;  1WCM A;  3G4A A;  4GTL A;  5M3F K;  4KDD A;  1DCO A;  1DD5 A;  1JOE A;  2GSU A;  1TWC A;  1VH2 A;  4A3J C;  4LOW A;  4O2D A;  2R7Z A;  1TWH K;  1ZQ1 C;  4PAA A;  4YFK A;  5CHP A;  2R92 K;  3K7A K;  3CQZ C;  4PAB A;  2PMZ L;  4A3K K;  4Y52 C;  1I6H K;  1TWF K;  1Y1V C;  4OIQ A;  3AD8 C;  4ILD A;  5C4X C;  4YG2 A;  3DXJ A;  1O2B A;  4QIW D;  2GAG C;  3ADA C;  5M3M K;  2P5M A;  2JA8 C;  3M4O K;  4GTD A;  2W7V A;  3FKI K;  1XZP B;  3LAP A;  1Y1W A;  2JA5 C;  1SFO K;  3S1R C;  2JA7 A;  4C2M K;  2CW0 A;  2D6F C;  1SMY A;  5IOT A;  3AH5 A;  5IP7 C;  2VUM K;  2VUM A;  2JA7 C;  1F7V A;  1WOR A;  5C4J K;  3IPJ A;  3PO3 C;  2WB1 L;  1I50 C; 
#chains in the Genus database with same CATH homology
 4A3D C;  5TMF A;  4C3I K;  1WCM C;  1I3Q K;  3RZD K;  3PO3 K;  3HOZ K;  4OIP A;  4A3C C;  2E2I C;  1K83 K;  2PPB A;  1TWF C;  4A3F C;  4YFX A;  3S15 K;  3GTK K;  3GTO K;  4Y52 K;  4KMU A;  4MEX A;  4A3K C;  3GTL C;  1Y1V K;  4X6A C;  5IYD K;  1R9T C;  1Y1W C;  3K7A C;  3H3V D;  1I6H C;  2WAQ L;  3H0G C;  4AYB L;  2E2H C;  4BY1 C;  3HOV C;  3PO2 C;  3GTQ C;  3S14 C;  5IP9 K;  3PO2 K;  2WB1 D;  3S14 K;  3H0G K;  1TWH C;  2E2H K;  2YU9 C;  1YNJ A;  4XSX A;  3M3Y C;  4A3I K;  4MQ9 A;  5C3E C;  3S1M K;  4GZY A;  2NVY K;  1TWC C;  1TWA K;  4Y7N C;  4A3J K;  2A68 A;  3RZO K;  4A3B C;  4BXX K;  2R7Z K;  4BY7 K;  4NOI A;  3S1Q K;  1K83 C;  4KN4 A;  2E2J C;  4Q4Z A;  2R7Z C;  2PMZ D;  3RZO C;  4A93 C;  4BY7 C;  1TWC K;  2NVY C;  4A3B K;  4BXX C;  4A93 K;  1BDF A;  5C3E K;  2E2J K;  4G7Z A;  1I3Q C;  1TWA C;  4Y7N K;  3S1Q C;  3S17 K;  3S2H K;  4G7O A;  3HOY C;  3HKZ D;  2O5J A;  4A3M C;  4BBS C;  2NVT K;  4A3G K;  5C4J C;  1TWG C;  4OIO A;  4C3J K;  2JA7 K;  2NVT C;  4A3M K;  4BBS K;  4OIR A;  2VUM C;  2Y0S D;  3S2D K;  1TWG K;  1YNN A;  4A3E K;  4XSZ A;  3S15 C;  5M5X K;  4QJV B;  2A69 A;  3HOY K;  3S2D C;  4A3L K;  4A3G C;  1R9T K;  4X6A K;  3I4N C;  5IYC K;  3GTM C;  4MEY A;  3GTK C;  3S17 C;  5TMC A;  3S2H C;  5M3F K;  4A3C K;  3RZD C;  2NVQ C;  4YFN A;  4AYB D;  4A3D K;  5C44 K;  4LLG A;  4A3J C;  1ZYR A;  4BBR C;  3I4N K;  3WOD A;  5D4D A;  4A3I C;  1I50 K;  4A3L C;  1WCM K;  3S16 K;  2PA8 L;  1TWH K;  4C3H K;  2YU9 K;  4BY1 K;  2PA8 D;  5IP9 C;  3GTP C;  4YFK A;  3M3Y K;  3HOV K;  4Q5S A;  5IP7 K;  3K7A K;  2R92 K;  3CQZ C;  2PMZ L;  4A3K K;  3GTL K;  4Y52 C;  5IYD C;  3GTQ K;  4A3F K;  1I6H K;  1Y1W K;  1TWF K;  1Y1V C;  4OIQ A;  2NVX C;  3GTO C;  3CQZ K;  1HQM A;  1IW7 A;  4JK1 A;  3I4M K;  5C4X C;  4OIN A;  4YG2 A;  3DXJ A;  3GTJ K;  3S1N C;  4QIW D;  4LJZ A;  3FKI C;  3HOX K;  2B63 C;  2A6E A;  2Y0S L;  5M3M K;  3HOU K;  3HOX C;  2WAQ D;  2B63 K;  3S1M C;  3H3V L;  4KN7 A;  3GTJ C;  3S1N K;  3EQL A;  2JA8 C;  3I4M C;  3M4O K;  3FKI K;  3HKZ L;  2NVQ K;  3HOU C;  2A6H A;  4LK1 A;  2NVX K;  5IYB C;  5FJ8 K;  4XLN A;  5M5Y K;  5C4X K;  2JA5 C;  3S1R K;  1XPP A;  5M5W K;  3HOW K;  2O5I A;  1SFO K;  5IYC C;  3GTG C;  3S1R C;  3GTM K;  2R93 C;  4XLP A;  2JA6 K;  4C2M K;  1SFO C;  2CW0 A;  5FLM C;  1I6V A;  4ZH4 A;  2R93 K;  1SMY A;  5FLM K;  3GTP K;  4QIW L;  2JA6 C;  2BE5 A;  4A3E C;  2E2I K;  3GTG K;  4LK0 A;  5IP7 C;  2R92 C;  3HOW C;  2VUM K;  4G7H A;  2JA8 K;  4QJV A;  2JA5 K;  2JA7 C;  3HOZ C;  3M4O C;  5C4J K;  4BBR K;  3PO3 C;  2WB1 L;  5IYB K;  3S16 C;  5C44 C;  1I50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...