1IE0A

Crystal structure of luxs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
PSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 44
structure length 155
sequence length 156
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1ie0A00
1J6VA 1VGXA 1J6XA 1JQWA 1VJEA 1VH2A 1YCLA 2FQOA 1INNA 5E68A 1JVIA 1J98A 4XCHA 1JOEA 1IE0A 2FQTA 1J6WA
chains in the Genus database with same CATH superfamily
3TTGA 3GTPK 4ZH4A 3TFJA 2PA8D 3GTKC 2NVXC 2A69A 4P5BA 3Q3QA 2YU9K 1USMA 3OREA 1VLOA 4LLGA 2YU9A 2PA8L 1B4BA 1IQ0A 4X6AK 5IYBK 3S1QC 4A3KC 2WB1L 3AQPA 4GTFA 1O26A 2E2HA 4PAAA 3GSIA 5C4JC 4WILA 4A3DC 5FLMK 4KMDA 1YNNA 3HKZL 2NVYK 2ZUFA 2NVQK 3RZDK 2O5JA 4MEYA 3S14C 3S17K 2BE5A 1O2FB 3I4MK 3PO2K 1F7VA 4XSXA 3S16C 4BBSK 3FOFA 4A3IK 2JA6K 2XCOA 3GTOK 3HOZC 5TJ3A 4FZBA 2E2HC 2B63A 1JVIA 2R93A 4G0VA 4MEXA 3M3YC 4JK1A 1BJTA 4A3CC 5C44C 4GTEA 1XZPB 1WCMK 3CQZK 4C2MK 2R93K 4OIOA 3S1NC 4LK1A 4Y52C 1O27A 2R7ZK 4GT9A 5CJ9A 1R9TA 2Y3PA 1TWAA 1ZVUA 2A6EA 5JFEA 4QIWD 4C3JK 4YFXA 2V6UA 1DCHA 1EK8A 4AH6A 5D4DA 5M3FK 3AD7C 4A3JC 2CFAA 3BUEA 4M1XA 3GTQC 2JA5C 3I4NC 3CAGA 1TWFC 2XCRB 3FHZA 1Y1VC 4XCHA 1TWGK 4KN4A 3GTLK 3HOXC 3OEPA 1O29A 1YNJA 4GTDA 5C3EK 3GTOA 1WCMA 3CQZA 2E2IK 4GTBA 5L46A 2XCQA 1VJEA 3DXJA 3S14K 2GSUA 4KM9A 4OINA 3S17C 2RH6A 4KASA 4A3LK 1IL2A 2W7VA 2WB1D 1K83A 5IYDK 3H0GK 5M5WK 1TWHA 3HOWK 3H0GA 1Y1VA 4BBRK 5C4XC 4QIWL 1J6VA 4BXXC 1BS2A 4BLAA 5FJ8K 5M5YK 3K7AK 4A3BK 1DD5A 2JA8K 1SFOK 2NVTK 4QJVB 3N0BA 3S1NK 4KB4A 4BLBA 4RMFA 1V5VA 1R9TC 2GSOA 4A3GK 1TWCA 2E2IA 1KQ4A 3AH5A 1RU0A 4C3IK 1XPPA 3GTKK 3A8IA 4A3FK 3HOUK 3GTQK 3H3VD 1TWFK 4A3MC 4WJ4A 1Y1VK 1I6HC 1TWHK 4BY1C 2O5IA 2CW0A 2E2JK 4O2DA 4X6AC 4MQ9A 4C3HC 1O28A 2WAQD 4BY7K 4LJZA 2VUMC 3FKIA 3ERED 2E2IC 2NVYC 2D6FC 1HI9A 2NVQC 1L0WA 4YFKA 1WQHA 1Y1WK 4OIRA 3LAJA 4Y7NC 5IOQA 1K83C 3BP8C 3G4AA 1HQMA 1EI6A 1VH2A 3GTGK 2B63K 3S2DK 4G7OA 2ZFZA 5IOSA 3JSTA 3M3YK 5JVOA 4A3BC 4A93C 4GTAA 4KMHA 4C2MC 2R93C 3S15K 2VUMA 1X31C 3AD8C 3LPXA 4G0WA 1WQGA 4OIPA 1ZXOA 3GTJA 4A3GC 4NOIA 1IW7A 3AQOA 1I3QC 4G0UA 2Y0SD 3GTKA 4ILDA 1G51A 1C0AA 2R92K 5M5XK 3RZDC 4QJVA 3T02A 3L4JA 1WOPA 1TWAC 1SMYA 2PMZD 3FOEA 5CHPA 1VRQC 1PJ5A 1TWGC 3GTMC 3GTQA 2JA5A 3S1QK 5IYCC 3S1RK 3GTOC 3PO3K 1PJ7A 3IPJA 1USOA 3T00A 4P9SA 1WOSA 3TFHA 2JA7C 3HOVK 1IE0A 1ZQ1C 3A8JA 2PHCB 3T01A 4A3EC 4A3LC 4Q4ZA 1XXBA 1DCPA 1XZPA 2A68A 4LQYA 4XSZA 3S2HK 3HXAA 4Y52K 3S0XA 4KAWX 2B63C 3GTPA 2KWAA 2R92A 3HOZK 1WIHA 1O24A 5C4XK 4BXXK 2ZUEA 4KARA 4A3CK 1WQFA 5IP9K 3S15C 3GTJK 4G7HA 3GTLC 4WJ3M 2GAHC 4XLPA 2R7ZC 1I3QA 2JA7A 3S1MK 2R92C 4KM8A 1B4AA 1YCLA 3GTPC 4C3JC 3HOUC 3RZOC 1EFWA 1WSVA 4KDDA 1F7UA 3V4GA 1I6HK 1DCOA 2YU9C 1TWCC 1F9NA 1BGWA 3G4CA 2A6HA 4P5AA 3N3YA 3S16K 1I50K 3GTMA 5IYBC 2JA6A 5IYCK 3S1RC 1IBAA 1XZQB 3H3VL 4BY7C 2V6TA 2VUMK 5C3EC 3GTGA 3FKIC 2GAGC 5C4JK 3BP3A 3K7AC 2JA7K 1WOOA 4A3EK 1SFOC 2NVTC 2GSNA 4J3NA 1J98A 3QX3A 1Y1WA 1R9TK 4GZYA 3S2HC 3I4MC 3PO2C 4G7ZA 4GTLA 1WORA 3GDZA 3GTGC 2JA6C 4FM9A 1IS1A 4A3JK 1ZYRA 4GFQA 5IP9C 5M3MK 2NVXK 1TWHC 4BY1K 3HOYK 5IP7K 2EBBA 2FQTA 1WCMC 3CQZC 4C45A 3NUHA 4Q5SA 3S1MC 5FLMC 3LAPA 1O2BA 4C3IC 2NVYA 1WSRA 4PABA 4LK0A 4A3FC 4A3MK 1TWCK 5TMCA 1O2AA 2JA5K 2P5MA 1K83K 2RGRA 4KB2A 3EQLA 4YG2A 5IORA 4BBSC 2NVXA 2PMZL 3S2DC 4BBRC 1J6WA 3SZYA 3M4OC 2P8TA 5C44K 3A8KA 1Y1WC 2JA8C 2Y0SL 3L4KA 1O25A 1XZQA 3TFIA 4KMUA 3GEIA 1JQWA 1UV7A 4XLNA 1PJ6A 4KN7A 1ISEA 5IOTA 1TWAK 4LOWA 1EQRA 1EH1A 3HOYC 5IP7C 1TWGA 3I4NK 2FQOA 3GTJC 1F93A 1I50A 3AD9C 3GEHA 3N0CA 1VGXA 3HOXK 1J6XA 1XXCA 3ADAC 4KC6A 3GTLA 1I3QK 4A3KK 5HL8A 3PO3C 5TMFA 1XXAA 4GTCA 3WODA 4YFNA 1I6VA 4KATA 4A3DK 4AYBL 3RZOK 1AB4A 1INNA 2R7ZA 3MMLB 3HOVC 2WAQL 5EGHA 1ZBSA 2E2JC 5IYDC 1I50C 2JH3A 3GTMK 3H0GC 3OPFA 4BKWA 1TWFA 4C3HK 3GEEA 4OIQA 5EGEA 3FKIK 4A3IC 2PPBA 3HOWC 5E68A 1GE9A 4DDQA 3M4OK 3VA7A 2E2HK 1YX2A 4A93K 4KMAA 3GIRA 2CFAB 3HKZD 2V6SA 1BDFA 4Y7NK 1SFOA 4AYBD 4LR2A 3SZZA 1JOEA
chains in the Genus database with same CATH topology
1J6VA 1VGXA 1J6XA 1JQWA 1VJEA 1VH2A 1YCLA 2FQOA 1INNA 5E68A 1JVIA 1J98A 4XCHA 1JOEA 1IE0A 2FQTA 1J6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6V A;  1VGX A;  1J6X A;  1JQW A;  1VJE A;  1VH2 A;  1YCL A;  2FQO A;  1INN A;  5E68 A;  1JVI A;  1J98 A;  4XCH A;  1JOE A;  1IE0 A;  2FQT A;  1J6W A; 
#chains in the Genus database with same CATH topology
 3TTG A;  3GTP K;  4ZH4 A;  3TFJ A;  2PA8 D;  3GTK C;  2NVX C;  2A69 A;  4P5B A;  3Q3Q A;  2YU9 K;  1USM A;  3ORE A;  1VLO A;  4LLG A;  2YU9 A;  2PA8 L;  1B4B A;  1IQ0 A;  4X6A K;  5IYB K;  3S1Q C;  4A3K C;  2WB1 L;  3AQP A;  4GTF A;  1O26 A;  2E2H A;  4PAA A;  3GSI A;  5C4J C;  4WIL A;  4A3D C;  5FLM K;  4KMD A;  1YNN A;  3HKZ L;  2NVY K;  2ZUF A;  2NVQ K;  3RZD K;  2O5J A;  4MEY A;  3S14 C;  3S17 K;  2BE5 A;  1O2F B;  3I4M K;  3PO2 K;  1F7V A;  4XSX A;  3S16 C;  4BBS K;  3FOF A;  4A3I K;  2JA6 K;  2XCO A;  3GTO K;  3HOZ C;  5TJ3 A;  4FZB A;  2E2H C;  2B63 A;  1JVI A;  2R93 A;  4G0V A;  4MEX A;  3M3Y C;  4JK1 A;  1BJT A;  4A3C C;  5C44 C;  4GTE A;  1XZP B;  1WCM K;  3CQZ K;  4C2M K;  2R93 K;  4OIO A;  3S1N C;  4LK1 A;  4Y52 C;  1O27 A;  2R7Z K;  4GT9 A;  5CJ9 A;  1R9T A;  2Y3P A;  1TWA A;  1ZVU A;  2A6E A;  5JFE A;  4QIW D;  4C3J K;  4YFX A;  2V6U A;  1DCH A;  1EK8 A;  4AH6 A;  5D4D A;  5M3F K;  3AD7 C;  4A3J C;  2CFA A;  3BUE A;  4M1X A;  3GTQ C;  2JA5 C;  3I4N C;  3CAG A;  1TWF C;  2XCR B;  3FHZ A;  1Y1V C;  4XCH A;  1TWG K;  4KN4 A;  3GTL K;  3HOX C;  3OEP A;  1O29 A;  1YNJ A;  4GTD A;  5C3E K;  3GTO A;  1WCM A;  3CQZ A;  2E2I K;  4GTB A;  5L46 A;  2XCQ A;  1VJE A;  3DXJ A;  3S14 K;  2GSU A;  4KM9 A;  4OIN A;  3S17 C;  2RH6 A;  4KAS A;  4A3L K;  1IL2 A;  2W7V A;  2WB1 D;  1K83 A;  5IYD K;  3H0G K;  5M5W K;  1TWH A;  3HOW K;  3H0G A;  1Y1V A;  4BBR K;  5C4X C;  4QIW L;  1J6V A;  4BXX C;  1BS2 A;  4BLA A;  5FJ8 K;  5M5Y K;  3K7A K;  4A3B K;  1DD5 A;  2JA8 K;  1SFO K;  2NVT K;  4QJV B;  3N0B A;  3S1N K;  4KB4 A;  4BLB A;  4RMF A;  1V5V A;  1R9T C;  2GSO A;  4A3G K;  1TWC A;  2E2I A;  1KQ4 A;  3AH5 A;  1RU0 A;  4C3I K;  1XPP A;  3GTK K;  3A8I A;  4A3F K;  3HOU K;  3GTQ K;  3H3V D;  1TWF K;  4A3M C;  4WJ4 A;  1Y1V K;  1I6H C;  1TWH K;  4BY1 C;  2O5I A;  2CW0 A;  2E2J K;  4O2D A;  4X6A C;  4MQ9 A;  4C3H C;  1O28 A;  2WAQ D;  4BY7 K;  4LJZ A;  2VUM C;  3FKI A;  3ERE D;  2E2I C;  2NVY C;  2D6F C;  1HI9 A;  2NVQ C;  1L0W A;  4YFK A;  1WQH A;  1Y1W K;  4OIR A;  3LAJ A;  4Y7N C;  5IOQ A;  1K83 C;  3BP8 C;  3G4A A;  1HQM A;  1EI6 A;  1VH2 A;  3GTG K;  2B63 K;  3S2D K;  4G7O A;  2ZFZ A;  5IOS A;  3JST A;  3M3Y K;  5JVO A;  4A3B C;  4A93 C;  4GTA A;  4KMH A;  4C2M C;  2R93 C;  3S15 K;  2VUM A;  1X31 C;  3AD8 C;  3LPX A;  4G0W A;  1WQG A;  4OIP A;  1ZXO A;  3GTJ A;  4A3G C;  4NOI A;  1IW7 A;  3AQO A;  1I3Q C;  4G0U A;  2Y0S D;  3GTK A;  4ILD A;  1G51 A;  1C0A A;  2R92 K;  5M5X K;  3RZD C;  4QJV A;  3T02 A;  3L4J A;  1WOP A;  1TWA C;  1SMY A;  2PMZ D;  3FOE A;  5CHP A;  1VRQ C;  1PJ5 A;  1TWG C;  3GTM C;  3GTQ A;  2JA5 A;  3S1Q K;  5IYC C;  3S1R K;  3GTO C;  3PO3 K;  1PJ7 A;  3IPJ A;  1USO A;  3T00 A;  4P9S A;  1WOS A;  3TFH A;  2JA7 C;  3HOV K;  1IE0 A;  1ZQ1 C;  3A8J A;  2PHC B;  3T01 A;  4A3E C;  4A3L C;  4Q4Z A;  1XXB A;  1DCP A;  1XZP A;  2A68 A;  4LQY A;  4XSZ A;  3S2H K;  3HXA A;  4Y52 K;  3S0X A;  4KAW X;  2B63 C;  3GTP A;  2KWA A;  2R92 A;  3HOZ K;  1WIH A;  1O24 A;  5C4X K;  4BXX K;  2ZUE A;  4KAR A;  4A3C K;  1WQF A;  5IP9 K;  3S15 C;  3GTJ K;  4G7H A;  3GTL C;  4WJ3 M;  2GAH C;  4XLP A;  2R7Z C;  1I3Q A;  2JA7 A;  3S1M K;  2R92 C;  4KM8 A;  1B4A A;  1YCL A;  3GTP C;  4C3J C;  3HOU C;  3RZO C;  1EFW A;  1WSV A;  4KDD A;  1F7U A;  3V4G A;  1I6H K;  1DCO A;  2YU9 C;  1TWC C;  1F9N A;  1BGW A;  3G4C A;  2A6H A;  4P5A A;  3N3Y A;  3S16 K;  1I50 K;  3GTM A;  5IYB C;  2JA6 A;  5IYC K;  3S1R C;  1IBA A;  1XZQ B;  3H3V L;  4BY7 C;  2V6T A;  2VUM K;  5C3E C;  3GTG A;  3FKI C;  2GAG C;  5C4J K;  3BP3 A;  3K7A C;  2JA7 K;  1WOO A;  4A3E K;  1SFO C;  2NVT C;  2GSN A;  4J3N A;  1J98 A;  3QX3 A;  1Y1W A;  1R9T K;  4GZY A;  3S2H C;  3I4M C;  3PO2 C;  4G7Z A;  4GTL A;  1WOR A;  3GDZ A;  3GTG C;  2JA6 C;  4FM9 A;  1IS1 A;  4A3J K;  1ZYR A;  4GFQ A;  5IP9 C;  5M3M K;  2NVX K;  1TWH C;  4BY1 K;  3HOY K;  5IP7 K;  2EBB A;  2FQT A;  1WCM C;  3CQZ C;  4C45 A;  3NUH A;  4Q5S A;  3S1M C;  5FLM C;  3LAP A;  1O2B A;  4C3I C;  2NVY A;  1WSR A;  4PAB A;  4LK0 A;  4A3F C;  4A3M K;  1TWC K;  5TMC A;  1O2A A;  2JA5 K;  2P5M A;  1K83 K;  2RGR A;  4KB2 A;  3EQL A;  4YG2 A;  5IOR A;  4BBS C;  2NVX A;  2PMZ L;  3S2D C;  4BBR C;  1J6W A;  3SZY A;  3M4O C;  2P8T A;  5C44 K;  3A8K A;  1Y1W C;  2JA8 C;  2Y0S L;  3L4K A;  1O25 A;  1XZQ A;  3TFI A;  4KMU A;  3GEI A;  1JQW A;  1UV7 A;  4XLN A;  1PJ6 A;  4KN7 A;  1ISE A;  5IOT A;  1TWA K;  4LOW A;  1EQR A;  1EH1 A;  3HOY C;  5IP7 C;  1TWG A;  3I4N K;  2FQO A;  3GTJ C;  1F93 A;  1I50 A;  3AD9 C;  3GEH A;  3N0C A;  1VGX A;  3HOX K;  1J6X A;  1XXC A;  3ADA C;  4KC6 A;  3GTL A;  1I3Q K;  4A3K K;  5HL8 A;  3PO3 C;  5TMF A;  1XXA A;  4GTC A;  3WOD A;  4YFN A;  1I6V A;  4KAT A;  4A3D K;  4AYB L;  3RZO K;  1AB4 A;  1INN A;  2R7Z A;  3MML B;  3HOV C;  2WAQ L;  5EGH A;  1ZBS A;  2E2J C;  5IYD C;  1I50 C;  2JH3 A;  3GTM K;  3H0G C;  3OPF A;  4BKW A;  1TWF A;  4C3H K;  3GEE A;  4OIQ A;  5EGE A;  3FKI K;  4A3I C;  2PPB A;  3HOW C;  5E68 A;  1GE9 A;  4DDQ A;  3M4O K;  3VA7 A;  2E2H K;  1YX2 A;  4A93 K;  4KMA A;  3GIR A;  2CFA B;  3HKZ D;  2V6S A;  1BDF A;  4Y7N K;  1SFO A;  4AYB D;  4LR2 A;  3SZZ A;  1JOE A; 
#chains in the Genus database with same CATH homology
 1J6V A;  1VGX A;  1J6X A;  1JQW A;  1VJE A;  1VH2 A;  1YCL A;  2FQO A;  1INN A;  5E68 A;  1JVI A;  1J98 A;  4XCH A;  1JOE A;  1IE0 A;  2FQT A;  1J6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...