1IE0A

Crystal structure of luxs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
PSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
total genus 44
structure length 155
sequence length 156
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1ie0A00
5E68A 1VGXA 1JOEA 1IE0A 1VH2A 1J98A 2FQTA 4XCHA 1YCLA 1J6VA 1JVIA 1VJEA 1J6XA 1J6WA 1INNA 2FQOA 1JQWA
chains in the Genus database with same CATH superfamily
3L4JA 4LR2A 1I50A 1WQGA 2NVYA 4KB2A 3GTKC 4GFQA 4YG2A 3LAJA 1J6VA 2CFAB 4LQYA 4BXXK 5CJ9A 3SZZA 2R7ZC 4G7HA 1I3QC 3GTMA 1O29A 2PPBA 5C3EK 2R92C 1PJ5A 1SFOA 4BBSK 4ILDA 3GTOC 1J6WA 1V5VA 1DCOA 3OPFA 4GTDA 4GTEA 1R9TK 3GTKK 2B63A 4A3DC 3AH5A 1I6VA 1B4BA 2VUMC 2XCRB 1B4AA 4XLPA 4KMUA 4P5AA 2JA6A 1Y1WC 4DDQA 2R7ZK 1INNA 1I3QK 4GTBA 5TMFA 3GSIA 2R92K 1Y1VC 3GEIA 3TTGA 1ZQ1C 3GTPA 3GTGA 2V6TA 3Q3QA 2JA7A 1YX2A 2FQOA 4Y52C 1YNNA 2VUMK 2JA8K 5TMCA 1YNJA 2WAQL 4GT9A 4KATA 1WIHA 1IW7A 5IYCC 5IP7C 4A3IC 4RMFA 1VGXA 2WB1L 4O2DA 5M3MK 3GTMC 1IL2A 1Y1VK 4KMDA 4J3NA 1WORA 1O2BA 1X31C 3GDZA 3K7AC 4LK0A 3HOYC 1XZQB 1O26A 2YU9A 1WOSA 3T01A 4BY7C 1ZYRA 2JH3A 4Y52K 5IOSA 4P5BA 3JSTA 2ZUFA 1IQ0A 1WCMA 3CAGA 4A3IK 1TWHA 1G51A 3RZOC 4JK1A 1K83A 4KB4A 3S14C 3I4NK 3HOYK 2V6SA 4GTFA 2A68A 4BY7K 3ADAC 3OREA 4BY1K 1DCPA 2JA7C 1XPPA 3GTQA 3FHZA 3PO3C 1EK8A 3N3YA 1O25A 5FLMC 2RGRA 3S1QC 1VH2A 3RZOK 4C3IC 1XZPB 1TWAK 1TWCC 3AQOA 4QIWL 4A3FK 1WSVA 1TWGK 4XCHA 3S14K 4GTAA 4YFKA 4MEYA 3GEHA 3BP3A 4A3LK 2KWAA 2YU9C 3GTLK 4A3CC 2E2IK 2JA5A 2R93A 5FLMK 1XXCA 3SZYA 4C3IK 4GZYA 3GEEA 1TWHC 4G7OA 2NVXC 3H3VL 2PMZL 3GTJK 1J98A 1VLOA 3G4CA 1IS1A 1GE9A 3PO2K 4KARA 1BJTA 4A3BC 3S1MC 4M1XA 4WILA 4AYBL 4OINA 4OIRA 1ISEA 3GTQC 3I4MK 2E2HC 2Y0SL 2GSUA 1USMA 2NVXK 5D4DA 5IYBC 3TFHA 1WQFA 3S17C 3S16C 3TFIA 4A3BK 1J6XA 5IP9C 2D6FC 1L0WA 3H0GC 4LLGA 2Y3PA 3M3YC 3FKIA 1TWFC 3FOEA 5EGHA 1O2FB 4A3KC 2E2HK 3NUHA 3S1NC 3GTOK 3HOUC 3CQZA 5IOQA 2P8TA 5IYBK 1BGWA 3L4KA 3QX3A 4A3DK 1I50C 5M5YK 3S17K 2NVYC 2PA8D 3S16K 5EGEA 5IORA 4Q5SA 4LOWA 3FOFA 3S0XA 5IP9K 4Y7NC 4ZH4A 3H0GK 1Y1WK 3M3YK 2XCQA 3EQLA 1TWFK 3RZDC 5C4XC 3HOUK 1HI9A 4X6AC 1SFOC 3AD7C 4BLAA 4BLBA 3HKZD 2E2JC 5M3FK 1I50K 1RU0A 2NVYK 1F93A 3MMLB 1KQ4A 2B63C 3S15C 5IYCK 4KM8A 4G0VA 4C2MC 4Y7NK 1YCLA 1ZVUA 4WJ4A 2NVQC 5IP7K 1XXAA 1ZBSA 4GTLA 5C4XK 2JA6C 4BBRC 3FKIC 3GTMK 2A69A 4GTCA 2BE5A 2PHCB 1VJEA 4X6AK 3K7AK 3WODA 4QJVA 5JFEA 2O5IA 4YFNA 1VRQC 3GTPC 3GTGC 2B63K 4MEXA 2P5MA 3S15K 1BDFA 4C2MK 4QIWD 4P9SA 2ZUEA 2JA6K 5C44C 1DCHA 3HOWC 1R9TA 2NVTC 1WQHA 3GTKA 4KN4A 1I6HC 3GTPK 3GTGK 1WSRA 3VA7A 4OIPA 2JA7K 1F9NA 4KDDA 2R7ZA 1I3QA 3PO3K 4A93C 3ERED 2R92A 3S1QK 1WCMC 2A6HA 1O24A 5C44K 1TWCK 3GTOA 3T02A 1DD5A 1K83C 4C3JC 4LJZA 2VUMA 2W7VA 2YU9K 4A3CK 3N0CA 2GAHC 5M5XK 4KMAA 4A93K 1PJ6A 4MQ9A 5IYDC 4A3EC 1Y1VA 1TWHK 4BBSC 4KASA 1K83K 4XLNA 4C3JK 4XSZA 4PAAA 4LK1A 3A8JA 2V6UA 3S1RC 1R9TC 2ZFZA 3LPXA 3S1MK 2RH6A 3TFJA 4PABA 1EI6A 3GTQK 5IYDK 3BP8C 2JA5C 4A3EK 2R93C 5HL8A 1O2AA 4KMHA 4WJ3M 1UV7A 2GSNA 3HOZC 1AB4A 5TJ3A 4KM9A 4NOIA 2CFAA 3S1RK 4A3GC 2WAQD 2FQTA 1F7VA 1SMYA 1EH1A 2GAGC 3GIRA 2JA8C 5JVOA 4G0WA 2WB1D 1TWAA 3M4OC 4C3HC 2JA5K 2R93K 4A3KK 1HQMA 1TWGA 1ZXOA 1IE0A 3S1NK 3HOVC 3HOZK 1EFWA 5IOTA 4FM9A 4A3GK 4OIOA 3GTLA 3AQPA 4A3MC 4Q4ZA 1BS2A 3V4GA 2E2IA 1WOOA 1PJ7A 3T00A 4QJVB 2PA8L 1C0AA 2XCOA 4A3JC 3A8IA 1TWCA 3M4OK 4C3HK 3RZDK 3HXAA 4G7ZA 4KC6A 4FZBA 3GTJA 3HOVK 1SFOK 1USOA 3I4NC 4OIQA 3N0BA 2E2JK 3CQZC 2O5JA 1O28A 4A3MK 4BY1C 3HKZL 4C45A 4A3JK 3DXJA 1EQRA 4BKWA 2NVQK 1JVIA 1TWAC 1XZQA 4BBRK 3HOXC 3FKIK 1JQWA 2NVXA 4A3FC 1TWGC 5L46A 5C4JC 4YFXA 3S2HC 4KAWX 3CQZK 5CHPA 3S2DC 3BUEA 3OEPA 1F7UA 4A3LC 3IPJA 3GTLC 3LAPA 3AD9C 4KN7A 2E2IC 2E2HA 4G0UA 5E68A 3HOXK 2A6EA 3H3VD 2PMZD 1WOPA 5C4JK 1O27A 2EBBA 3AD8C 3HOWK 5M5WK 2NVTK 3GTJC 3S2HK 1JOEA 3A8KA 2GSOA 1I6HK 3S2DK 3G4AA 4AYBD 1IBAA 1XZPA 3PO2C 1Y1WA 3H0GA 4BXXC 1TWFA 5FJ8K 2CW0A 3I4MC 1WCMK 2Y0SD 5C3EC 4AH6A 1XXBA 4XSXA
chains in the Genus database with same CATH topology
5E68A 1VGXA 1JOEA 1IE0A 1VH2A 1J98A 2FQTA 4XCHA 1YCLA 1J6VA 1JVIA 1VJEA 1J6XA 1J6WA 1INNA 2FQOA 1JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E68 A;  1VGX A;  1JOE A;  1IE0 A;  1VH2 A;  1J98 A;  2FQT A;  4XCH A;  1YCL A;  1J6V A;  1JVI A;  1VJE A;  1J6X A;  1J6W A;  1INN A;  2FQO A;  1JQW A; 
#chains in the Genus database with same CATH topology
 3L4J A;  4LR2 A;  1I50 A;  1WQG A;  2NVY A;  4KB2 A;  3GTK C;  4GFQ A;  4YG2 A;  3LAJ A;  1J6V A;  2CFA B;  4LQY A;  4BXX K;  5CJ9 A;  3SZZ A;  2R7Z C;  4G7H A;  1I3Q C;  3GTM A;  1O29 A;  2PPB A;  5C3E K;  2R92 C;  1PJ5 A;  1SFO A;  4BBS K;  4ILD A;  3GTO C;  1J6W A;  1V5V A;  1DCO A;  3OPF A;  4GTD A;  4GTE A;  1R9T K;  3GTK K;  2B63 A;  4A3D C;  3AH5 A;  1I6V A;  1B4B A;  2VUM C;  2XCR B;  1B4A A;  4XLP A;  4KMU A;  4P5A A;  2JA6 A;  1Y1W C;  4DDQ A;  2R7Z K;  1INN A;  1I3Q K;  4GTB A;  5TMF A;  3GSI A;  2R92 K;  1Y1V C;  3GEI A;  3TTG A;  1ZQ1 C;  3GTP A;  3GTG A;  2V6T A;  3Q3Q A;  2JA7 A;  1YX2 A;  2FQO A;  4Y52 C;  1YNN A;  2VUM K;  2JA8 K;  5TMC A;  1YNJ A;  2WAQ L;  4GT9 A;  4KAT A;  1WIH A;  1IW7 A;  5IYC C;  5IP7 C;  4A3I C;  4RMF A;  1VGX A;  2WB1 L;  4O2D A;  5M3M K;  3GTM C;  1IL2 A;  1Y1V K;  4KMD A;  4J3N A;  1WOR A;  1O2B A;  1X31 C;  3GDZ A;  3K7A C;  4LK0 A;  3HOY C;  1XZQ B;  1O26 A;  2YU9 A;  1WOS A;  3T01 A;  4BY7 C;  1ZYR A;  2JH3 A;  4Y52 K;  5IOS A;  4P5B A;  3JST A;  2ZUF A;  1IQ0 A;  1WCM A;  3CAG A;  4A3I K;  1TWH A;  1G51 A;  3RZO C;  4JK1 A;  1K83 A;  4KB4 A;  3S14 C;  3I4N K;  3HOY K;  2V6S A;  4GTF A;  2A68 A;  4BY7 K;  3ADA C;  3ORE A;  4BY1 K;  1DCP A;  2JA7 C;  1XPP A;  3GTQ A;  3FHZ A;  3PO3 C;  1EK8 A;  3N3Y A;  1O25 A;  5FLM C;  2RGR A;  3S1Q C;  1VH2 A;  3RZO K;  4C3I C;  1XZP B;  1TWA K;  1TWC C;  3AQO A;  4QIW L;  4A3F K;  1WSV A;  1TWG K;  4XCH A;  3S14 K;  4GTA A;  4YFK A;  4MEY A;  3GEH A;  3BP3 A;  4A3L K;  2KWA A;  2YU9 C;  3GTL K;  4A3C C;  2E2I K;  2JA5 A;  2R93 A;  5FLM K;  1XXC A;  3SZY A;  4C3I K;  4GZY A;  3GEE A;  1TWH C;  4G7O A;  2NVX C;  3H3V L;  2PMZ L;  3GTJ K;  1J98 A;  1VLO A;  3G4C A;  1IS1 A;  1GE9 A;  3PO2 K;  4KAR A;  1BJT A;  4A3B C;  3S1M C;  4M1X A;  4WIL A;  4AYB L;  4OIN A;  4OIR A;  1ISE A;  3GTQ C;  3I4M K;  2E2H C;  2Y0S L;  2GSU A;  1USM A;  2NVX K;  5D4D A;  5IYB C;  3TFH A;  1WQF A;  3S17 C;  3S16 C;  3TFI A;  4A3B K;  1J6X A;  5IP9 C;  2D6F C;  1L0W A;  3H0G C;  4LLG A;  2Y3P A;  3M3Y C;  3FKI A;  1TWF C;  3FOE A;  5EGH A;  1O2F B;  4A3K C;  2E2H K;  3NUH A;  3S1N C;  3GTO K;  3HOU C;  3CQZ A;  5IOQ A;  2P8T A;  5IYB K;  1BGW A;  3L4K A;  3QX3 A;  4A3D K;  1I50 C;  5M5Y K;  3S17 K;  2NVY C;  2PA8 D;  3S16 K;  5EGE A;  5IOR A;  4Q5S A;  4LOW A;  3FOF A;  3S0X A;  5IP9 K;  4Y7N C;  4ZH4 A;  3H0G K;  1Y1W K;  3M3Y K;  2XCQ A;  3EQL A;  1TWF K;  3RZD C;  5C4X C;  3HOU K;  1HI9 A;  4X6A C;  1SFO C;  3AD7 C;  4BLA A;  4BLB A;  3HKZ D;  2E2J C;  5M3F K;  1I50 K;  1RU0 A;  2NVY K;  1F93 A;  3MML B;  1KQ4 A;  2B63 C;  3S15 C;  5IYC K;  4KM8 A;  4G0V A;  4C2M C;  4Y7N K;  1YCL A;  1ZVU A;  4WJ4 A;  2NVQ C;  5IP7 K;  1XXA A;  1ZBS A;  4GTL A;  5C4X K;  2JA6 C;  4BBR C;  3FKI C;  3GTM K;  2A69 A;  4GTC A;  2BE5 A;  2PHC B;  1VJE A;  4X6A K;  3K7A K;  3WOD A;  4QJV A;  5JFE A;  2O5I A;  4YFN A;  1VRQ C;  3GTP C;  3GTG C;  2B63 K;  4MEX A;  2P5M A;  3S15 K;  1BDF A;  4C2M K;  4QIW D;  4P9S A;  2ZUE A;  2JA6 K;  5C44 C;  1DCH A;  3HOW C;  1R9T A;  2NVT C;  1WQH A;  3GTK A;  4KN4 A;  1I6H C;  3GTP K;  3GTG K;  1WSR A;  3VA7 A;  4OIP A;  2JA7 K;  1F9N A;  4KDD A;  2R7Z A;  1I3Q A;  3PO3 K;  4A93 C;  3ERE D;  2R92 A;  3S1Q K;  1WCM C;  2A6H A;  1O24 A;  5C44 K;  1TWC K;  3GTO A;  3T02 A;  1DD5 A;  1K83 C;  4C3J C;  4LJZ A;  2VUM A;  2W7V A;  2YU9 K;  4A3C K;  3N0C A;  2GAH C;  5M5X K;  4KMA A;  4A93 K;  1PJ6 A;  4MQ9 A;  5IYD C;  4A3E C;  1Y1V A;  1TWH K;  4BBS C;  4KAS A;  1K83 K;  4XLN A;  4C3J K;  4XSZ A;  4PAA A;  4LK1 A;  3A8J A;  2V6U A;  3S1R C;  1R9T C;  2ZFZ A;  3LPX A;  3S1M K;  2RH6 A;  3TFJ A;  4PAB A;  1EI6 A;  3GTQ K;  5IYD K;  3BP8 C;  2JA5 C;  4A3E K;  2R93 C;  5HL8 A;  1O2A A;  4KMH A;  4WJ3 M;  1UV7 A;  2GSN A;  3HOZ C;  1AB4 A;  5TJ3 A;  4KM9 A;  4NOI A;  2CFA A;  3S1R K;  4A3G C;  2WAQ D;  2FQT A;  1F7V A;  1SMY A;  1EH1 A;  2GAG C;  3GIR A;  2JA8 C;  5JVO A;  4G0W A;  2WB1 D;  1TWA A;  3M4O C;  4C3H C;  2JA5 K;  2R93 K;  4A3K K;  1HQM A;  1TWG A;  1ZXO A;  1IE0 A;  3S1N K;  3HOV C;  3HOZ K;  1EFW A;  5IOT A;  4FM9 A;  4A3G K;  4OIO A;  3GTL A;  3AQP A;  4A3M C;  4Q4Z A;  1BS2 A;  3V4G A;  2E2I A;  1WOO A;  1PJ7 A;  3T00 A;  4QJV B;  2PA8 L;  1C0A A;  2XCO A;  4A3J C;  3A8I A;  1TWC A;  3M4O K;  4C3H K;  3RZD K;  3HXA A;  4G7Z A;  4KC6 A;  4FZB A;  3GTJ A;  3HOV K;  1SFO K;  1USO A;  3I4N C;  4OIQ A;  3N0B A;  2E2J K;  3CQZ C;  2O5J A;  1O28 A;  4A3M K;  4BY1 C;  3HKZ L;  4C45 A;  4A3J K;  3DXJ A;  1EQR A;  4BKW A;  2NVQ K;  1JVI A;  1TWA C;  1XZQ A;  4BBR K;  3HOX C;  3FKI K;  1JQW A;  2NVX A;  4A3F C;  1TWG C;  5L46 A;  5C4J C;  4YFX A;  3S2H C;  4KAW X;  3CQZ K;  5CHP A;  3S2D C;  3BUE A;  3OEP A;  1F7U A;  4A3L C;  3IPJ A;  3GTL C;  3LAP A;  3AD9 C;  4KN7 A;  2E2I C;  2E2H A;  4G0U A;  5E68 A;  3HOX K;  2A6E A;  3H3V D;  2PMZ D;  1WOP A;  5C4J K;  1O27 A;  2EBB A;  3AD8 C;  3HOW K;  5M5W K;  2NVT K;  3GTJ C;  3S2H K;  1JOE A;  3A8K A;  2GSO A;  1I6H K;  3S2D K;  3G4A A;  4AYB D;  1IBA A;  1XZP A;  3PO2 C;  1Y1W A;  3H0G A;  4BXX C;  1TWF A;  5FJ8 K;  2CW0 A;  3I4M C;  1WCM K;  2Y0S D;  5C3E C;  4AH6 A;  1XXB A;  4XSX A; 
#chains in the Genus database with same CATH homology
 5E68 A;  1VGX A;  1JOE A;  1IE0 A;  1VH2 A;  1J98 A;  2FQT A;  4XCH A;  1YCL A;  1J6V A;  1JVI A;  1VJE A;  1J6X A;  1J6W A;  1INN A;  2FQO A;  1JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...