1IE0A

Crystal structure of luxs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
PSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 155
sequence length 156
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1ie0A00
1YCLA 1J6WA 1INNA 1J98A 1J6VA 5E68A 1JVIA 1VJEA 2FQTA 1VGXA 1J6XA 4XCHA 1IE0A 1JQWA 1VH2A 1JOEA 2FQOA
chains in the Genus database with same CATH superfamily
3ADAC 4J3NA 4PAAA 1HI9A 4KARA 1SFOK 3GTMC 3N3YA 1WSVA 3H0GA 3AH5A 1WQHA 3OEPA 5M5WK 4Y7NC 3HOUK 1SFOA 3MMLB 4C3HK 4M1XA 1I6VA 1R9TK 1O26A 4LK0A 4BY7K 4A3JC 5M5YK 1O27A 4WILA 1R9TA 4OIRA 1EH1A 2GSNA 2R93A 1JVIA 3FOFA 3RZDC 2JA8C 3M3YK 1TWCC 4BBRC 4GTBA 3S1QK 4A3GK 5FLMC 4G7ZA 4A3BK 1XZPB 2PPBA 3PO3K 3FKIC 3S1RK 1YX2A 3S2HK 1EQRA 4O2DA 5JFEA 3T02A 3HKZL 1EFWA 5TJ3A 2PMZL 3I4MC 3BP3A 3K7AK 1Y1WK 1XXBA 4P9SA 3CQZC 1IL2A 2D6FC 2BE5A 2Y0SL 4A3EK 3A8KA 1Y1WA 1J98A 3HOUC 3CAGA 2JH3A 5IP7C 4C45A 1YNJA 2R92C 1F7UA 3A8JA 3I4NC 1GE9A 1JOEA 1XXAA 2A6HA 5C4XK 4A3KK 2B63K 3S17K 4BXXK 1J6VA 3GTGC 3GEHA 4QJVA 2B63A 4GTLA 5TMCA 1DCHA 3S1QC 3HOYC 4OIOA 4BKWA 4A3IC 4MEXA 1F7VA 2WAQL 1BDFA 2RGRA 4XSZA 3QX3A 1Y1VK 4LR2A 2E2IK 1I3QK 3L4KA 1WQGA 3TFIA 4G0UA 4A93K 3S2HC 3TTGA 1Y1VA 3GTKK 2E2IA 1I3QA 3PO2C 2JA5C 2GSUA 1WORA 4G7OA 3GTKA 2JA6A 4PABA 4KMDA 3Q3QA 5L46A 3ERED 3S1NC 5IYCK 1TWHC 3H3VD 2E2JC 1J6XA 3S1MC 1ZBSA 5M3FK 2VUMC 4G7HA 3T01A 2A68A 3S17C 3OREA 2NVQK 1VJEA 3S15C 2PA8D 1I50C 1WSRA 3A8IA 3GSIA 1O2BA 3GEEA 1EK8A 4C2MK 2NVYK 3S2DC 1TWFC 4A3CK 4LOWA 2E2HA 4A3DK 3VA7A 3GEIA 4FM9A 4ILDA 4BBSK 2NVYA 5C4JK 4QIWD 3GTLA 4KM8A 1VRQC 2W7VA 3LAPA 4X6AC 2CFAA 2NVXA 4NOIA 4BLAA 1O25A 4YFNA 4KMHA 3GTPK 2R93K 1WCMC 5C3EC 4BY1K 4XLNA 3GTQK 5IYCC 3GTPA 3AQPA 1WOSA 3HOWC 2ZUEA 4A3MC 3GTQA 1XZQA 1PJ7A 4KB2A 1IE0A 1I6HC 5M5XK 4Q5SA 1O24A 1O29A 2GAGC 4BLBA 4ZH4A 1J6WA 3GTOC 5IYBC 2YU9K 3S14K 5IP9C 4Y52C 1K83K 3H0GC 4C3JK 4QJVB 2YU9A 1DCPA 3HOVC 5IORA 1SFOC 1K83A 5E68A 2GSOA 4AH6A 3GDZA 5TMFA 3TFHA 3H3VL 4C3HC 2JA7A 1R9TC 2PHCB 2R93C 4A3LK 1UV7A 4BY7C 2XCQA 1L0WA 2P5MA 3FHZA 3BP8C 1TWAK 1YNNA 4GTFA 5CHPA 1PJ5A 2PA8L 3LPXA 2XCRB 3HOXK 3M3YC 5IYDK 3RZOK 3LAJA 3DXJA 1TWAA 4A3GC 3IPJA 3S16K 4A3BC 4XLPA 3AD8C 3V4GA 3PO3C 1O28A 1INNA 3S1RC 4QIWL 3N0BA 1WOOA 1DD5A 4C3IK 1AB4A 2JA6K 2VUMA 3NUHA 1ZXOA 4GT9A 2NVTK 2FQTA 1XXCA 1VGXA 3K7AC 4KM9A 4P5BA 1Y1WC 1BJTA 2R7ZK 3HOZK 1TWGK 4A3EC 3GTJK 1BS2A 2R7ZA 1TWGA 3EQLA 3GTJA 2GAHC 5EGHA 5IOSA 4LLGA 2B63C 1XPPA 5C44K 4A3KC 2KWAA 5C4XC 4BXXC 4Y7NK 3GTMA 1BGWA 3L4JA 2CFAB 2V6SA 4DDQA 1JQWA 1VH2A 1ZYRA 4OIQA 4A3JK 1DCOA 1ISEA 1PJ6A 1WIHA 3M4OK 5IOQA 2E2HK 3RZDK 4KMUA 3BUEA 4OINA 1TWCK 4BBRK 1Y1VC 3GTLK 2E2IC 1I3QC 1XZQB 4A93C 5FLMK 1YCLA 2NVXK 1TWCA 3GTKC 2JA6C 1O2FB 4YFKA 3SZYA 4YG2A 3FKIK 4WJ4A 3S0XA 3HOZC 3SZZA 3TFJA 4GTAA 4LQYA 4KASA 1IW7A 2P8TA 3FKIA 2A69A 3I4MK 3CQZK 1VLOA 3JSTA 1V5VA 5C44C 5D4DA 2NVQC 3CQZA 4WJ3M 2O5IA 5IP7K 2R92K 1KQ4A 3GIRA 1WQFA 3I4NK 5CJ9A 1USMA 4Q4ZA 2RH6A 3GTGK 3M4OC 2R92A 2E2HC 4C2MC 1O2AA 2NVYC 5FJ8K 3GTLC 3GTGA 2Y3PA 4A3CC 4AYBD 3HOYK 4A3DC 3N0CA 5EGEA 4BBSC 1RU0A 4A3IK 2NVXC 2JA7K 1IS1A 5C4JC 3AD7C 5IOTA 1EI6A 5HL8A 4KDDA 4GZYA 3G4CA 3GTPC 4A3FK 3AD9C 3T00A 2O5JA 3FOEA 3PO2K 2JA5K 4BY1C 3GTQC 2EBBA 3WODA 4KC6A 4LJZA 2WB1D 2V6UA 4KATA 2JA5A 4OIPA 2ZFZA 3AQOA 3G4AA 2XCOA 3S1NK 1B4BA 1XZPA 4JK1A 1TWHK 2E2JK 3S1MK 4XSXA 2VUMK 2V6TA 4RMFA 1TWHA 3HXAA 2YU9C 1IQ0A 3OPFA 3S14C 4KB4A 4G0WA 1K83C 4C3JC 3S15K 4GFQA 4KN7A 1I50K 4P5AA 2JA7C 1F9NA 4LK1A 1I50A 3S2DK 1TWFK 4YFXA 3GTMK 4G0VA 1HQMA 1WOPA 5M3MK 4A3FC 4FZBA 4A3LC 1TWFA 1TWAC 2FQOA 4X6AK 3HKZD 1X31C 5IYDC 2PMZD 3HOXC 1C0AA 3RZOC 4GTEA 2Y0SD 1WCMK 1F93A 5C3EK 1ZQ1C 4GTDA 4KAWX 1B4AA 3S16C 4MQ9A 2CW0A 3HOWK 2JA8K 1WCMA 4AYBL 1G51A 4A3MK 4XCHA 4KN4A 1I6HK 2A6EA 4C3IC 2NVTC 2ZUFA 1SMYA 4MEYA 5JVOA 2R7ZC 1ZVUA 3GTOK 1TWGC 5IYBK 4KMAA 5IP9K 3GTJC 1IBAA 4Y52K 4GTCA 3H0GK 1USOA 3GTOA 2WB1L 3HOVK 2WAQD
chains in the Genus database with same CATH topology
1YCLA 1J6WA 1INNA 1J98A 1J6VA 5E68A 1JVIA 1VJEA 2FQTA 1VGXA 1J6XA 4XCHA 1IE0A 1JQWA 1VH2A 1JOEA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  1J6W A;  1INN A;  1J98 A;  1J6V A;  5E68 A;  1JVI A;  1VJE A;  2FQT A;  1VGX A;  1J6X A;  4XCH A;  1IE0 A;  1JQW A;  1VH2 A;  1JOE A;  2FQO A; 
#chains in the Genus database with same CATH topology
 3ADA C;  4J3N A;  4PAA A;  1HI9 A;  4KAR A;  1SFO K;  3GTM C;  3N3Y A;  1WSV A;  3H0G A;  3AH5 A;  1WQH A;  3OEP A;  5M5W K;  4Y7N C;  3HOU K;  1SFO A;  3MML B;  4C3H K;  4M1X A;  1I6V A;  1R9T K;  1O26 A;  4LK0 A;  4BY7 K;  4A3J C;  5M5Y K;  1O27 A;  4WIL A;  1R9T A;  4OIR A;  1EH1 A;  2GSN A;  2R93 A;  1JVI A;  3FOF A;  3RZD C;  2JA8 C;  3M3Y K;  1TWC C;  4BBR C;  4GTB A;  3S1Q K;  4A3G K;  5FLM C;  4G7Z A;  4A3B K;  1XZP B;  2PPB A;  3PO3 K;  3FKI C;  3S1R K;  1YX2 A;  3S2H K;  1EQR A;  4O2D A;  5JFE A;  3T02 A;  3HKZ L;  1EFW A;  5TJ3 A;  2PMZ L;  3I4M C;  3BP3 A;  3K7A K;  1Y1W K;  1XXB A;  4P9S A;  3CQZ C;  1IL2 A;  2D6F C;  2BE5 A;  2Y0S L;  4A3E K;  3A8K A;  1Y1W A;  1J98 A;  3HOU C;  3CAG A;  2JH3 A;  5IP7 C;  4C45 A;  1YNJ A;  2R92 C;  1F7U A;  3A8J A;  3I4N C;  1GE9 A;  1JOE A;  1XXA A;  2A6H A;  5C4X K;  4A3K K;  2B63 K;  3S17 K;  4BXX K;  1J6V A;  3GTG C;  3GEH A;  4QJV A;  2B63 A;  4GTL A;  5TMC A;  1DCH A;  3S1Q C;  3HOY C;  4OIO A;  4BKW A;  4A3I C;  4MEX A;  1F7V A;  2WAQ L;  1BDF A;  2RGR A;  4XSZ A;  3QX3 A;  1Y1V K;  4LR2 A;  2E2I K;  1I3Q K;  3L4K A;  1WQG A;  3TFI A;  4G0U A;  4A93 K;  3S2H C;  3TTG A;  1Y1V A;  3GTK K;  2E2I A;  1I3Q A;  3PO2 C;  2JA5 C;  2GSU A;  1WOR A;  4G7O A;  3GTK A;  2JA6 A;  4PAB A;  4KMD A;  3Q3Q A;  5L46 A;  3ERE D;  3S1N C;  5IYC K;  1TWH C;  3H3V D;  2E2J C;  1J6X A;  3S1M C;  1ZBS A;  5M3F K;  2VUM C;  4G7H A;  3T01 A;  2A68 A;  3S17 C;  3ORE A;  2NVQ K;  1VJE A;  3S15 C;  2PA8 D;  1I50 C;  1WSR A;  3A8I A;  3GSI A;  1O2B A;  3GEE A;  1EK8 A;  4C2M K;  2NVY K;  3S2D C;  1TWF C;  4A3C K;  4LOW A;  2E2H A;  4A3D K;  3VA7 A;  3GEI A;  4FM9 A;  4ILD A;  4BBS K;  2NVY A;  5C4J K;  4QIW D;  3GTL A;  4KM8 A;  1VRQ C;  2W7V A;  3LAP A;  4X6A C;  2CFA A;  2NVX A;  4NOI A;  4BLA A;  1O25 A;  4YFN A;  4KMH A;  3GTP K;  2R93 K;  1WCM C;  5C3E C;  4BY1 K;  4XLN A;  3GTQ K;  5IYC C;  3GTP A;  3AQP A;  1WOS A;  3HOW C;  2ZUE A;  4A3M C;  3GTQ A;  1XZQ A;  1PJ7 A;  4KB2 A;  1IE0 A;  1I6H C;  5M5X K;  4Q5S A;  1O24 A;  1O29 A;  2GAG C;  4BLB A;  4ZH4 A;  1J6W A;  3GTO C;  5IYB C;  2YU9 K;  3S14 K;  5IP9 C;  4Y52 C;  1K83 K;  3H0G C;  4C3J K;  4QJV B;  2YU9 A;  1DCP A;  3HOV C;  5IOR A;  1SFO C;  1K83 A;  5E68 A;  2GSO A;  4AH6 A;  3GDZ A;  5TMF A;  3TFH A;  3H3V L;  4C3H C;  2JA7 A;  1R9T C;  2PHC B;  2R93 C;  4A3L K;  1UV7 A;  4BY7 C;  2XCQ A;  1L0W A;  2P5M A;  3FHZ A;  3BP8 C;  1TWA K;  1YNN A;  4GTF A;  5CHP A;  1PJ5 A;  2PA8 L;  3LPX A;  2XCR B;  3HOX K;  3M3Y C;  5IYD K;  3RZO K;  3LAJ A;  3DXJ A;  1TWA A;  4A3G C;  3IPJ A;  3S16 K;  4A3B C;  4XLP A;  3AD8 C;  3V4G A;  3PO3 C;  1O28 A;  1INN A;  3S1R C;  4QIW L;  3N0B A;  1WOO A;  1DD5 A;  4C3I K;  1AB4 A;  2JA6 K;  2VUM A;  3NUH A;  1ZXO A;  4GT9 A;  2NVT K;  2FQT A;  1XXC A;  1VGX A;  3K7A C;  4KM9 A;  4P5B A;  1Y1W C;  1BJT A;  2R7Z K;  3HOZ K;  1TWG K;  4A3E C;  3GTJ K;  1BS2 A;  2R7Z A;  1TWG A;  3EQL A;  3GTJ A;  2GAH C;  5EGH A;  5IOS A;  4LLG A;  2B63 C;  1XPP A;  5C44 K;  4A3K C;  2KWA A;  5C4X C;  4BXX C;  4Y7N K;  3GTM A;  1BGW A;  3L4J A;  2CFA B;  2V6S A;  4DDQ A;  1JQW A;  1VH2 A;  1ZYR A;  4OIQ A;  4A3J K;  1DCO A;  1ISE A;  1PJ6 A;  1WIH A;  3M4O K;  5IOQ A;  2E2H K;  3RZD K;  4KMU A;  3BUE A;  4OIN A;  1TWC K;  4BBR K;  1Y1V C;  3GTL K;  2E2I C;  1I3Q C;  1XZQ B;  4A93 C;  5FLM K;  1YCL A;  2NVX K;  1TWC A;  3GTK C;  2JA6 C;  1O2F B;  4YFK A;  3SZY A;  4YG2 A;  3FKI K;  4WJ4 A;  3S0X A;  3HOZ C;  3SZZ A;  3TFJ A;  4GTA A;  4LQY A;  4KAS A;  1IW7 A;  2P8T A;  3FKI A;  2A69 A;  3I4M K;  3CQZ K;  1VLO A;  3JST A;  1V5V A;  5C44 C;  5D4D A;  2NVQ C;  3CQZ A;  4WJ3 M;  2O5I A;  5IP7 K;  2R92 K;  1KQ4 A;  3GIR A;  1WQF A;  3I4N K;  5CJ9 A;  1USM A;  4Q4Z A;  2RH6 A;  3GTG K;  3M4O C;  2R92 A;  2E2H C;  4C2M C;  1O2A A;  2NVY C;  5FJ8 K;  3GTL C;  3GTG A;  2Y3P A;  4A3C C;  4AYB D;  3HOY K;  4A3D C;  3N0C A;  5EGE A;  4BBS C;  1RU0 A;  4A3I K;  2NVX C;  2JA7 K;  1IS1 A;  5C4J C;  3AD7 C;  5IOT A;  1EI6 A;  5HL8 A;  4KDD A;  4GZY A;  3G4C A;  3GTP C;  4A3F K;  3AD9 C;  3T00 A;  2O5J A;  3FOE A;  3PO2 K;  2JA5 K;  4BY1 C;  3GTQ C;  2EBB A;  3WOD A;  4KC6 A;  4LJZ A;  2WB1 D;  2V6U A;  4KAT A;  2JA5 A;  4OIP A;  2ZFZ A;  3AQO A;  3G4A A;  2XCO A;  3S1N K;  1B4B A;  1XZP A;  4JK1 A;  1TWH K;  2E2J K;  3S1M K;  4XSX A;  2VUM K;  2V6T A;  4RMF A;  1TWH A;  3HXA A;  2YU9 C;  1IQ0 A;  3OPF A;  3S14 C;  4KB4 A;  4G0W A;  1K83 C;  4C3J C;  3S15 K;  4GFQ A;  4KN7 A;  1I50 K;  4P5A A;  2JA7 C;  1F9N A;  4LK1 A;  1I50 A;  3S2D K;  1TWF K;  4YFX A;  3GTM K;  4G0V A;  1HQM A;  1WOP A;  5M3M K;  4A3F C;  4FZB A;  4A3L C;  1TWF A;  1TWA C;  2FQO A;  4X6A K;  3HKZ D;  1X31 C;  5IYD C;  2PMZ D;  3HOX C;  1C0A A;  3RZO C;  4GTE A;  2Y0S D;  1WCM K;  1F93 A;  5C3E K;  1ZQ1 C;  4GTD A;  4KAW X;  1B4A A;  3S16 C;  4MQ9 A;  2CW0 A;  3HOW K;  2JA8 K;  1WCM A;  4AYB L;  1G51 A;  4A3M K;  4XCH A;  4KN4 A;  1I6H K;  2A6E A;  4C3I C;  2NVT C;  2ZUF A;  1SMY A;  4MEY A;  5JVO A;  2R7Z C;  1ZVU A;  3GTO K;  1TWG C;  5IYB K;  4KMA A;  5IP9 K;  3GTJ C;  1IBA A;  4Y52 K;  4GTC A;  3H0G K;  1USO A;  3GTO A;  2WB1 L;  3HOV K;  2WAQ D; 
#chains in the Genus database with same CATH homology
 1YCL A;  1J6W A;  1INN A;  1J98 A;  1J6V A;  5E68 A;  1JVI A;  1VJE A;  2FQT A;  1VGX A;  1J6X A;  4XCH A;  1IE0 A;  1JQW A;  1VH2 A;  1JOE A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...