1IE0A

Crystal structure of luxs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
PSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
total genus 44
structure length 155
sequence length 156
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1ie0A00
1YCLA 1J98A 1INNA 1VGXA 2FQTA 4XCHA 1J6VA 1JVIA 5E68A 1IE0A 1JQWA 2FQOA 1J6WA 1JOEA 1VH2A 1VJEA 1J6XA
chains in the Genus database with same CATH superfamily
5M5WK 4ZH4A 4G0UA 4QJVB 4O2DA 3TFJA 4LR2A 1TWHC 3HOYK 2PMZL 1TWFA 3GTLK 2JA6C 1ZQ1C 4A3IC 2CFAA 3S16C 4KB4A 4XLPA 2GSNA 3ADAC 1O24A 3HKZD 1F7UA 4A3GC 4C45A 2BE5A 1J6VA 4G7HA 3GTOK 2P5MA 4YFXA 3A8JA 1TWAA 2JA5K 4BBSC 5C44C 4A3EC 2E2JC 3CQZC 4GTBA 4X6AC 3PO2C 4A3JK 4A3DC 3AQPA 3HOVC 4GTAA 4AH6A 4KATA 4KM8A 3FOEA 1VJEA 1XZPB 5TJ3A 1TWHK 4C2MK 1SFOA 4YG2A 1BDFA 2YU9A 2JA6K 4LK1A 3GTKA 3GEIA 4A3IK 5C4XC 4A3BC 3NUHA 1PJ5A 5JFEA 1B4BA 1BS2A 3LAJA 2B63C 3S16K 3S17C 1IBAA 2PPBA 2Y3PA 1SFOC 2NVXC 4A3GK 2JA7A 4LOWA 2WB1L 3EQLA 3HOWC 1J98A 4KB2A 1K83A 2W7VA 1F7VA 5M5XK 4BBSK 1TWGA 5C44K 4A3EK 2E2JK 2R92C 3CQZK 4X6AK 3PO2K 5HL8A 5IOSA 5C3EC 2JA7C 4P9SA 4AYBD 3HOVK 2XCQA 4LK0A 2PA8L 3S1RC 2O5JA 1JQWA 4KMAA 4OINA 4QIWL 2XCRB 5IP7C 4GFQA 1PJ7A 1WQHA 4A3BK 1R9TC 1I6HC 3I4NC 2B63K 2FQOA 3BP8C 3G4CA 3AD8C 3GTOA 1SFOK 1O26A 2NVXK 5EGEA 4A93C 3DXJA 4J3NA 1ZXOA 3HOWK 5E68A 1ZBSA 4A3KC 1SMYA 4PAAA 2R92K 3OREA 3S2HC 5C3EK 2NVYC 1YX2A 1TWHA 5IOQA 1I3QC 2JA7K 4MEXA 1IQ0A 3S15C 3CAGA 3S1RK 3TFIA 3M4OC 2JA6A 4QJVA 2VUMC 5IP7K 3GTGC 4A3LC 4FM9A 4LJZA 4WILA 1O2BA 5IP9C 1R9TK 1I6HK 1WOSA 4G7OA 1WIHA 1WORA 3MMLB 5IYBC 1ISEA 1B4AA 3FKIC 1L0WA 4A93K 3CQZA 4NOIA 4A3KK 4GTDA 4KAWX 1C0AA 4A3MC 3GTJC 2Y0SD 3N3YA 3S2HK 1WQFA 1ZYRA 3GTQC 4XCHA 2NVYK 5JVOA 5L46A 1I3QK 3HOZC 5IYDC 3GTPC 3S15K 3PO3C 4GT9A 2CFAB 2V6UA 2ZUFA 2E2IC 3M4OK 4BKWA 1WSRA 3RZOC 1F9NA 2WAQL 4RMFA 2VUMK 1XZPA 1DD5A 3GTGK 1XXBA 4A3LK 2B63A 4OIPA 5IP9K 1XXAA 4KASA 3N0BA 2NVXA 1XZQA 1V5VA 5IYBK 4BY1C 3FKIK 1YNJA 2E2HC 2R7ZC 2R92A 5EGHA 2R93C 1EFWA 3LPXA 4A3MK 2A68A 4OIOA 1YNNA 3TFHA 3GTJK 5C4JC 1WSVA 3HKZL 4QIWD 3VA7A 1EH1A 3GTQK 3AD9C 1EQRA 3Q3QA 2JH3A 3HOZK 5IYDK 5CJ9A 3GTPK 3GTMC 3PO3K 1WCMC 1O25A 3BUEA 3WODA 2E2IK 4A3DK 2NVQC 3FOFA 1R9TA 4G0WA 1DCPA 2XCOA 3HOXC 4G0VA 4WJ3M 3S2DC 1I50C 3S1QC 5C4XK 1O28A 4BY1K 3GIRA 2GSUA 1USOA 3IPJA 4Q4ZA 5CHPA 2A6EA 4Y7NC 3S17K 1AB4A 2E2HK 2R7ZK 5M5YK 2R93K 1JVIA 4ILDA 1O2FB 1ZVUA 2PHCB 1J6WA 2V6SA 2NVYA 3S1MC 5C4JK 1I3QA 4KM9A 1O27A 3L4KA 1XXCA 5M3FK 3GDZA 3GTMK 1WCMK 3T01A 3QX3A 2VUMA 2PMZD 2RGRA 1HI9A 3BP3A 3GTGA 2NVQK 3JSTA 4AYBL 3H3VL 1JOEA 3V4GA 2ZFZA 1Y1WC 3HXAA 4C3JC 2GAHC 3HOXK 3FKIA 3S2DK 1Y1VC 1I50K 2A69A 4Y52C 3S1QK 2CW0A 4P5BA 1EK8A 2A6HA 4C3HC 1PJ6A 3I4NK 4A3FC 3GTJA 4Y7NK 3T02A 3FHZA 3OPFA 4C3IC 1BGWA 2FQTA 3GTQA 1VGXA 5IYCC 4KMUA 4G7ZA 3GTPA 4BLAA 4KN7A 2E2IA 4GTEA 3A8IA 4XLNA 2NVTC 5FJ8K 1XPPA 1DCHA 3S14C 3S1NC 4C2MC 1TWCA 1VLOA 4BXXC 1DCOA 1YCLA 1KQ4A 4BLBA 3T00A 1Y1WK 4C3JK 2ZUEA 1WQGA 1Y1VK 3RZDC 4Y52K 1TWCC 4BBRC 1TWFC 3M3YC 2E2HA 4KMDA 4C3HK 1VH2A 2R7ZA 1RU0A 1IL2A 2R93A 2WB1D 4KN4A 4A3FK 1IE0A 4GTCA 3I4MC 2JA8C 4C3IK 4Q5SA 5D4DA 4BY7C 4MEYA 3AD7C 5IYCK 3GTMA 1WCMA 2PA8D 4A3CC 2NVTK 1F93A 1TWAC 3H0GA 3HOUC 4P5AA 2Y0SL 3S14K 3S1NK 1O2AA 4YFNA 4OIRA 4KMHA 5IORA 2KWAA 4BXXK 1XZQB 4LLGA 3GSIA 1I50A 5IOTA 2V6TA 3RZOK 3H0GC 1WOOA 3AQOA 5M3MK 1BJTA 3RZDK 1TWCK 1TWFK 2GAGC 4BBRK 3M3YK 4GZYA 4YFKA 2YU9C 1G51A 3GTKC 1HQMA 4JK1A 4MQ9A 1GE9A 2P8TA 3TTGA 3I4MK 1WOPA 1O29A 2JA8K 2EBBA 3K7AC 1EI6A 1J6XA 4BY7K 3LAPA 4GTFA 5FLMC 3H3VD 4A3CK 1TWAK 3AH5A 3HOUK 3GTLA 1K83C 1UV7A 4M1XA 1TWGC 4KDDA 1Y1WA 5TMFA 3ERED 3HOYC 1Y1VA 4XSZA 3H0GK 2GSOA 4FZBA 3GTLC 5TMCA 1IW7A 3G4AA 3N0CA 2JA5A 3SZZA 2YU9K 3GTKK 3GEHA 4DDQA 3GEEA 3L4JA 1INNA 4LQYA 4XSXA 1USMA 2O5IA 1IS1A 4OIQA 3A8KA 3GTOC 3K7AK 2JA5C 1I6VA 5FLMK 4PABA 1X31C 4KARA 2RH6A 1VRQC 4GTLA 3S0XA 4KC6A 3OEPA 4A3JC 3SZYA 3S1MK 2D6FC 2WAQD 1K83K 4WJ4A 1TWGK
chains in the Genus database with same CATH topology
1YCLA 1J98A 1INNA 1VGXA 2FQTA 4XCHA 1J6VA 1JVIA 5E68A 1IE0A 1JQWA 2FQOA 1J6WA 1JOEA 1VH2A 1VJEA 1J6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  1J98 A;  1INN A;  1VGX A;  2FQT A;  4XCH A;  1J6V A;  1JVI A;  5E68 A;  1IE0 A;  1JQW A;  2FQO A;  1J6W A;  1JOE A;  1VH2 A;  1VJE A;  1J6X A; 
#chains in the Genus database with same CATH topology
 5M5W K;  4ZH4 A;  4G0U A;  4QJV B;  4O2D A;  3TFJ A;  4LR2 A;  1TWH C;  3HOY K;  2PMZ L;  1TWF A;  3GTL K;  2JA6 C;  1ZQ1 C;  4A3I C;  2CFA A;  3S16 C;  4KB4 A;  4XLP A;  2GSN A;  3ADA C;  1O24 A;  3HKZ D;  1F7U A;  4A3G C;  4C45 A;  2BE5 A;  1J6V A;  4G7H A;  3GTO K;  2P5M A;  4YFX A;  3A8J A;  1TWA A;  2JA5 K;  4BBS C;  5C44 C;  4A3E C;  2E2J C;  3CQZ C;  4GTB A;  4X6A C;  3PO2 C;  4A3J K;  4A3D C;  3AQP A;  3HOV C;  4GTA A;  4AH6 A;  4KAT A;  4KM8 A;  3FOE A;  1VJE A;  1XZP B;  5TJ3 A;  1TWH K;  4C2M K;  1SFO A;  4YG2 A;  1BDF A;  2YU9 A;  2JA6 K;  4LK1 A;  3GTK A;  3GEI A;  4A3I K;  5C4X C;  4A3B C;  3NUH A;  1PJ5 A;  5JFE A;  1B4B A;  1BS2 A;  3LAJ A;  2B63 C;  3S16 K;  3S17 C;  1IBA A;  2PPB A;  2Y3P A;  1SFO C;  2NVX C;  4A3G K;  2JA7 A;  4LOW A;  2WB1 L;  3EQL A;  3HOW C;  1J98 A;  4KB2 A;  1K83 A;  2W7V A;  1F7V A;  5M5X K;  4BBS K;  1TWG A;  5C44 K;  4A3E K;  2E2J K;  2R92 C;  3CQZ K;  4X6A K;  3PO2 K;  5HL8 A;  5IOS A;  5C3E C;  2JA7 C;  4P9S A;  4AYB D;  3HOV K;  2XCQ A;  4LK0 A;  2PA8 L;  3S1R C;  2O5J A;  1JQW A;  4KMA A;  4OIN A;  4QIW L;  2XCR B;  5IP7 C;  4GFQ A;  1PJ7 A;  1WQH A;  4A3B K;  1R9T C;  1I6H C;  3I4N C;  2B63 K;  2FQO A;  3BP8 C;  3G4C A;  3AD8 C;  3GTO A;  1SFO K;  1O26 A;  2NVX K;  5EGE A;  4A93 C;  3DXJ A;  4J3N A;  1ZXO A;  3HOW K;  5E68 A;  1ZBS A;  4A3K C;  1SMY A;  4PAA A;  2R92 K;  3ORE A;  3S2H C;  5C3E K;  2NVY C;  1YX2 A;  1TWH A;  5IOQ A;  1I3Q C;  2JA7 K;  4MEX A;  1IQ0 A;  3S15 C;  3CAG A;  3S1R K;  3TFI A;  3M4O C;  2JA6 A;  4QJV A;  2VUM C;  5IP7 K;  3GTG C;  4A3L C;  4FM9 A;  4LJZ A;  4WIL A;  1O2B A;  5IP9 C;  1R9T K;  1I6H K;  1WOS A;  4G7O A;  1WIH A;  1WOR A;  3MML B;  5IYB C;  1ISE A;  1B4A A;  3FKI C;  1L0W A;  4A93 K;  3CQZ A;  4NOI A;  4A3K K;  4GTD A;  4KAW X;  1C0A A;  4A3M C;  3GTJ C;  2Y0S D;  3N3Y A;  3S2H K;  1WQF A;  1ZYR A;  3GTQ C;  4XCH A;  2NVY K;  5JVO A;  5L46 A;  1I3Q K;  3HOZ C;  5IYD C;  3GTP C;  3S15 K;  3PO3 C;  4GT9 A;  2CFA B;  2V6U A;  2ZUF A;  2E2I C;  3M4O K;  4BKW A;  1WSR A;  3RZO C;  1F9N A;  2WAQ L;  4RMF A;  2VUM K;  1XZP A;  1DD5 A;  3GTG K;  1XXB A;  4A3L K;  2B63 A;  4OIP A;  5IP9 K;  1XXA A;  4KAS A;  3N0B A;  2NVX A;  1XZQ A;  1V5V A;  5IYB K;  4BY1 C;  3FKI K;  1YNJ A;  2E2H C;  2R7Z C;  2R92 A;  5EGH A;  2R93 C;  1EFW A;  3LPX A;  4A3M K;  2A68 A;  4OIO A;  1YNN A;  3TFH A;  3GTJ K;  5C4J C;  1WSV A;  3HKZ L;  4QIW D;  3VA7 A;  1EH1 A;  3GTQ K;  3AD9 C;  1EQR A;  3Q3Q A;  2JH3 A;  3HOZ K;  5IYD K;  5CJ9 A;  3GTP K;  3GTM C;  3PO3 K;  1WCM C;  1O25 A;  3BUE A;  3WOD A;  2E2I K;  4A3D K;  2NVQ C;  3FOF A;  1R9T A;  4G0W A;  1DCP A;  2XCO A;  3HOX C;  4G0V A;  4WJ3 M;  3S2D C;  1I50 C;  3S1Q C;  5C4X K;  1O28 A;  4BY1 K;  3GIR A;  2GSU A;  1USO A;  3IPJ A;  4Q4Z A;  5CHP A;  2A6E A;  4Y7N C;  3S17 K;  1AB4 A;  2E2H K;  2R7Z K;  5M5Y K;  2R93 K;  1JVI A;  4ILD A;  1O2F B;  1ZVU A;  2PHC B;  1J6W A;  2V6S A;  2NVY A;  3S1M C;  5C4J K;  1I3Q A;  4KM9 A;  1O27 A;  3L4K A;  1XXC A;  5M3F K;  3GDZ A;  3GTM K;  1WCM K;  3T01 A;  3QX3 A;  2VUM A;  2PMZ D;  2RGR A;  1HI9 A;  3BP3 A;  3GTG A;  2NVQ K;  3JST A;  4AYB L;  3H3V L;  1JOE A;  3V4G A;  2ZFZ A;  1Y1W C;  3HXA A;  4C3J C;  2GAH C;  3HOX K;  3FKI A;  3S2D K;  1Y1V C;  1I50 K;  2A69 A;  4Y52 C;  3S1Q K;  2CW0 A;  4P5B A;  1EK8 A;  2A6H A;  4C3H C;  1PJ6 A;  3I4N K;  4A3F C;  3GTJ A;  4Y7N K;  3T02 A;  3FHZ A;  3OPF A;  4C3I C;  1BGW A;  2FQT A;  3GTQ A;  1VGX A;  5IYC C;  4KMU A;  4G7Z A;  3GTP A;  4BLA A;  4KN7 A;  2E2I A;  4GTE A;  3A8I A;  4XLN A;  2NVT C;  5FJ8 K;  1XPP A;  1DCH A;  3S14 C;  3S1N C;  4C2M C;  1TWC A;  1VLO A;  4BXX C;  1DCO A;  1YCL A;  1KQ4 A;  4BLB A;  3T00 A;  1Y1W K;  4C3J K;  2ZUE A;  1WQG A;  1Y1V K;  3RZD C;  4Y52 K;  1TWC C;  4BBR C;  1TWF C;  3M3Y C;  2E2H A;  4KMD A;  4C3H K;  1VH2 A;  2R7Z A;  1RU0 A;  1IL2 A;  2R93 A;  2WB1 D;  4KN4 A;  4A3F K;  1IE0 A;  4GTC A;  3I4M C;  2JA8 C;  4C3I K;  4Q5S A;  5D4D A;  4BY7 C;  4MEY A;  3AD7 C;  5IYC K;  3GTM A;  1WCM A;  2PA8 D;  4A3C C;  2NVT K;  1F93 A;  1TWA C;  3H0G A;  3HOU C;  4P5A A;  2Y0S L;  3S14 K;  3S1N K;  1O2A A;  4YFN A;  4OIR A;  4KMH A;  5IOR A;  2KWA A;  4BXX K;  1XZQ B;  4LLG A;  3GSI A;  1I50 A;  5IOT A;  2V6T A;  3RZO K;  3H0G C;  1WOO A;  3AQO A;  5M3M K;  1BJT A;  3RZD K;  1TWC K;  1TWF K;  2GAG C;  4BBR K;  3M3Y K;  4GZY A;  4YFK A;  2YU9 C;  1G51 A;  3GTK C;  1HQM A;  4JK1 A;  4MQ9 A;  1GE9 A;  2P8T A;  3TTG A;  3I4M K;  1WOP A;  1O29 A;  2JA8 K;  2EBB A;  3K7A C;  1EI6 A;  1J6X A;  4BY7 K;  3LAP A;  4GTF A;  5FLM C;  3H3V D;  4A3C K;  1TWA K;  3AH5 A;  3HOU K;  3GTL A;  1K83 C;  1UV7 A;  4M1X A;  1TWG C;  4KDD A;  1Y1W A;  5TMF A;  3ERE D;  3HOY C;  1Y1V A;  4XSZ A;  3H0G K;  2GSO A;  4FZB A;  3GTL C;  5TMC A;  1IW7 A;  3G4A A;  3N0C A;  2JA5 A;  3SZZ A;  2YU9 K;  3GTK K;  3GEH A;  4DDQ A;  3GEE A;  3L4J A;  1INN A;  4LQY A;  4XSX A;  1USM A;  2O5I A;  1IS1 A;  4OIQ A;  3A8K A;  3GTO C;  3K7A K;  2JA5 C;  1I6V A;  5FLM K;  4PAB A;  1X31 C;  4KAR A;  2RH6 A;  1VRQ C;  4GTL A;  3S0X A;  4KC6 A;  3OEP A;  4A3J C;  3SZY A;  3S1M K;  2D6F C;  2WAQ D;  1K83 K;  4WJ4 A;  1TWG K; 
#chains in the Genus database with same CATH homology
 1YCL A;  1J98 A;  1INN A;  1VGX A;  2FQT A;  4XCH A;  1J6V A;  1JVI A;  5E68 A;  1IE0 A;  1JQW A;  2FQO A;  1J6W A;  1JOE A;  1VH2 A;  1VJE A;  1J6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...