1IE0A

Crystal structure of luxs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
b'PSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
total genus 44
structure length 155
sequence length 156
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1ie0A00
1J98A 1J6XA 1JVIA 1J6WA 1VGXA 1YCLA 1VH2A 2FQOA 1INNA 1JOEA 1JQWA 1J6VA 2FQTA 5E68A 4XCHA 1IE0A 1VJEA
chains in the Genus database with same CATH superfamily
2EBBA 1Y1WK 4KMUA 3SZZA 2NVXA 4X6AC 5CHPA 4Q5SA 2FQTA 2NVXC 2PA8D 4AYBL 4Y7NK 2GSOA 4KMAA 1IL2A 5C44C 5CJ9A 3GTGA 1Y1VA 1YX2A 1WSRA 1V5VA 3WODA 1F93A 4JK1A 5IP7K 5M5XK 3GTGC 1Y1VC 4C3HC 4LOWA 1BGWA 4BY7C 1SFOK 4XCHA 3AD9C 3JSTA 1TWFK 4C3IK 1J6VA 1WORA 3GTKK 1I6HC 4MEXA 1ISEA 3HOYC 2V6SA 1J6XA 4MEYA 1C0AA 3S1RK 2RH6A 1PJ6A 3AQPA 3QX3A 2ZFZA 4C2MC 1O25A 4A3FK 2CW0A 3RZDC 1I3QK 5HL8A 2GAHC 4GTBA 2NVYA 3CQZK 4A3KK 1O24A 1XXAA 1WOPA 3HOZK 2NVYC 5M3MK 4PAAA 4G0WA 3PO2K 4A3DC 3GDZA 3RZOK 2CFAA 3OREA 4A3IC 1O29A 1EI6A 3GTQA 3FKIK 4WJ3M 1ZXOA 3VA7A 1F7VA 1WCMA 3FHZA 5IYBC 3GTQC 1VRQC 4LR2A 4YFKA 3T02A 3GEIA 1WCMC 4A3MC 2NVXK 3GTPA 3HKZL 1TWGK 4G7OA 4OINA 1WQHA 1G51A 3GTPC 1ZVUA 5C44K 1XZQA 2R7ZK 1EQRA 1B4BA 2A69A 3TFIA 3I4NC 4GZYA 3GTMA 1Y1VK 3A8KA 2GAGC 5IYDK 5EGHA 3GTMC 3M4OC 4A3JC 1R9TK 3AD7C 3GIRA 4QIWL 4OIQA 4QJVA 1XXBA 3S16C 4YG2A 3GTOK 2Y0SD 5FLMK 2NVQC 3S1NC 4KB4A 4C3JC 3NUHA 1IW7A 5M3FK 4A93C 4KAWX 2JA8K 3S2DK 4GTDA 4OIOA 3K7AC 1F7UA 3HXAA 3V4GA 4BY1C 1JOEA 3GTLA 1BS2A 2YU9A 2GSUA 1ZBSA 3GTLC 2YU9C 4GTCA 1TWCK 4KASA 4BBSK 1K83K 1USOA 3OPFA 1ZYRA 2B63A 1GE9A 1XZQB 4BBRC 2BE5A 2B63C 3H0GA 4KMDA 3M3YK 5C4XC 2RGRA 1AB4A 1I6VA 3GTJK 3H3VL 2A68A 4GTAA 3H0GC 2E2IA 4WJ4A 2E2IC 3LAJA 3S17C 4QJVB 1O27A 3AD8C 2R92A 2VUMK 1TWHK 3HOXK 3PO3C 4A3GC 1O2AA 2R92C 3ERED 5IYCK 3S1MC 5IP9C 1USMA 1BDFA 5EGEA 2WB1D 2NVTC 2R93K 1JVIA 2PPBA 1WQGA 4A3CC 3S14C 3MMLB 4YFNA 4C3JK 4A3BC 2JA6A 3HOUK 1I50K 4A3LK 2E2HA 2XCOA 3G4CA 4ZH4A 5JFEA 2JA6C 2E2HC 4Y52K 1WOOA 5E68A 1O2FB 4P5BA 2V6TA 2WAQD 2O5JA 2JA5A 2E2JC 4A3EC 2JA5C 1IBAA 4XLPA 3G4AA 4BKWA 1O28A 3HOWK 3S15C 4Q4ZA 4GTFA 2P8TA 1L0WA 3I4MC 4X6AK 3Q3QA 5C3EC 2JA7A 3H0GK 5C4JC 4AYBD 4KN4A 4G0UA 5TJ3A 3S1QC 2JA7C 3GEHA 3FOEA 4ILDA 1TWAA 3S2HC 3AQOA 4BLBA 1TWAC 3GTGK 1WSVA 1Y1WA 4GFQA 3HOVC 4C3HK 4BY7K 1Y1WC 2PMZL 3S0XA 4O2DA 1DCHA 5IOQA 1I6HK 2JH3A 3HOYK 2ZUFA 3ADAC 4C2MK 3GEEA 1B4AA 2D6FC 2PA8L 3RZDK 4P5AA 1DD5A 5IP7C 4G7ZA 3N0CA 1SFOA 2P5MA 1VGXA 5IOSA 1BJTA 2NVYK 1TWFA 1SFOC 1EK8A 4C45A 3GTKA 4A3DK 1J6WA 4C3IC 1YNNA 4LQYA 3AH5A 3GTKC 4A3IK 2V6UA 4GTLA 4G0VA 1HQMA 1RU0A 3S1RC 3N3YA 4LK0A 3TTGA 4KB2A 4XSZA 5IYBK 3GTQK 1I3QA 3HKZD 4DDQA 4G7HA 4KN7A 1DCOA 1PJ5A 1WCMK 3CQZA 4A3MK 1I3QC 2Y3PA 3CQZC 4WILA 3GTPK 4A3KC 3HOZC 3I4NK 3TFJA 5TMCA 1XXCA 2KWAA 4FM9A 1INNA 3FKIA 4LJZA 5IOTA 3RZOC 1WQFA 4QIWD 1PJ7A 3FKIC 2FQOA 3GTMK 2A6HA 3M4OK 4A3JK 3BUEA 4KM8A 3S16K 3N0BA 1TWGA 5M5WK 3L4JA 4AH6A 2NVQK 2XCRB 1TWGC 2R7ZA 3S1NK 2R7ZC 5TMFA 3L4KA 4A93K 2O5IA 2A6EA 4KC6A 4PABA 3K7AK 1R9TA 1X31C 4RMFA 5IYDC 1IS1A 1YCLA 4BY1K 3GTOA 1R9TC 1VJEA 5L46A 4LK1A 3GTLK 3GTOC 2YU9K 4GTEA 5FLMC 4OIRA 1KQ4A 4KM9A 3H3VD 3TFHA 3T01A 4BBRK 2B63K 4M1XA 1XZPB 2Y0SL 5C4XK 2PHCB 4BXXC 1IQ0A 2JA8C 1WOSA 3OEPA 3S2DC 2GSNA 4LLGA 2E2IK 3S17K 4KMHA 4OIPA 3DXJA 1TWCA 1K83A 5JVOA 1EFWA 1JQWA 3PO3K 1TWCC 1O2BA 4BBSC 1K83C 4A3GK 1SMYA 2R92K 1IE0A 1UV7A 4NOIA 3S1MK 5IP9K 4J3NA 4FZBA 3GTJA 4XLNA 2NVTK 4MQ9A 3M3YC 3GTJC 4P9SA 4A3CK 2XCQA 3S14K 2ZUEA 3EQLA 4A3BK 2VUMA 1HI9A 4Y7NC 1TWHA 5D4DA 3LAPA 4BLAA 4GT9A 2JA6K 2VUMC 1ZQ1C 3IPJA 5IORA 1O26A 2E2HK 3FOFA 1TWHC 3HOXC 1XPPA 4KARA 2R93A 3LPXA 1VLOA 5IYCC 2E2JK 3A8JA 2R93C 4YFXA 4A3EK 2JA5K 2WB1L 1TWFC 3BP8C 3SZYA 1I50A 3S15K 1WIHA 4KATA 5FJ8K 3HOUC 3I4MK 1I50C 4A3LC 4BXXK 5M5YK 1J98A 5C3EK 2CFAB 1EH1A 5C4JK 4A3FC 4Y52C 3S1QK 3BP3A 3CAGA 2JA7K 1F9NA 1YNJA 2W7VA 3T00A 3GSIA 3S2HK 1VH2A 1XZPA 2WAQL 4XSXA 3PO2C 3A8IA 1TWAK 4KDDA 2PMZD 1DCPA 3HOVK 3HOWC
chains in the Genus database with same CATH topology
1J98A 1J6XA 1JVIA 1J6WA 1VGXA 1YCLA 1VH2A 2FQOA 1INNA 1JOEA 1JQWA 1J6VA 2FQTA 5E68A 4XCHA 1IE0A 1VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J98 A;  1J6X A;  1JVI A;  1J6W A;  1VGX A;  1YCL A;  1VH2 A;  2FQO A;  1INN A;  1JOE A;  1JQW A;  1J6V A;  2FQT A;  5E68 A;  4XCH A;  1IE0 A;  1VJE A; 
#chains in the Genus database with same CATH topology
 2EBB A;  1Y1W K;  4KMU A;  3SZZ A;  2NVX A;  4X6A C;  5CHP A;  4Q5S A;  2FQT A;  2NVX C;  2PA8 D;  4AYB L;  4Y7N K;  2GSO A;  4KMA A;  1IL2 A;  5C44 C;  5CJ9 A;  3GTG A;  1Y1V A;  1YX2 A;  1WSR A;  1V5V A;  3WOD A;  1F93 A;  4JK1 A;  5IP7 K;  5M5X K;  3GTG C;  1Y1V C;  4C3H C;  4LOW A;  1BGW A;  4BY7 C;  1SFO K;  4XCH A;  3AD9 C;  3JST A;  1TWF K;  4C3I K;  1J6V A;  1WOR A;  3GTK K;  1I6H C;  4MEX A;  1ISE A;  3HOY C;  2V6S A;  1J6X A;  4MEY A;  1C0A A;  3S1R K;  2RH6 A;  1PJ6 A;  3AQP A;  3QX3 A;  2ZFZ A;  4C2M C;  1O25 A;  4A3F K;  2CW0 A;  3RZD C;  1I3Q K;  5HL8 A;  2GAH C;  4GTB A;  2NVY A;  3CQZ K;  4A3K K;  1O24 A;  1XXA A;  1WOP A;  3HOZ K;  2NVY C;  5M3M K;  4PAA A;  4G0W A;  3PO2 K;  4A3D C;  3GDZ A;  3RZO K;  2CFA A;  3ORE A;  4A3I C;  1O29 A;  1EI6 A;  3GTQ A;  3FKI K;  4WJ3 M;  1ZXO A;  3VA7 A;  1F7V A;  1WCM A;  3FHZ A;  5IYB C;  3GTQ C;  1VRQ C;  4LR2 A;  4YFK A;  3T02 A;  3GEI A;  1WCM C;  4A3M C;  2NVX K;  3GTP A;  3HKZ L;  1TWG K;  4G7O A;  4OIN A;  1WQH A;  1G51 A;  3GTP C;  1ZVU A;  5C44 K;  1XZQ A;  2R7Z K;  1EQR A;  1B4B A;  2A69 A;  3TFI A;  3I4N C;  4GZY A;  3GTM A;  1Y1V K;  3A8K A;  2GAG C;  5IYD K;  5EGH A;  3GTM C;  3M4O C;  4A3J C;  1R9T K;  3AD7 C;  3GIR A;  4QIW L;  4OIQ A;  4QJV A;  1XXB A;  3S16 C;  4YG2 A;  3GTO K;  2Y0S D;  5FLM K;  2NVQ C;  3S1N C;  4KB4 A;  4C3J C;  3NUH A;  1IW7 A;  5M3F K;  4A93 C;  4KAW X;  2JA8 K;  3S2D K;  4GTD A;  4OIO A;  3K7A C;  1F7U A;  3HXA A;  3V4G A;  4BY1 C;  1JOE A;  3GTL A;  1BS2 A;  2YU9 A;  2GSU A;  1ZBS A;  3GTL C;  2YU9 C;  4GTC A;  1TWC K;  4KAS A;  4BBS K;  1K83 K;  1USO A;  3OPF A;  1ZYR A;  2B63 A;  1GE9 A;  1XZQ B;  4BBR C;  2BE5 A;  2B63 C;  3H0G A;  4KMD A;  3M3Y K;  5C4X C;  2RGR A;  1AB4 A;  1I6V A;  3GTJ K;  3H3V L;  2A68 A;  4GTA A;  3H0G C;  2E2I A;  4WJ4 A;  2E2I C;  3LAJ A;  3S17 C;  4QJV B;  1O27 A;  3AD8 C;  2R92 A;  2VUM K;  1TWH K;  3HOX K;  3PO3 C;  4A3G C;  1O2A A;  2R92 C;  3ERE D;  5IYC K;  3S1M C;  5IP9 C;  1USM A;  1BDF A;  5EGE A;  2WB1 D;  2NVT C;  2R93 K;  1JVI A;  2PPB A;  1WQG A;  4A3C C;  3S14 C;  3MML B;  4YFN A;  4C3J K;  4A3B C;  2JA6 A;  3HOU K;  1I50 K;  4A3L K;  2E2H A;  2XCO A;  3G4C A;  4ZH4 A;  5JFE A;  2JA6 C;  2E2H C;  4Y52 K;  1WOO A;  5E68 A;  1O2F B;  4P5B A;  2V6T A;  2WAQ D;  2O5J A;  2JA5 A;  2E2J C;  4A3E C;  2JA5 C;  1IBA A;  4XLP A;  3G4A A;  4BKW A;  1O28 A;  3HOW K;  3S15 C;  4Q4Z A;  4GTF A;  2P8T A;  1L0W A;  3I4M C;  4X6A K;  3Q3Q A;  5C3E C;  2JA7 A;  3H0G K;  5C4J C;  4AYB D;  4KN4 A;  4G0U A;  5TJ3 A;  3S1Q C;  2JA7 C;  3GEH A;  3FOE A;  4ILD A;  1TWA A;  3S2H C;  3AQO A;  4BLB A;  1TWA C;  3GTG K;  1WSV A;  1Y1W A;  4GFQ A;  3HOV C;  4C3H K;  4BY7 K;  1Y1W C;  2PMZ L;  3S0X A;  4O2D A;  1DCH A;  5IOQ A;  1I6H K;  2JH3 A;  3HOY K;  2ZUF A;  3ADA C;  4C2M K;  3GEE A;  1B4A A;  2D6F C;  2PA8 L;  3RZD K;  4P5A A;  1DD5 A;  5IP7 C;  4G7Z A;  3N0C A;  1SFO A;  2P5M A;  1VGX A;  5IOS A;  1BJT A;  2NVY K;  1TWF A;  1SFO C;  1EK8 A;  4C45 A;  3GTK A;  4A3D K;  1J6W A;  4C3I C;  1YNN A;  4LQY A;  3AH5 A;  3GTK C;  4A3I K;  2V6U A;  4GTL A;  4G0V A;  1HQM A;  1RU0 A;  3S1R C;  3N3Y A;  4LK0 A;  3TTG A;  4KB2 A;  4XSZ A;  5IYB K;  3GTQ K;  1I3Q A;  3HKZ D;  4DDQ A;  4G7H A;  4KN7 A;  1DCO A;  1PJ5 A;  1WCM K;  3CQZ A;  4A3M K;  1I3Q C;  2Y3P A;  3CQZ C;  4WIL A;  3GTP K;  4A3K C;  3HOZ C;  3I4N K;  3TFJ A;  5TMC A;  1XXC A;  2KWA A;  4FM9 A;  1INN A;  3FKI A;  4LJZ A;  5IOT A;  3RZO C;  1WQF A;  4QIW D;  1PJ7 A;  3FKI C;  2FQO A;  3GTM K;  2A6H A;  3M4O K;  4A3J K;  3BUE A;  4KM8 A;  3S16 K;  3N0B A;  1TWG A;  5M5W K;  3L4J A;  4AH6 A;  2NVQ K;  2XCR B;  1TWG C;  2R7Z A;  3S1N K;  2R7Z C;  5TMF A;  3L4K A;  4A93 K;  2O5I A;  2A6E A;  4KC6 A;  4PAB A;  3K7A K;  1R9T A;  1X31 C;  4RMF A;  5IYD C;  1IS1 A;  1YCL A;  4BY1 K;  3GTO A;  1R9T C;  1VJE A;  5L46 A;  4LK1 A;  3GTL K;  3GTO C;  2YU9 K;  4GTE A;  5FLM C;  4OIR A;  1KQ4 A;  4KM9 A;  3H3V D;  3TFH A;  3T01 A;  4BBR K;  2B63 K;  4M1X A;  1XZP B;  2Y0S L;  5C4X K;  2PHC B;  4BXX C;  1IQ0 A;  2JA8 C;  1WOS A;  3OEP A;  3S2D C;  2GSN A;  4LLG A;  2E2I K;  3S17 K;  4KMH A;  4OIP A;  3DXJ A;  1TWC A;  1K83 A;  5JVO A;  1EFW A;  1JQW A;  3PO3 K;  1TWC C;  1O2B A;  4BBS C;  1K83 C;  4A3G K;  1SMY A;  2R92 K;  1IE0 A;  1UV7 A;  4NOI A;  3S1M K;  5IP9 K;  4J3N A;  4FZB A;  3GTJ A;  4XLN A;  2NVT K;  4MQ9 A;  3M3Y C;  3GTJ C;  4P9S A;  4A3C K;  2XCQ A;  3S14 K;  2ZUE A;  3EQL A;  4A3B K;  2VUM A;  1HI9 A;  4Y7N C;  1TWH A;  5D4D A;  3LAP A;  4BLA A;  4GT9 A;  2JA6 K;  2VUM C;  1ZQ1 C;  3IPJ A;  5IOR A;  1O26 A;  2E2H K;  3FOF A;  1TWH C;  3HOX C;  1XPP A;  4KAR A;  2R93 A;  3LPX A;  1VLO A;  5IYC C;  2E2J K;  3A8J A;  2R93 C;  4YFX A;  4A3E K;  2JA5 K;  2WB1 L;  1TWF C;  3BP8 C;  3SZY A;  1I50 A;  3S15 K;  1WIH A;  4KAT A;  5FJ8 K;  3HOU C;  3I4M K;  1I50 C;  4A3L C;  4BXX K;  5M5Y K;  1J98 A;  5C3E K;  2CFA B;  1EH1 A;  5C4J K;  4A3F C;  4Y52 C;  3S1Q K;  3BP3 A;  3CAG A;  2JA7 K;  1F9N A;  1YNJ A;  2W7V A;  3T00 A;  3GSI A;  3S2H K;  1VH2 A;  1XZP A;  2WAQ L;  4XSX A;  3PO2 C;  3A8I A;  1TWA K;  4KDD A;  2PMZ D;  1DCP A;  3HOV K;  3HOW C; 
#chains in the Genus database with same CATH homology
 1J98 A;  1J6X A;  1JVI A;  1J6W A;  1VGX A;  1YCL A;  1VH2 A;  2FQO A;  1INN A;  1JOE A;  1JQW A;  1J6V A;  2FQT A;  5E68 A;  4XCH A;  1IE0 A;  1VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...