3ADAC

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with sulfite
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3adaC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3adaC01
1VLOA 1V5VA 3TFIA 1WSRA 3GEIA 4PABA 3A8JA 1YX2A 3GEEA 5L46A 3A8IA 1WOSA 2GAGC 1WOOA 4PAAA 3ADAC 1PJ5A 1XZPB 1WOPA 1VRQC 3TFHA 2GAHC 3AD7C 1WSVA 1X31C 3TTGA 3GEHA 3AD9C 1XZQA 3AD8C 1XZQB 3TFJA 3GSIA 3GIRA 4P9SA 1WORA 3A8KA 1PJ6A 1PJ7A 1XZPA
chains in the Genus database with same CATH superfamily
4A93C 1MNEA 2JJ4D 4XSZA 1WKLA 1JKHB 3TVYA 1USMA 1WKJA 4A48A 3N5FA 1UWBB 3UN2A 5FIIA 2GV1A 1UEUA 3FK4A 4N76A 2YBVA 3VHQA 1KLMA 2Y0SD 2KI2A 1TWFK 4WTOB 1R6YA 3C16B 4AFFA 2ZBQA 5HL8A 2KG1A 4A3BC 2UV8A 3MCMA 4A8YA 4IKAA 1RT5A 1TWFA 3THPA 2V6TA 2DGXA 3OW2R 1UJ5A 2P2CB 4A8MP 3NKYA 4DEZA 1HNVB 5AJ3J 3HVTA 2MZRA 1JJ2R 2W8LA 4ED7A 3PRBA 3MPYA 1S7IA 2HIQA 1Q95G 1I51B 4IQXA 2KZMA 4ZPWR 2DNKA 5A8WB 3PX4A 2OMOA 2H5EA 2F3JA 5KG2A 5H1SV 3AB4B 3VAIA 2ZZNA 1RT2B 3OL6A 4N8NA 4P9SA 1PJ7A 3HJVA 1XZPA 3MUVP 3G8QA 5IOQA 2R42A 1NPPA 5A2QY 4URQU 1NJZA 5JUMA 1TZ0A 4KAWX 4IO9Q 1N36J 2VG5B 5J2PB 2WBMA 3PYGA 2JFKA 5L46A 4NCAA 1TV6B 3CCTA 2CPHA 3ENAA 1IWAA 2FC9A 4FBUA 3MAAA 1H74A 1TWHA 2BE2B 2RH3A 2HHPA 5KFMA 3I5AA 2E1PA 4DV4F 4HH1A 2IHR1 4ZKAA 2GAGC 4QIWL 4MKYA 4XLNA 3KLEB 3GLJA 4DXLA 4O3SA 2E1AA 2E5IA 2WOMB 3TANA 3MPUB 4O0IA 4K4XA 4EZ6A 3N5BA 4LSNA 2FQOA 3HJFA 1IBAA 1M5VC 1N36F 3HLUA 4WIIA 1X9SA 5IM0A 1VS3A 4D3GA 3NCRA 2H5IB 5AE2A 4DR7F 1EP4A 1RA6A 4K4SA 2FHJA 2H1YA 4EWTA 5M2RA 4A8WA 3PTWA 1J5OB 5IC6B 2Z56B 4U6PA 3MEDA 1C0TB 4ES2A 1F7VA 5L1LA 2W7OA 3QGHA 4CLFA 2ZH1A 4LF7J 5GAGI 3A8EA 1FJGJ 2IFXA 3PW7A 5IYBC 2V8DA 1EIYB 1ZZFA 4ECZA 2MKIA 5A76A 1W26A 1R6VA 3KLIA 1M1GA 1FJEB 3D0GE 3BSAA 4UOCA 1S6PA 3M7VA 3VVTA 4MFBB 3TFJA 4JK1A 5IZHA 1I1GA 3H25A 2PA8L 1HWIA 1ZYRA 2C3YA 5JJBA 2D3O1 1U1OA 3SDEA 1BQXA 1VCTA 3AQPA 3AHPA 4C0BA 3KHGA 4GT9A 1KQFB 7FDRA 4KPYA 1UWBA 3Q83A 5EX3A 2LDIA 1IBKJ 4M5JA 3RRHA 4MYTA 2YNGB 2V6SA 4ZVHA 1A6LA 2EG1A 2XEXA 4C3LA 2FJDB 2LECA 1S5ZA 5BXIA 1AUDA 3GTOA 2NVQC 4PPDA 5IOTA 3A3PB 1F2GA 5KG3A 2DPIA 1VQOS 2RVJA 2LXFA 2YVSA 2CVIA 1RWNB 2VDIA 4DZDA 1X5TA 4ECXA 1YBTA 1CEZA 3I31A 3H2LA 2XY5A 3A8IA 1SIZA 2KHCA 1WC6A 2BW2A 3FRZA 4P2MA 3IGNA 2D3UA 1REVB 3DRRB 5CA5A 5KFPA 2HMIB 3IN5A 2GCFA 3SV3A 3ZZTA 1I50C 1FD2A 4L6V3 4W98A 1HQEA 4M5MA 4BBSC 4NLGA 2FJBB 2DGWA 1CJTA 2V4JA 2UXBJ 3V6JA 1LEOA 3IRWP 2VG6A 3TW0A 5J2QA 1NO8A 3TJ8A 3CD0A 2VQEJ 2NVYA 2W7PA 1KQ4A 2JNJA 1XZQA 2VFUA 1RA7A 4CLWA 3MM9B 1TKZB 2HFNA 3HHLB 4QPTA 2F7VA 1SCJB 2BE7D 1RHRB 1YRUA 1M5HA 1SJFA 1UJ6A 4PYAA 3DOLB 4OI4A 3R2DJ 2CNLB 1INNA 1ISEA 4MYUA 1FCAA 3LALA 2KM8C 2E9TA 3I96A 4OYMA 4DV7F 4HTJA 1MWZA 2BE2A 2O5DA 4GTEA 2BABA 3H0GC 5IT9U 5CH7B 1R9TC 4USMA 5E3RA 4TN2A 1JLFB 1P1LA 3VALA 2V8HA 2MLYA 3JYTB 2WONA 4WWSA 3MMAA 4JI0F 5IP7K 4K4ZA 2ATCB 5C42B 2WOMA 3NY0A 2AP6A 4QYZK 2CQPA 4WFZA 3BKFA 4F3QA 5HVGA 2NQPA 2LA4A 2MJUA 2GW8A 3HCXA 5E3PA 4I1TA 1NKBA 2HGLA 2QMXA 3MUMP 1RHUB 1EARA 1RADB 2IYGA 2A2CA 4KC6A 1VH2A 1FK9A 1CVJA 3I4PA 1DCOA 1SUQB 3KHLA 3WHIA 2W4DA 3RG6A 4FXVA 4WJ3M 3C2PA 2V2KA 3MWBA 1SMYA 4J9QA 2YU9K 1GE9A 6FDRA 2LMIA 3MR2A 1IKYA 5F8IA 4LQYA 2P6TA 3BBCA 3GTLA 3M9OB 3MM6B 1YTYA 1VOMA 4JI4F 4I2PB 3DLGA 2VV5A 2E5LF 4Q8FA 3TZWA 2JA6C 2IRYA 3A1YG 5DLFA 3BP3A 1SJ3P 4JI3F 4P2XA 4K2XA 3DXJA 2B5JA 1I3QA 2L08A 1SKUB 4Y0FA 2J7WA 2W2OP 4QWDA 1NDKA 1HNIA 4GZYA 3QT7A 2W1BA 3M2VB 2RH6A 1HQUA 1WI8A 2D7SA 2NYHA 3MD3A 3AD8C 4O3QA 4DG1A 2WRMA 1HPZB 4OZJA 1DFDA 2DR7A 1SC4B 3S2DC 3CPWR 4XSXA 1JX4A 4ZCMA 2B9EA 3AY0A 4V19X 1D9AA 2B51A 4ZS6A 4MTPA 2XY6A 3MECB 5AE1A 1R89A 1BLUA 1M1HA 1KLNA 4ZH4A 1IKWB 4Y6IA 1U6FA 4LFAF 1TL7B 4ZOSA 4ZVPB 4QWAA 1BGXT 4ZVGA 3B82A 4I4BA 1YG0A 4B3RF 5HP1A 5G0RA 3LP0B 2ZVSA 2D6FC 2PN6A 2WCXA 3K8VA 1WNEA 1CJTB 3T1YJ 1UVJA 3D6FB 3HHNB 4B9UA 1ZETA 1LWCA 1N5TA 1RAJA 4CO1A 4QW9A 2BJ8A 3T5HA 1C2PA 4YFUA 3OXLA 1HBNA 1DD5A 4LF7F 4RX6A 1TVRB 1FD8A 4BWJA 5B0BA 3NGKA 2LCWA 4IG0A 2PI5A 2UUTA 1O26A 3K89A 4HACB 6AT1B 3QBCA 2ZUEA 2YY3A 3P4UB 1N6QB 2DHGA 2ROPA 3HOVC 4RW6B 2ZH6A 3H4BA 4Y7NC 3RZAA 1NK7A 2WVFA 4DL4A 2F63A 5KG7A 2ZC3A 2RB7A 4LVOP 1WWHA 3R8YA 3HVAA 2ABYA 1LNQA 2KN4A 2OKQA 3WX4A 4DR2J 2CG8A 3UR3C 3DU5A 3AODA 3MDFA 4YY3J 2J0QD 2X3GA 1LFWA 2FQTA 1U1RA 2YQ1A 3QMQA 5LL6d 5H9EJ 5IS2A 2LQ5A 2DJWA 3R27A 5B0EA 1GH8A 2DVIA 4LR9A 4KY3A 4NASA 3HOUC 4NLQA 1EB0A 4OJHA 1JNRB 3S1MK 1MU2B 3SV4A 1IBLF 1KQKA 3GTYX 3KDOA 2XMJA 5ETQA 2ASDA 2G2ZA 2A1BA 4DJBA 1JKHA 4DU8A 3UN3A 2VBZA 2XGQA 1T03B 4KFBA 2BE5A 3S2DK 2I5JB 3FBBA 2LU2A 4IFVA 4NCGA 1M0SA 4DSJA 3QT5A 3OR1B 5C4XC 2BQUA 3KNGA 4Y2AA 3KLFB 2VD3A 4NEYA 4A8FA 4P10A 4LBIA 5TMFA 2G2YA 5ETVA 5F8HA 4R8UB 4B9VA 3VGVA 4XPEA 3OVSA 1X4CA 3FRYA 4CLZA 3L7OA 4F4XA 1FWPA 3SQGB 4KKOB 3TAMB 4EGLA 1EQ0A 1RTHB 1O29A 1N33J 1XR7A 2BANB 2G0CA 2RQ4A 1X4FA 3JAMY 1YBUA 1WC4A 3CDAA 3UCGA 2RS8A 3MZIA 3CD7A 3T5KA 4DR6F 4NOIA 1QUVA 3GMGA 2JDJA 4TYBA 4BXXK 3HKWA 4ILDA 2KKHA 3BGLA 2A6EA 2PMZL 4MQ9A 2SXLA 2DNLA 2J9EA 2Q3PA 1JLAA 1IBLJ 2A18A 3QNWB 2F4FA 1PYTA 1X0PA 2U2FA 2NVTC 3IAM9 5KFSA 3W2WB 2QA1A 4KYZA 5C5JA 3S1QC 1D9FA 1SV5B 4CT9A 3I4NK 5AXMA 4A8KA 2KXHA 2ZH4A 4XDDA 1S1VA 2CQGA 3VV2B 1YRTA 4WXOA 3GILA 3GTOK 4E2FB 1TVRA 3VAMA 2MZ1A 4Z7YA 3O6QA 3TX0A 1RCXB 3CD5A 5DG9A 4ANDA 1WHVA 4FF3A 1KN6A 2OPSA 4Q0BB 6FD1A 4U67Q 2R8HA 3M8ZA 2MGZA 4DPWA 3D2WA 4F0HA 3M30A 5IM0B 5GVQA 3J7ZT 1V3SA 4XK8C 4G1QB 3BP8C 4RUHA 4ZP8A 3TUPA 4Q43A 2JLFA 1JLEB 2GIQA 3F0NA 5DDOC 3KHRA 1HNXF 4A3EK 3CE8A 3ETOA 4LF5F 1RTIB 1S1TA 3GJTB 1GXLA 5F8MA 5BYRA 4RUCA 1F6TA 4YR0A 3TARA 2GIFA 1Y4ZB 4RW8B 2ZJPQ 3FKIK 3HKZL 2B0GA 4DR5F 4RL1A 1MLAA 1QSLA 3DI6A 3ZTOA 1MW7A 3FMBA 4F7VA 1NCLA 2BM0A 1I50A 1GMVA 3VZIA 4OLOA 1WORA 2GIRA 1QM9A 2B4UA 2J0WA 2Z4PA 3JSTA 3FZBA 2HURA 1T03A 4NXMF 2BUNA 3W3SA 1XZPB 1LW2A 3CJ2A 2B8QA 1HNXJ 3FDSA 4ED3A 1ITPA 1RB0A 4M5DA 3DOKA 1UA1A 2ZBRA 2KTQA 3L7PA 2HEKA 5KFHA 1NK9A 2HKEA 4KH1B 3QAUA 4HT7A 4DV7J 2CQHA 3R5CA 1S79A 3GTQK 2PE8A 1VBXA 3TTGA 1U7LA 2DH9A 2MSSA 1I5OB 1I6HC 4P7VA 1CPZA 4O3NA 4I2QA 1D8YA 2JRSA 4AL7A 4ID5A 1OQ6A 1HI1A 3UE2A 3AJDA 1RHJB 1WC5A 3P5TL 4CM0A 2R2RA 2VQEF 4PG7A 1N0UA 3TZZA 4LK0A 1FFWB 2XLKA 1AYEA 4EBEA 3RB4A 1Q0NA 2GQ2A 2JL9A 4I6YA 5F0WA 1VLYA 4NXNJ 5IWAJ 4YR3A 1TUVA 3IR6B 3MMJA 2HGMA 2QE5A 2JEIA 4ZP7A 1NXIA 1A9NB 4G7ZA 3UR0A 3OJUA 1UPPA 4QR2A 1TKXB 2X1AA 2VBYA 2CADA 4RZRA 2XCQA 2GMLA 3OTOJ 2H51B 1LWFB 4NLDA 3G6YA 1KS2A 3DXSX 3EDQB 3V6HA 1I6JA 4GC7A 2DHHA 2POKA 2LQ8A 5FLMC 1S12A 3W8GA 2EC2A 1JK9B 3RZDK 4Q5SA 4JP8A 5FDLB 4OHZA 2Z2YB 1IM4A 4FS2A 3KUHA 1HYSB 1KQGB 1TFWA 2JA7K 1N33F 5T41A 2YNHA 1BJTA 3HOZK 3GTLC 3S01A 2NPIA 3NWRA 5JVGQ 1UVMA 2ZD1A 2NS1B 5KFLA 1RXOB 2G0JA 4Q44A 4AL5A 1X4DA 4ZCLA 5I3QA 1XWLA 4K4UA 1VFJA 1HD0A 4TLRA 2CAJA 1Y10A 1Y3JA 2JA6K 2DXFA 3DLEB 2XMTA 3SXLA 1VHIA 3GPAA 5DQIA 3GIKA 3U1NA 3TAPA 2XCOA 2F5GA 5D0RA 3CDUA 5KFUA 4K59A 1JXVA 2DXEA 2N82B 4MMOA 1KWMA 3KK3B 5GADI 1ZTWA 1X9MA 2EKYA 2QEXS 1NB2A 3CT9A 3EXYA 2EI5A 4BY1K 1FVQA 3KMSA 4FDFA 1T9WA 3VAJA 1X4GA 4DV0F 2B43A 3D3CJ 2QSWA 3CCUS 1WI6A 4UZCA 2VUGA 1NPRA 2XS5A 2ZKTA 3B4MA 5EGEA 4NYOA 3GTKK 4B17A 2WVBA 3I56S 3FMWA 2P9EA 1L3SA 1DBDA 2DTJA 4JI2F 4I67A 1FXRA 5KFBA 2QMWA 1S9EA 4X4NA 1M1KT 1SVDA 5DETA 3E3XA 1RT2A 4IYQA 2ZH5A 2NVXC 3HZGA 2V0NA 4EBDA 2COLA 2VA2A 2R4FA 3MEGA 2C2EA 3CQZC 4UTGA 1VJWA 1Q53A 1LW2B 4A8SA 2MY8A 1O0PA 4N47A 2BQRA 2W9AA 3RB3A 3M1VA 4X64F 5FLXY 2J0XA 4IOCQ 2D1CA 3WQPA 3UCUP 4LFAJ 4UT4A 2R93C 3OTOF 4NLVA 3ILIA 3N0VA 5IP9K 1TV6A 4UY8T 4IDKA 1C1BA 3M2UB 2AD9A 4I2QB 4DFMA 3FEXB 4HTIA 4I7FA 4DQQA 2YNFA 1UTAA 1NSPA 4DV6J 1B7FA 2YWWA 3NBPA 1F3FA 4ECQA 4PG8A 5M5YK 1S10A 2EFGA 2XI2A 4HT5A 4X65F 5K9FA 4Y7NK 3WZ0A 2FHOB 2RE1A 2VH7A 2AJ1A 3J7YU 1RWWB 2A6HA 2PHCB 2E2JK 3C6UA 2XB2D 3AFGA 1KC8T 2QSFA 4Q5VA 1HW8A 1Y5NB 2PI4A 3H0PA 2HS4A 2KHDA 1WHXA 3IM8A 5KFTA 3LPXA 2AHOB 2XYHB 4ZCKA 1RACB 3CF5Q 3LP2A 4C2MK 2Y3PA 4RUAA 2ZEJA 2OSRA 1RKJA 1T9YA 3CIMA 1IW7A 3MEDB 3FOEA 3UNYA 2VQFJ 4OI0A 2X51A 3EICA 2EEYA 2OPRA 5DM6Q 1YK9A 4RNOA 3LP1B 3EQLA 4J9NA 4BS2A 2R3VA 3KLEA 1DQ9A 3AD7C 4DV4J 3H0GA 4CM2A 2CDRB 2XQCA 3H4DA 2D69A 2E5JA 3Q8QB 4ED8A 4CDIA 2YNIB 2QA4S 4LLGA 4JYAJ 3QWUA 3BEGB 1X4EA 1SC1B 1W7WA 3C16A 5ETMA 5HVHA 3FHZA 3NS7B 3S7RA 1H3DA 1IKXA 1IBCB 2AJ2A 3KOAA 1HA1A 3P45B 2GJFA 3RBDA 3FQLA 1I94J 1VRTB 4WZQA 4HR2A 1C0TA 4USJC 2OUGA 1H2VZ 1C0UB 4KV8A 3I0RA 3BN4A 4X4VA 2J9DE 4A93K 2W2PP 4Y00A 2KVQE 4ZMMA 5D15A 3R5GA 4OIQA 1PBUA 1VRUB 1PJ5A 3D5MA 1RAGB 5I42A 2M52A 3S15K 3CUNA 4KM9A 3ZZYA 2BM1A 2YX1A 4F0KA 3PNIA 5THWA 1UEVA 1NJXA 2JA5A 1SJ1A 2H48B 5JXSA 4WZMA 3D66A 3U7JA 1X8DA 2Z0GA 2QMUB 4PPZA 4JUZA 4YDXA 3PO2K 3IRXB 3MM5A 4O4GA 3BPSP 4RBTA 4UQTA 1V5VA 3TUZC 2KM8B 1BDFA 2Q1LA 2JA5C 1KOOA 3SCJE 1YJ9S 3ILJA 5F9LA 3DNCA 3BSOA 1RTZA 3FQKA 2HNYB 3HOWK 3NLCA 3OJSA 3PV8A 2F65A 1TWHK 5K14B 2CYYA 3ZTRA 1KBRA 3DMJB 4DL2A 3Q86A 3SQGA 5K8NA 4IDKB 2HHHJ 2R2UA 3VTIA 2Y0SL 1KEKA 4I7FB 1VC0A 4BDPA 2EKNA 2MHEA 2EK6A 4CO3A 2IRUA 1RGVA 2YWKA 3F41A 3NGSA 3R7SB 4LF9J 1D9DA 1WHYA 2E7WA 1DTTA 2WONB 2AJFE 1F3VA 3OBIA 4ZPCA 3LAMA 2ZWPA 3VVUA 2RQCA 3UNGC 2P9CA 1CS4B 2UVRA 3N4WA 4PUOB 3IBCB 4A3GC 3D3BJ 3D4JA 3K5MA 1X5SA 5B09A 4LF9F 1G1XA 4F4ZA 4A3EC 1SV5A 2KT3A 2MQ8A 2WBRA 2GSUA 3OFEA 4IOBA 3KLIB 1JLBB 4YB6A 2CQ2A 3MPDA 2DHXA 1YJRA 1BE4A 4OJ3A 1TWAA 4J3NA 1TELA 4WPAA 5C3EK 3R1LA 5CQGA 5J2NB 3MFIA 3E8OA 4CLKA 2OPSB 4IH6A 1JLGA 3D0HE 4DSLA 3K59A 3UCZP 3GCWP 2ILZA 4KE5A 3Q8PB 3T9NA 3OFFA 4L73A 3B6BA 2MYFA 1WCMC 3MFHA 4N56A 4CO4A 2HPUA 2V67A 3CCSS 3M6VA 3BM7A 2VQFF 4R8UA 3HD1A 3BR9A 3FGVA 2BQ3A 1WSVA 4QOTA 3GJSB 3GFHA 2V6AA 3I9V9 4KR0B 3VQSA 3GTGA 3K5NA 1HPZA 3UN5A 1VC6A 2CA9A 3OTEA 3POTA 3R5BA 3ZXWA 4C48A 2VFTA 1RTHA 4NI2A 2AW0A 4LREA 2F4VF 5T7LA 3EVOA 1D8ZA 3OSNA 3H5XA 1SC3B 3QSIA 2WAQL 3BGOP 5D6GA 3LO3A 3QGIA 1TWHC 4OX7A 3OL9A 2M88A 4DLEA 1HBMA 3GTGC 4URGA 3AH5A 5L1JA 4LJMA 4ZHRA 1CJVA 2NXUA 4KSEB 3R97A 1NZ8A 2GMHA 4IH5A 4KMDA 2OO4A 2ASJA 1KP6A 3BKTA 4PG5A 1SH3A 4W90B 1QVFR 3DDNA 4NLTA 4N8OA 4M94A 1S0OA 4PQUB 2JA6A 3M4XA 4IH7A 5FLXU 2C2RA 4PG4A 2B9WA 2IM0A 4UUWA 2GHVC 1FKPB 1WEXA 2FJEB 1HHQA 2AT1B 3C15A 3DOMA 3JTPA 1U6ZA 1WD6A 2BKNA 3VWSA 3E2EA 4DL5A 1BS2A 5ETTA 2GSOA 1X0FA 2H4YB 3BGRA 3HOXK 4NLRA 4YS2A 2M3DA 3T41A 1JQWA 4ED6A 3M30B 3TOQA 5HVFA 3MR7A 1NEEA 2Y1LB 2Z2ZA 5C24B 5A6WA 4RO0A 4WK3A 5BYQA 1XPPA 3SCKE 1QLNA 5KFYA 2IPOB 4FF1A 2HK2A 1YJNS 5HJYA 1VQ4S 1QAJA 1GMWA 1NU4A 4C9DA 1S1TB 5CXTA 1JLQB 1MN7A 3B54A 1S0VA 1WCMK 4YHHJ 3HM9A 3CO0P 1UPMB 2CZ9A 4NA3A 1N48A 4RW8A 2HZAA 3JXOA 3UQSA 4YEAA 2J6SA 1FNOA 2DNPA 4YR2A 4J9KA 3ZZUA 3F44A 2CJBA 4BLBA 4Y2KA 2GVZA 3D67A 3GTMK 1ZQ1C 4DPYA 2G1HA 4WJ4A 1L0WA 2PEBA 3K0JA 4YQWA 4RUBA 3M9NB 3HHKA 1PAUB 1CULB 2AGPA 3HF5A 3KJNB 3I4HX 4KM8A 2R8KA 5K8MA 5ETRA 3BBBA 1NBEB 4J9RA 2CPYA 3CQZA 2HS3A 4L76A 1T9UA 2RAQA 4NYPA 2JLGA 1WSRA 2MKKA 3BV8A 2P8TA 2VG5A 1S1UA 1ZM2A 1EQMA 5CAAA 5LSOA 4EUVA 4WTYA 5D4PA 2UVUA 3OD2A 4OZ3A 2WTFA 3ULHA 1NB7A 2MLXA 2JC0A 2UZAA 3MOZA 2X1FA 2B63A 2YKQA 4I6AA 4PABA 2MZSA 2ZITA 4B02A 3A4TA 2KFYA 3R2CJ 4KMUA 1PAEX 3MECA 2V2ZA 2C3MA 2OPQB 2QC3A 2HMIA 1P27B 3M3YK 4LFBJ 2GJIA 1TL4A 3LTOA 4GTBA 2B9YA 2NVYC 8AT1B 1VGYA 2E2IK 2IBOA 3OUYA 3MM7A 3DM2B 4Q45A 2QLBB 5MLCV 5E2QA 1XMBA 4NLSA 2B63C 4PZVA 3GB0A 2AGQA 1WEZA 2D3OR 4C8MA 4H4MA 4HI2A 1NKEA 5CYMB 3BDPA 3V81A 1RAOA 3MM9A 1EP4B 1GAOA 4OX9J 1M90T 3P3DA 3EUNA 2WVCA 1JVIA 1MSWD 2ZH3A 4DN9A 2XBPA 1F0XA 5E0OA 1QY7A 1CJVB 2ATLA 4DDFA 3H42A 5K8PA 4G0UA 4FF4A 1KHWA 2ADCA 2BJ1A 2EXUA 3KJFB 3C6TB 4CYUA 4XPCA 3S15C 3QT8A 3PR5B 5HLFB 4GKJJ 3W63A 5HL7Q 4ILMA 4L75A 4N7TA 3L4JA 4TNOA 3HOYC 4A46A 1JJHA 1C4AA 3T6BA 5HMWA 2K8GA 5HJXA 5IV4A 4LF1A 2PFFB 3CTRA 1BY9A 3GJRB 1I6HK 1EZZB 3IFEA 2ACMA 1TTHB 3K5PA 3RU0A 4RNNA 4ICLB 3PYDA 1SKWA 2N3LA 4DUYJ 4X62J 2CJKA 3LAPA 4RR5A 5CHPA 3Q22A 4K5SA 1KTQA 3VA7A 2W9BA 1YHQS 4EI2A 3NAIA 2WSFC 3UD5A 1LW0B 3VF0B 4H4OB 1LWXA 2AGOA 4OIRA 1U26A 1P8GA 3JAMU 1Q8KA 2CFXA 1XXBA 1VQKS 4U7UD 4HHUA 1T7PA 3GYXB 3ZNUA 4OHYA 2DYAA 4P2FA 3UDCA 5U47A 4DV5F 2ROEA 2XMWA 2FVQA 4Y3CA 4KIAA 3TUIC 2UUAJ 2EFOA 4K5RA 1ROFA 1UW9A 3S6EA 1YJ7A 3IXQA 5K20B 4MEXA 1ZZNA 3K17A 1NZAA 2J5AA 3Q0AA 4IUFA 1R0CB 2MGZB 2DGTA 3CWJA 2AEMA 3HSJA 3BB5A 4LQ9A 4I64A 1KVKA 4DL3A 2OD6A 4G0WA 2GGPB 1TMJA 3NP5A 2L9WA 3DLKB 5HMYA 5JVHQ 3OTBA 3V4MA 4MT1A 4MIBA 2DD8S 4K0KF 4ELTA 1RT3B 5F8GA 1VQ5S 2RF2A 2FDNA 1WC0A 2ZH2A 3FBFA 2N4CA 3QO9B 2IVFB 3C14B 5LOQA 5IYCC 2CJXB 4LR7A 1FRLA 4P6QA 2RUSA 2E9RX 2BXJA 2OFGX 2AQ4A 4ECVA 1WOSA 4U9RA 3Q8SB 2R2TA 3MMCA 2NVXA 4HVZA 3PRVA 1N54B 2XLJA 3RB6A 1OS5A 2IM1A 3V6DB 3GIMA 3VZHA 1FE4A 3DDIA 5D3GB 5GAEU 4ILRA 4NRTA 2CFAB 2UXDF 5KG1A 2R93K 2V5HG 3GIIA 2QIFA 2R7OA 1VK3A 2IVMA 2VG7B 1V5IB 1N5QA 3N79A 3OVAA 1LV5A 2R93A 3EGZA 4C3HK 1UFWA 4BBYA 1TWAC 2W7AA 1R9TK 1S1XA 2JOQA 2XMMA 1WEYA 3MOJB 1QVGR 1RUSA 1IWGA 2RDDA 2AF6A 4LF8F 3EVWA 1N52B 5K14A 3KFWX 5EWFA 4O0NA 1ZM9A 3N6MA 4ECUA 3PYFA 4ZVEA 1NNDA 1UVIA 3TR5A 3HT3A 3E01A 2VU5A 4I68A 4A3MC 4ZVFA 2HFZA 1VQNS 1Q8BA 2DHAA 4OI6A 1L3VA 4YFXA 3QATA 2V69A 4DG1B 5LXYA 3OLBA 4A3FC 1G51A 2QX0A 3M8SA 3PO4A 5ETKA 3PX0A 1RBLA 3HVRA 1OPZA 4WU2A 3SSRA 4RMFA 2DB1A 2ZUGA 1HBOA 1YBAA 2YTCA 2YWFA 2W01A 1RAAB 4QJVA 2YKMA 4CO0A 1NSQA 4NCGB 2WZ1A 2CPIA 2XO6A 4C45A 3OR2B 1K47A 2V4QA 4OQJA 2DIUA 1OSDA 3ZTSA 4OYXA 2RRBA 2QJ3A 3GSDA 4ED1A 3BDEA 2I1RA 3PJ9A 5CYJA 1VQ9S 4DHVA 4AXIA 1D09B 1V3RA 3TX8A 4QIWD 4B3MJ 3BO3A 4C8YA 3K5OA 2B7CB 2KXFA 2HQFA 2PIIA 3P49B 4CQ1A 4KB7A 1RJJA 4LOWA 4A3CC 3AH6A 3OQ2A 1C1BB 4PEOA 2E5LJ 2OELA 1SFOA 2GMJA 1KSPA 1S9EB 1E6YB 4ZA1A 3W60A 1RT1A 5LMUF 3AJ2A 3LUYA 1IKVB 2C2DA 3JS9A 3QO9A 3MEEB 4X4UA 3IP0A 4DV3F 2QT7A 2G0IA 3ZFVA 4LIRA 1DTTB 4ZHRB 3GTLK 1TK0A 1RSCA 2KZZA 4JI6J 2KYXA 1VR6A 1S6QA 3P5BP 4KGMA 1YGYA 4BY7K 4QIEA 5ETPA 2AX1A 1X4BA 3KLGB 3OFGA 2HHUA 2VHGA 4B3SJ 3PEJA 2P5MA 4ZVOB 1TK8A 2FIUA 3BN7A 1H2TZ 4G7HA 3BGUA 2GO8A 2GFFA 3HP6A 4FZBA 1N8RT 4O3PA 4CLSA 3CC7S 2E9ZA 4DUTA 1NLKL 5FJ4A 3N28A 2NR0A 2H5JB 3WC0A 3PO2C 1K9MT 3DCAA 4O3OA 2FJAB 4F04B 4KDDA 2KG0A 5L8RC 1U1MA 2VZ9A 2GQQA 3GIJA 4B3OA 1SQGA 1E6VB 5I3PA 4QCLA 2JA5K 2ZKUA 4LF6J 2V63A 2VJVA 2FYXA 4ZVSB 2UXDJ 4BBRC 1TWGA 2UVWA 4RU9A 2RRAA 1EHWA 1G6BA 1HR0F 2R8JA 4MH8A 3EWGA 3KG1A 3TI0A 1UJ4A 3CNQP 4FKYA 5D4OA 4RPFA 4YHHF 2ZNZA 3QQCD 3THVA 1XNRF 4KQZA 3EZOA 1M5KC 1KR4A 2QYGA 1REVA 4KMAA 1VQ7S 1O25A 2GA7A 5KFFA 4NL5A 2FJXA 3H5UA 3N01A 3M8PB 1RWVB 2UU9J 2HBQB 1L5UA 2H9ZA 4IG3A 3SSQA 3J7AN 4DFKA 1ZBTA 5DQHA 1FKOB 2KRBA 2Y8WA 1CULA 5T7LB 1JLCA 3RZOC 4MKAA 1Y1VA 1GNKA 4OMFG 1UWAA 2GVZB 3DOKB 4WFXA 1IR0A 3DU6A 3GTPK 5J2MA 1DJ0A 2XYGB 4XDCA 2DNNA 1XR5A 2K1RA 1G7CB 4LFCF 2QV6A 1N5VA 3R7BB 1GMUA 4NLWA 3W2WA 1W25A 3DYAA 3AAWB 4ID5B 5EGYA 3S1TA 3SCLE 1W2BR 1WACA 1BWVA 3CCLS 4DLGA 4C8KA 5CYQA 4F50A 4PWDA 4C8OA 4DQRA 2V2VA 4BY7C 4DR4J 3CCWA 3DDKA 3LGNA 3KK2A 4OL8A 5HSPA 2NVXK 3HVTB 2ROGA 4OV1A 2ZUAA 4GVBA 4ZN1A 4DR4F 4CH0S 1NM2A 3QIPA 1HWUA 1RDRA 8ATCB 4A4JA 1DRZA 3HK2A 1B4AA 2OPPA 1MMLA 1YVFA 3QJJA 4ZLLA 1HQEB 1U0HA 1P6TA 3E51A 1XERA 1WHWA 4EEYA 2C3UA 1SUQA 2R7VA 2C2KB 2CJQA 3W2VB 5KFXA 3JQJA 3HFVA 1RAFB 4JI7J 2R92K 3D7SB 5I3UA 1UFKA 2HNZA 1XMOF 3HX9A 2WB1L 1OYEA 4DN0A 2Z8QA 4J9PA 3M8QA 2DO4A 4DR7J 2YNHB 1HD1A 2OEMA 2GO9A 3IM9A 4A3DK 1CQNA 1FNMA 1NJIT 2H54B 1FWKA 2G13A 2RDIA 1KD1T 3FKIC 2JC1A 4F25A 5KFGA 1QTNB 2VJUA 1HARA 1KVIA 3VAFA 4LF4J 4U96A 3IPJA 3KJVB 3DKDA 4JI1J 3G6XA 1J27A 3M6UA 3CMQA 3NGTA 1WIHA 3SEOA 2V4RA 1KLMB 2OSQA 2DT9A 2PDAA 3KXDA 1H0HB 5DRKA 1J5EF 3QJLA 4TQRA 2DNYA 4ZP6A 3R5AA 2FJVA 5IC4B 1XR6A 3MR5A 1VI7A 4OHXA 4NZ6A 2WVEA 4OJGA 1ZA1B 3UI3A 2PMWA 4LSLA 4NLUA 2FD2A 2C2ZB 4XCHA 3BR8A 2F9JA 4JV2A 3QZ8A 2HHSA 3ERED 2AEJA 1O51A 3OPKA 1VBKA 4F4KA 2NUHA 2MDAA 4GO5X 4K8RA 4B3SF 2HBYB 4WFAQ 3EZ5A 5L9NA 4DQIA 3PEHA 3FBEA 4O2DA 3HPOA 2OIHA 2YH0A 2R7XA 4DR5J 2V8PA 1RT5B 4KBIA 2PEHA 2FVSA 1LWFA 2J9DA 4J37A 2PMHA 2RGRA 4OYZA 4O4RA 2NXEA 4P73A 3VAKA 2DNHA 3HOUK 5DDRC 1V6HA 4TY9A 1JB0C 2R2SA 4KAIA 1J2VA 2OGUA 5A8WA 2XHCA 2VPZB 3EVMA 3PM9A 1RT3A 4BLGA 3Q24A 3ZC4A 5CZVA 8RUCA 5AXNA 4I69A 4CWBA 3RTVA 5D0HA 2E2HK 4UY85 3GV8B 3FCHA 2FQQB 3VCDA 4C97A 3C6UB 2QA2A 2QTWA 1HW9A 1F5BA 1HBMB 2D74B 2Y1RI 4X6AK 1ZAWA 1VDHA 1SQEA 1TL7A 4KHPJ 4IRDA 2LDYA 4M1KA 3BO4A 2MZJA 3HXMA 4IRKA 1EETB 4X66J 3D54A 5J2PA 4JI3J 3S1RK 5G0RB 3LPEA 5CABA 4DF8A 4AH6A 2I2YA 3FKBA 3EGNA 1JXLA 2VG6B 4OHVA 2AMCB 1AZSB 1J5OA 1U09A 4XO0A 2DY9A 1X31C 3N0CA 2E66A 2UUBF 3MHYA 1RYRA 1IR1A 4QWBA 4K4YA 1EJ7L 2UUWA 4KGXB 2CPXA 1URRA 2CIMA 2A68A 1IVZA 1T11A 3QSYB 3GP9A 1T3NA 4CLPA 1TL3B 3DOMB 4NX9A 3C19A 1TL1A 1OSCA 4LBPA 1HNWF 2IJFA 4RW4B 3BBFA 2CWKA 3LF0A 3DGPA 1YNJA 3G4CA 4DS5A 2V94A 1V3ZA 2HHHF 2DEJA 1R27B 2ZC4A 1NAQA 1B4BA 3HHDA 1N88A 3OFHA 1VMBA 1QSSA 1KVJA 2BJ9A 4PXEA 1XXCA 3T1HF 5KT7A 3DRXA 2UV8G 5L9XA 1QDUB 1P9QC 4YY3F 4B3RJ 2O67A 3QX3A 4FN5A 3NGRA 1UA0A 4O23A 3TVZA 3VGTA 2P8IA 3QPIA 5EUHA 4M5GA 4CO2A 3PW4A 3RRGA 1Y5IB 1PKUA 2XMKA 3CMAS 5HBMB 3W9IA 3POTB 1YITS 1HWJA 4DZ6A 4K50A 5H9EK 3MCNA 4BC9A 4C4WA 2DBBA 1KNZA 4PWUA 3CJKB 2VA3A 3UDVA 2B6AA 1UCNA 2CVEA 2DNMA 4NA1A 3L7UA 4NRUA 1N34F 4L3KA 4J91A 1RTDA 2HG4A 5E5NA 1TP7A 1XC9A 1R0AA 1DHMA 4DPXA 3GEHA 4KFBB 2YKMB 5K5MA 3IWLA 5DG7A 1K1SA 4TQSA 2DNOA 4A3LC 4USUA 2XWXA 4IFVB 1EAYC 1HWKA 1S6OA 1LOUA 5HQLA 4GO7X 1YX2A 2HIYA 4BHQA 2GVDA 1VYAA 1ULRA 4NYZA 5IP9C 1GXUA 2J7UA 2V8GA 2GC8A 3CJQA 4CH1A 2Z2LA 1TKZA 4NZ7A 5KFQA 3UW1A 2BRLA 4DV2J 4L3NA 3MURP 3C15B 2C3PA 1CJKB 1H72C 5BR8J 2EFNA 3J81j 4EMDA 1HHSA 2BVZA 2KT5A 5IYCK 2XS7A 5GAHI 2QA4G 4ED4A 3MR3A 3IC1A 3MM7B 1NDLA 4YMEA 4QBUA 4YP3A 1PGZA 5B0DA 3PKMA 1XBWA 2QGFB 5D0EA 3JTOA 2NVTK 5F41A 4QPXA 4OIXA 3KK1B 1HNWJ 5EGHA 5BJRA 3EPIA 3V81B 3M8RA 1LKZA 5M3MK 1Y7PA 1RI7A 2BX6A 2FZGB 4WU3A 3HFKA 1B4SA 5LMNF 5IV3A 3BH6B 4G7OA 4OX8A 3H2UB 2VASA 4C7QA 1IQ0A 2VFRA 1UZDA 1C0UA 2HQIA 1LWEA 5TJ3A 3G82B 3UDEA 3S1NC 3KLHA 3MAAB 1A7GE 4LVNP 4C8ZA 1JOEA 2OHDA 4TKTA 1FRIA 1RABB 3AD9C 2OH2A 3K57A 1N32J 5J2NA 1HFEL 3SSSA 5IYBK 1JLGB 4A8QA 3V4IA 3MXHP 3BQ2A 1A0OB 4WKRA 1IKYB 4H4KA 1S6UA 2YKNA 3AQOA 3IO1A 1PYOB 3U1MA 2XMVA 3TA0A 4HDGA 4YB1P 4R25A 1S1UB 2O01C 4B3OB 5KG0A 1RAHB 4A3KC 1F9FA 3NS5A 3AOBA 2WAQD 5C25B 1HNVA 2M5YA 2W9BB 2AYBA 4WBFA 2NSBA 1S99A 3V6KA 3ZZPA 2XGPA 2EVZA 2E7VA 2HFOA 3G71S 3EMTA 2KRRA 3H3VL 2A0FB 2MQLA 3DM2A 2QZ8A 1KFDA 4LBHA 1RHKB 1TFYA 2XG8A 3WODA 3TP2A 2Y1IA 3QIDA 3S17K 4JV1A 2IDEA 1FJGF 1GXTA 1XK8A 4TY8A 2DR9A 1LK7A 4ZPVR 3O1LA 5E3QA 3LAJA 1AFJA 3C14A 1SI9A 1WQHA 3S0XA 3QRPA 1B0TA 1L3KA 3C66A 5F3TA 1IKWA 3B78A 5A8RA 1OY6A 1K83A 1XNQJ 1NK4A 1VC5A 2VOOA 2EBBA 4BBSK 4DX8H 2E44A 1AB4A 3LP0A 2GGPA 4CLUA 3N6NA 2XM3A 4A8OA 5HAOA 3KDNA 3NGDA 5HI7A 5IOSA 1HBUB 1OIAA 1LWCB 1OJ4A 3W9HA 2HVEA 2RT3A 3CVKA 2UUCF 1JLBA 3W65A 2AU0A 5GMKa 5CCMA 3IGVA 3V2UC 2YXLA 3LQVA 1QJHA 1TL5A 4FF2A 1SL2A 4LUBA 2RF2B 2X7IA 1VJEA 1FHTA 4NWBA 3TYTA 4C98A 3PR4A 5CYQB 5HANA 5DDPC 2G4BA 2GX8A 3M32A 1GT8A 2VPXB 3DRRA 4CLTA 4X4TA 4LF4F 3H98A 3S1QK 3KK2B 1UP1A 3S2HK 5CHCB 2XHWA 2J8AA 5HQMA 3RW6A 2E7XA 1RKIA 3R5DA 3MGJA 5KFDA 4M5KA 3CQZK 3R6LB 3QIPB 2IC3B 1KTVA 2XTJP 1VQ8S 4J9UE 2WW8A 5IP7C 1X4HA 2B4OA 4OZ5A 1U4BA 2YX4A 4MKBA 3HOZC 4J9VA 1TWCK 2BMBA 2RU9A 3V4GA 4A3BK 4ERDA 4ZVUB 1UVLA 1QD1A 2OEJA 3S14C 2DITA 2M0GB 3ENWA 2GHWA 4WYWA 4PR6A 1J5EJ 4LT6A 4KB2A 1RQ0A 1T9XA 3OTCA 1IBMF 1XJWB 2LEPA 4KPCA 3JQKA 1I3OB 1I3QK 2IMWP 1HYSA 2HSEB 4DSEA 5M5XK 4HL9A 3KYLA 4OZ1A 5ETLA 1ZM3A 3SI8A 1HKAA 1PC4A 2W25A 4NLPA 5KAKA 3ITHB 3Q3QA 2YWEA 3CDWA 5L1IA 3E01B 3M1VB 3FC9A 4UQGA 3S1RC 1PYSB 1AT1B 1LXNA 2NREA 1O27A 4OYBA 2X1BA 2HFSA 4LRFA 3DLEA 1EFWA 2V9KA 3I5BA 5AE3A 2FLOA 2QL7B 1QE1B 1IN0A 5E68A 2F8HA 2CQIA 4CH7A 1ZTTA 3ISND 1R8HA 1IM6A 1U1PA 2NLWA 3G4AA 1FKPA 1O6XA 1GMWD 1OY8A 4CTAB 3RAMA 1IJEB 4JI0J 4XLPA 4F02A 1SXLA 1WC1A 2AEFA 4FS1A 2MKHA 4QWCA 2HYIB 1X7VA 2AJQA 3G96A 4DF4A 4DR6J 1DY3A 3G6VA 1KOHA 1TWAK 1TAUA 4TY8B 4IFYB 4B9LA 3LWLA 2QL9B 2RHSB 4JI4J 1U6BA 1F9NA 4J9SA 2RMLA 3PHTA 4HEA9 3MPVA 3R9LA 4WK1A 2DO0A 3GV5B 3MF5A 3H20A 5E7OB 2CZVC 1OQ3A 5KT6A 2CWXA 3OXGA 2GS8A 4M5DB 3CJTA 1DCHA 2ZNYA 3M6WA 2Y3YA 2D9OA 2JA8K 3NNCA 1VQPS 3W5ZA 3G8TA 3JSMB 1F93A 3CW2C 4HLBA 3UO0A 2N7YA 5KFCA 4X4PA 3TO8A 2W2NP 1RTJB 1PIEA 3DC2A 1U8WA 4WYLA 4FXDA 5LXRA 2KU7A 5E33A 2VC0A 3RR7A 4CLYA 1U45A 4X4RA 1ZXOA 2AIRB 1X5PA 1IKXB 4C2MC 2XLIA 4A3FK 3BGFA 4U8VA 1QAYA 3JYTA 3S16K 2E5GA 4FPRA 2HAFA 2YX7A 2Y1JA 2VUMK 3FFIA 3CCJS 3I0RB 5DGAA 5HMXA 1TKTB 2GNKA 4EBCA 1S0NA 3MD1A 3KUGA 1FDBA 3Q89A 4YOEA 3SZZA 4FXWA 4DL7A 3N3YA 3HSGA 2AJ4A 1JJ4A 2BW7A 2E5HA 3ZTPA 1PCAA 3VAGA 4OLPA 4Y52C 5KFIA 5KT5A 1G4CA 2JEJA 2QLXA 4USIA 1IBKF 3QFHA 1K83C 1NKCA 3IR5B 3WX8A 4ZIWA 4HACA 4DUZJ 4MAKA 3R5JB 4HHHA 1YZ6A 1I6VA 2I8EA 1XMQF 2W9CA 3QWPA 5C2CA 3SFUA 2ERRA 5KFZA 5F8NA 4NMXA 1GFWB 1LQ9A 1S49A 4RW4A 4WJBA 1FKOA 4DFPA 2YNIA 2EK1A 2LU1A 3RRKA 3GTKC 3F56A 5FLMK 4U95A 1NH7A 3TRGA 3OL7A 3BJYA 2M2BA 1Q8LA 5IFMA 4USTA 3CULA 1R8AA 2VODA 2PA3A 3HHLD 3ISZA 3BPDA 3DHXA 4C3KA 3OT9A 2BR0A 3QRRA 1H73A 1P9YA 1FJCA 1RCOB 4I56A 3DOLA 2MQMA 2R8IA 3GSIA 1GTEA 5ETNA 2XYPB 2I6WA 1TWGC 2NVYK 1AFIA 1F5CA 3JSRA 1SIWB 1WQFA 4YG2A 5DLGA 3ILLA 4UW2A 2JSXA 3W9JA 1FI4A 3FUYA 4DX6A 1VRUA 3Q8RB 2EFQA 1UVNA 4H4KC 5B0AA 3N6LA 5HO4A 5KFOA 2B8PA 5HP1B 1N5YB 1OPIA 3NG8A 2RRNA 3M8YA 1CS4A 1D1UA 4X84A 2XULA 3PG9A 3U27A 5ADZA 2DRDA 2OTJS 3EXCX 2K1RB 1WCMA 2MZTA 4OI2A 2I0XA 1X5OA 3AJ1A 3WDOA 2VB6A 2VFVA 3RBXA 9RUBA 2XI3A 1HBNB 2IM2A 2QO3A 5DZ6A 5DZ7A 4ES3A 1Y1VC 3G2XA 3R3TA 2GSNA 2RQKA 2BRKA 2JH3A 2I38A 4Z7CA 2MPUA 1RT4A 2CPJA 3AB2B 3QYYA 1NK0A 4GMKA 2YPZA 1Y11A 2DNGA 4LSNB 2O5JA 3D68A 1WTBA 4A3GK 1R8PA 2HWTA 2CQBA 3AT1B 3IAS9 1T0TV 2DEIA 3FEYB 2HLTA 2HRUA 2NYIA 2DNRA 1PC5A 3LH2S 2XZTB 2UXCJ 1S57A 1CC7A 3KNAA 3IS9A 2KDOA 4DUZF 2R8GA 2IIHA 2HVDA 2DRAA 1AROP 5C3EC 2K06A 1FKAF 2HVHA 2A69A 5EN1A 2VPYB 3ZTQA 2E1CA 2D41A 2JZ5A 5HN0A 3J7Z5 1JIHA 2ZJRQ 1RWMB 1KHVA 1N0VC 2DGQA 2WW4A 3US5A 4GRSA 1O28A 4C8NA 1K8AT 1H98A 1JQGA 3JTNA 5LJ3Y 1EKRA 4QJVB 1OY9A 3H90A 3D1HA 3AXMA 4QIGA 3GG1A 3IWXA 1OMSA 2R7SA 2M8HA 5JVOA 2DGOA 3L3CA 4QIVA 4AQYF 4RBVA 4FVMA 1IE0A 3T00A 2F40A 2MXYA 2FHMA 3GTJK 2QFJA 4ED5A 3LANA 1S48A 2ZH8A 2B9XA 1FJ7A 3FKIA 1FRXA 1SFOC 3FZ2A 2J7KA 2MHNA 1NRKA 3I0SA 5HQ8A 1IS1A 2ZUFA 3GJQB 3EJMA 4FKXA 1FXDA 1K1QA 2AJ0A 2W24A 4GVBB 3OL8A 2K3KA 4MK9A 1H38A 1MMDA 2KL8A 2WHOA 1ZVUA 3DI6B 3MCOA 1E6YA 1CJUA 2W4PA 5IYDK 4NPOA 1YDLA 3QZ7A 4TYAA 2FZCB 2K3IA 1HNZF 4A3LK 4TU7A 3PIOQ 3V5RA 1RT7B 3MPWA 1JXEA 1BQNA 2MQOA 3CJ0A 4B9MA 3GFXA 4YB7A 2DGSA 2ACYA 1UFLA 4J90A 2PC6A 1RU1A 2CW0A 4DV3J 3CCES 5IQQA 3FNNA 5KFAA 4CCHA 3DRPB 1EKSA 2B7BB 4P5AA 1RP5A 2BJ7A 2PFDA 1FK9B 1WELA 3KLHB 2KFNA 2LXIA 2EBEA 2VKRA 1RT6B 3VAHA 1DAXA 3MTKA 2UXCF 3DGVA 1FDAA 3GWCA 4I0WA 4AT1B 4F3MA 3QJPA 3NUHA 2XMUA 1Q1KA 4PG6A 1RT4B 2W4CA 2DHSA 5GAEI 3GR1A 1RAEB 5A8KA 4P74A 4DSKA 4DU7A 5F8JA 4IOAQ 2XCRB 1TMMA 2XWYA 2Q6BA 1SJQA 3T01A 4A47A 2Q66A 4C0HA 2L3MA 5F0UA 3IBFB 4IR9A 5E41A 2RU3A 4LIWA 4K4TA 4G1QA 2OAUA 3T1YF 4R5PB 5KFWA 1CQMA 2JX2A 4ZLJA 5C24A 3HOVK 2MKYA 2CUYA 3W61A 3CXCR 5DDQC 3M2RB 1Q7YT 1T3OA 3X3UA 2DGUA 3D6MB 4WE1B 3AXKA 5GMDA 2YWHA 3MM6A 3SZYA 4KARA 1JLQA 4C6AA 2AZ1A 3D1OA 4DUYF 1DARA 1ZM4A 1VBZA 1RAIB 2JVRA 2M7SA 1UETA 3NRBA 3RW7A 1BHNA 5C4XK 2HQ3A 1EK8A 4LR2A 2J0SD 3NGUA 1XNRJ 5J1PA 4IQMA 3EM1A 3RGIA 2RHQB 4LF5J 4PXCA 2FVRA 3PO3C 4A3KK 5A8RB 1T05A 3VQTA 1WUUA 3S1MC 3WIUA 2VFSA 1LK5A 5LJ5Y 2LXUA 4DI6A 1KFSA 2NXNA 3GV7B 2IJRA 1Y0HA 4DV0J 2WK4A 1Z2ZA 1BQMB 1NH8A 2LFVA 3NEKA 4DMZA 4KRWA 1NMEB 1K83K 5KG6A 1ICEB 2R7QA 2YH1A 4ATNA 3I6PA 2P5VA 2R7RA 4X66F 2J8SA 5H9FK 4GTDA 2ZHAA 2FGCA 3MMBB 2HNYA 4KASA 1MWYA 4NLYA 2B6AB 1RWKB 1S9GA 1VQMS 2HW3A 1U1KA 4JV5F 4LR8A 1N6QA 3A8KA 1RWXB 3N0BA 3GFYA 2V50A 1SJRA 1R0AB 2CJAA 4CT8A 1LXJA 4GC6A 4UOHA 1H7XA 5MAOA 3H7HB 1B70B 1Y9OA 3RBEA 3EX7B 3PW2A 2DR8A 1JLEA 4MK8A 3K2YA 2FVPA 1UL3A 3QLHB 1BQNB 1RBAA 1TWFC 4ZK7M 5KG5A 2KVIA 5C44C 1B3TA 2F8MA 1RHQB 3S17C 1T8EA 1GK8A 3NNHA 1UVKA 3PJWA 4P5BA 7FD1A 3A3OB 3Q8YA 4WCEQ 2BEFA 2HHVA 2HFUA 3D1QA 5E3CA 2DISA 1Y1WK 3HFZB 4OZ2A 2JHEA 1VIOA 3Q8VA 4X2BA 2HGNA 4IG3B 5SZTA 5D78A 2X1GA 3A3NB 5KFEA 3V4IB 5HROB 1B0PA 1JLCB 2ZD1B 4GVLA 5HATA 3KJQB 2RJZA 4ID8A 1AA1B 3A12A 3Q2TC 2G2OA 3DRSA 4Q2MA 1WJ9A 3BH7B 1RBOB 5DS7A 2MTLA 2RD5C 1VRQC 3RB0A 1ZPWX 5LMUJ 1U48A 2ZZMA 1LWEB 3BZQA 3G6ES 1ZH5A 2FPHX 1MN9A 3IBWA 4ICLA 3S14K 1P1TA 3KK3A 4KHMA 2IMOA 3M05A 1FERA 4U7UK 3ONQA 1FEHA 2DCUB 3IG1B 2FJWA 2RILA 3BS9A 5GAHU 3KTQA 1WG5A 2FLPA 4QZVB 3RR8A 4Z2XA 2BACA 3FSYA 1RTDB 1Q86T 4U7CA 2BANA 2YKNB 2ZDPA 1WQGA 2ZHBA 2MQQA 2BJDA 2OP5A 2QL5B 4ELVA 3T6JA 2GZOA 3DRYA 2W9CB 1U8SA 4JV0A 2ADBA 4TU8A 3PIPQ 2VBXA 3CGIA 4P71A 4DR2F 4UOGA 2W2MP 1QTMA 3HHLA 2UU9F 4NEZA 1RISA 1HIYA 1SQFA 1VRTA 3BREA 3SCIE 1I50K 1O24A 5A0YA 2V6UA 2JA7A 3OHAA 3I87A 2YNGA 4KKOA 2MSTA 1C1CA 2MEWA 4IRCA 2W7VA 2DY1A 4QR0A 2B56A 1VGXA 2VOPA 1F5AA 3M2UA 4PQUA 5DQGA 1SH0A 4BKWA 4OX6A 4HH0A 5CZXA 1AUSL 5C44K 2RKIA 3W7BA 3F73A 1VHFA 1WG1A 3CO9A 1QAIA 1Q78A 3X1LB 5KOXA 2I9SA 2JA7C 3MMBA 1DLOB 4X4SA 1S9FA 1S7HA 5EHHA 2V34A 1BXNA 4RJVA 4Y65A 4X65J 3LWMA 3T19A 5IT4A 4JV5J 4ED0A 2PO4A 2RNEA 2KXNB 4OX9F 1FDDA 5L1KA 2HRYA 4PAAA 1R43A 2HLUA 4RU2A 3U1LA 1FTRA 3PCOB 3L4KA 4CIOA 1VQSA 3KHHA 3DFEA 1OO0B 1TKTA 1L3UA 4ZJQA 3NCPA 4EO8A 3J7YI 1GQEA 1H6KX 1RTIA 3CAGA 1D0EA 4F2RA 2BA9A 3WC2A 5AXLA 3AA8A 1FTCA 1S76D 3MEKA 1ACMB 2VUMA 1XZQB 5HK4A 2W2QP 4IO1A 2VKZG 3Q23A 2DR5A 2KFZA 4N77A 4DPOA 1YJWS 2ZH9A 1F7UA 3M32B 2OPRB 1MROB 3C46A 2HQDA 2JVOA 3R1HA 1FFGB 3GG0A 3RAXA 3QGGA 2O1PA 3RJMB 3LW5C 3TJAA 3GEEA 1X60A 4NXNF 4PRFA 3D6HB 5J1EA 2B3TB 4DDQA 2M70A 3L9ZA 4GKKF 4ER8A 1BWEA 3SIPB 2CXEA 3NOCA 1RLCL 5B08A 4PKDB 2CQ3A 2HZCA 2Z30B 5M3FK 2RUGA 1Q4RA 2AYGA 4F2SA 2UXBF 4ZP9A 1T9VA 5F3ZA 1TAQA 3MI7X 4A3IC 4ECSA 2H4WB 2CG4A 4QW8A 1RU0A 2IY5B 1UV7A 1NPKA 2L9DA 2OPQA 4B9TA 4ZJOA 4MIWA 4KHRA 3HD2A 4CTAA 2HK3A 3W5XA 2BJEA 4DV1F 4OYIA 2R7UA 3CD6S 1JLAB 4QIFA 2E2HC 1U24A 2CPFA 3HHEA 4BY1C 3TA2A 3PFEA 2QLFB 4X4OA 4OFZA 3I55S 3FVYA 3GTKA 1R3NA 1Z1ZA 4QU7A 2F1FA 4ZLNA 1VIXA 2DPJA 2BDPA 2IA0A 3GTGK 4U8YA 1H2UX 1OWXA 1AZSA 3ET6A 1Q79A 2IVYA 4ANCA 5A0YB 4TXSA 3U02A 1REGX 3IMQJ 3EZUA 3TQEA 4KMHA 2CNKB 3H2VE 4YUDA 2HBRB 3DLKA 2ZBCA 4JBCA 2IDLA 5KFKA 1Q7LB 1N32F 2ZFZA 3G4SS 3GQCA 3K5LA 5KFRA 2BKOA 2HVZA 3DGPB 2CDQA 4KO0A 3W64A 3OREA 4GTCA 3NMRA 3HZEA 3CDBA 4FPIA 2IA6A 1SJ4P 3VGUA 1IQTA 2PT0A 3T5LA 3CJ5A 3EE3A 1WTFA 4F3OA 3ZZRA 4KT0C 3W62A 3HSZA 4RW9A 1R7IA 2XSJB 2IM3A 1S6QB 2O66A 1Z4UA 2RIJA 1NK8A 3DLLQ 4ALZA 2NZCA 4B08A 5ETOA 2C3OA 3S2HC 2AWZA 1YKWA 1RU2A 2A6MA 3I82A 4J9OA 2UUAF 5J1NA 4RW7A 4LFBF 1M5OC 4B9NA 2NXJA 2F9DA 2WB1D 1GEHA 3PY8A 2VIHA 4YN3B 5KT4A 4OYWA 5J2MB 3CJ3A 3TFHA 1RYSA 4NOHA 4KGVB 2BJ3A 4C3IK 2E1RA 3D0IE 4FYXB 1FX4A 1SKSA 3P6YC 1ZS6A 3CC4S 3NAHA 1J6XA 3QGPA 1TKDA 4ELUA 3CCQS 4ZDNA 1VBYA 4K0KJ 2WSEC 2WSCC 1RZMA 5FJ8K 2HZVA 4GTLA 3H3VD 4X4QA 3UPFA 4CRJA 3QAEA 1S1WA 4NCBA 1HL6A 3GONA 3UVJA 4C2MA 4F8RA 2HHWA 3GTQA 3NMAA 3TA1A 3TJ9A 2ZM6F 4L72B 5AXKA 4USWA 2DNQA 1N34J 4WE1A 1WC3A 2FY8A 1IQZA 4Y2CA 4ZN3A 2FVCA 2CPZA 5C4JK 1W2IA 2ZE2A 3ICLA 4ZITA 2NCKL 2QLJB 2ZWOA 3DMJA 1AW0A 3TAQA 4MIAA 4EZ9A 2OJ3A 1WDTA 1AB8A 3KUEA 4JOUA 5B0GA 3FOFA 4UZBA 4A3MK 4NI2B 4DBQA 3GTQC 4URSA 5EX0A 5K8OA 1JJCB 1LFPA 5D0GA 2YU9A 3A8JA 2C22A 3BSCA 1UKUA 4DOZA 1XMQJ 4DCPB 1PO6A 2FTRA 5I3UB 3MAHA 3BKUA 2B63K 3J80Y 3DLHA 4KC5A 1IUJA 5I4MA 3HOYK 1TWCA 4ECRA 3ZO7A 2C2NA 4OHWA 2AYMA 1HI9A 3HOWC 3ETMA 4UF4A 2CFAA 4G1IA 3G82A 1RWOB 3MUTP 4DL0C 1G3OA 3I5CA 1PJ6A 4X62F 4KTQA 3Q8UA 3VGSA 2H65B 5D77A 4FYYB 1YIJS 3H5SA 4FVCA 4RBUA 4DPUA 3GTJC 4YFKA 1HQMA 2KJVA 3OUYB 3T5JA 1F2HA 2FLNA 5KFNA 3TZXA 2C42A 1O8BA 4RNFA 1H7WA 3EYZA 4C11A 4Q8EA 3GFZA 2K2PA 2XCAA 3ZZZA 3MMLB 2ZH7A 4H4MB 5GAGU 2JA8C 2E2IA 1S77D 5H9FJ 1J6VA 3JSYA 2OMLA 2XCPA 2J9CA 1YI2S 4C3IC 4FBTA 2R9LA 1HQ2A 5D4LA 1VQ6S 4GFQA 3K58A 2Y9HA 4J7CA 2OLWA 5D4DA 4R0EA 5EDWA 3MCSA 2XSFA 4ZCIA 3BUEA 4DV6F 1F9EB 3SYZA 4EFAC 2BYCA 4ZVQB 1K73T 2ALYB 5I42B 5E3AA 4BLAA 2HQGA 2MQNA 3KG4A 4ECTA 4JI1F 1FNXH 1Q81T 4L74A 1I94F 4X64J 3BO2A 1NJYA 5HROA 2Z2MA 4WFNQ 3LAKA 3LGHA 1RWUA 3OR2A 1FA0A 4BC7A 1UEKA 5IT9Y 2ZDOA 2BKPA 1Q16B 1SBRA 3DRSB 1G2EA 4DQPA 3AOCA 2NSCA 2VONA 2ZBIA 1HBUA 3KMQA 2Q79A 2QFIA 2VC1A 4Z37A 1DZ5A 2ZOGA 2O5IA 4OI3A 4C3JK 4OYOA 3DHWC 3J80U 2IBKA 4JI2J 1NUEA 2HWHA 3PACA 2U1AA 3NBPB 2PPBA 2HHTA 4CLLA 1NHKL 1UZHA 2H3EB 5CD4H 2C2OB 4JI6F 1Z2LA 3GTOC 3SMZA 4DSIA 4I6WA 2DK2A 4D3HA 1U2FA 3MAQA 1CSJA 4KJIA 5JFEA 4P52A 3BGRB 3RBZA 1EETA 2XY7A 1TKXA 1S97A 2OFHX 1U2CA 2IC3A 2MKSA 4DX5A 3LP2B 4E0DA 3HOXC 3SQOP 3NNAA 3PRDA 4K4VA 3RYLA 3C3LA 2AZ3A 4FYDA 4F4WA 3SBMA 1WG4A 3W8PA 4PUOA 3P96A 4DX7A 4JB8B 3QFWA 2FGOA 4NA2A 2FUG9 1HQUB 3C6TA 1X4AA 4CYUB 5BYSA 4ED2A 1GX6A 3RAQA 5IT0A 4KN4A 2LVWA 4OZ0A 1FRKA 2PSZA 4DS4A 4M63A 2Z57B 1TU0B 5HMZA 2EFVA 1CJUB 3TEHB 2C1EB 1T02A 2RS2A 4AQYJ 1JWWA 2APOA 4QQBA 1IKVA 3HI9A 4HKQA 2BE9B 3IS9B 4DSFA 4AYBD 3G86A 1DURA 3O44A 4M5LA 3MMAB 2HFVA 3CCVS 4JI8F 1SL0A 4LRBA 1GX5A 4MK7A 4IR1A 4DR1J 3PDNA 2VL1A 4P72A 1M5PC 1R9TA 4RLEA 4OINA 1HWLA 3KLGA 2OI2A 2VBWA 2A3JA 3K7AC 2YKPA 3ENVA 1IJFB 4P7TA 2A6OA 3EGVA 4H4OA 2HHXA 4WILA 4F36A 4M5IA 2XC9A 4YDDB 4B9SA 3M6XA 2KYZA 1FRMA 4LK1A 4A8XA 1SKRA 1ZYQA 2ASLA 3M2RA 2X3DA 3GTMC 2BV3A 3FSIA 1K44A 1FT8A 4LQ3A 4RWWA 2LQ9A 2M8DB 3R7NB 2CQDA 2J6TA 3TZYA 4QYRA 4Y2IA 4RNHA 2BOAA 4LF6F 3RUBL 7AT1B 4AE5A 2CQ0A 1U1QA 1YQHA 3GE9A 4WF9Q 1SB6A 4KH0B 2GJ2A 3NOGA 5GMEA 2MKCA 3N9UC 3GTJA 4ZIVA 4NXMJ 3M4OK 3TEGA 3PHEA 2VF3A 1NHVA 1K0VA 3L4BC 2HWIA 2HHQA 1T95A 1CG2A 2E2IC 2YKOA 3ISNC 4EU0A 2EG2A 2P6SA 2LLZA 1HMVB 2DXDA 1L3TA 2RKIB 2QG9B 1YJTA 3CJSA 5AJ3F 3CJKA 5M2UA 4GTAA 5EWGA 4ILLA 1WDDA 2HNDB 3MM8A 4YB5A 5LSRA 2LQJA 4DL6A 4FYVB 5IQ6A 4C0OC 2V2QA 4ZPDA 4J9MA 3FFIB 5M5WK 1MWQA 4A3JK 3LGMA 4ZPAA 4ANEA 5IXUA 2AYEA 1UAWA 2FC8A 4WKYA 1ZOTA 3S8SA 4OJ1A 3V6DA 1FDNA 3ET6B 1R31A 3WIVA 1J6WA 2ASYA 3DYAB 3W2VA 2IAJB 3KWMA 4ES1A 2E2JC 1O5JA 1YRXA 4OV6A 3A13A 1SL1A 1LW0A 5KT3A 5IYDC 4OYAA 4OIPA 2HNZB 1HR0J 4TVAB 1BMQB 1RK8A 2RSQA 3QRQA 3I4NC 4N5SA 2CJ9A 2C28A 3L95X 2UUBJ 2QLWA 1S1XB 1SH2A 2Q43A 3GCXP 3OHBA 3QT6A 4QU6A 4DR3J 3EGWB 2N3OA 1VLOA 1B0VA 4ETXA 3ADAC 4LF8J 4F4AA 5C25A 2YQ3A 4USKA 2B4VA 4CI0B 4K7QA 3CCMS 3EDRB 3M9MB 1FFSB 4ETZA 3HDSA 2KWAA 2MMYA 2IRXA 5LM7E 4Y52K 3T1HJ 1YWXA 2Z58B 3RZOK 4CNYA 4OI1A 1KDNA 1HNZJ 2RDJA 3BQ0A 2HBZB 4M5NA 2LEAA 1U49A 3HULA 5LT5A 3I32A 5T14A 5BR8F 3CEDA 1X9WA 1WF1A 1TWGK 3PFOA 4TU9A 4RW7B 2EBGA 2XO7A 2R7WA 1TR0A 5KTQA 1XNQF 5DG8A 3LP1A 3Q2SC 4LMZA 1B99A 3KJVA 1B64A 1TL1B 3OVBA 4ZPTR 3PZPA 1XN9A 1VQLS 3FCWA 3UFCX 4EYIB 4EYHB 2C2MB 2HAIA 3OR1A 5J2QB 3LOUA 2LEBA 4N41A 2FHJD 5A2QU 2R7TA 1TWCC 5CCLA 1GTHA 3I0SB 4Q2LA 3UVJB 2AX0A 3TQ1A 2B5JB 2CKWA 1KRPA 4F67A 2KO1A 1U0SA 2VG7A 2MZQA 2DCLA 1N56A 5DM7Q 1ZAVA 2JFDA 1YJUA 3IWNC 4ECYA 2ALZA 4A3IK 5LMNJ 5KFVA 1S0MA 3H5YA 2Y0BB 1Y1VK 1VJQA 1AXQA 4OIOA 5D4NA 1FE0A 4PXBA 4LRAA 4G65A 2R7ZA 5KT2A 2PGCA 4ENOA 2NUUG 3BYRA 3CDEA 4F0MA 1Y00A 4O44A 1HMVA 4CP5A 2DKOB 4DPTA 2R7ZK 3NWGA 4JI5J 1DLOA 3G87A 2BOPA 1BUXA 5C7PA 2N4DA 3HMJG 4QWEA 2FHKA 1FRJA 5B7WA 4GKKJ 1ZBSA 2HNDA 3MM8B 4ZVRB 2GAHC 1R8BA 5B0CA 4BCAA 3GDZA 4DCJB 1APSA 3I9ZA 4C3HC 4Y28C 4GTFA 4C3JC 3TVKA 1JNZB 4JYAF 3MM5B 2XSJA 4O4GB 4O3RA 3OSPA 1U1LA 4PCQA 1RT6A 3KG0A 3O3LA 4DR1F 2GVDB 1NDCA 4NE9C 2J6UA 5KOWA 1D3WA 4WP9A 2DGVA 2FLLA 2FB0A 4M8LA 1DTQB 4KHPF 1HI0P 1USOA 2KH9A 3W5YA 4WXWA 5LSLA 5A8KB 1WF0A 1N5SA 3S1NK 1BD6A 4FZVA 1DCPA 5ETSA 4DR3F 2V68A 1FVSA 5C2GA 3UDLA 3DLBA 5M2PA 3G9CA 4Q0BA 4GKJF 1FESA 3HT0A 2JEGA 1WOOA 1U02A 2A10A 3FBCA 4DV5J 4V1Ak 3D28A 1RWPB 2OTLS 1U1NA 3J81U 3JB9k 2R92C 3LA0A 3SZ2A 2OEKA 4WFYA 1RHMB 3J7A1 2KJWA 1YZ7A 3OTDA 2VPWB 2ZFHA 2ZJQQ 3IG1A 1IR2A 2G9OA 2GQCA 1Y1WC 4Y2MA 3OV7A 3H40A 2NVQK 5DJBA 3I4MK 4FNIA 1EX8A 4ITSA 1VISA 4H54A 4F26A 1TL3A 1NJWA 3OEPA 1XQIA 2ZE2B 1IL2A 1U47A 3FEZA 1S6PB 3P8BB 3DLGB 4IFYA 2BBEA 3PW5A 3ENQA 5CYMA 4QR1A 3PVXA 3K8WA 5JMNA 4KB4A 3SDEB 2EPIA 4FYWB 3T1AA 4KGKA 3VR1A 2VUMC 1Q8IA 4NLOA 3BSNA 1T05B 1SPBP 2HVIA 3CJRA 1RT7A 5DGBA 3O5TB 4RKUC 3H59A 2I5JA 5L38A 3UWTA 1JMTA 1B7YB 2ZBPA 4USHA 5F8LA 1FEEA 2XZWA 3NXZA 2RQMA 1VK8A 3BF4A 2EFPA 4C8LA 2MJNA 2NZ4A 2AKWB 2L9NA 1QUPA 2JLEA 1C0AA 3DRPA 2M9KA 1FWLA 3GU0A 2V9WA 4E98A 1ELOA 5KFJA 3GYNA 3CCRS 1K0TA 2DR6A 3AA9A 1R8CA 4A3CK 3WBZA 1URNA 3L09A 1C4CA 2MY7A 1S9GB 2ILYA 4HI1A 3CCZA 3JQMA 2LQBA 4EK2A 4V19J 3GTMA 4PXDA 3TAMA 1WF2A 1NDPA 1O2FB 3EPGA 4KATA 3O8WA 4HHJA 1KONA 2EC0A 2V4JB 3MMCB 2MQPA 4W4MA 1VQYA 2ZZTA 2YU9C 2CQCA 4C11B 2EW9A 4OZNA 1YCLA 2QRRA 5D3GA 2LA6A 3KK1A 3TUJC 2F8EX 3MEGB 2L41A 3CJ8A 2QN6B 3MTJA 3CC2S 4G3IA 5C4JC 4DFJA 3PW0A 3W1YC 1FO1A 2IJNA 3D6TB 5ITHA 4B3TJ 1YSJA 3BYPA 1XMOJ 4CO5A 3K7AK 3GZ7A 1KKHA 2MB0B 1HLWA 1S59A 4NZ0A 4ZVTB 2JWNA 3DN9A 1TUWA 4W92B 4G1PA 3GTPA 3T02A 1WKKA 1JLFA 5J1EB 3PO5A 1Q5YA 4BBRK 4JI7F 5IWAF 4HYKA 4G6VB 4WFBQ 3HO1A 5C42A 3D9BA 3R6GB 4PQAA 2V8VA 4AYBL 4G0VA 4USVA 1NK6A 1BGWA 3B4DA 1I3QC 3GTPC 5F9NA 4RNMA 3NCQA 4OYPA 3KLFA 1U25A 2CNOB 1BQMA 2B4PA 5TMCA 4OZLA 4F4YA 2WVDA 4YFNA 1F1BB 1S1WB 1TQLA 4HDHA 4PYDA 4XAKA 4PWDB 4LRDA 4LFCJ 1HBOB 3K7RA 3TNVA 3HHLC 1F9HA 1N5YA 1EI6A 4P2SA 5KG4A 3TFIA 3UD3P 4ZPBA 4P75A 1WOPA 3KLVA 2KB2A 3G8SA 3CSKA 3LPYA 2QYCA 4Q4ZA 3MEEA 3NL0A 1U0HB 3M3YC 2XS2A 4JI8J 2O3DA 3CB4A 3H8YA 3CIZA 3ZZ0A 4LSZB 3ITHA 2IYIA 4AD6A 3QLHA 3T9ZA 5SUHA 2ZM6J 1HNIB 4M95A 4MKVA 2HRTA 1YNNA 3M2VA 4ECWA 3FCVA 2KT2A 1RE1B 2N7CA 3M8WA 4WP3A 1R0BG 5HLFA 1FF2A 3GR0A 2K7KA 2L48A 1S1VB 1FX2A 4C3MA 3PKYA 3SFGA 4K2JA 3PXGa 4KO0B 2R92A 2D3ZA 2XMAA 2DH8A 3UD4P 1N4LA 3RZDC 4QYZJ 2LP4A 4M5HA 1ZPVA 4A3DC 1CBKA 1U2RA 5EWEA 2E1MC 4NLXA 1E6VA 4DV1J 1XEZA 4PWWA 2K7JA 4CNZA 2F4VJ 4RW9B 1O2AA 3PYEA 1FXLA 1T94A 4ZJLA 2ZHOA 1Y5LB 1S4FA 1EH1A 4LF2A 2YKAA 2HQCA 2CQ4A 3T3FA 2MKJA 1IXKA 4LJZA 1XIQA 4NMLA 3OXFA 2LYVA 1YJVA 2PD1A 5IOLA 4ZLPA 4B3TF 3GIRA 1S72S 4LSLB 2IAJA 2NPFA 5FDLA 4RW6A 4M1XA 1UMJA 1J98A 2YPYA 2R7ZC 2XNQA 5CJ9A 1Q82T 4I2PA 3OPFA 2UUCJ 1RTJA 2OD4A 1HI8A 3GYGA 3PJXA 4UUXA 3CJ4A 5DO2A 2CQ1A 2LKZA 2CPDA 4BWMA 3O2IA 3ZNJ1 2ZOFA 1ZAXA 1PILA 2DNZA 2CNNB 1Y3KA 5G4DA 2CZ4A 1PSDA 4DV2F 3HVWA 4UOFA 5IORA 4J5OA 5HBMA 2P9GA 1YLXA 4FNHA 5CD4A 3FSXA 1C1CB 2YWGA 2E2HA 4KV8B 5RUBA 2GHPA 3MR6A 1QE1A 1IBMJ 4AUKA 3AOAA 4Y34A 1BC6A 3HKZD 1XXAA 1RT1B 2DRBA 3DXBA 3HSDA 3S16C 4B3MF 3TWZA 3BQ1A 4TLQA 1RLDA 4K4WA 2MLZA 5AT1B 3NS6A 4MEYA 1KQSR 3H0GK 4RWXA 1SFOK 1CC8A 3W66A 4XIUA 2OPPB 1S4EA 4BXXC 2XZDB 4FM9A 4MJKA 1T9TA 2CPEA 1NSAA 1HHTP 1MMNA 4WIQA 3IA0A 1FRHA 3IRXA 2Y8YA 3THTA 4Q7AA 3FJ2A 4J9LA 1Q5VA 3PX6A 2G1DA 1Y1WA 2M4MA 3DLJA 2UP1A 3B8HA 1MG7A 1QSYA 2FY1A 1NK5A 3OLAA 2D9PA 2DH7A 3M8QB 3ZZOA 2NXCA 3C8YA 4IG0B 3JSMA 2BZ2A 2WB4A 3ELHA 1ZA2B 1MROA 1TUGB 1CJKA 4S0MA 2ZOMA 5B0FA 1PG5B 1XTZA 1OYDA 4WP8A 1DQAA 2CRLA 4EO6A 5L39A 4JI5F 4DWIA 2DIVA 3ILOA 1CLFA 4FP9A 4KN7A 1NSKL 2YQ0A 3GEIA 2PMZD 4O44B 1SC6A 2XNRA 2CJYB 2YNFB 4LRCA 3PO3K 2UVVA 4AXJA 4R5PA 3M4OC 4A3JC 5FD1A 1QAXA 2HS0A 3CMES 1M5SA 1V9OA 2ZVIA 3JSBA 1O2BA 3KKFA 4XTTA 3J81Y 4E8UA 3IR7B 1DQ8A 2VICA 2E29A 1TK5A 1F60B 5A6PA 2VDHA 5GADU 3HXAA 1UW4A 4DCOB 3M8PA 2J76E 2A2DA 4R0JA 5D8HB 2Q6CA 1EQRA 3I4MC 4KGZB 2AV5A 1NHUA 4MFBA 4CZCA 2PA8D 2FZKB 4AL6A 1PBAA 4DQSA 1MU2A 4X6AC 9ATCB 1DTQA 2W8KA 2JEFA 2EWHA
chains in the Genus database with same CATH topology
1VLOA 1V5VA 3TFIA 1WSRA 3GEIA 4PABA 3A8JA 1YX2A 3GEEA 5L46A 3A8IA 1WOSA 2GAGC 1WOOA 4PAAA 3ADAC 1PJ5A 1XZPB 1WOPA 1VRQC 3TFHA 2GAHC 3AD7C 1WSVA 1X31C 3TTGA 3GEHA 3AD9C 1XZQA 3AD8C 1XZQB 3TFJA 3GSIA 3GIRA 4P9SA 1WORA 3A8KA 1PJ6A 1PJ7A 1XZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLO A;  1V5V A;  3TFI A;  1WSR A;  3GEI A;  4PAB A;  3A8J A;  1YX2 A;  3GEE A;  5L46 A;  3A8I A;  1WOS A;  2GAG C;  1WOO A;  4PAA A;  3ADA C;  1PJ5 A;  1XZP B;  1WOP A;  1VRQ C;  3TFH A;  2GAH C;  3AD7 C;  1WSV A;  1X31 C;  3TTG A;  3GEH A;  3AD9 C;  1XZQ A;  3AD8 C;  1XZQ B;  3TFJ A;  3GSI A;  3GIR A;  4P9S A;  1WOR A;  3A8K A;  1PJ6 A;  1PJ7 A;  1XZP A; 
#chains in the Genus database with same CATH topology
 4A93 C;  1MNE A;  2JJ4 D;  4XSZ A;  1WKL A;  1JKH B;  3TVY A;  1USM A;  1WKJ A;  4A48 A;  3N5F A;  1UWB B;  3UN2 A;  5FII A;  2GV1 A;  1UEU A;  3FK4 A;  4N76 A;  2YBV A;  3VHQ A;  1KLM A;  2Y0S D;  2KI2 A;  1TWF K;  4WTO B;  1R6Y A;  3C16 B;  4AFF A;  2ZBQ A;  5HL8 A;  2KG1 A;  4A3B C;  2UV8 A;  3MCM A;  4A8Y A;  4IKA A;  1RT5 A;  1TWF A;  3THP A;  2V6T A;  2DGX A;  3OW2 R;  1UJ5 A;  2P2C B;  4A8M P;  3NKY A;  4DEZ A;  1HNV B;  5AJ3 J;  3HVT A;  2MZR A;  1JJ2 R;  2W8L A;  4ED7 A;  3PRB A;  3MPY A;  1S7I A;  2HIQ A;  1Q95 G;  1I51 B;  4IQX A;  2KZM A;  4ZPW R;  2DNK A;  5A8W B;  3PX4 A;  2OMO A;  2H5E A;  2F3J A;  5KG2 A;  5H1S V;  3AB4 B;  3VAI A;  2ZZN A;  1RT2 B;  3OL6 A;  4N8N A;  4P9S A;  1PJ7 A;  3HJV A;  1XZP A;  3MUV P;  3G8Q A;  5IOQ A;  2R42 A;  1NPP A;  5A2Q Y;  4URQ U;  1NJZ A;  5JUM A;  1TZ0 A;  4KAW X;  4IO9 Q;  1N36 J;  2VG5 B;  5J2P B;  2WBM A;  3PYG A;  2JFK A;  5L46 A;  4NCA A;  1TV6 B;  3CCT A;  2CPH A;  3ENA A;  1IWA A;  2FC9 A;  4FBU A;  3MAA A;  1H74 A;  1TWH A;  2BE2 B;  2RH3 A;  2HHP A;  5KFM A;  3I5A A;  2E1P A;  4DV4 F;  4HH1 A;  2IHR 1;  4ZKA A;  2GAG C;  4QIW L;  4MKY A;  4XLN A;  3KLE B;  3GLJ A;  4DXL A;  4O3S A;  2E1A A;  2E5I A;  2WOM B;  3TAN A;  3MPU B;  4O0I A;  4K4X A;  4EZ6 A;  3N5B A;  4LSN A;  2FQO A;  3HJF A;  1IBA A;  1M5V C;  1N36 F;  3HLU A;  4WII A;  1X9S A;  5IM0 A;  1VS3 A;  4D3G A;  3NCR A;  2H5I B;  5AE2 A;  4DR7 F;  1EP4 A;  1RA6 A;  4K4S A;  2FHJ A;  2H1Y A;  4EWT A;  5M2R A;  4A8W A;  3PTW A;  1J5O B;  5IC6 B;  2Z56 B;  4U6P A;  3MED A;  1C0T B;  4ES2 A;  1F7V A;  5L1L A;  2W7O A;  3QGH A;  4CLF A;  2ZH1 A;  4LF7 J;  5GAG I;  3A8E A;  1FJG J;  2IFX A;  3PW7 A;  5IYB C;  2V8D A;  1EIY B;  1ZZF A;  4ECZ A;  2MKI A;  5A76 A;  1W26 A;  1R6V A;  3KLI A;  1M1G A;  1FJE B;  3D0G E;  3BSA A;  4UOC A;  1S6P A;  3M7V A;  3VVT A;  4MFB B;  3TFJ A;  4JK1 A;  5IZH A;  1I1G A;  3H25 A;  2PA8 L;  1HWI A;  1ZYR A;  2C3Y A;  5JJB A;  2D3O 1;  1U1O A;  3SDE A;  1BQX A;  1VCT A;  3AQP A;  3AHP A;  4C0B A;  3KHG A;  4GT9 A;  1KQF B;  7FDR A;  4KPY A;  1UWB A;  3Q83 A;  5EX3 A;  2LDI A;  1IBK J;  4M5J A;  3RRH A;  4MYT A;  2YNG B;  2V6S A;  4ZVH A;  1A6L A;  2EG1 A;  2XEX A;  4C3L A;  2FJD B;  2LEC A;  1S5Z A;  5BXI A;  1AUD A;  3GTO A;  2NVQ C;  4PPD A;  5IOT A;  3A3P B;  1F2G A;  5KG3 A;  2DPI A;  1VQO S;  2RVJ A;  2LXF A;  2YVS A;  2CVI A;  1RWN B;  2VDI A;  4DZD A;  1X5T A;  4ECX A;  1YBT A;  1CEZ A;  3I31 A;  3H2L A;  2XY5 A;  3A8I A;  1SIZ A;  2KHC A;  1WC6 A;  2BW2 A;  3FRZ A;  4P2M A;  3IGN A;  2D3U A;  1REV B;  3DRR B;  5CA5 A;  5KFP A;  2HMI B;  3IN5 A;  2GCF A;  3SV3 A;  3ZZT A;  1I50 C;  1FD2 A;  4L6V 3;  4W98 A;  1HQE A;  4M5M A;  4BBS C;  4NLG A;  2FJB B;  2DGW A;  1CJT A;  2V4J A;  2UXB J;  3V6J A;  1LEO A;  3IRW P;  2VG6 A;  3TW0 A;  5J2Q A;  1NO8 A;  3TJ8 A;  3CD0 A;  2VQE J;  2NVY A;  2W7P A;  1KQ4 A;  2JNJ A;  1XZQ A;  2VFU A;  1RA7 A;  4CLW A;  3MM9 B;  1TKZ B;  2HFN A;  3HHL B;  4QPT A;  2F7V A;  1SCJ B;  2BE7 D;  1RHR B;  1YRU A;  1M5H A;  1SJF A;  1UJ6 A;  4PYA A;  3DOL B;  4OI4 A;  3R2D J;  2CNL B;  1INN A;  1ISE A;  4MYU A;  1FCA A;  3LAL A;  2KM8 C;  2E9T A;  3I96 A;  4OYM A;  4DV7 F;  4HTJ A;  1MWZ A;  2BE2 A;  2O5D A;  4GTE A;  2BAB A;  3H0G C;  5IT9 U;  5CH7 B;  1R9T C;  4USM A;  5E3R A;  4TN2 A;  1JLF B;  1P1L A;  3VAL A;  2V8H A;  2MLY A;  3JYT B;  2WON A;  4WWS A;  3MMA A;  4JI0 F;  5IP7 K;  4K4Z A;  2ATC B;  5C42 B;  2WOM A;  3NY0 A;  2AP6 A;  4QYZ K;  2CQP A;  4WFZ A;  3BKF A;  4F3Q A;  5HVG A;  2NQP A;  2LA4 A;  2MJU A;  2GW8 A;  3HCX A;  5E3P A;  4I1T A;  1NKB A;  2HGL A;  2QMX A;  3MUM P;  1RHU B;  1EAR A;  1RAD B;  2IYG A;  2A2C A;  4KC6 A;  1VH2 A;  1FK9 A;  1CVJ A;  3I4P A;  1DCO A;  1SUQ B;  3KHL A;  3WHI A;  2W4D A;  3RG6 A;  4FXV A;  4WJ3 M;  3C2P A;  2V2K A;  3MWB A;  1SMY A;  4J9Q A;  2YU9 K;  1GE9 A;  6FDR A;  2LMI A;  3MR2 A;  1IKY A;  5F8I A;  4LQY A;  2P6T A;  3BBC A;  3GTL A;  3M9O B;  3MM6 B;  1YTY A;  1VOM A;  4JI4 F;  4I2P B;  3DLG A;  2VV5 A;  2E5L F;  4Q8F A;  3TZW A;  2JA6 C;  2IRY A;  3A1Y G;  5DLF A;  3BP3 A;  1SJ3 P;  4JI3 F;  4P2X A;  4K2X A;  3DXJ A;  2B5J A;  1I3Q A;  2L08 A;  1SKU B;  4Y0F A;  2J7W A;  2W2O P;  4QWD A;  1NDK A;  1HNI A;  4GZY A;  3QT7 A;  2W1B A;  3M2V B;  2RH6 A;  1HQU A;  1WI8 A;  2D7S A;  2NYH A;  3MD3 A;  3AD8 C;  4O3Q A;  4DG1 A;  2WRM A;  1HPZ B;  4OZJ A;  1DFD A;  2DR7 A;  1SC4 B;  3S2D C;  3CPW R;  4XSX A;  1JX4 A;  4ZCM A;  2B9E A;  3AY0 A;  4V19 X;  1D9A A;  2B51 A;  4ZS6 A;  4MTP A;  2XY6 A;  3MEC B;  5AE1 A;  1R89 A;  1BLU A;  1M1H A;  1KLN A;  4ZH4 A;  1IKW B;  4Y6I A;  1U6F A;  4LFA F;  1TL7 B;  4ZOS A;  4ZVP B;  4QWA A;  1BGX T;  4ZVG A;  3B82 A;  4I4B A;  1YG0 A;  4B3R F;  5HP1 A;  5G0R A;  3LP0 B;  2ZVS A;  2D6F C;  2PN6 A;  2WCX A;  3K8V A;  1WNE A;  1CJT B;  3T1Y J;  1UVJ A;  3D6F B;  3HHN B;  4B9U A;  1ZET A;  1LWC A;  1N5T A;  1RAJ A;  4CO1 A;  4QW9 A;  2BJ8 A;  3T5H A;  1C2P A;  4YFU A;  3OXL A;  1HBN A;  1DD5 A;  4LF7 F;  4RX6 A;  1TVR B;  1FD8 A;  4BWJ A;  5B0B A;  3NGK A;  2LCW A;  4IG0 A;  2PI5 A;  2UUT A;  1O26 A;  3K89 A;  4HAC B;  6AT1 B;  3QBC A;  2ZUE A;  2YY3 A;  3P4U B;  1N6Q B;  2DHG A;  2ROP A;  3HOV C;  4RW6 B;  2ZH6 A;  3H4B A;  4Y7N C;  3RZA A;  1NK7 A;  2WVF A;  4DL4 A;  2F63 A;  5KG7 A;  2ZC3 A;  2RB7 A;  4LVO P;  1WWH A;  3R8Y A;  3HVA A;  2ABY A;  1LNQ A;  2KN4 A;  2OKQ A;  3WX4 A;  4DR2 J;  2CG8 A;  3UR3 C;  3DU5 A;  3AOD A;  3MDF A;  4YY3 J;  2J0Q D;  2X3G A;  1LFW A;  2FQT A;  1U1R A;  2YQ1 A;  3QMQ A;  5LL6 d;  5H9E J;  5IS2 A;  2LQ5 A;  2DJW A;  3R27 A;  5B0E A;  1GH8 A;  2DVI A;  4LR9 A;  4KY3 A;  4NAS A;  3HOU C;  4NLQ A;  1EB0 A;  4OJH A;  1JNR B;  3S1M K;  1MU2 B;  3SV4 A;  1IBL F;  1KQK A;  3GTY X;  3KDO A;  2XMJ A;  5ETQ A;  2ASD A;  2G2Z A;  2A1B A;  4DJB A;  1JKH A;  4DU8 A;  3UN3 A;  2VBZ A;  2XGQ A;  1T03 B;  4KFB A;  2BE5 A;  3S2D K;  2I5J B;  3FBB A;  2LU2 A;  4IFV A;  4NCG A;  1M0S A;  4DSJ A;  3QT5 A;  3OR1 B;  5C4X C;  2BQU A;  3KNG A;  4Y2A A;  3KLF B;  2VD3 A;  4NEY A;  4A8F A;  4P10 A;  4LBI A;  5TMF A;  2G2Y A;  5ETV A;  5F8H A;  4R8U B;  4B9V A;  3VGV A;  4XPE A;  3OVS A;  1X4C A;  3FRY A;  4CLZ A;  3L7O A;  4F4X A;  1FWP A;  3SQG B;  4KKO B;  3TAM B;  4EGL A;  1EQ0 A;  1RTH B;  1O29 A;  1N33 J;  1XR7 A;  2BAN B;  2G0C A;  2RQ4 A;  1X4F A;  3JAM Y;  1YBU A;  1WC4 A;  3CDA A;  3UCG A;  2RS8 A;  3MZI A;  3CD7 A;  3T5K A;  4DR6 F;  4NOI A;  1QUV A;  3GMG A;  2JDJ A;  4TYB A;  4BXX K;  3HKW A;  4ILD A;  2KKH A;  3BGL A;  2A6E A;  2PMZ L;  4MQ9 A;  2SXL A;  2DNL A;  2J9E A;  2Q3P A;  1JLA A;  1IBL J;  2A18 A;  3QNW B;  2F4F A;  1PYT A;  1X0P A;  2U2F A;  2NVT C;  3IAM 9;  5KFS A;  3W2W B;  2QA1 A;  4KYZ A;  5C5J A;  3S1Q C;  1D9F A;  1SV5 B;  4CT9 A;  3I4N K;  5AXM A;  4A8K A;  2KXH A;  2ZH4 A;  4XDD A;  1S1V A;  2CQG A;  3VV2 B;  1YRT A;  4WXO A;  3GIL A;  3GTO K;  4E2F B;  1TVR A;  3VAM A;  2MZ1 A;  4Z7Y A;  3O6Q A;  3TX0 A;  1RCX B;  3CD5 A;  5DG9 A;  4AND A;  1WHV A;  4FF3 A;  1KN6 A;  2OPS A;  4Q0B B;  6FD1 A;  4U67 Q;  2R8H A;  3M8Z A;  2MGZ A;  4DPW A;  3D2W A;  4F0H A;  3M30 A;  5IM0 B;  5GVQ A;  3J7Z T;  1V3S A;  4XK8 C;  4G1Q B;  3BP8 C;  4RUH A;  4ZP8 A;  3TUP A;  4Q43 A;  2JLF A;  1JLE B;  2GIQ A;  3F0N A;  5DDO C;  3KHR A;  1HNX F;  4A3E K;  3CE8 A;  3ETO A;  4LF5 F;  1RTI B;  1S1T A;  3GJT B;  1GXL A;  5F8M A;  5BYR A;  4RUC A;  1F6T A;  4YR0 A;  3TAR A;  2GIF A;  1Y4Z B;  4RW8 B;  2ZJP Q;  3FKI K;  3HKZ L;  2B0G A;  4DR5 F;  4RL1 A;  1MLA A;  1QSL A;  3DI6 A;  3ZTO A;  1MW7 A;  3FMB A;  4F7V A;  1NCL A;  2BM0 A;  1I50 A;  1GMV A;  3VZI A;  4OLO A;  1WOR A;  2GIR A;  1QM9 A;  2B4U A;  2J0W A;  2Z4P A;  3JST A;  3FZB A;  2HUR A;  1T03 A;  4NXM F;  2BUN A;  3W3S A;  1XZP B;  1LW2 A;  3CJ2 A;  2B8Q A;  1HNX J;  3FDS A;  4ED3 A;  1ITP A;  1RB0 A;  4M5D A;  3DOK A;  1UA1 A;  2ZBR A;  2KTQ A;  3L7P A;  2HEK A;  5KFH A;  1NK9 A;  2HKE A;  4KH1 B;  3QAU A;  4HT7 A;  4DV7 J;  2CQH A;  3R5C A;  1S79 A;  3GTQ K;  2PE8 A;  1VBX A;  3TTG A;  1U7L A;  2DH9 A;  2MSS A;  1I5O B;  1I6H C;  4P7V A;  1CPZ A;  4O3N A;  4I2Q A;  1D8Y A;  2JRS A;  4AL7 A;  4ID5 A;  1OQ6 A;  1HI1 A;  3UE2 A;  3AJD A;  1RHJ B;  1WC5 A;  3P5T L;  4CM0 A;  2R2R A;  2VQE F;  4PG7 A;  1N0U A;  3TZZ A;  4LK0 A;  1FFW B;  2XLK A;  1AYE A;  4EBE A;  3RB4 A;  1Q0N A;  2GQ2 A;  2JL9 A;  4I6Y A;  5F0W A;  1VLY A;  4NXN J;  5IWA J;  4YR3 A;  1TUV A;  3IR6 B;  3MMJ A;  2HGM A;  2QE5 A;  2JEI A;  4ZP7 A;  1NXI A;  1A9N B;  4G7Z A;  3UR0 A;  3OJU A;  1UPP A;  4QR2 A;  1TKX B;  2X1A A;  2VBY A;  2CAD A;  4RZR A;  2XCQ A;  2GML A;  3OTO J;  2H51 B;  1LWF B;  4NLD A;  3G6Y A;  1KS2 A;  3DXS X;  3EDQ B;  3V6H A;  1I6J A;  4GC7 A;  2DHH A;  2POK A;  2LQ8 A;  5FLM C;  1S12 A;  3W8G A;  2EC2 A;  1JK9 B;  3RZD K;  4Q5S A;  4JP8 A;  5FDL B;  4OHZ A;  2Z2Y B;  1IM4 A;  4FS2 A;  3KUH A;  1HYS B;  1KQG B;  1TFW A;  2JA7 K;  1N33 F;  5T41 A;  2YNH A;  1BJT A;  3HOZ K;  3GTL C;  3S01 A;  2NPI A;  3NWR A;  5JVG Q;  1UVM A;  2ZD1 A;  2NS1 B;  5KFL A;  1RXO B;  2G0J A;  4Q44 A;  4AL5 A;  1X4D A;  4ZCL A;  5I3Q A;  1XWL A;  4K4U A;  1VFJ A;  1HD0 A;  4TLR A;  2CAJ A;  1Y10 A;  1Y3J A;  2JA6 K;  2DXF A;  3DLE B;  2XMT A;  3SXL A;  1VHI A;  3GPA A;  5DQI A;  3GIK A;  3U1N A;  3TAP A;  2XCO A;  2F5G A;  5D0R A;  3CDU A;  5KFU A;  4K59 A;  1JXV A;  2DXE A;  2N82 B;  4MMO A;  1KWM A;  3KK3 B;  5GAD I;  1ZTW A;  1X9M A;  2EKY A;  2QEX S;  1NB2 A;  3CT9 A;  3EXY A;  2EI5 A;  4BY1 K;  1FVQ A;  3KMS A;  4FDF A;  1T9W A;  3VAJ A;  1X4G A;  4DV0 F;  2B43 A;  3D3C J;  2QSW A;  3CCU S;  1WI6 A;  4UZC A;  2VUG A;  1NPR A;  2XS5 A;  2ZKT A;  3B4M A;  5EGE A;  4NYO A;  3GTK K;  4B17 A;  2WVB A;  3I56 S;  3FMW A;  2P9E A;  1L3S A;  1DBD A;  2DTJ A;  4JI2 F;  4I67 A;  1FXR A;  5KFB A;  2QMW A;  1S9E A;  4X4N A;  1M1K T;  1SVD A;  5DET A;  3E3X A;  1RT2 A;  4IYQ A;  2ZH5 A;  2NVX C;  3HZG A;  2V0N A;  4EBD A;  2COL A;  2VA2 A;  2R4F A;  3MEG A;  2C2E A;  3CQZ C;  4UTG A;  1VJW A;  1Q53 A;  1LW2 B;  4A8S A;  2MY8 A;  1O0P A;  4N47 A;  2BQR A;  2W9A A;  3RB3 A;  3M1V A;  4X64 F;  5FLX Y;  2J0X A;  4IOC Q;  2D1C A;  3WQP A;  3UCU P;  4LFA J;  4UT4 A;  2R93 C;  3OTO F;  4NLV A;  3ILI A;  3N0V A;  5IP9 K;  1TV6 A;  4UY8 T;  4IDK A;  1C1B A;  3M2U B;  2AD9 A;  4I2Q B;  4DFM A;  3FEX B;  4HTI A;  4I7F A;  4DQQ A;  2YNF A;  1UTA A;  1NSP A;  4DV6 J;  1B7F A;  2YWW A;  3NBP A;  1F3F A;  4ECQ A;  4PG8 A;  5M5Y K;  1S10 A;  2EFG A;  2XI2 A;  4HT5 A;  4X65 F;  5K9F A;  4Y7N K;  3WZ0 A;  2FHO B;  2RE1 A;  2VH7 A;  2AJ1 A;  3J7Y U;  1RWW B;  2A6H A;  2PHC B;  2E2J K;  3C6U A;  2XB2 D;  3AFG A;  1KC8 T;  2QSF A;  4Q5V A;  1HW8 A;  1Y5N B;  2PI4 A;  3H0P A;  2HS4 A;  2KHD A;  1WHX A;  3IM8 A;  5KFT A;  3LPX A;  2AHO B;  2XYH B;  4ZCK A;  1RAC B;  3CF5 Q;  3LP2 A;  4C2M K;  2Y3P A;  4RUA A;  2ZEJ A;  2OSR A;  1RKJ A;  1T9Y A;  3CIM A;  1IW7 A;  3MED B;  3FOE A;  3UNY A;  2VQF J;  4OI0 A;  2X51 A;  3EIC A;  2EEY A;  2OPR A;  5DM6 Q;  1YK9 A;  4RNO A;  3LP1 B;  3EQL A;  4J9N A;  4BS2 A;  2R3V A;  3KLE A;  1DQ9 A;  3AD7 C;  4DV4 J;  3H0G A;  4CM2 A;  2CDR B;  2XQC A;  3H4D A;  2D69 A;  2E5J A;  3Q8Q B;  4ED8 A;  4CDI A;  2YNI B;  2QA4 S;  4LLG A;  4JYA J;  3QWU A;  3BEG B;  1X4E A;  1SC1 B;  1W7W A;  3C16 A;  5ETM A;  5HVH A;  3FHZ A;  3NS7 B;  3S7R A;  1H3D A;  1IKX A;  1IBC B;  2AJ2 A;  3KOA A;  1HA1 A;  3P45 B;  2GJF A;  3RBD A;  3FQL A;  1I94 J;  1VRT B;  4WZQ A;  4HR2 A;  1C0T A;  4USJ C;  2OUG A;  1H2V Z;  1C0U B;  4KV8 A;  3I0R A;  3BN4 A;  4X4V A;  2J9D E;  4A93 K;  2W2P P;  4Y00 A;  2KVQ E;  4ZMM A;  5D15 A;  3R5G A;  4OIQ A;  1PBU A;  1VRU B;  1PJ5 A;  3D5M A;  1RAG B;  5I42 A;  2M52 A;  3S15 K;  3CUN A;  4KM9 A;  3ZZY A;  2BM1 A;  2YX1 A;  4F0K A;  3PNI A;  5THW A;  1UEV A;  1NJX A;  2JA5 A;  1SJ1 A;  2H48 B;  5JXS A;  4WZM A;  3D66 A;  3U7J A;  1X8D A;  2Z0G A;  2QMU B;  4PPZ A;  4JUZ A;  4YDX A;  3PO2 K;  3IRX B;  3MM5 A;  4O4G A;  3BPS P;  4RBT A;  4UQT A;  1V5V A;  3TUZ C;  2KM8 B;  1BDF A;  2Q1L A;  2JA5 C;  1KOO A;  3SCJ E;  1YJ9 S;  3ILJ A;  5F9L A;  3DNC A;  3BSO A;  1RTZ A;  3FQK A;  2HNY B;  3HOW K;  3NLC A;  3OJS A;  3PV8 A;  2F65 A;  1TWH K;  5K14 B;  2CYY A;  3ZTR A;  1KBR A;  3DMJ B;  4DL2 A;  3Q86 A;  3SQG A;  5K8N A;  4IDK B;  2HHH J;  2R2U A;  3VTI A;  2Y0S L;  1KEK A;  4I7F B;  1VC0 A;  4BDP A;  2EKN A;  2MHE A;  2EK6 A;  4CO3 A;  2IRU A;  1RGV A;  2YWK A;  3F41 A;  3NGS A;  3R7S B;  4LF9 J;  1D9D A;  1WHY A;  2E7W A;  1DTT A;  2WON B;  2AJF E;  1F3V A;  3OBI A;  4ZPC A;  3LAM A;  2ZWP A;  3VVU A;  2RQC A;  3UNG C;  2P9C A;  1CS4 B;  2UVR A;  3N4W A;  4PUO B;  3IBC B;  4A3G C;  3D3B J;  3D4J A;  3K5M A;  1X5S A;  5B09 A;  4LF9 F;  1G1X A;  4F4Z A;  4A3E C;  1SV5 A;  2KT3 A;  2MQ8 A;  2WBR A;  2GSU A;  3OFE A;  4IOB A;  3KLI B;  1JLB B;  4YB6 A;  2CQ2 A;  3MPD A;  2DHX A;  1YJR A;  1BE4 A;  4OJ3 A;  1TWA A;  4J3N A;  1TEL A;  4WPA A;  5C3E K;  3R1L A;  5CQG A;  5J2N B;  3MFI A;  3E8O A;  4CLK A;  2OPS B;  4IH6 A;  1JLG A;  3D0H E;  4DSL A;  3K59 A;  3UCZ P;  3GCW P;  2ILZ A;  4KE5 A;  3Q8P B;  3T9N A;  3OFF A;  4L73 A;  3B6B A;  2MYF A;  1WCM C;  3MFH A;  4N56 A;  4CO4 A;  2HPU A;  2V67 A;  3CCS S;  3M6V A;  3BM7 A;  2VQF F;  4R8U A;  3HD1 A;  3BR9 A;  3FGV A;  2BQ3 A;  1WSV A;  4QOT A;  3GJS B;  3GFH A;  2V6A A;  3I9V 9;  4KR0 B;  3VQS A;  3GTG A;  3K5N A;  1HPZ A;  3UN5 A;  1VC6 A;  2CA9 A;  3OTE A;  3POT A;  3R5B A;  3ZXW A;  4C48 A;  2VFT A;  1RTH A;  4NI2 A;  2AW0 A;  4LRE A;  2F4V F;  5T7L A;  3EVO A;  1D8Z A;  3OSN A;  3H5X A;  1SC3 B;  3QSI A;  2WAQ L;  3BGO P;  5D6G A;  3LO3 A;  3QGI A;  1TWH C;  4OX7 A;  3OL9 A;  2M88 A;  4DLE A;  1HBM A;  3GTG C;  4URG A;  3AH5 A;  5L1J A;  4LJM A;  4ZHR A;  1CJV A;  2NXU A;  4KSE B;  3R97 A;  1NZ8 A;  2GMH A;  4IH5 A;  4KMD A;  2OO4 A;  2ASJ A;  1KP6 A;  3BKT A;  4PG5 A;  1SH3 A;  4W90 B;  1QVF R;  3DDN A;  4NLT A;  4N8O A;  4M94 A;  1S0O A;  4PQU B;  2JA6 A;  3M4X A;  4IH7 A;  5FLX U;  2C2R A;  4PG4 A;  2B9W A;  2IM0 A;  4UUW A;  2GHV C;  1FKP B;  1WEX A;  2FJE B;  1HHQ A;  2AT1 B;  3C15 A;  3DOM A;  3JTP A;  1U6Z A;  1WD6 A;  2BKN A;  3VWS A;  3E2E A;  4DL5 A;  1BS2 A;  5ETT A;  2GSO A;  1X0F A;  2H4Y B;  3BGR A;  3HOX K;  4NLR A;  4YS2 A;  2M3D A;  3T41 A;  1JQW A;  4ED6 A;  3M30 B;  3TOQ A;  5HVF A;  3MR7 A;  1NEE A;  2Y1L B;  2Z2Z A;  5C24 B;  5A6W A;  4RO0 A;  4WK3 A;  5BYQ A;  1XPP A;  3SCK E;  1QLN A;  5KFY A;  2IPO B;  4FF1 A;  2HK2 A;  1YJN S;  5HJY A;  1VQ4 S;  1QAJ A;  1GMW A;  1NU4 A;  4C9D A;  1S1T B;  5CXT A;  1JLQ B;  1MN7 A;  3B54 A;  1S0V A;  1WCM K;  4YHH J;  3HM9 A;  3CO0 P;  1UPM B;  2CZ9 A;  4NA3 A;  1N48 A;  4RW8 A;  2HZA A;  3JXO A;  3UQS A;  4YEA A;  2J6S A;  1FNO A;  2DNP A;  4YR2 A;  4J9K A;  3ZZU A;  3F44 A;  2CJB A;  4BLB A;  4Y2K A;  2GVZ A;  3D67 A;  3GTM K;  1ZQ1 C;  4DPY A;  2G1H A;  4WJ4 A;  1L0W A;  2PEB A;  3K0J A;  4YQW A;  4RUB A;  3M9N B;  3HHK A;  1PAU B;  1CUL B;  2AGP A;  3HF5 A;  3KJN B;  3I4H X;  4KM8 A;  2R8K A;  5K8M A;  5ETR A;  3BBB A;  1NBE B;  4J9R A;  2CPY A;  3CQZ A;  2HS3 A;  4L76 A;  1T9U A;  2RAQ A;  4NYP A;  2JLG A;  1WSR A;  2MKK A;  3BV8 A;  2P8T A;  2VG5 A;  1S1U A;  1ZM2 A;  1EQM A;  5CAA A;  5LSO A;  4EUV A;  4WTY A;  5D4P A;  2UVU A;  3OD2 A;  4OZ3 A;  2WTF A;  3ULH A;  1NB7 A;  2MLX A;  2JC0 A;  2UZA A;  3MOZ A;  2X1F A;  2B63 A;  2YKQ A;  4I6A A;  4PAB A;  2MZS A;  2ZIT A;  4B02 A;  3A4T A;  2KFY A;  3R2C J;  4KMU A;  1PAE X;  3MEC A;  2V2Z A;  2C3M A;  2OPQ B;  2QC3 A;  2HMI A;  1P27 B;  3M3Y K;  4LFB J;  2GJI A;  1TL4 A;  3LTO A;  4GTB A;  2B9Y A;  2NVY C;  8AT1 B;  1VGY A;  2E2I K;  2IBO A;  3OUY A;  3MM7 A;  3DM2 B;  4Q45 A;  2QLB B;  5MLC V;  5E2Q A;  1XMB A;  4NLS A;  2B63 C;  4PZV A;  3GB0 A;  2AGQ A;  1WEZ A;  2D3O R;  4C8M A;  4H4M A;  4HI2 A;  1NKE A;  5CYM B;  3BDP A;  3V81 A;  1RAO A;  3MM9 A;  1EP4 B;  1GAO A;  4OX9 J;  1M90 T;  3P3D A;  3EUN A;  2WVC A;  1JVI A;  1MSW D;  2ZH3 A;  4DN9 A;  2XBP A;  1F0X A;  5E0O A;  1QY7 A;  1CJV B;  2ATL A;  4DDF A;  3H42 A;  5K8P A;  4G0U A;  4FF4 A;  1KHW A;  2ADC A;  2BJ1 A;  2EXU A;  3KJF B;  3C6T B;  4CYU A;  4XPC A;  3S15 C;  3QT8 A;  3PR5 B;  5HLF B;  4GKJ J;  3W63 A;  5HL7 Q;  4ILM A;  4L75 A;  4N7T A;  3L4J A;  4TNO A;  3HOY C;  4A46 A;  1JJH A;  1C4A A;  3T6B A;  5HMW A;  2K8G A;  5HJX A;  5IV4 A;  4LF1 A;  2PFF B;  3CTR A;  1BY9 A;  3GJR B;  1I6H K;  1EZZ B;  3IFE A;  2ACM A;  1TTH B;  3K5P A;  3RU0 A;  4RNN A;  4ICL B;  3PYD A;  1SKW A;  2N3L A;  4DUY J;  4X62 J;  2CJK A;  3LAP A;  4RR5 A;  5CHP A;  3Q22 A;  4K5S A;  1KTQ A;  3VA7 A;  2W9B A;  1YHQ S;  4EI2 A;  3NAI A;  2WSF C;  3UD5 A;  1LW0 B;  3VF0 B;  4H4O B;  1LWX A;  2AGO A;  4OIR A;  1U26 A;  1P8G A;  3JAM U;  1Q8K A;  2CFX A;  1XXB A;  1VQK S;  4U7U D;  4HHU A;  1T7P A;  3GYX B;  3ZNU A;  4OHY A;  2DYA A;  4P2F A;  3UDC A;  5U47 A;  4DV5 F;  2ROE A;  2XMW A;  2FVQ A;  4Y3C A;  4KIA A;  3TUI C;  2UUA J;  2EFO A;  4K5R A;  1ROF A;  1UW9 A;  3S6E A;  1YJ7 A;  3IXQ A;  5K20 B;  4MEX A;  1ZZN A;  3K17 A;  1NZA A;  2J5A A;  3Q0A A;  4IUF A;  1R0C B;  2MGZ B;  2DGT A;  3CWJ A;  2AEM A;  3HSJ A;  3BB5 A;  4LQ9 A;  4I64 A;  1KVK A;  4DL3 A;  2OD6 A;  4G0W A;  2GGP B;  1TMJ A;  3NP5 A;  2L9W A;  3DLK B;  5HMY A;  5JVH Q;  3OTB A;  3V4M A;  4MT1 A;  4MIB A;  2DD8 S;  4K0K F;  4ELT A;  1RT3 B;  5F8G A;  1VQ5 S;  2RF2 A;  2FDN A;  1WC0 A;  2ZH2 A;  3FBF A;  2N4C A;  3QO9 B;  2IVF B;  3C14 B;  5LOQ A;  5IYC C;  2CJX B;  4LR7 A;  1FRL A;  4P6Q A;  2RUS A;  2E9R X;  2BXJ A;  2OFG X;  2AQ4 A;  4ECV A;  1WOS A;  4U9R A;  3Q8S B;  2R2T A;  3MMC A;  2NVX A;  4HVZ A;  3PRV A;  1N54 B;  2XLJ A;  3RB6 A;  1OS5 A;  2IM1 A;  3V6D B;  3GIM A;  3VZH A;  1FE4 A;  3DDI A;  5D3G B;  5GAE U;  4ILR A;  4NRT A;  2CFA B;  2UXD F;  5KG1 A;  2R93 K;  2V5H G;  3GII A;  2QIF A;  2R7O A;  1VK3 A;  2IVM A;  2VG7 B;  1V5I B;  1N5Q A;  3N79 A;  3OVA A;  1LV5 A;  2R93 A;  3EGZ A;  4C3H K;  1UFW A;  4BBY A;  1TWA C;  2W7A A;  1R9T K;  1S1X A;  2JOQ A;  2XMM A;  1WEY A;  3MOJ B;  1QVG R;  1RUS A;  1IWG A;  2RDD A;  2AF6 A;  4LF8 F;  3EVW A;  1N52 B;  5K14 A;  3KFW X;  5EWF A;  4O0N A;  1ZM9 A;  3N6M A;  4ECU A;  3PYF A;  4ZVE A;  1NND A;  1UVI A;  3TR5 A;  3HT3 A;  3E01 A;  2VU5 A;  4I68 A;  4A3M C;  4ZVF A;  2HFZ A;  1VQN S;  1Q8B A;  2DHA A;  4OI6 A;  1L3V A;  4YFX A;  3QAT A;  2V69 A;  4DG1 B;  5LXY A;  3OLB A;  4A3F C;  1G51 A;  2QX0 A;  3M8S A;  3PO4 A;  5ETK A;  3PX0 A;  1RBL A;  3HVR A;  1OPZ A;  4WU2 A;  3SSR A;  4RMF A;  2DB1 A;  2ZUG A;  1HBO A;  1YBA A;  2YTC A;  2YWF A;  2W01 A;  1RAA B;  4QJV A;  2YKM A;  4CO0 A;  1NSQ A;  4NCG B;  2WZ1 A;  2CPI A;  2XO6 A;  4C45 A;  3OR2 B;  1K47 A;  2V4Q A;  4OQJ A;  2DIU A;  1OSD A;  3ZTS A;  4OYX A;  2RRB A;  2QJ3 A;  3GSD A;  4ED1 A;  3BDE A;  2I1R A;  3PJ9 A;  5CYJ A;  1VQ9 S;  4DHV A;  4AXI A;  1D09 B;  1V3R A;  3TX8 A;  4QIW D;  4B3M J;  3BO3 A;  4C8Y A;  3K5O A;  2B7C B;  2KXF A;  2HQF A;  2PII A;  3P49 B;  4CQ1 A;  4KB7 A;  1RJJ A;  4LOW A;  4A3C C;  3AH6 A;  3OQ2 A;  1C1B B;  4PEO A;  2E5L J;  2OEL A;  1SFO A;  2GMJ A;  1KSP A;  1S9E B;  1E6Y B;  4ZA1 A;  3W60 A;  1RT1 A;  5LMU F;  3AJ2 A;  3LUY A;  1IKV B;  2C2D A;  3JS9 A;  3QO9 A;  3MEE B;  4X4U A;  3IP0 A;  4DV3 F;  2QT7 A;  2G0I A;  3ZFV A;  4LIR A;  1DTT B;  4ZHR B;  3GTL K;  1TK0 A;  1RSC A;  2KZZ A;  4JI6 J;  2KYX A;  1VR6 A;  1S6Q A;  3P5B P;  4KGM A;  1YGY A;  4BY7 K;  4QIE A;  5ETP A;  2AX1 A;  1X4B A;  3KLG B;  3OFG A;  2HHU A;  2VHG A;  4B3S J;  3PEJ A;  2P5M A;  4ZVO B;  1TK8 A;  2FIU A;  3BN7 A;  1H2T Z;  4G7H A;  3BGU A;  2GO8 A;  2GFF A;  3HP6 A;  4FZB A;  1N8R T;  4O3P A;  4CLS A;  3CC7 S;  2E9Z A;  4DUT A;  1NLK L;  5FJ4 A;  3N28 A;  2NR0 A;  2H5J B;  3WC0 A;  3PO2 C;  1K9M T;  3DCA A;  4O3O A;  2FJA B;  4F04 B;  4KDD A;  2KG0 A;  5L8R C;  1U1M A;  2VZ9 A;  2GQQ A;  3GIJ A;  4B3O A;  1SQG A;  1E6V B;  5I3P A;  4QCL A;  2JA5 K;  2ZKU A;  4LF6 J;  2V63 A;  2VJV A;  2FYX A;  4ZVS B;  2UXD J;  4BBR C;  1TWG A;  2UVW A;  4RU9 A;  2RRA A;  1EHW A;  1G6B A;  1HR0 F;  2R8J A;  4MH8 A;  3EWG A;  3KG1 A;  3TI0 A;  1UJ4 A;  3CNQ P;  4FKY A;  5D4O A;  4RPF A;  4YHH F;  2ZNZ A;  3QQC D;  3THV A;  1XNR F;  4KQZ A;  3EZO A;  1M5K C;  1KR4 A;  2QYG A;  1REV A;  4KMA A;  1VQ7 S;  1O25 A;  2GA7 A;  5KFF A;  4NL5 A;  2FJX A;  3H5U A;  3N01 A;  3M8P B;  1RWV B;  2UU9 J;  2HBQ B;  1L5U A;  2H9Z A;  4IG3 A;  3SSQ A;  3J7A N;  4DFK A;  1ZBT A;  5DQH A;  1FKO B;  2KRB A;  2Y8W A;  1CUL A;  5T7L B;  1JLC A;  3RZO C;  4MKA A;  1Y1V A;  1GNK A;  4OMF G;  1UWA A;  2GVZ B;  3DOK B;  4WFX A;  1IR0 A;  3DU6 A;  3GTP K;  5J2M A;  1DJ0 A;  2XYG B;  4XDC A;  2DNN A;  1XR5 A;  2K1R A;  1G7C B;  4LFC F;  2QV6 A;  1N5V A;  3R7B B;  1GMU A;  4NLW A;  3W2W A;  1W25 A;  3DYA A;  3AAW B;  4ID5 B;  5EGY A;  3S1T A;  3SCL E;  1W2B R;  1WAC A;  1BWV A;  3CCL S;  4DLG A;  4C8K A;  5CYQ A;  4F50 A;  4PWD A;  4C8O A;  4DQR A;  2V2V A;  4BY7 C;  4DR4 J;  3CCW A;  3DDK A;  3LGN A;  3KK2 A;  4OL8 A;  5HSP A;  2NVX K;  3HVT B;  2ROG A;  4OV1 A;  2ZUA A;  4GVB A;  4ZN1 A;  4DR4 F;  4CH0 S;  1NM2 A;  3QIP A;  1HWU A;  1RDR A;  8ATC B;  4A4J A;  1DRZ A;  3HK2 A;  1B4A A;  2OPP A;  1MML A;  1YVF A;  3QJJ A;  4ZLL A;  1HQE B;  1U0H A;  1P6T A;  3E51 A;  1XER A;  1WHW A;  4EEY A;  2C3U A;  1SUQ A;  2R7V A;  2C2K B;  2CJQ A;  3W2V B;  5KFX A;  3JQJ A;  3HFV A;  1RAF B;  4JI7 J;  2R92 K;  3D7S B;  5I3U A;  1UFK A;  2HNZ A;  1XMO F;  3HX9 A;  2WB1 L;  1OYE A;  4DN0 A;  2Z8Q A;  4J9P A;  3M8Q A;  2DO4 A;  4DR7 J;  2YNH B;  1HD1 A;  2OEM A;  2GO9 A;  3IM9 A;  4A3D K;  1CQN A;  1FNM A;  1NJI T;  2H54 B;  1FWK A;  2G13 A;  2RDI A;  1KD1 T;  3FKI C;  2JC1 A;  4F25 A;  5KFG A;  1QTN B;  2VJU A;  1HAR A;  1KVI A;  3VAF A;  4LF4 J;  4U96 A;  3IPJ A;  3KJV B;  3DKD A;  4JI1 J;  3G6X A;  1J27 A;  3M6U A;  3CMQ A;  3NGT A;  1WIH A;  3SEO A;  2V4R A;  1KLM B;  2OSQ A;  2DT9 A;  2PDA A;  3KXD A;  1H0H B;  5DRK A;  1J5E F;  3QJL A;  4TQR A;  2DNY A;  4ZP6 A;  3R5A A;  2FJV A;  5IC4 B;  1XR6 A;  3MR5 A;  1VI7 A;  4OHX A;  4NZ6 A;  2WVE A;  4OJG A;  1ZA1 B;  3UI3 A;  2PMW A;  4LSL A;  4NLU A;  2FD2 A;  2C2Z B;  4XCH A;  3BR8 A;  2F9J A;  4JV2 A;  3QZ8 A;  2HHS A;  3ERE D;  2AEJ A;  1O51 A;  3OPK A;  1VBK A;  4F4K A;  2NUH A;  2MDA A;  4GO5 X;  4K8R A;  4B3S F;  2HBY B;  4WFA Q;  3EZ5 A;  5L9N A;  4DQI A;  3PEH A;  3FBE A;  4O2D A;  3HPO A;  2OIH A;  2YH0 A;  2R7X A;  4DR5 J;  2V8P A;  1RT5 B;  4KBI A;  2PEH A;  2FVS A;  1LWF A;  2J9D A;  4J37 A;  2PMH A;  2RGR A;  4OYZ A;  4O4R A;  2NXE A;  4P73 A;  3VAK A;  2DNH A;  3HOU K;  5DDR C;  1V6H A;  4TY9 A;  1JB0 C;  2R2S A;  4KAI A;  1J2V A;  2OGU A;  5A8W A;  2XHC A;  2VPZ B;  3EVM A;  3PM9 A;  1RT3 A;  4BLG A;  3Q24 A;  3ZC4 A;  5CZV A;  8RUC A;  5AXN A;  4I69 A;  4CWB A;  3RTV A;  5D0H A;  2E2H K;  4UY8 5;  3GV8 B;  3FCH A;  2FQQ B;  3VCD A;  4C97 A;  3C6U B;  2QA2 A;  2QTW A;  1HW9 A;  1F5B A;  1HBM B;  2D74 B;  2Y1R I;  4X6A K;  1ZAW A;  1VDH A;  1SQE A;  1TL7 A;  4KHP J;  4IRD A;  2LDY A;  4M1K A;  3BO4 A;  2MZJ A;  3HXM A;  4IRK A;  1EET B;  4X66 J;  3D54 A;  5J2P A;  4JI3 J;  3S1R K;  5G0R B;  3LPE A;  5CAB A;  4DF8 A;  4AH6 A;  2I2Y A;  3FKB A;  3EGN A;  1JXL A;  2VG6 B;  4OHV A;  2AMC B;  1AZS B;  1J5O A;  1U09 A;  4XO0 A;  2DY9 A;  1X31 C;  3N0C A;  2E66 A;  2UUB F;  3MHY A;  1RYR A;  1IR1 A;  4QWB A;  4K4Y A;  1EJ7 L;  2UUW A;  4KGX B;  2CPX A;  1URR A;  2CIM A;  2A68 A;  1IVZ A;  1T11 A;  3QSY B;  3GP9 A;  1T3N A;  4CLP A;  1TL3 B;  3DOM B;  4NX9 A;  3C19 A;  1TL1 A;  1OSC A;  4LBP A;  1HNW F;  2IJF A;  4RW4 B;  3BBF A;  2CWK A;  3LF0 A;  3DGP A;  1YNJ A;  3G4C A;  4DS5 A;  2V94 A;  1V3Z A;  2HHH F;  2DEJ A;  1R27 B;  2ZC4 A;  1NAQ A;  1B4B A;  3HHD A;  1N88 A;  3OFH A;  1VMB A;  1QSS A;  1KVJ A;  2BJ9 A;  4PXE A;  1XXC A;  3T1H F;  5KT7 A;  3DRX A;  2UV8 G;  5L9X A;  1QDU B;  1P9Q C;  4YY3 F;  4B3R J;  2O67 A;  3QX3 A;  4FN5 A;  3NGR A;  1UA0 A;  4O23 A;  3TVZ A;  3VGT A;  2P8I A;  3QPI A;  5EUH A;  4M5G A;  4CO2 A;  3PW4 A;  3RRG A;  1Y5I B;  1PKU A;  2XMK A;  3CMA S;  5HBM B;  3W9I A;  3POT B;  1YIT S;  1HWJ A;  4DZ6 A;  4K50 A;  5H9E K;  3MCN A;  4BC9 A;  4C4W A;  2DBB A;  1KNZ A;  4PWU A;  3CJK B;  2VA3 A;  3UDV A;  2B6A A;  1UCN A;  2CVE A;  2DNM A;  4NA1 A;  3L7U A;  4NRU A;  1N34 F;  4L3K A;  4J91 A;  1RTD A;  2HG4 A;  5E5N A;  1TP7 A;  1XC9 A;  1R0A A;  1DHM A;  4DPX A;  3GEH A;  4KFB B;  2YKM B;  5K5M A;  3IWL A;  5DG7 A;  1K1S A;  4TQS A;  2DNO A;  4A3L C;  4USU A;  2XWX A;  4IFV B;  1EAY C;  1HWK A;  1S6O A;  1LOU A;  5HQL A;  4GO7 X;  1YX2 A;  2HIY A;  4BHQ A;  2GVD A;  1VYA A;  1ULR A;  4NYZ A;  5IP9 C;  1GXU A;  2J7U A;  2V8G A;  2GC8 A;  3CJQ A;  4CH1 A;  2Z2L A;  1TKZ A;  4NZ7 A;  5KFQ A;  3UW1 A;  2BRL A;  4DV2 J;  4L3N A;  3MUR P;  3C15 B;  2C3P A;  1CJK B;  1H72 C;  5BR8 J;  2EFN A;  3J81 j;  4EMD A;  1HHS A;  2BVZ A;  2KT5 A;  5IYC K;  2XS7 A;  5GAH I;  2QA4 G;  4ED4 A;  3MR3 A;  3IC1 A;  3MM7 B;  1NDL A;  4YME A;  4QBU A;  4YP3 A;  1PGZ A;  5B0D A;  3PKM A;  1XBW A;  2QGF B;  5D0E A;  3JTO A;  2NVT K;  5F41 A;  4QPX A;  4OIX A;  3KK1 B;  1HNW J;  5EGH A;  5BJR A;  3EPI A;  3V81 B;  3M8R A;  1LKZ A;  5M3M K;  1Y7P A;  1RI7 A;  2BX6 A;  2FZG B;  4WU3 A;  3HFK A;  1B4S A;  5LMN F;  5IV3 A;  3BH6 B;  4G7O A;  4OX8 A;  3H2U B;  2VAS A;  4C7Q A;  1IQ0 A;  2VFR A;  1UZD A;  1C0U A;  2HQI A;  1LWE A;  5TJ3 A;  3G82 B;  3UDE A;  3S1N C;  3KLH A;  3MAA B;  1A7G E;  4LVN P;  4C8Z A;  1JOE A;  2OHD A;  4TKT A;  1FRI A;  1RAB B;  3AD9 C;  2OH2 A;  3K57 A;  1N32 J;  5J2N A;  1HFE L;  3SSS A;  5IYB K;  1JLG B;  4A8Q A;  3V4I A;  3MXH P;  3BQ2 A;  1A0O B;  4WKR A;  1IKY B;  4H4K A;  1S6U A;  2YKN A;  3AQO A;  3IO1 A;  1PYO B;  3U1M A;  2XMV A;  3TA0 A;  4HDG A;  4YB1 P;  4R25 A;  1S1U B;  2O01 C;  4B3O B;  5KG0 A;  1RAH B;  4A3K C;  1F9F A;  3NS5 A;  3AOB A;  2WAQ D;  5C25 B;  1HNV A;  2M5Y A;  2W9B B;  2AYB A;  4WBF A;  2NSB A;  1S99 A;  3V6K A;  3ZZP A;  2XGP A;  2EVZ A;  2E7V A;  2HFO A;  3G71 S;  3EMT A;  2KRR A;  3H3V L;  2A0F B;  2MQL A;  3DM2 A;  2QZ8 A;  1KFD A;  4LBH A;  1RHK B;  1TFY A;  2XG8 A;  3WOD A;  3TP2 A;  2Y1I A;  3QID A;  3S17 K;  4JV1 A;  2IDE A;  1FJG F;  1GXT A;  1XK8 A;  4TY8 A;  2DR9 A;  1LK7 A;  4ZPV R;  3O1L A;  5E3Q A;  3LAJ A;  1AFJ A;  3C14 A;  1SI9 A;  1WQH A;  3S0X A;  3QRP A;  1B0T A;  1L3K A;  3C66 A;  5F3T A;  1IKW A;  3B78 A;  5A8R A;  1OY6 A;  1K83 A;  1XNQ J;  1NK4 A;  1VC5 A;  2VOO A;  2EBB A;  4BBS K;  4DX8 H;  2E44 A;  1AB4 A;  3LP0 A;  2GGP A;  4CLU A;  3N6N A;  2XM3 A;  4A8O A;  5HAO A;  3KDN A;  3NGD A;  5HI7 A;  5IOS A;  1HBU B;  1OIA A;  1LWC B;  1OJ4 A;  3W9H A;  2HVE A;  2RT3 A;  3CVK A;  2UUC F;  1JLB A;  3W65 A;  2AU0 A;  5GMK a;  5CCM A;  3IGV A;  3V2U C;  2YXL A;  3LQV A;  1QJH A;  1TL5 A;  4FF2 A;  1SL2 A;  4LUB A;  2RF2 B;  2X7I A;  1VJE A;  1FHT A;  4NWB A;  3TYT A;  4C98 A;  3PR4 A;  5CYQ B;  5HAN A;  5DDP C;  2G4B A;  2GX8 A;  3M32 A;  1GT8 A;  2VPX B;  3DRR A;  4CLT A;  4X4T A;  4LF4 F;  3H98 A;  3S1Q K;  3KK2 B;  1UP1 A;  3S2H K;  5CHC B;  2XHW A;  2J8A A;  5HQM A;  3RW6 A;  2E7X A;  1RKI A;  3R5D A;  3MGJ A;  5KFD A;  4M5K A;  3CQZ K;  3R6L B;  3QIP B;  2IC3 B;  1KTV A;  2XTJ P;  1VQ8 S;  4J9U E;  2WW8 A;  5IP7 C;  1X4H A;  2B4O A;  4OZ5 A;  1U4B A;  2YX4 A;  4MKB A;  3HOZ C;  4J9V A;  1TWC K;  2BMB A;  2RU9 A;  3V4G A;  4A3B K;  4ERD A;  4ZVU B;  1UVL A;  1QD1 A;  2OEJ A;  3S14 C;  2DIT A;  2M0G B;  3ENW A;  2GHW A;  4WYW A;  4PR6 A;  1J5E J;  4LT6 A;  4KB2 A;  1RQ0 A;  1T9X A;  3OTC A;  1IBM F;  1XJW B;  2LEP A;  4KPC A;  3JQK A;  1I3O B;  1I3Q K;  2IMW P;  1HYS A;  2HSE B;  4DSE A;  5M5X K;  4HL9 A;  3KYL A;  4OZ1 A;  5ETL A;  1ZM3 A;  3SI8 A;  1HKA A;  1PC4 A;  2W25 A;  4NLP A;  5KAK A;  3ITH B;  3Q3Q A;  2YWE A;  3CDW A;  5L1I A;  3E01 B;  3M1V B;  3FC9 A;  4UQG A;  3S1R C;  1PYS B;  1AT1 B;  1LXN A;  2NRE A;  1O27 A;  4OYB A;  2X1B A;  2HFS A;  4LRF A;  3DLE A;  1EFW A;  2V9K A;  3I5B A;  5AE3 A;  2FLO A;  2QL7 B;  1QE1 B;  1IN0 A;  5E68 A;  2F8H A;  2CQI A;  4CH7 A;  1ZTT A;  3ISN D;  1R8H A;  1IM6 A;  1U1P A;  2NLW A;  3G4A A;  1FKP A;  1O6X A;  1GMW D;  1OY8 A;  4CTA B;  3RAM A;  1IJE B;  4JI0 J;  4XLP A;  4F02 A;  1SXL A;  1WC1 A;  2AEF A;  4FS1 A;  2MKH A;  4QWC A;  2HYI B;  1X7V A;  2AJQ A;  3G96 A;  4DF4 A;  4DR6 J;  1DY3 A;  3G6V A;  1KOH A;  1TWA K;  1TAU A;  4TY8 B;  4IFY B;  4B9L A;  3LWL A;  2QL9 B;  2RHS B;  4JI4 J;  1U6B A;  1F9N A;  4J9S A;  2RML A;  3PHT A;  4HEA 9;  3MPV A;  3R9L A;  4WK1 A;  2DO0 A;  3GV5 B;  3MF5 A;  3H20 A;  5E7O B;  2CZV C;  1OQ3 A;  5KT6 A;  2CWX A;  3OXG A;  2GS8 A;  4M5D B;  3CJT A;  1DCH A;  2ZNY A;  3M6W A;  2Y3Y A;  2D9O A;  2JA8 K;  3NNC A;  1VQP S;  3W5Z A;  3G8T A;  3JSM B;  1F93 A;  3CW2 C;  4HLB A;  3UO0 A;  2N7Y A;  5KFC A;  4X4P A;  3TO8 A;  2W2N P;  1RTJ B;  1PIE A;  3DC2 A;  1U8W A;  4WYL A;  4FXD A;  5LXR A;  2KU7 A;  5E33 A;  2VC0 A;  3RR7 A;  4CLY A;  1U45 A;  4X4R A;  1ZXO A;  2AIR B;  1X5P A;  1IKX B;  4C2M C;  2XLI A;  4A3F K;  3BGF A;  4U8V A;  1QAY A;  3JYT A;  3S16 K;  2E5G A;  4FPR A;  2HAF A;  2YX7 A;  2Y1J A;  2VUM K;  3FFI A;  3CCJ S;  3I0R B;  5DGA A;  5HMX A;  1TKT B;  2GNK A;  4EBC A;  1S0N A;  3MD1 A;  3KUG A;  1FDB A;  3Q89 A;  4YOE A;  3SZZ A;  4FXW A;  4DL7 A;  3N3Y A;  3HSG A;  2AJ4 A;  1JJ4 A;  2BW7 A;  2E5H A;  3ZTP A;  1PCA A;  3VAG A;  4OLP A;  4Y52 C;  5KFI A;  5KT5 A;  1G4C A;  2JEJ A;  2QLX A;  4USI A;  1IBK F;  3QFH A;  1K83 C;  1NKC A;  3IR5 B;  3WX8 A;  4ZIW A;  4HAC A;  4DUZ J;  4MAK A;  3R5J B;  4HHH A;  1YZ6 A;  1I6V A;  2I8E A;  1XMQ F;  2W9C A;  3QWP A;  5C2C A;  3SFU A;  2ERR A;  5KFZ A;  5F8N A;  4NMX A;  1GFW B;  1LQ9 A;  1S49 A;  4RW4 A;  4WJB A;  1FKO A;  4DFP A;  2YNI A;  2EK1 A;  2LU1 A;  3RRK A;  3GTK C;  3F56 A;  5FLM K;  4U95 A;  1NH7 A;  3TRG A;  3OL7 A;  3BJY A;  2M2B A;  1Q8L A;  5IFM A;  4UST A;  3CUL A;  1R8A A;  2VOD A;  2PA3 A;  3HHL D;  3ISZ A;  3BPD A;  3DHX A;  4C3K A;  3OT9 A;  2BR0 A;  3QRR A;  1H73 A;  1P9Y A;  1FJC A;  1RCO B;  4I56 A;  3DOL A;  2MQM A;  2R8I A;  3GSI A;  1GTE A;  5ETN A;  2XYP B;  2I6W A;  1TWG C;  2NVY K;  1AFI A;  1F5C A;  3JSR A;  1SIW B;  1WQF A;  4YG2 A;  5DLG A;  3ILL A;  4UW2 A;  2JSX A;  3W9J A;  1FI4 A;  3FUY A;  4DX6 A;  1VRU A;  3Q8R B;  2EFQ A;  1UVN A;  4H4K C;  5B0A A;  3N6L A;  5HO4 A;  5KFO A;  2B8P A;  5HP1 B;  1N5Y B;  1OPI A;  3NG8 A;  2RRN A;  3M8Y A;  1CS4 A;  1D1U A;  4X84 A;  2XUL A;  3PG9 A;  3U27 A;  5ADZ A;  2DRD A;  2OTJ S;  3EXC X;  2K1R B;  1WCM A;  2MZT A;  4OI2 A;  2I0X A;  1X5O A;  3AJ1 A;  3WDO A;  2VB6 A;  2VFV A;  3RBX A;  9RUB A;  2XI3 A;  1HBN B;  2IM2 A;  2QO3 A;  5DZ6 A;  5DZ7 A;  4ES3 A;  1Y1V C;  3G2X A;  3R3T A;  2GSN A;  2RQK A;  2BRK A;  2JH3 A;  2I38 A;  4Z7C A;  2MPU A;  1RT4 A;  2CPJ A;  3AB2 B;  3QYY A;  1NK0 A;  4GMK A;  2YPZ A;  1Y11 A;  2DNG A;  4LSN B;  2O5J A;  3D68 A;  1WTB A;  4A3G K;  1R8P A;  2HWT A;  2CQB A;  3AT1 B;  3IAS 9;  1T0T V;  2DEI A;  3FEY B;  2HLT A;  2HRU A;  2NYI A;  2DNR A;  1PC5 A;  3LH2 S;  2XZT B;  2UXC J;  1S57 A;  1CC7 A;  3KNA A;  3IS9 A;  2KDO A;  4DUZ F;  2R8G A;  2IIH A;  2HVD A;  2DRA A;  1ARO P;  5C3E C;  2K06 A;  1FKA F;  2HVH A;  2A69 A;  5EN1 A;  2VPY B;  3ZTQ A;  2E1C A;  2D41 A;  2JZ5 A;  5HN0 A;  3J7Z 5;  1JIH A;  2ZJR Q;  1RWM B;  1KHV A;  1N0V C;  2DGQ A;  2WW4 A;  3US5 A;  4GRS A;  1O28 A;  4C8N A;  1K8A T;  1H98 A;  1JQG A;  3JTN A;  5LJ3 Y;  1EKR A;  4QJV B;  1OY9 A;  3H90 A;  3D1H A;  3AXM A;  4QIG A;  3GG1 A;  3IWX A;  1OMS A;  2R7S A;  2M8H A;  5JVO A;  2DGO A;  3L3C A;  4QIV A;  4AQY F;  4RBV A;  4FVM A;  1IE0 A;  3T00 A;  2F40 A;  2MXY A;  2FHM A;  3GTJ K;  2QFJ A;  4ED5 A;  3LAN A;  1S48 A;  2ZH8 A;  2B9X A;  1FJ7 A;  3FKI A;  1FRX A;  1SFO C;  3FZ2 A;  2J7K A;  2MHN A;  1NRK A;  3I0S A;  5HQ8 A;  1IS1 A;  2ZUF A;  3GJQ B;  3EJM A;  4FKX A;  1FXD A;  1K1Q A;  2AJ0 A;  2W24 A;  4GVB B;  3OL8 A;  2K3K A;  4MK9 A;  1H38 A;  1MMD A;  2KL8 A;  2WHO A;  1ZVU A;  3DI6 B;  3MCO A;  1E6Y A;  1CJU A;  2W4P A;  5IYD K;  4NPO A;  1YDL A;  3QZ7 A;  4TYA A;  2FZC B;  2K3I A;  1HNZ F;  4A3L K;  4TU7 A;  3PIO Q;  3V5R A;  1RT7 B;  3MPW A;  1JXE A;  1BQN A;  2MQO A;  3CJ0 A;  4B9M A;  3GFX A;  4YB7 A;  2DGS A;  2ACY A;  1UFL A;  4J90 A;  2PC6 A;  1RU1 A;  2CW0 A;  4DV3 J;  3CCE S;  5IQQ A;  3FNN A;  5KFA A;  4CCH A;  3DRP B;  1EKS A;  2B7B B;  4P5A A;  1RP5 A;  2BJ7 A;  2PFD A;  1FK9 B;  1WEL A;  3KLH B;  2KFN A;  2LXI A;  2EBE A;  2VKR A;  1RT6 B;  3VAH A;  1DAX A;  3MTK A;  2UXC F;  3DGV A;  1FDA A;  3GWC A;  4I0W A;  4AT1 B;  4F3M A;  3QJP A;  3NUH A;  2XMU A;  1Q1K A;  4PG6 A;  1RT4 B;  2W4C A;  2DHS A;  5GAE I;  3GR1 A;  1RAE B;  5A8K A;  4P74 A;  4DSK A;  4DU7 A;  5F8J A;  4IOA Q;  2XCR B;  1TMM A;  2XWY A;  2Q6B A;  1SJQ A;  3T01 A;  4A47 A;  2Q66 A;  4C0H A;  2L3M A;  5F0U A;  3IBF B;  4IR9 A;  5E41 A;  2RU3 A;  4LIW A;  4K4T A;  4G1Q A;  2OAU A;  3T1Y F;  4R5P B;  5KFW A;  1CQM A;  2JX2 A;  4ZLJ A;  5C24 A;  3HOV K;  2MKY A;  2CUY A;  3W61 A;  3CXC R;  5DDQ C;  3M2R B;  1Q7Y T;  1T3O A;  3X3U A;  2DGU A;  3D6M B;  4WE1 B;  3AXK A;  5GMD A;  2YWH A;  3MM6 A;  3SZY A;  4KAR A;  1JLQ A;  4C6A A;  2AZ1 A;  3D1O A;  4DUY F;  1DAR A;  1ZM4 A;  1VBZ A;  1RAI B;  2JVR A;  2M7S A;  1UET A;  3NRB A;  3RW7 A;  1BHN A;  5C4X K;  2HQ3 A;  1EK8 A;  4LR2 A;  2J0S D;  3NGU A;  1XNR J;  5J1P A;  4IQM A;  3EM1 A;  3RGI A;  2RHQ B;  4LF5 J;  4PXC A;  2FVR A;  3PO3 C;  4A3K K;  5A8R B;  1T05 A;  3VQT A;  1WUU A;  3S1M C;  3WIU A;  2VFS A;  1LK5 A;  5LJ5 Y;  2LXU A;  4DI6 A;  1KFS A;  2NXN A;  3GV7 B;  2IJR A;  1Y0H A;  4DV0 J;  2WK4 A;  1Z2Z A;  1BQM B;  1NH8 A;  2LFV A;  3NEK A;  4DMZ A;  4KRW A;  1NME B;  1K83 K;  5KG6 A;  1ICE B;  2R7Q A;  2YH1 A;  4ATN A;  3I6P A;  2P5V A;  2R7R A;  4X66 F;  2J8S A;  5H9F K;  4GTD A;  2ZHA A;  2FGC A;  3MMB B;  2HNY A;  4KAS A;  1MWY A;  4NLY A;  2B6A B;  1RWK B;  1S9G A;  1VQM S;  2HW3 A;  1U1K A;  4JV5 F;  4LR8 A;  1N6Q A;  3A8K A;  1RWX B;  3N0B A;  3GFY A;  2V50 A;  1SJR A;  1R0A B;  2CJA A;  4CT8 A;  1LXJ A;  4GC6 A;  4UOH A;  1H7X A;  5MAO A;  3H7H B;  1B70 B;  1Y9O A;  3RBE A;  3EX7 B;  3PW2 A;  2DR8 A;  1JLE A;  4MK8 A;  3K2Y A;  2FVP A;  1UL3 A;  3QLH B;  1BQN B;  1RBA A;  1TWF C;  4ZK7 M;  5KG5 A;  2KVI A;  5C44 C;  1B3T A;  2F8M A;  1RHQ B;  3S17 C;  1T8E A;  1GK8 A;  3NNH A;  1UVK A;  3PJW A;  4P5B A;  7FD1 A;  3A3O B;  3Q8Y A;  4WCE Q;  2BEF A;  2HHV A;  2HFU A;  3D1Q A;  5E3C A;  2DIS A;  1Y1W K;  3HFZ B;  4OZ2 A;  2JHE A;  1VIO A;  3Q8V A;  4X2B A;  2HGN A;  4IG3 B;  5SZT A;  5D78 A;  2X1G A;  3A3N B;  5KFE A;  3V4I B;  5HRO B;  1B0P A;  1JLC B;  2ZD1 B;  4GVL A;  5HAT A;  3KJQ B;  2RJZ A;  4ID8 A;  1AA1 B;  3A12 A;  3Q2T C;  2G2O A;  3DRS A;  4Q2M A;  1WJ9 A;  3BH7 B;  1RBO B;  5DS7 A;  2MTL A;  2RD5 C;  1VRQ C;  3RB0 A;  1ZPW X;  5LMU J;  1U48 A;  2ZZM A;  1LWE B;  3BZQ A;  3G6E S;  1ZH5 A;  2FPH X;  1MN9 A;  3IBW A;  4ICL A;  3S14 K;  1P1T A;  3KK3 A;  4KHM A;  2IMO A;  3M05 A;  1FER A;  4U7U K;  3ONQ A;  1FEH A;  2DCU B;  3IG1 B;  2FJW A;  2RIL A;  3BS9 A;  5GAH U;  3KTQ A;  1WG5 A;  2FLP A;  4QZV B;  3RR8 A;  4Z2X A;  2BAC A;  3FSY A;  1RTD B;  1Q86 T;  4U7C A;  2BAN A;  2YKN B;  2ZDP A;  1WQG A;  2ZHB A;  2MQQ A;  2BJD A;  2OP5 A;  2QL5 B;  4ELV A;  3T6J A;  2GZO A;  3DRY A;  2W9C B;  1U8S A;  4JV0 A;  2ADB A;  4TU8 A;  3PIP Q;  2VBX A;  3CGI A;  4P71 A;  4DR2 F;  4UOG A;  2W2M P;  1QTM A;  3HHL A;  2UU9 F;  4NEZ A;  1RIS A;  1HIY A;  1SQF A;  1VRT A;  3BRE A;  3SCI E;  1I50 K;  1O24 A;  5A0Y A;  2V6U A;  2JA7 A;  3OHA A;  3I87 A;  2YNG A;  4KKO A;  2MST A;  1C1C A;  2MEW A;  4IRC A;  2W7V A;  2DY1 A;  4QR0 A;  2B56 A;  1VGX A;  2VOP A;  1F5A A;  3M2U A;  4PQU A;  5DQG A;  1SH0 A;  4BKW A;  4OX6 A;  4HH0 A;  5CZX A;  1AUS L;  5C44 K;  2RKI A;  3W7B A;  3F73 A;  1VHF A;  1WG1 A;  3CO9 A;  1QAI A;  1Q78 A;  3X1L B;  5KOX A;  2I9S A;  2JA7 C;  3MMB A;  1DLO B;  4X4S A;  1S9F A;  1S7H A;  5EHH A;  2V34 A;  1BXN A;  4RJV A;  4Y65 A;  4X65 J;  3LWM A;  3T19 A;  5IT4 A;  4JV5 J;  4ED0 A;  2PO4 A;  2RNE A;  2KXN B;  4OX9 F;  1FDD A;  5L1K A;  2HRY A;  4PAA A;  1R43 A;  2HLU A;  4RU2 A;  3U1L A;  1FTR A;  3PCO B;  3L4K A;  4CIO A;  1VQS A;  3KHH A;  3DFE A;  1OO0 B;  1TKT A;  1L3U A;  4ZJQ A;  3NCP A;  4EO8 A;  3J7Y I;  1GQE A;  1H6K X;  1RTI A;  3CAG A;  1D0E A;  4F2R A;  2BA9 A;  3WC2 A;  5AXL A;  3AA8 A;  1FTC A;  1S76 D;  3MEK A;  1ACM B;  2VUM A;  1XZQ B;  5HK4 A;  2W2Q P;  4IO1 A;  2VKZ G;  3Q23 A;  2DR5 A;  2KFZ A;  4N77 A;  4DPO A;  1YJW S;  2ZH9 A;  1F7U A;  3M32 B;  2OPR B;  1MRO B;  3C46 A;  2HQD A;  2JVO A;  3R1H A;  1FFG B;  3GG0 A;  3RAX A;  3QGG A;  2O1P A;  3RJM B;  3LW5 C;  3TJA A;  3GEE A;  1X60 A;  4NXN F;  4PRF A;  3D6H B;  5J1E A;  2B3T B;  4DDQ A;  2M70 A;  3L9Z A;  4GKK F;  4ER8 A;  1BWE A;  3SIP B;  2CXE A;  3NOC A;  1RLC L;  5B08 A;  4PKD B;  2CQ3 A;  2HZC A;  2Z30 B;  5M3F K;  2RUG A;  1Q4R A;  2AYG A;  4F2S A;  2UXB F;  4ZP9 A;  1T9V A;  5F3Z A;  1TAQ A;  3MI7 X;  4A3I C;  4ECS A;  2H4W B;  2CG4 A;  4QW8 A;  1RU0 A;  2IY5 B;  1UV7 A;  1NPK A;  2L9D A;  2OPQ A;  4B9T A;  4ZJO A;  4MIW A;  4KHR A;  3HD2 A;  4CTA A;  2HK3 A;  3W5X A;  2BJE A;  4DV1 F;  4OYI A;  2R7U A;  3CD6 S;  1JLA B;  4QIF A;  2E2H C;  1U24 A;  2CPF A;  3HHE A;  4BY1 C;  3TA2 A;  3PFE A;  2QLF B;  4X4O A;  4OFZ A;  3I55 S;  3FVY A;  3GTK A;  1R3N A;  1Z1Z A;  4QU7 A;  2F1F A;  4ZLN A;  1VIX A;  2DPJ A;  2BDP A;  2IA0 A;  3GTG K;  4U8Y A;  1H2U X;  1OWX A;  1AZS A;  3ET6 A;  1Q79 A;  2IVY A;  4ANC A;  5A0Y B;  4TXS A;  3U02 A;  1REG X;  3IMQ J;  3EZU A;  3TQE A;  4KMH A;  2CNK B;  3H2V E;  4YUD A;  2HBR B;  3DLK A;  2ZBC A;  4JBC A;  2IDL A;  5KFK A;  1Q7L B;  1N32 F;  2ZFZ A;  3G4S S;  3GQC A;  3K5L A;  5KFR A;  2BKO A;  2HVZ A;  3DGP B;  2CDQ A;  4KO0 A;  3W64 A;  3ORE A;  4GTC A;  3NMR A;  3HZE A;  3CDB A;  4FPI A;  2IA6 A;  1SJ4 P;  3VGU A;  1IQT A;  2PT0 A;  3T5L A;  3CJ5 A;  3EE3 A;  1WTF A;  4F3O A;  3ZZR A;  4KT0 C;  3W62 A;  3HSZ A;  4RW9 A;  1R7I A;  2XSJ B;  2IM3 A;  1S6Q B;  2O66 A;  1Z4U A;  2RIJ A;  1NK8 A;  3DLL Q;  4ALZ A;  2NZC A;  4B08 A;  5ETO A;  2C3O A;  3S2H C;  2AWZ A;  1YKW A;  1RU2 A;  2A6M A;  3I82 A;  4J9O A;  2UUA F;  5J1N A;  4RW7 A;  4LFB F;  1M5O C;  4B9N A;  2NXJ A;  2F9D A;  2WB1 D;  1GEH A;  3PY8 A;  2VIH A;  4YN3 B;  5KT4 A;  4OYW A;  5J2M B;  3CJ3 A;  3TFH A;  1RYS A;  4NOH A;  4KGV B;  2BJ3 A;  4C3I K;  2E1R A;  3D0I E;  4FYX B;  1FX4 A;  1SKS A;  3P6Y C;  1ZS6 A;  3CC4 S;  3NAH A;  1J6X A;  3QGP A;  1TKD A;  4ELU A;  3CCQ S;  4ZDN A;  1VBY A;  4K0K J;  2WSE C;  2WSC C;  1RZM A;  5FJ8 K;  2HZV A;  4GTL A;  3H3V D;  4X4Q A;  3UPF A;  4CRJ A;  3QAE A;  1S1W A;  4NCB A;  1HL6 A;  3GON A;  3UVJ A;  4C2M A;  4F8R A;  2HHW A;  3GTQ A;  3NMA A;  3TA1 A;  3TJ9 A;  2ZM6 F;  4L72 B;  5AXK A;  4USW A;  2DNQ A;  1N34 J;  4WE1 A;  1WC3 A;  2FY8 A;  1IQZ A;  4Y2C A;  4ZN3 A;  2FVC A;  2CPZ A;  5C4J K;  1W2I A;  2ZE2 A;  3ICL A;  4ZIT A;  2NCK L;  2QLJ B;  2ZWO A;  3DMJ A;  1AW0 A;  3TAQ A;  4MIA A;  4EZ9 A;  2OJ3 A;  1WDT A;  1AB8 A;  3KUE A;  4JOU A;  5B0G A;  3FOF A;  4UZB A;  4A3M K;  4NI2 B;  4DBQ A;  3GTQ C;  4URS A;  5EX0 A;  5K8O A;  1JJC B;  1LFP A;  5D0G A;  2YU9 A;  3A8J A;  2C22 A;  3BSC A;  1UKU A;  4DOZ A;  1XMQ J;  4DCP B;  1PO6 A;  2FTR A;  5I3U B;  3MAH A;  3BKU A;  2B63 K;  3J80 Y;  3DLH A;  4KC5 A;  1IUJ A;  5I4M A;  3HOY K;  1TWC A;  4ECR A;  3ZO7 A;  2C2N A;  4OHW A;  2AYM A;  1HI9 A;  3HOW C;  3ETM A;  4UF4 A;  2CFA A;  4G1I A;  3G82 A;  1RWO B;  3MUT P;  4DL0 C;  1G3O A;  3I5C A;  1PJ6 A;  4X62 F;  4KTQ A;  3Q8U A;  3VGS A;  2H65 B;  5D77 A;  4FYY B;  1YIJ S;  3H5S A;  4FVC A;  4RBU A;  4DPU A;  3GTJ C;  4YFK A;  1HQM A;  2KJV A;  3OUY B;  3T5J A;  1F2H A;  2FLN A;  5KFN A;  3TZX A;  2C42 A;  1O8B A;  4RNF A;  1H7W A;  3EYZ A;  4C11 A;  4Q8E A;  3GFZ A;  2K2P A;  2XCA A;  3ZZZ A;  3MML B;  2ZH7 A;  4H4M B;  5GAG U;  2JA8 C;  2E2I A;  1S77 D;  5H9F J;  1J6V A;  3JSY A;  2OML A;  2XCP A;  2J9C A;  1YI2 S;  4C3I C;  4FBT A;  2R9L A;  1HQ2 A;  5D4L A;  1VQ6 S;  4GFQ A;  3K58 A;  2Y9H A;  4J7C A;  2OLW A;  5D4D A;  4R0E A;  5EDW A;  3MCS A;  2XSF A;  4ZCI A;  3BUE A;  4DV6 F;  1F9E B;  3SYZ A;  4EFA C;  2BYC A;  4ZVQ B;  1K73 T;  2ALY B;  5I42 B;  5E3A A;  4BLA A;  2HQG A;  2MQN A;  3KG4 A;  4ECT A;  4JI1 F;  1FNX H;  1Q81 T;  4L74 A;  1I94 F;  4X64 J;  3BO2 A;  1NJY A;  5HRO A;  2Z2M A;  4WFN Q;  3LAK A;  3LGH A;  1RWU A;  3OR2 A;  1FA0 A;  4BC7 A;  1UEK A;  5IT9 Y;  2ZDO A;  2BKP A;  1Q16 B;  1SBR A;  3DRS B;  1G2E A;  4DQP A;  3AOC A;  2NSC A;  2VON A;  2ZBI A;  1HBU A;  3KMQ A;  2Q79 A;  2QFI A;  2VC1 A;  4Z37 A;  1DZ5 A;  2ZOG A;  2O5I A;  4OI3 A;  4C3J K;  4OYO A;  3DHW C;  3J80 U;  2IBK A;  4JI2 J;  1NUE A;  2HWH A;  3PAC A;  2U1A A;  3NBP B;  2PPB A;  2HHT A;  4CLL A;  1NHK L;  1UZH A;  2H3E B;  5CD4 H;  2C2O B;  4JI6 F;  1Z2L A;  3GTO C;  3SMZ A;  4DSI A;  4I6W A;  2DK2 A;  4D3H A;  1U2F A;  3MAQ A;  1CSJ A;  4KJI A;  5JFE A;  4P52 A;  3BGR B;  3RBZ A;  1EET A;  2XY7 A;  1TKX A;  1S97 A;  2OFH X;  1U2C A;  2IC3 A;  2MKS A;  4DX5 A;  3LP2 B;  4E0D A;  3HOX C;  3SQO P;  3NNA A;  3PRD A;  4K4V A;  3RYL A;  3C3L A;  2AZ3 A;  4FYD A;  4F4W A;  3SBM A;  1WG4 A;  3W8P A;  4PUO A;  3P96 A;  4DX7 A;  4JB8 B;  3QFW A;  2FGO A;  4NA2 A;  2FUG 9;  1HQU B;  3C6T A;  1X4A A;  4CYU B;  5BYS A;  4ED2 A;  1GX6 A;  3RAQ A;  5IT0 A;  4KN4 A;  2LVW A;  4OZ0 A;  1FRK A;  2PSZ A;  4DS4 A;  4M63 A;  2Z57 B;  1TU0 B;  5HMZ A;  2EFV A;  1CJU B;  3TEH B;  2C1E B;  1T02 A;  2RS2 A;  4AQY J;  1JWW A;  2APO A;  4QQB A;  1IKV A;  3HI9 A;  4HKQ A;  2BE9 B;  3IS9 B;  4DSF A;  4AYB D;  3G86 A;  1DUR A;  3O44 A;  4M5L A;  3MMA B;  2HFV A;  3CCV S;  4JI8 F;  1SL0 A;  4LRB A;  1GX5 A;  4MK7 A;  4IR1 A;  4DR1 J;  3PDN A;  2VL1 A;  4P72 A;  1M5P C;  1R9T A;  4RLE A;  4OIN A;  1HWL A;  3KLG A;  2OI2 A;  2VBW A;  2A3J A;  3K7A C;  2YKP A;  3ENV A;  1IJF B;  4P7T A;  2A6O A;  3EGV A;  4H4O A;  2HHX A;  4WIL A;  4F36 A;  4M5I A;  2XC9 A;  4YDD B;  4B9S A;  3M6X A;  2KYZ A;  1FRM A;  4LK1 A;  4A8X A;  1SKR A;  1ZYQ A;  2ASL A;  3M2R A;  2X3D A;  3GTM C;  2BV3 A;  3FSI A;  1K44 A;  1FT8 A;  4LQ3 A;  4RWW A;  2LQ9 A;  2M8D B;  3R7N B;  2CQD A;  2J6T A;  3TZY A;  4QYR A;  4Y2I A;  4RNH A;  2BOA A;  4LF6 F;  3RUB L;  7AT1 B;  4AE5 A;  2CQ0 A;  1U1Q A;  1YQH A;  3GE9 A;  4WF9 Q;  1SB6 A;  4KH0 B;  2GJ2 A;  3NOG A;  5GME A;  2MKC A;  3N9U C;  3GTJ A;  4ZIV A;  4NXM J;  3M4O K;  3TEG A;  3PHE A;  2VF3 A;  1NHV A;  1K0V A;  3L4B C;  2HWI A;  2HHQ A;  1T95 A;  1CG2 A;  2E2I C;  2YKO A;  3ISN C;  4EU0 A;  2EG2 A;  2P6S A;  2LLZ A;  1HMV B;  2DXD A;  1L3T A;  2RKI B;  2QG9 B;  1YJT A;  3CJS A;  5AJ3 F;  3CJK A;  5M2U A;  4GTA A;  5EWG A;  4ILL A;  1WDD A;  2HND B;  3MM8 A;  4YB5 A;  5LSR A;  2LQJ A;  4DL6 A;  4FYV B;  5IQ6 A;  4C0O C;  2V2Q A;  4ZPD A;  4J9M A;  3FFI B;  5M5W K;  1MWQ A;  4A3J K;  3LGM A;  4ZPA A;  4ANE A;  5IXU A;  2AYE A;  1UAW A;  2FC8 A;  4WKY A;  1ZOT A;  3S8S A;  4OJ1 A;  3V6D A;  1FDN A;  3ET6 B;  1R31 A;  3WIV A;  1J6W A;  2ASY A;  3DYA B;  3W2V A;  2IAJ B;  3KWM A;  4ES1 A;  2E2J C;  1O5J A;  1YRX A;  4OV6 A;  3A13 A;  1SL1 A;  1LW0 A;  5KT3 A;  5IYD C;  4OYA A;  4OIP A;  2HNZ B;  1HR0 J;  4TVA B;  1BMQ B;  1RK8 A;  2RSQ A;  3QRQ A;  3I4N C;  4N5S A;  2CJ9 A;  2C28 A;  3L95 X;  2UUB J;  2QLW A;  1S1X B;  1SH2 A;  2Q43 A;  3GCX P;  3OHB A;  3QT6 A;  4QU6 A;  4DR3 J;  3EGW B;  2N3O A;  1VLO A;  1B0V A;  4ETX A;  3ADA C;  4LF8 J;  4F4A A;  5C25 A;  2YQ3 A;  4USK A;  2B4V A;  4CI0 B;  4K7Q A;  3CCM S;  3EDR B;  3M9M B;  1FFS B;  4ETZ A;  3HDS A;  2KWA A;  2MMY A;  2IRX A;  5LM7 E;  4Y52 K;  3T1H J;  1YWX A;  2Z58 B;  3RZO K;  4CNY A;  4OI1 A;  1KDN A;  1HNZ J;  2RDJ A;  3BQ0 A;  2HBZ B;  4M5N A;  2LEA A;  1U49 A;  3HUL A;  5LT5 A;  3I32 A;  5T14 A;  5BR8 F;  3CED A;  1X9W A;  1WF1 A;  1TWG K;  3PFO A;  4TU9 A;  4RW7 B;  2EBG A;  2XO7 A;  2R7W A;  1TR0 A;  5KTQ A;  1XNQ F;  5DG8 A;  3LP1 A;  3Q2S C;  4LMZ A;  1B99 A;  3KJV A;  1B64 A;  1TL1 B;  3OVB A;  4ZPT R;  3PZP A;  1XN9 A;  1VQL S;  3FCW A;  3UFC X;  4EYI B;  4EYH B;  2C2M B;  2HAI A;  3OR1 A;  5J2Q B;  3LOU A;  2LEB A;  4N41 A;  2FHJ D;  5A2Q U;  2R7T A;  1TWC C;  5CCL A;  1GTH A;  3I0S B;  4Q2L A;  3UVJ B;  2AX0 A;  3TQ1 A;  2B5J B;  2CKW A;  1KRP A;  4F67 A;  2KO1 A;  1U0S A;  2VG7 A;  2MZQ A;  2DCL A;  1N56 A;  5DM7 Q;  1ZAV A;  2JFD A;  1YJU A;  3IWN C;  4ECY A;  2ALZ A;  4A3I K;  5LMN J;  5KFV A;  1S0M A;  3H5Y A;  2Y0B B;  1Y1V K;  1VJQ A;  1AXQ A;  4OIO A;  5D4N A;  1FE0 A;  4PXB A;  4LRA A;  4G65 A;  2R7Z A;  5KT2 A;  2PGC A;  4ENO A;  2NUU G;  3BYR A;  3CDE A;  4F0M A;  1Y00 A;  4O44 A;  1HMV A;  4CP5 A;  2DKO B;  4DPT A;  2R7Z K;  3NWG A;  4JI5 J;  1DLO A;  3G87 A;  2BOP A;  1BUX A;  5C7P A;  2N4D A;  3HMJ G;  4QWE A;  2FHK A;  1FRJ A;  5B7W A;  4GKK J;  1ZBS A;  2HND A;  3MM8 B;  4ZVR B;  2GAH C;  1R8B A;  5B0C A;  4BCA A;  3GDZ A;  4DCJ B;  1APS A;  3I9Z A;  4C3H C;  4Y28 C;  4GTF A;  4C3J C;  3TVK A;  1JNZ B;  4JYA F;  3MM5 B;  2XSJ A;  4O4G B;  4O3R A;  3OSP A;  1U1L A;  4PCQ A;  1RT6 A;  3KG0 A;  3O3L A;  4DR1 F;  2GVD B;  1NDC A;  4NE9 C;  2J6U A;  5KOW A;  1D3W A;  4WP9 A;  2DGV A;  2FLL A;  2FB0 A;  4M8L A;  1DTQ B;  4KHP F;  1HI0 P;  1USO A;  2KH9 A;  3W5Y A;  4WXW A;  5LSL A;  5A8K B;  1WF0 A;  1N5S A;  3S1N K;  1BD6 A;  4FZV A;  1DCP A;  5ETS A;  4DR3 F;  2V68 A;  1FVS A;  5C2G A;  3UDL A;  3DLB A;  5M2P A;  3G9C A;  4Q0B A;  4GKJ F;  1FES A;  3HT0 A;  2JEG A;  1WOO A;  1U02 A;  2A10 A;  3FBC A;  4DV5 J;  4V1A k;  3D28 A;  1RWP B;  2OTL S;  1U1N A;  3J81 U;  3JB9 k;  2R92 C;  3LA0 A;  3SZ2 A;  2OEK A;  4WFY A;  1RHM B;  3J7A 1;  2KJW A;  1YZ7 A;  3OTD A;  2VPW B;  2ZFH A;  2ZJQ Q;  3IG1 A;  1IR2 A;  2G9O A;  2GQC A;  1Y1W C;  4Y2M A;  3OV7 A;  3H40 A;  2NVQ K;  5DJB A;  3I4M K;  4FNI A;  1EX8 A;  4ITS A;  1VIS A;  4H54 A;  4F26 A;  1TL3 A;  1NJW A;  3OEP A;  1XQI A;  2ZE2 B;  1IL2 A;  1U47 A;  3FEZ A;  1S6P B;  3P8B B;  3DLG B;  4IFY A;  2BBE A;  3PW5 A;  3ENQ A;  5CYM A;  4QR1 A;  3PVX A;  3K8W A;  5JMN A;  4KB4 A;  3SDE B;  2EPI A;  4FYW B;  3T1A A;  4KGK A;  3VR1 A;  2VUM C;  1Q8I A;  4NLO A;  3BSN A;  1T05 B;  1SPB P;  2HVI A;  3CJR A;  1RT7 A;  5DGB A;  3O5T B;  4RKU C;  3H59 A;  2I5J A;  5L38 A;  3UWT A;  1JMT A;  1B7Y B;  2ZBP A;  4USH A;  5F8L A;  1FEE A;  2XZW A;  3NXZ A;  2RQM A;  1VK8 A;  3BF4 A;  2EFP A;  4C8L A;  2MJN A;  2NZ4 A;  2AKW B;  2L9N A;  1QUP A;  2JLE A;  1C0A A;  3DRP A;  2M9K A;  1FWL A;  3GU0 A;  2V9W A;  4E98 A;  1ELO A;  5KFJ A;  3GYN A;  3CCR S;  1K0T A;  2DR6 A;  3AA9 A;  1R8C A;  4A3C K;  3WBZ A;  1URN A;  3L09 A;  1C4C A;  2MY7 A;  1S9G B;  2ILY A;  4HI1 A;  3CCZ A;  3JQM A;  2LQB A;  4EK2 A;  4V19 J;  3GTM A;  4PXD A;  3TAM A;  1WF2 A;  1NDP A;  1O2F B;  3EPG A;  4KAT A;  3O8W A;  4HHJ A;  1KON A;  2EC0 A;  2V4J B;  3MMC B;  2MQP A;  4W4M A;  1VQY A;  2ZZT A;  2YU9 C;  2CQC A;  4C11 B;  2EW9 A;  4OZN A;  1YCL A;  2QRR A;  5D3G A;  2LA6 A;  3KK1 A;  3TUJ C;  2F8E X;  3MEG B;  2L41 A;  3CJ8 A;  2QN6 B;  3MTJ A;  3CC2 S;  4G3I A;  5C4J C;  4DFJ A;  3PW0 A;  3W1Y C;  1FO1 A;  2IJN A;  3D6T B;  5ITH A;  4B3T J;  1YSJ A;  3BYP A;  1XMO J;  4CO5 A;  3K7A K;  3GZ7 A;  1KKH A;  2MB0 B;  1HLW A;  1S59 A;  4NZ0 A;  4ZVT B;  2JWN A;  3DN9 A;  1TUW A;  4W92 B;  4G1P A;  3GTP A;  3T02 A;  1WKK A;  1JLF A;  5J1E B;  3PO5 A;  1Q5Y A;  4BBR K;  4JI7 F;  5IWA F;  4HYK A;  4G6V B;  4WFB Q;  3HO1 A;  5C42 A;  3D9B A;  3R6G B;  4PQA A;  2V8V A;  4AYB L;  4G0V A;  4USV A;  1NK6 A;  1BGW A;  3B4D A;  1I3Q C;  3GTP C;  5F9N A;  4RNM A;  3NCQ A;  4OYP A;  3KLF A;  1U25 A;  2CNO B;  1BQM A;  2B4P A;  5TMC A;  4OZL A;  4F4Y A;  2WVD A;  4YFN A;  1F1B B;  1S1W B;  1TQL A;  4HDH A;  4PYD A;  4XAK A;  4PWD B;  4LRD A;  4LFC J;  1HBO B;  3K7R A;  3TNV A;  3HHL C;  1F9H A;  1N5Y A;  1EI6 A;  4P2S A;  5KG4 A;  3TFI A;  3UD3 P;  4ZPB A;  4P75 A;  1WOP A;  3KLV A;  2KB2 A;  3G8S A;  3CSK A;  3LPY A;  2QYC A;  4Q4Z A;  3MEE A;  3NL0 A;  1U0H B;  3M3Y C;  2XS2 A;  4JI8 J;  2O3D A;  3CB4 A;  3H8Y A;  3CIZ A;  3ZZ0 A;  4LSZ B;  3ITH A;  2IYI A;  4AD6 A;  3QLH A;  3T9Z A;  5SUH A;  2ZM6 J;  1HNI B;  4M95 A;  4MKV A;  2HRT A;  1YNN A;  3M2V A;  4ECW A;  3FCV A;  2KT2 A;  1RE1 B;  2N7C A;  3M8W A;  4WP3 A;  1R0B G;  5HLF A;  1FF2 A;  3GR0 A;  2K7K A;  2L48 A;  1S1V B;  1FX2 A;  4C3M A;  3PKY A;  3SFG A;  4K2J A;  3PXG a;  4KO0 B;  2R92 A;  2D3Z A;  2XMA A;  2DH8 A;  3UD4 P;  1N4L A;  3RZD C;  4QYZ J;  2LP4 A;  4M5H A;  1ZPV A;  4A3D C;  1CBK A;  1U2R A;  5EWE A;  2E1M C;  4NLX A;  1E6V A;  4DV1 J;  1XEZ A;  4PWW A;  2K7J A;  4CNZ A;  2F4V J;  4RW9 B;  1O2A A;  3PYE A;  1FXL A;  1T94 A;  4ZJL A;  2ZHO A;  1Y5L B;  1S4F A;  1EH1 A;  4LF2 A;  2YKA A;  2HQC A;  2CQ4 A;  3T3F A;  2MKJ A;  1IXK A;  4LJZ A;  1XIQ A;  4NML A;  3OXF A;  2LYV A;  1YJV A;  2PD1 A;  5IOL A;  4ZLP A;  4B3T F;  3GIR A;  1S72 S;  4LSL B;  2IAJ A;  2NPF A;  5FDL A;  4RW6 A;  4M1X A;  1UMJ A;  1J98 A;  2YPY A;  2R7Z C;  2XNQ A;  5CJ9 A;  1Q82 T;  4I2P A;  3OPF A;  2UUC J;  1RTJ A;  2OD4 A;  1HI8 A;  3GYG A;  3PJX A;  4UUX A;  3CJ4 A;  5DO2 A;  2CQ1 A;  2LKZ A;  2CPD A;  4BWM A;  3O2I A;  3ZNJ 1;  2ZOF A;  1ZAX A;  1PIL A;  2DNZ A;  2CNN B;  1Y3K A;  5G4D A;  2CZ4 A;  1PSD A;  4DV2 F;  3HVW A;  4UOF A;  5IOR A;  4J5O A;  5HBM A;  2P9G A;  1YLX A;  4FNH A;  5CD4 A;  3FSX A;  1C1C B;  2YWG A;  2E2H A;  4KV8 B;  5RUB A;  2GHP A;  3MR6 A;  1QE1 A;  1IBM J;  4AUK A;  3AOA A;  4Y34 A;  1BC6 A;  3HKZ D;  1XXA A;  1RT1 B;  2DRB A;  3DXB A;  3HSD A;  3S16 C;  4B3M F;  3TWZ A;  3BQ1 A;  4TLQ A;  1RLD A;  4K4W A;  2MLZ A;  5AT1 B;  3NS6 A;  4MEY A;  1KQS R;  3H0G K;  4RWX A;  1SFO K;  1CC8 A;  3W66 A;  4XIU A;  2OPP B;  1S4E A;  4BXX C;  2XZD B;  4FM9 A;  4MJK A;  1T9T A;  2CPE A;  1NSA A;  1HHT P;  1MMN A;  4WIQ A;  3IA0 A;  1FRH A;  3IRX A;  2Y8Y A;  3THT A;  4Q7A A;  3FJ2 A;  4J9L A;  1Q5V A;  3PX6 A;  2G1D A;  1Y1W A;  2M4M A;  3DLJ A;  2UP1 A;  3B8H A;  1MG7 A;  1QSY A;  2FY1 A;  1NK5 A;  3OLA A;  2D9P A;  2DH7 A;  3M8Q B;  3ZZO A;  2NXC A;  3C8Y A;  4IG0 B;  3JSM A;  2BZ2 A;  2WB4 A;  3ELH A;  1ZA2 B;  1MRO A;  1TUG B;  1CJK A;  4S0M A;  2ZOM A;  5B0F A;  1PG5 B;  1XTZ A;  1OYD A;  4WP8 A;  1DQA A;  2CRL A;  4EO6 A;  5L39 A;  4JI5 F;  4DWI A;  2DIV A;  3ILO A;  1CLF A;  4FP9 A;  4KN7 A;  1NSK L;  2YQ0 A;  3GEI A;  2PMZ D;  4O44 B;  1SC6 A;  2XNR A;  2CJY B;  2YNF B;  4LRC A;  3PO3 K;  2UVV A;  4AXJ A;  4R5P A;  3M4O C;  4A3J C;  5FD1 A;  1QAX A;  2HS0 A;  3CME S;  1M5S A;  1V9O A;  2ZVI A;  3JSB A;  1O2B A;  3KKF A;  4XTT A;  3J81 Y;  4E8U A;  3IR7 B;  1DQ8 A;  2VIC A;  2E29 A;  1TK5 A;  1F60 B;  5A6P A;  2VDH A;  5GAD U;  3HXA A;  1UW4 A;  4DCO B;  3M8P A;  2J76 E;  2A2D A;  4R0J A;  5D8H B;  2Q6C A;  1EQR A;  3I4M C;  4KGZ B;  2AV5 A;  1NHU A;  4MFB A;  4CZC A;  2PA8 D;  2FZK B;  4AL6 A;  1PBA A;  4DQS A;  1MU2 A;  4X6A C;  9ATC B;  1DTQ A;  2W8K A;  2JEF A;  2EWH A; 
#chains in the Genus database with same CATH homology
 1VLO A;  1V5V A;  3TFI A;  1WSR A;  3GEI A;  4PAB A;  3A8J A;  1YX2 A;  3GEE A;  5L46 A;  3A8I A;  1WOS A;  2GAG C;  1WOO A;  4PAA A;  3ADA C;  1PJ5 A;  1XZP B;  1WOP A;  1VRQ C;  3TFH A;  2GAH C;  3AD7 C;  1WSV A;  1X31 C;  3TTG A;  3GEH A;  3AD9 C;  1XZQ A;  3AD8 C;  1XZQ B;  3TFJ A;  3GSI A;  3GIR A;  4P9S A;  1WOR A;  3A8K A;  1PJ6 A;  1PJ7 A;  1XZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...