3ADAC

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with sulfite
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3adaC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3adaC01
1YX2A 1XZQB 1WORA 1XZQA 3GEIA 1WOSA 1PJ5A 3TTGA 4PABA 1VLOA 2GAHC 1WSVA 3GIRA 3A8JA 3A8KA 3A8IA 3TFJA 2GAGC 5L46A 3AD9C 1XZPB 4PAAA 1XZPA 3AD7C 1PJ7A 1V5VA 3GEEA 1WSRA 3TFHA 3TFIA 1VRQC 4P9SA 3AD8C 3GSIA 1X31C 3ADAC 1PJ6A 1WOPA 3GEHA 1WOOA
chains in the Genus database with same CATH superfamily
3LANA 2E9ZA 4XDCA 3MD3A 4DPYA 4C8YA 3NCQA 2PA8L 5M5YK 1PG5B 4RU9A 3I9ZA 3GEIA 4C6AA 4TN2A 2BQ3A 3I55S 5JXSA 4U8YA 4BBRC 2HBQB 4KARA 1NJZA 5M2UA 2GMJA 3CJ3A 1LFWA 2H65B 1S4FA 3MUTP 1QJHA 1LW0A 1KD1T 1HPZA 1C0AA 3S2DK 5E33A 2E2HK 2W9BB 3M4OK 1ZM4A 1NK0A 1YJUA 2HVIA 2MSSA 4P73A 3RB4A 2FVRA 4NLDA 1I50K 5F3TA 1OSDA 2JL9A 4OHZA 3NBPB 2O1PA 5EWGA 1FNOA 2GS8A 3L3CA 1GX5A 1QTMA 1Q1KA 1WOPA 2AJ1A 2LQJA 5EX0A 2BJEA 2HWTA 2XSFA 3CMAS 5IQ6A 3W3SA 1Y1VA 3H3VD 2VL1A 2RHSB 4C11A 2V8VA 4O3RA 4X64F 4M8LA 2R7SA 1DQAA 1SUQA 5LMUJ 1D0EA 2JEGA 1BQNB 1TMJA 3BF4A 2HAIA 5ITHA 4FP9A 4TKTA 1SH2A 1HQEB 5FD1A 4YFUA 4BBSK 4C45A 4ECSA 5HANA 2K1RB 1H2UX 4WFXA 4ZHRA 1N88A 3S17C 5IYDC 3HXAA 1J2VA 4EU0A 2RB7A 1XZQA 4B3TF 4DU8A 4ZVTB 2X1BA 2YH0A 2J9CA 2NXUA 2AGQA 2B7CB 3UN5A 3CCVS 3A3PB 2NUUG 5E3PA 1URRA 3CC7S 2LYVA 2B56A 5SUHA 2CG8A 1LK7A 2CPXA 1EAYC 5ETTA 5J2NB 3W2WB 1J6VA 3QWUA 1O6XA 3RZDK 5CHPA 1QAJA 2DIVA 1L3UA 2YNFA 3WIVA 1RZMA 2PT0A 2UXBF 4DPOA 2CG4A 4Q2LA 3RZOK 4GRSA 3PIOQ 2Z30B 3VR1A 3M9MB 2MZRA 5KT6A 4NXMF 3Q3QA 2XB2D 2WBMA 3T9ZA 4FN5A 3QT7A 4OI2A 4YFXA 1K8AT 1HNZJ 5ETNA 3W66A 3MCMA 3NWGA 3UR3C 4PABA 1XR5A 2ZOMA 5DGBA 3LGMA 1TMMA 1EQ0A 1CJUB 3A3NB 3OUYA 4NLRA 4BY1C 3HX9A 1N5SA 2ZZMA 1ISEA 1Q78A 2DKOB 2V2QA 3R7SB 5C24A 1OYEA 1D3WA 2QRRA 1K83C 2J0QD 2UUCJ 2RE1A 4TU9A 1JXVA 2NSBA 3PO2K 4UOFA 5GVQA 3S1QK 3B6BA 3S2HK 2KM8C 4K2JA 4ZITA 2KJWA 5FJ4A 2BZ2A 5HSPA 3R6GB 1JQGA 4J91A 3CCSS 5LMNJ 1IKWA 1T02A 4WPAA 4J9QA 3G6ES 3GWCA 5E3QA 1GT8A 1BWVA 3ELHA 2D3OR 3H4DA 2HGLA 1JLAB 1WC1A 2VB6A 2R7OA 3QO9A 4K4XA 2JEFA 2AIRB 4X66J 2VQFF 2GQQA 2DGUA 2F9DA 3GTMA 4RW4A 3R5CA 3BGOP 4DV2F 4ZPDA 3TX8A 2ZUGA 2X3DA 1IUJA 3CJQA 1MN7A 4A3LC 1I1GA 2H4YB 1CSJA 2RJZA 4I2QB 1Q8IA 1NO8A 2I5JB 1TL1B 2ZH3A 5KFPA 1Q81T 5LT5A 2COLA 3AB2B 5L46A 3OHAA 1U0HA 5ETRA 3U1NA 3BKFA 2DH7A 1R8CA 3CNQP 2C3UA 4LSLA 1RWVB 3NL0A 1T05A 2FHKA 3RB3A 2E7XA 1HYSB 2YTCA 3J7YU 3KKFA 2X1GA 2AV5A 4DV6J 3D6HB 2CZ4A 1O2BA 2R8GA 3QFWA 1VFJA 3BO2A 2ZITA 1NH8A 3VQSA 4KHRA 2F1FA 4QR0A 1YJVA 5D6GA 4ID8A 1WWHA 3JYTB 1FDNA 3SMZA 1D9AA 1T3NA 4HACA 3IP0A 3WC2A 3ITHA 4JI5F 2WB1D 3A8IA 3Q24A 1YJ9S 4TNOA 2H51B 4DHVA 4HL9A 2MGZA 3GTQK 1ZAVA 5F8LA 5DM6Q 1H7WA 2CQ2A 5EGYA 5DDRC 4K0KF 1UTAA 2FQTA 3IC1A 4LF8F 3UW1A 2K2PA 4ZMMA 2E5LF 3OTDA 1TWHA 2DITA 1TKZB 3I4MK 4L72B 4LVOP 2X51A 1I3QA 4I0WA 4MYUA 4TYBA 4ED2A 3B78A 1FEEA 5KFUA 3V81B 4WFBQ 1TQLA 4WZMA 2VBWA 3CJKA 2BABA 3TFIA 4IFVA 2QLJB 3HD2A 3CB4A 1VK3A 3DLKB 3LOUA 3QT6A 2HFVA 1XNQJ 5EDWA 1ZM2A 3SYZA 1SL0A 3NOCA 3SCIE 1HBUA 5E7OB 3W64A 1S9GB 1IBKJ 5D4OA 1NK5A 3A3OB 4FXWA 2ZH1A 4BDPA 3GJQB 5KFYA 1EB0A 1CJVB 3V2UC 1UMJA 4RLEA 3MAAB 2VICA 4OX9F 1L3TA 4YDXA 1D9FA 2H5JB 3HOXC 2YKPA 3BBFA 3CVKA 4X65F 2JEIA 2V69A 4CZCA 2XNRA 1NPPA 1ZM9A 3MOJB 1SKRA 4PG7A 3GTOC 4GZYA 4HH1A 1S49A 2ABYA 3NCPA 4ANDA 2MEWA 4QJVB 3K0JA 3PVXA 3N0CA 4YMEA 1PJ5A 2NYIA 1RWWB 5CABA 3UQSA 1HMVA 3MCNA 3MM5A 2ZKUA 3UI3A 2GSOA 1U49A 1P8GA 1FDBA 1JLEA 2UUAJ 2C3MA 1VK8A 2WW8A 2HQ3A 2E2IC 4M1KA 3CDWA 3SSRA 2B9YA 3MEEA 1HNVB 3G8TA 2P6TA 4ILRA 4KPYA 4QIEA 3M8QB 4DR2F 4GTBA 2XS2A 1SKUB 2F5GA 1RWUA 2E1RA 3NAHA 2MB0B 1PBAA 4AYBL 1LKZA 4DFJA 1AUDA 2C2RA 5KFBA 3KLHA 2CJQA 2WOMB 1TWGC 1WJ9A 2CPFA 4KN4A 3ULHA 3ICLA 1XMQF 4ZP7A 1TP7A 4FYVB 4QIGA 2YWKA 5CJ9A 2JA5K 4LFAF 2OGUA 1UVMA 2KB2A 1Y7PA 1BY9A 3JTNA 4LF6J 2VUMA 4NYZA 2JDJA 4MFBA 2QGFB 3GQCA 3D0IE 4ECWA 1SL1A 2XLIA 3MM8A 2BACA 4LSNB 3TEHB 3TQ1A 4DV3F 3LP1A 4DS5A 4X4QA 4WP3A 5LJ3Y 3M2RA 3S1TA 1TWCA 4TLQA 2KL8A 3PW2A 2HWHA 2I8EA 1VBXA 3TP2A 3AOAA 3AA8A 4CRJA 1TKTB 4QWCA 2RNEA 2FQQB 4C0OC 1FD8A 2XO7A 4FF2A 5D0GA 1U1NA 4OYXA 4GKJJ 3GTKK 4HEA9 2L9WA 5ETSA 2Z2YB 5F9LA 2IHR1 2KHCA 2N4CA 1V5VA 3ZFVA 1RTJA 1CS4B 2ZWOA 5D4PA 4LRAA 1GH8A 3L4KA 4L3KA 5AXLA 2A69A 1HBOB 1HIYA 2WHOA 2E9RX 4KATA 2SXLA 3F0NA 1RT1A 2CPDA 2DYAA 4LRBA 2HGMA 3ADAC 1QM9A 4RW7A 1WNEA 3D54A 3J7A1 4NCGA 2KU7A 2VIHA 2MLZA 3TUJC 3THTA 5U47A 1CULA 2EC0A 3DMJA 2MZQA 2DHXA 2DGWA 4ITSA 1C1CB 1AA1B 2JRSA 3MOZA 2XTJP 1NPKA 2CQHA 1HD1A 3UR0A 2FY1A 3UNGC 1BHNA 3GJRB 1N33J 1Q8LA 1H0HB 2CNLB 2GAGC 4OYAA 2BKOA 2JHEA 1V3ZA 4I56A 5D0HA 5A8RA 1NK9A 1HPZB 1S1WB 4NZ0A 3MF5A 2HFUA 4ZCIA 2VG5B 5IM0B 3L9ZA 4F3QA 3SV4A 3DU6A 3RB6A 3W2VA 5A8KB 4H4MA 3CCTA 5IOSA 2DH8A 4C11B 3S2DC 4CLTA 4Q45A 2AGPA 3M6UA 3GTLC 2QA4G 3KJNB 4DCJB 3QPIA 2ZBCA 5HLFA 5T7LB 2VOOA 2O01C 1Q7LB 4B9TA 2IVFB 1Q5YA 1RB0A 3KLIA 4WTYA 2BJ3A 4XSXA 2RH3A 4ZHRB 1O28A 1FRIA 4ZPVR 4ZVQB 1SJ1A 3SZZA 3TO8A 1VC5A 4G1QA 2YWFA 2ZKTA 3TAMB 3J80U 4MH8A 3GTGA 1FKPB 2R2SA 2HQGA 3BBCA 1TWFC 4ZP8A 4QCLA 1FJGJ 4DUZJ 2MSTA 5CD4H 2FUG9 2NUHA 4CCHA 4UZCA 1SPBP 3BP8C 1AFIA 4RBUA 5KT7A 4GO5X 3SFUA 1A7GE 3PYFA 1YSJA 3AHPA 4C8NA 3AODA 5JVGQ 2H54B 3F41A 1TTHB 1EQMA 3CTRA 1S9EA 4KJIA 2JVOA 5CA5A 2CIMA 5IWAF 4OI4A 4H4OB 3PO3K 4KH0B 3KLEB 4JI8J 3VGSA 3M3YK 2XEXA 1XQIA 2CNOB 4LF7F 3QLHB 4AL6A 2OH2A 3EZOA 1NB7A 1KRPA 3RZDC 1IWGA 3QRRA 2M3DA 5IV3A 4MQ9A 1TWAA 2KJVA 4Y2MA 2J6UA 4CNYA 3OUYB 3I4NC 3RGIA 2VDHA 4PXEA 1PGZA 4MK9A 5CZXA 4DQRA 3TOQA 4HTIA 1U24A 2ZOFA 3N9UC 2VBYA 3LP0A 4KM9A 5K14A 2V9WA 2VDIA 3PM9A 3MMAB 1WC5A 1RT3B 5KG7A 2N82B 5K8NA 1I94J 5L1JA 5LXYA 3IBCB 2NVXK 2K8GA 2B8QA 5K9FA 2MLXA 1FXRA 1KQGB 3MTKA 5I3PA 4DWIA 2DGTA 5D3GB 4C8KA 4RW8A 4OJ3A 2V8GA 1IKWB 4ED1A 2Z8QA 2I0XA 4RWWA 2WTFA 2R4FA 3PJXA 4HDGA 4BXXK 3ISND 2W8KA 3DDIA 3PO2C 3QO9B 1U09A 3S1QC 1EHWA 4NLQA 3Q8PB 3DI6A 2NREA 3K5OA 3T5JA 4O0NA 3FBCA 3NNCA 4RW4B 2HFOA 4USVA 4KTQA 2Y1LB 4Y2KA 2CZVC 1JLBB 4OHYA 3AJDA 5D77A 2NVTC 2Q6CA 4OI6A 4FNHA 3BR8A 1ZA1B 2OPPB 5LSOA 2QO3A 5CZVA 4IOCQ 2RKIB 1OMSA 3B4DA 2ZH7A 3E01B 2VG7A 2W7AA 3ZNUA 2VU5A 3LF0A 3KJQB 1KVJA 2DPJA 1RT6A 4JV5J 3GFHA 5HBMA 1QDUB 2R92A 1EETA 2Y1IA 2GSUA 2BKPA 1U2RA 2ZC4A 4K4SA 2F9JA 2RQKA 3HOVC 4O3QA 3EVMA 5G0RA 3PX4A 3FRYA 3DXBA 1LXJA 4YR0A 2DXFA 4JI7J 3GSDA 3SCKE 2XSJA 3PRVA 2XMJA 1FRHA 4XAKA 4CH0S 2F4FA 3MR2A 3TAQA 2ZUEA 3CC4S 4MKBA 5DLFA 2V2ZA 4ICLA 2RT3A 4WILA 1S1TB 4ELTA 1EFWA 5A6WA 1IW7A 2OPQA 3C16B 4EWTA 4I7FA 3RW7A 3QJPA 2ZVIA 2AGOA 2VONA 1Y3JA 4DV5J 1FJEB 3PFEA 4OZJA 1N5QA 2ZH5A 3S1MK 2IJRA 5HJYA 4PUOA 1AUSL 3CCES 3ITHB 4X62J 4CWBA 1VHFA 4WIQA 3EZ5A 1IJFB 4CI0B 5KFZA 3UVJB 3MUMP 5DG8A 2K06A 1IN0A 4DS4A 4LRFA 1O2AA 1S97A 2RRBA 2D3O1 4A93C 3NNHA 3VV2B 3KG4A 3CGIA 4KE5A 3MD1A 3D6MB 2CJ9A 1JOEA 1HNZF 3LALA 5JMNA 2ZDPA 3ENQA 3S1RK 3JXOA 3VVTA 1VDHA 4MK8A 2GW8A 3AAWB 2OO4A 4EI2A 4M5LA 1YJWS 5GMDA 1RAOA 2PMHA 2XMVA 3SSSA 2NXJA 3FRZA 3U02A 4U7CA 4CH1A 5CYMB 3GP9A 1U8SA 3KLVA 4G65A 2UUCF 2J0SD 4F2SA 4Y7NK 1KBRA 3OEPA 1D8YA 2DNNA 1R43A 5DDQC 4IRKA 2HHPA 4P7VA 3E51A 1TL7B 4C8OA 3OD2A 1U45A 2BE5A 3Q8RB 2HZVA 3TFJA 2EWHA 5LMNF 4FZVA 3NLCA 4LF5F 3FUYA 1FRMA 2FTRA 1SJQA 1RLCL 4OLOA 4UZBA 1WUUA 4TXSA 3KNAA 2FC8A 3OTOJ 3A8JA 2JEJA 2ZEJA 4X66F 4G1PA 4F4KA 2HHHJ 2VFRA 4F25A 3I82A 3CEDA 3MXHP 1WQGA 4E2FB 1T94A 4O3NA 3V5RA 2FQOA 2BANB 2QA1A 2AJ4A 4OLPA 2PI4A 1H98A 4DV0J 3RZAA 3A8EA 2BJ8A 5IQQA 1B0PA 3H0GC 1JLEB 2P9EA 4J37A 4DSKA 1OPIA 1LWEA 3MEEB 4Y2CA 1BQMB 3D7SB 4ZP6A 1CQNA 4PQUB 2MKCA 4K8RA 1Q7YT 3H59A 2H5EA 1KOHA 2GIQA 2FVQA 2MZJA 1FF2A 1QUVA 1VRUB 4RNNA 1YCLA 3HT3A 1VQ6S 3AJ2A 2ZBQA 4WK1A 4C3HC 1VRTA 3M30B 3H0PA 1RABB 3JSBA 2R7ZK 2E7WA 1F7VA 2YNHB 3ZO7A 4DV6F 1RT5A 1CJTA 2A2CA 4MFBB 1RWKB 3GIIA 1KNZA 2AWZA 4GMKA 3MPWA 3ETMA 1RT7B 4AQYJ 3AFGA 3E3XA 4KGZB 1WF1A 4A8XA 2R2TA 4DLEA 2AT1B 3KJVA 2I6WA 3LP1B 1WDTA 3O2IA 2Y1RI 4RW9A 3H2VE 2QLBB 2FLPA 3VZHA 2VODA 3OW2R 3KJFB 3DRRA 4DLGA 4F36A 1IQ0A 5GMEA 1SFOK 4EO6A 1DCPA 4FBUA 2MKYA 2R7WA 3R2CJ 5KFOA 3CSKA 2ZJPQ 3RBEA 5F0WA 4BHQA 3QRQA 4O4GA 5AXKA 1LOUA 2CQCA 2J0WA 1VQ9S 1RTJB 2FJAB 1UPMB 1CC7A 4QR1A 3DLEB 5DJBA 4PEOA 1UZDA 5L1LA 5KFMA 2WB4A 2YQ1A 3BQ0A 1RT1B 2FLOA 4A3IK 2DHSA 4P9SA 3GTMK 4RW7B 5E3CA 3IRXA 4RR5A 3CD0A 1H74A 2MKIA 4M5DA 4NCGB 4DL4A 1XNQF 2WW4A 2G2ZA 1HL6A 2ZBIA 3DMJB 3EGWB 1HLWA 4P2XA 4H4KA 4BLGA 1FKOA 3ZC4A 3OLAA 2LU2A 1SV5A 2OJ3A 1NDLA 1N4LA 4DPUA 2KT5A 5B08A 3GYXB 2HS4A 3OFEA 1QSYA 2DCLA 4WF9Q 1RQ0A 2ZJQQ 4OMFG 1HHTP 3C66A 5A8RB 1O26A 4NMXA 4DUYF 1ZBTA 5F9NA 1K44A 5LSRA 2R8IA 2XY5A 3OPFA 3NUHA 1VIOA 3M32A 4HR2A 2HPUA 4CT9A 4HHJA 2FLLA 4HDHA 2DH9A 3L7PA 1OYDA 3Q8QB 2A6OA 1Y4ZB 2CFAA 3UDVA 1VBKA 1UL3A 3SDEB 5J2QA 4JBCA 4WFZA 3FJ2A 3RRKA 2MZSA 3Q22A 4C3KA 1X4GA 5FLMK 1M5HA 4FS1A 2A1BA 3MDFA 4WP8A 1CG2A 2RRAA 2UUAF 1LQ9A 5HLFB 4ZVGA 2XGQA 2XZTB 5F8IA 4JI4F 1T03B 2KXFA 2BRLA 2A6EA 3L95X 4YB1P 3HSJA 3CQZA 4CM0A 1RAEB 4QOTA 1NSPA 4C2MK 1TKDA 3GEEA 4L6V3 1DQ9A 3G86A 5LJ5Y 4FXDA 3OL7A 4W92B 2K3IA 3HP6A 3N6NA 3FBBA 2B63A 5IZHA 4X84A 2V94A 4LR2A 1J6XA 2L08A 3WX8A 1A0OB 1JKHB 1Q53A 2NZCA 1AZSB 1B4AA 3R27A 1Y1WA 2LKZA 2PGCA 4IRCA 3CWJA 4PKDB 2ACMA 5ETQA 3Q89A 4LF6F 1TWHK 4ECVA 5IT9U 5HROA 3DOMA 1I3QK 2CPJA 3Q86A 1S9EB 3S1NK 5I4MA 5T41A 2AMCB 1JJ2R 3GTYX 1DCHA 1J5OA 1XWLA 1DFDA 3P4UB 3IS9B 1IKXA 3HOUC 2HNDA 2RUSA 4UOGA 4YS2A 2EFNA 2DK2A 2HHSA 4KO0A 4WIIA 4I1TA 4P6QA 1JWWA 1QE1B 3BDEA 1AB4A 4DL2A 1SIZA 3T1YJ 3K8WA 2X7IA 4J9MA 1K47A 2GQ2A 5IYBC 5F41A 3U7JA 1IR2A 4I4BA 4ANCA 3D2WA 3M6VA 2DNZA 4KIAA 4O3SA 4BKWA 5A2QY 2UVRA 2V68A 5CQGA 2MZ1A 3LGHA 5LSLA 2XGPA 1VRQC 3H4BA 1X0FA 2G0IA 1UVKA 2CFXA 1N36F 4Y2AA 2RS8A 2A18A 2CJXB 1B7YB 4EUVA 3QIDA 2F7VA 1BUXA 5FDLA 4RW8B 4Q2MA 3JTPA 3GLJA 3IPJA 4NE9C 1TAUA 5C42A 1HNWJ 1VQ5S 4C98A 1WHVA 3DOLA 4MIBA 4IRDA 4NXNF 1YKWA 3BN4A 2J9EA 5H9EJ 4IO9Q 3SI8A 1N33F 2EFOA 2R8KA 2GVDB 3OTEA 5IP7K 3ZNJ1 2GO8A 3G87A 1RISA 2GC8A 2AP6A 4OV1A 2FJBB 2U1AA 2NVXC 2N4DA 4KT0C 4DR4J 4P5AA 2QSFA 2ROEA 2HQFA 2WSFC 1L0WA 4ZK7M 3R8YA 2E1AA 1S1XA 3GIKA 2EBGA 1UW4A 2GGPB 3QWPA 1SL2A 3LH2S 1Y5LB 3RAMA 4AH6A 3SCLE 1HNIA 4ATNA 4IG3B 2NSCA 2OELA 3QJLA 3KHLA 1LW2B 1RT6B 2X1AA 2DT9A 2R93A 1RSCA 3MM7A 2ZC3A 2OEJA 2ZUFA 2J0XA 4PR6A 5HBMB 2PEHA 1WHXA 2DB1A 2FIUA 5M3MK 1FA0A 4YEAA 1GE9A 2AJ0A 5IT4A 1XMOJ 3KLFB 1S1VA 1S6UA 3VAFA 1RHUB 4Q44A 1NHUA 5KFCA 5DG9A 4NCAA 4KFBB 1CQMA 4RUAA 2B6AA 4OYPA 4KKOB 2OEMA 3QIPA 3W8PA 3R5AA 4IKAA 2F3JA 3LGNA 4F4WA 2F65A 4USJC 2BOPA 1FJGF 2DTJA 4NLUA 3G82B 1X31C 4G7ZA 4B3SJ 1N6QA 4B3OA 3GU0A 4PUOB 1PYTA 2VC0A 4CLFA 1VCTA 2C22A 1RAGB 2OFHX 2AEFA 3SCJE 4FF3A 3JSTA 4G7OA 3O6QA 3UD3P 1XJWB 4I68A 3HHEA 2MJNA 2UV8G 2KYXA 2CRLA 4N7TA 4KMUA 4OJHA 3A8KA 1X5OA 2WSEC 4HVZA 5C4JC 5C2CA 3G6VA 4LMZA 2RS2A 2RRNA 1IKVB 2OFGX 4PYAA 3HM9A 4ZJQA 4DV4J 1W25A 1JLQB 3U27A 5BYQA 3RG6A 2KT2A 1T11A 1P1LA 3HPOA 3PW7A 1SJRA 2MKKA 2R7UA 1YBAA 4YR2A 1RHRB 2QE5A 3OFGA 3PW5A 2Z57B 1FRXA 4C3LA 2DEJA 4GC7A 2B4PA 4DN9A 3TW0A 4OX7A 4LBPA 4B3MF 3VTIA 4DSFA 2OPSB 2R8JA 4M95A 3ISZA 1S9FA 4JI0J 2ZFHA 2W24A 1GMWD 2VA2A 4IOBA 1IQTA 2B5JB 1I94F 2G0JA 4LF2A 1N0UA 1WEZA 3H5YA 3GCWP 2DNOA 2YH1A 4LBIA 1TELA 4NA3A 4XTTA 4IFYB 1UVLA 1N5VA 2H3EB 2C2EA 2DNMA 3K17A 4Y7NC 4X4VA 4P52A 1UKUA 5H9FK 4F0HA 4ID5B 4W90B 3NMAA 4JOUA 4A8KA 3AJ1A 5CYQB 4TQRA 4C9DA 3QGHA 2YVSA 4XPEA 1VYAA 2CQPA 2W9BA 4KV8A 2K7KA 2NVQC 1F2HA 1RT4A 3R7BB 1PILA 2BM0A 1FK9B 1X5SA 3GTGK 2EFVA 4PCQA 1A6LA 3NBPA 2RSQA 5ADZA 3TA0A 1N8RT 3VAGA 1RUSA 1I6HK 4A8FA 2C2DA 1GXUA 3FC9A 4A3GK 1R27B 2LVWA 1ITPA 4IG0B 1BQNA 4BLAA 3CJ2A 1RHJB 3PDNA 4M1XA 4DQPA 1K83A 1PBUA 1T9UA 2HW3A 3M8RA 3HHLC 2P9GA 3TUZC 3IG1A 5J1EA 1BS2A 1EP4A 1X4DA 3TJAA 2HZAA 2B9XA 2K1RA 4NOHA 2V6UA 1RT5B 5IXUA 3BSNA 4ILMA 2HQCA 1CJTB 4ZP9A 2CAJA 4FPRA 1S12A 1DQ8A 1C2PA 2IC3A 1ULRA 1TWAK 1IL2A 4AXJA 5E5NA 3FK4A 4DV5F 4A8MP 3PACA 4JI6F 3OSPA 2XCRB 2M2BA 1F5AA 4J3NA 3ZTOA 2R7ZC 1VR6A 1NSKL 2FB0A 4RW9B 3AY0A 5MLCV 4QZVB 3EXCX 3L09A 1SQGA 1FNMA 1BDFA 3FFIA 2P5MA 1ZS6A 5C5JA 3MR5A 3BO3A 4GVLA 3HOZK 3LQVA 5C4XC 2HKEA 1RWOB 3H2LA 4O4GB 2E2JK 5KFHA 2JX2A 1VGXA 2XS5A 2XY6A 1MWQA 2EFQA 1URNA 3DYAB 2EPIA 2RD5C 4CTAB 1NDKA 2HVZA 2VBZA 4OHXA 4LRDA 2XMAA 1SFOC 4B3RF 5KFNA 2AD9A 1Q5VA 3TWZA 3D0HE 2ZZNA 1BGWA 1CJUA 5B0BA 3KMQA 4JI2J 1NK8A 1H3DA 3IRXB 3G4SS 1ZA2B 3HCXA 1X9SA 2UVUA 5FLXY 1SBRA 2KN4A 3IGVA 4N56A 1JJCB 3GV7B 1O5JA 3M6WA 1DHMA 1NSAA 1T9VA 4M5JA 4DR3J 5L1KA 2N7YA 3F44A 3SFGA 3LPYA 3BS9A 3CJTA 2ATLA 1NK7A 2QLWA 1DBDA 3FCWA 4C8MA 4R0JA 2GVZA 1DTTA 1JVIA 2R92K 2OHDA 4PPZA 3FSIA 4CO5A 1JLAA 2I9SA 2ZJRQ 1JXEA 3OTOF 5ETLA 2IM2A 3M32B 2HHHF 1HW8A 3HHKA 4KPCA 1F0XA 4RNOA 4YG2A 1RTDB 2RHQB 4ZS6A 1NJXA 3SIPB 4DX5A 5J2QB 3DGVA 4DV0F 1HFEL 4EBCA 4DR1J 1B0VA 2LXUA 1TK8A 1VGYA 3ILOA 4JI3J 4I2QA 2CW0A 6AT1B 3HVRA 1TL1A 4P74A 3BQ2A 1RKJA 2AF6A 3L4BC 2O5JA 3ZTRA 1X60A 4Y52K 2C3OA 2L41A 3T5HA 4MKYA 4L3NA 1VOMA 3KHRA 1Y5IB 1RYSA 2VA3A 3KYLA 4RW6B 3MFIA 1WI8A 1SC6A 3GPAA 3J81j 4GTAA 1AFJA 2QTWA 2V6AA 2VZ9A 3AD9C 1U02A 3C6TB 3DHWC 2UVVA 1XZPA 3WODA 3P8BB 1FRKA 4EGLA 3ZZRA 5KFKA 5M5WK 4Q0BA 4OYIA 3H20A 3UD5A 4C2MC 1LWCB 1FO1A 4ELVA 1KTQA 2AX1A 2UU9J 3GR1A 3R1HA 3DOMB 3R2DJ 2WSCC 3OQ2A 2C3PA 1UCNA 4YB6A 4ANEA 1KP6A 4OHWA 3PY8A 1HI9A 4DSIA 4DF4A 2B8PA 3JYTA 3G6XA 5AJ3J 3TFHA 4DJBA 4F4AA 3OV7A 2UUBJ 5M2PA 4O3PA 3GTOA 4ES3A 1IKXB 3MEKA 2VV5A 2ZBRA 3A4TA 4OZ5A 4DFKA 2GHPA 3CPWR 2VPXB 3S1NC 3D66A 4NX9A 3X3UA 4AT1B 3T00A 1NUEA 2UXDF 1YBUA 3D67A 3C6UB 3D68A 5CAAA 4RO0A 4ENOA 2W2PP 1TKZA 2FZKB 2GQCA 3D1OA 2AEJA 2M9KA 3BSOA 3DLGB 1X0PA 1TWGA 5DRKA 2YU9K 2M8HA 2RILA 3DLKA 3TUPA 1GQEA 1YGYA 4FVMA 1S9GA 4EO8A 4J9SA 4CO2A 3MM9B 4LOWA 3M8WA 3DOLB 3M8YA 2OPRB 1NH7A 3S16K 4EYHB 2E66A 1KQFB 3A1YG 2PE8A 1UETA 2XLJA 4RX6A 4ECXA 4YFNA 1KQ4A 4GKKJ 3MCSA 4X4RA 5BYSA 2M5YA 5KFXA 2G2YA 3GV5B 4HHUA 6FDRA 2VF3A 4PG6A 2J9DA 1R89A 3DDNA 4C4WA 2PPBA 1I5OB 1WG1A 4FKYA 1LFPA 1HNIB 3WDOA 4KB7A 1XIQA 2Z4PA 5HMXA 3F56A 4DR5F 4DX7A 4N8OA 1NJIT 2DBBA 4F4ZA 2JA7K 5M5XK 5IYCC 3T5KA 3L4JA 2ZH6A 3ISNC 3N6LA 4IYQA 1DZ5A 3HOWK 3QATA 5EGEA 3DXSX 1HWLA 5B09A 4XCHA 1WG5A 2UXCJ 2BJ9A 4A3BK 3DLJA 5IORA 1HNVA 3UE2A 3M8QA 3W63A 5DQHA 1IS1A 4X4SA 1UAWA 3G4CA 1WACA 4J9OA 4ZA1A 4EZ9A 1RADB 3S6EA 2JA6C 4ZCLA 4XPCA 2XMMA 5HVHA 2WOMA 3BR9A 3BREA 4KASA 3EVWA 4DR7F 3OR2B 3H40A 4G0WA 3JS9A 3CJ5A 3T01A 4X6AK 2Q66A 2DGXA 1IE0A 3RU0A 3LW5C 1YG0A 2VFSA 2DISA 3P6YC 1WSVA 2XY7A 1BE4A 1DD5A 2IM0A 1F6TA 3GE9A 2P8TA 2N3LA 5EHHA 4ILDA 1PSDA 2ZNZA 4A3CK 4A3MC 2KO1A 3MECB 3H3VL 3UFCX 4LSNA 3SQOP 1RAJA 1GMWA 1N48A 4NLXA 2RQ4A 4IH7A 3OSNA 1N5YA 3US5A 2G0CA 1T8EA 1YJNS 4A8OA 5D0EA 3GONA 5AE1A 2IYIA 1Q82T 3GTLA 4ETXA 1VQNS 4F04B 3PX6A 4EBDA 2W25A 3H5SA 2BA9A 4W98A 3VAIA 1QAXA 2M0GB 3BGRA 1HBOA 2AEMA 2HGNA 1KWMA 1U0SA 2PN6A 3D28A 1N5TA 4KB2A 3AOCA 4WYWA 4OIRA 1C4AA 1JLGA 2AYGA 4HKQA 3BKTA 1J6WA 1F9NA 4LF9J 4ZDNA 1S57A 4QU6A 1TWFA 2GMLA 1HR0F 2WVEA 3T3FA 5DGAA 2YWEA 1S59A 3AOBA 4IDKB 1C1CA 4UOCA 4ZJLA 1L5UA 3K7AK 1HNWF 1PIEA 4A3JK 1DCOA 1M1GA 3O5TB 1X7VA 2JZ5A 3S15C 3PRDA 2NPIA 1UJ5A 3MPUB 1N34J 4PYDA 1OY6A 2YBVA 1F93A 3CQZK 2C28A 4N8NA 4JK1A 2QFIA 4DR4F 1R0BG 3IFEA 5C3EK 1S1WA 2VHGA 2CPEA 1R8PA 4KV8B 1RI7A 1OQ3A 1S0MA 1RT4B 3QT5A 2B63K 5IP9C 2CJBA 2VG5A 2Y3PA 4V19X 2R7TA 1KQKA 4CYUB 5IM0A 5A2QU 1XXBA 1KHVA 5HVFA 1R8BA 1F3VA 5AE3A 2VFUA 3LO3A 1UZHA 1Y1WK 1YNNA 1F1BB 4OI3A 5A8KA 4WCEQ 3UNYA 1FEHA 2W9CB 3RTVA 4RZRA 2C42A 3O3LA 1UA0A 2PA3A 1Y10A 4A3KC 3CCUS 3ZTQA 2OUGA 2MY7A 1VQPS 5T7LA 2PMZL 5IV4A 1YK9A 2ZH9A 2R42A 3IG1B 5IFMA 4K4WA 5J1EB 1EP4B 4FVCA 2KM8B 2IA6A 2KI2A 1VC6A 4DL5A 1RP5A 3C46A 3R5DA 4I6WA 2UVWA 3C8YA 5GAEU 1OY9A 1HBMB 3S14K 4LJMA 4Z7YA 3CF5Q 5BR8J 3TAMA 3GTJC 2IC3B 2B43A 3R5GA 1TV6A 3HHNB 3LAPA 1FKPA 1FWKA 3CDAA 5LM7E 1F5BA 3THVA 3B82A 2EVZA 1TZ0A 4B3SF 1ZH5A 1TL5A 3M2VB 1S4EA 3T19A 1VQ4S 4QIVA 1S10A 2FZCB 4B9MA 1XEZA 1Y3KA 3JQMA 4X64J 3FFIB 2KFYA 4WJ4A 3W9HA 1E6YB 3UCUP 2YX1A 5E3RA 2RH6A 3MAQA 4H4OA 3KLEA 3CCMS 1S76D 1FJ7A 3QLHA 4R5PB 3UCGA 2GMHA 1FTCA 3H5XA 4M5IA 1X4CA 2FVCA 2Y3YA 4IO1A 3JAMU 1QY7A 1WEXA 4NI2A 3TA2A 1XPPA 1NSQA 3ILJA 1RA6A 2JLFA 2BQRA 2R7RA 4C3JK 4U67Q 3FHZA 4U8VA 1BGXT 1WCMK 2J9DE 3KFWX 1YZ7A 3CCZA 2MQMA 5EX3A 5B0DA 1S6OA 2ZM6F 2QZ8A 4B9VA 3DLHA 3GIJA 2V0NA 2MXYA 1ELOA 1KLNA 3MMAA 4ZN1A 4WTOB 3VGVA 3TA1A 1RT3A 2BYCA 2UXBJ 2WB1L 1F9FA 1UFKA 4KGVB 2RQMA 3KHHA 4Q5VA 4R8UA 4P75A 2R93K 2B4OA 4NXMJ 2DRAA 1TUGB 5D3GA 3KMSA 1RU1A 2PMZD 1MROB 2GVZB 5HP1B 3DRYA 1DTTB 3CDUA 1O8BA 4DR6J 4M5MA 2PIIA 4BY7K 1FVSA 2LECA 2DGVA 2MKSA 3OXFA 2N7CA 3M2UB 3W5YA 2CUYA 4HT7A 1GEHA 2C2ZB 2F40A 2I2YA 1JLBA 3TZZA 1MMDA 3K7RA 2FJVA 4UQGA 2XMTA 4IQXA 4WFYA 1MSWD 2OD6A 1UWAA 2IAJB 1TK0A 3W61A 1MWZA 4OYZA 5KG1A 2OPPA 4P5BA 4BC7A 3K89A 3FQLA 1S0NA 4XLNA 2KT3A 1K1SA 2RKIA 3TANA 3BBBA 3E01A 2XHCA 2FJXA 4LFBF 4PRFA 3GTPC 3J7Z5 2IM1A 4BBRK 2A3JA 4OX6A 3S0XA 1U8WA 1WKLA 3AD8C 1FVQA 1B64A 5D4NA 3BO4A 2GHVC 1EJ7L 5D4DA 2J8AA 1ZPWX 3FEXB 2PDAA 1XZPB 3M7VA 3RUBL 3QRPA 4J7CA 2VQFJ 2GJIA 4Q0BB 4TU7A 3KG0A 2ZE2B 2DVIA 4DV2J 2MZTA 5A6PA 5CH7B 1S1TA 3I9V9 5IC4B 2DD8S 4NPOA 3C16A 3Q8SB 1G6BA 3CJ0A 5HI7A 2BDPA 4MEYA 3GIMA 2J7WA 4B02A 5CCMA 1VBYA 3JTOA 4NEYA 5JVOA 3G2XA 2OSQA 3NY0A 2NYHA 2Z2LA 3X1LB 3NP5A 1YDLA 3EUNA 2IJFA 4U95A 4JV0A 3G4AA 3K5NA 3S17K 5IYDK 1HI0P 4IH5A 3UVJA 4K50A 2PSZA 3PHEA 4ED3A 5B0FA 3HLUA 3W5XA 2E1MC 2RIJA 3BKUA 3R97A 3OREA 3NG8A 2XM3A 3H0GA 1GXTA 2XULA 1I51B 2XC9A 3WX4A 1YBTA 1YWXA 3HD1A 1FI4A 4PXCA 1U1QA 3Q83A 1RACB 4L73A 4CP5A 4J5OA 4KHPF 2KTQA 4Y28C 5KTQA 4X4PA 2IMWP 5KFEA 2Z2ZA 3N5BA 2W2QP 1RHQB 3NGSA 4QYZK 1B4SA 3K58A 5E68A 2Z2MA 3O1LA 5KFIA 1C4CA 4EEYA 3T5LA 5CYMA 1XERA 4JI5J 1QSLA 1PKUA 4AD6A 1EZZB 1SCJB 2WK4A 2P6SA 4DR3F 3GEHA 3RR8A 2FD2A 4DUTA 1TL7A 4K0KJ 4BY1K 2JA5A 4LFCJ 1JLCB 4UT4A 3V4MA 1UJ4A 4QW8A 2HLUA 1LK5A 4GTFA 1VC0A 3QYYA 1C0TB 3L7UA 3PYEA 2LLZA 4EYIB 1VLOA 2V63A 1K83K 4MJKA 2ACYA 4USKA 1BQXA 2IY5B 5EN1A 3HHLD 4KBIA 1X4BA 4M5GA 3V6DA 2HHUA 3MM6B 4IR9A 4C3IC 2BANA 4TY8B 2FPHX 3IN5A 1PC5A 4ELUA 4DR1F 1U4BA 1RCXB 3BPDA 2ILYA 5FLXU 4JI3F 3KLGB 2F8MA 2LDIA 2W01A 3PNIA 3C3LA 1H72C 3HOYC 4UY85 5HVGA 1BQMA 1HWKA 3BEGB 4PQUA 4WE1B 1X4EA 3EICA 2IDLA 3B8HA 3EGZA 4WKYA 3EDQB 3PYGA 4ED5A 2HWIA 4RMFA 3CJSA 5E3AA 1XXCA 1ZETA 3GILA 1U1PA 1VRUA 5A8WA 4ECUA 2AX0A 1VQSA 4L74A 3IR7B 4OI1A 4A3LK 3HFKA 4M5KA 3QZ8A 1T7PA 3BJYA 4A3EC 1X4HA 2DJWA 3M30A 5FIIA 4KY3A 1UVIA 2LFVA 4HH0A 2YNHA 2IBKA 4A3FC 7AT1B 3OL6A 5AXNA 2QN6B 2UU9F 4M63A 1Q8KA 3FBEA 4GVBB 4K7QA 1TU0B 1RT7A 4K4TA 1QAIA 5TMFA 4G3IA 5C44C 2NZ4A 2DNGA 3K5PA 1N5YB 3I5AA 1QLNA 5HAOA 4X2BA 1FWLA 2KDOA 4A47A 1YVFA 4OIQA 4W4MA 1X8DA 2HHVA 3NRBA 2UV8A 2HNZA 1LEOA 4OX8A 5HQLA 3H5UA 1FD2A 1FERA 3UD4P 5I42B 3TVKA 3LAKA 3SQGA 3RRGA 5IC6B 3FCVA 3NGTA 1Z4UA 4P2MA 3PKYA 2GIRA 4Q7AA 1FX4A 1QVFR 4QU7A 5H9EK 4Q43A 1U1LA 1A9NB 1RXOB 3PTWA 1RKIA 2HQDA 3BGRB 3DLEA 4F50A 4F67A 1WI6A 3ILIA 2W9AA 2MQLA 4I64A 3ZXWA 2FHOB 2YKQA 2NVYK 3VAMA 2NR0A 1JLGB 3J7AN 5KFJA 3VHQA 1S6QB 2YKAA 4G6VB 1NKCA 8ATCB 4F3OA 9RUBA 2J8SA 3PKMA 2FC9A 2KHDA 3QGPA 4HI2A 3PR5B 2NLWA 1S77D 4G0UA 4DPXA 2ILZA 5BJRA 4DV3J 2BUNA 4OZ1A 3VAJA 1CLFA 4Z37A 3P5TL 2AYEA 5KAKA 4ED7A 3TNVA 3D6TB 2ZFZA 3GFXA 5DLGA 3BGLA 4MIWA 4E8UA 3EM1A 1R9TK 1X4AA 2VD3A 1X5TA 5IOLA 1UP1A 4GKKF 2KXNB 1IQZA 1AROP 1PO6A 3NS6A 2E9TA 3KWMA 1ZQ1C 4NOIA 4Y34A 3NEKA 4U6PA 1K9MT 1YLXA 4F3MA 4ZOSA 2LA4A 4OYBA 2GX8A 3SDEA 3JB9k 3KHGA 2E2HC 3M4OC 1W7WA 1NDPA 1Y5NB 1XK8A 3EGVA 2BR0A 1T3OA 2J7KA 4KAWX 2ZHOA 2OKQA 1I50C 1SIWB 1FJCA 3DLBA 1T03A 3UN2A 1RK8A 2EFGA 1S72S 5KFGA 1FE0A 1N32F 1IM4A 3GTOK 5KG6A 3TQEA 4Y6IA 2VASA 2VKRA 4NA1A 4QWBA 3V4GA 3BSCA 3MAHA 2XI2A 3JSYA 3D3BJ 2EKYA 1IJEB 1S48A 3MI7X 1TV6B 1JKHA 4HI1A 1U1RA 1AZSA 3DNCA 1HQ2A 1NMEB 1IXKA 4BBSC 1I6JA 2E2IK 1H7XA 1TKXB 2W2OP 2DIUA 2JA8K 1YX2A 3OXGA 1YRXA 3IAM9 5EUHA 2AZ3A 4QW9A 1IBMF 2NVXA 2HVEA 4CM2A 2CNNB 3MR7A 2DNQA 5B0EA 2GSNA 2KH9A 5ETOA 1IBLJ 5K8PA 4KC6A 2HVDA 4YOEA 4HTJA 3HHDA 4EK2A 3IS9A 5J2MA 1SH3A 2B3TB 3VF0B 3GG1A 2IM3A 3AD7C 2XYPB 1V6HA 3NGRA 3PX0A 4ETZA 4N41A 4FNIA 3M8PA 4WU3A 2DEIA 2HIQA 3RZOC 4NI2B 1QE1A 3FBFA 1BC6A 2E5JA 4C97A 5A0YB 1FTRA 3A13A 2VG6A 3W5ZA 3CCWA 3QQCD 1WHYA 2E44A 5DG7A 2AKWB 2AYMA 2KKHA 1LWFB 4B08A 2F4VJ 3D4JA 1WELA 2C2KB 2J6SA 4BWMA 1HNXJ 4LQYA 1U48A 1ZZFA 2DGSA 4LF9F 4F02A 3FEZA 4NCBA 4C3JC 4KH1B 5IWAJ 1F60B 4R8UB 1UJ6A 2WVFA 1QTNB 1RDRA 3ZZZA 4TU8A 5EGHA 4Y65A 4UUXA 4LF7J 1I6VA 1RWMB 1OJ4A 4DCPB 3ZZUA 4A3DK 1RAFB 1VJWA 1V9OA 3QGGA 2DNLA 2GVDA 3S2HC 4HHHA 1NZ8A 4K59A 4LIRA 3FKIK 4K5SA 4WXWA 3EVOA 2POKA 3FMWA 1UWBA 3KK3B 3CD6S 4LRCA 5CCLA 3C14B 4M94A 2DNRA 3IRWP 1WORA 4LREA 2G13A 4WFNQ 4KYZA 4XK8C 3KDNA 3LTOA 3M6XA 3R9LA 2GGPA 1HBNB 2CXEA 1KFDA 2R7QA 2HBZB 4IG3A 4CIOA 5EWFA 4WK3A 1J27A 1LW2A 2CJYB 3M1VA 2YWHA 1F9HA 1NPRA 5LMUF 1YJ7A 2IRYA 4ECZA 2R2UA 2IDEA 1MNEA 1FCAA 4X4OA 5GAGI 1TL3A 5D15A 3KLFA 1SC1B 1YRUA 3CIZA 4I6YA 4MKAA 1WQFA 2RDIA 2B0GA 1UVNA 1VHIA 2HIYA 1PCAA 3C19A 2BEFA 1SI9A 4FXVA 4KFBA 3TVYA 4BBYA 5BR8F 2FZGB 4KKOA 4ZLLA 1Z2ZA 3GTLK 3CCLS 4C8ZA 3GB0A 3CMQA 1Y0HA 1VBZA 1FXDA 3G82A 2VH7A 1UVJA 5RUBA 3NGDA 3GG0A 1ACMB 1TK5A 2MQNA 2RDJA 1O29A 3FSXA 4U96A 5M2RA 4A48A 2QA2A 3D3CJ 3HULA 1YQHA 4FM9A 2IRXA 1R3NA 5D0RA 5J2PB 1X9WA 2WAQD 3VALA 1TWFK 3GDZA 4O44B 2CKWA 3DC2A 1VQOS 3IA0A 3K5MA 1AYEA 2HFZA 2JLEA 2KVIA 1IKVA 1WSRA 3KDOA 1Q16B 4KRWA 1T9WA 1JLQA 2VUGA 3GTQC 3T1AA 1KOOA 2D69A 4F4XA 2HK2A 4PZVA 2AU0A 2ZD1B 1RT2A 3OTCA 2J5AA 3HHLA 3CO0P 3GMGA 4YQWA 2MHEA 4Q5SA 1N0VC 3I4MC 4DL3A 2OPSA 4P2SA 1NHKL 4DQQA 1KVIA 3QSYB 2ASLA 2B5JA 4URQU 3PO5A 2PA8D 1Q95G 5EWEA 3DGPB 1Y1VK 2XCAA 3HXMA 1J5EJ 1FNXH 3I4NK 1HD0A 4IFYA 2R7ZA 2RAQA 3WQPA 3OJUA 3EQLA 3I6PA 4V19J 2BOAA 4DR6F 1G7CB 3CCRS 4MIAA 4I2PB 2BJDA 3QMQA 1K0TA 1RLDA 2OTLS 3J7ZT 4ID5A 4QIFA 2M7SA 2MQPA 2HBYB 3LAJA 1REVB 5CYQA 2MQQA 1M5SA 2NXCA 3V6DB 4DQSA 2W4DA 3JQKA 4KAIA 1FFSB 1SQFA 1Y00A 1FK9A 4G1IA 4ZCMA 2IMOA 3VVUA 1JQWA 2HAFA 5KOXA 1SFOA 1T9XA 4A8SA 2WRMA 5DDPC 5ETPA 2KVQE 1WOOA 5KT5A 1WTBA 2A6HA 2OEKA 2HS0A 1OS5A 1YHQS 5DS7A 5F8JA 4LF5J 2NVTK 4IG0A 1TAQA 2QL5B 5A8WB 1U7LA 1BWEA 1YTYA 5JJBA 2UUWA 4WXOA 4TVAB 3KK2A 1DAXA 3CXCR 2Y8WA 3CUNA 3HZEA 1AW0A 4LR9A 4LR8A 2PHCB 2XMUA 4NLGA 4DCOB 1KS2A 3TUIC 4ECRA 2DXDA 4FS2A 2RF2A 1WG4A 5F8HA 1G2EA 3BN7A 4PG8A 1RTHA 4NASA 2ZBPA 3IAS9 5KFLA 3KTQA 1PC4A 4KGMA 2JA5C 2U2FA 3HOVK 5LOQA 1S6PB 1VIXA 1D09B 4M5NA 2NXEA 3Q2TC 2BQUA 1GTEA 1XC9A 1IKYA 4L75A 5H9FJ 2ASYA 4ZPWR 3TEGA 3MTJA 3BGUA 4ED0A 3ZZ0A 1PJ6A 2HNZB 2LXFA 7FD1A 2ZUAA 3SQGB 1Y11A 2ZHBA 2ATCB 3MMBB 3TZXA 2R7XA 4DSLA 2YWGA 4Z2XA 3DYAA 3OJSA 4CTAA 1U6FA 4DF8A 3N5FA 5B0CA 2VBXA 4NZ7A 1BJTA 2XO6A 3IWLA 1U1KA 3BQ1A 3GTKC 1NNDA 1ROFA 2H48B 3FEYB 2F8EX 4GFQA 4A93K 1EARA 2RGRA 2Y8YA 1RAAB 3W62A 1JK9B 2HG4A 4LLGA 2CADA 1PAEX 4GTEA 3GJTB 1ZXOA 3I4PA 4FPIA 1S7IA 4C2MA 1IBKF 3LP2B 2NVYC 2P2CB 4DDFA 1ZVUA 2YY3A 4U9RA 4UQTA 3PG9A 1M1KT 5L38A 4LFCF 3T02A 4DG1A 2ZHAA 3LAMA 3GJSB 4LVNP 3Q8UA 1XTZA 1C1BA 4KMDA 4C3MA 4D3HA 4UY8T 2Z56B 3FMBA 4ZVUB 3T1HJ 3JQJA 1QVGR 2L9DA 1WC4A 5BYRA 1R9TC 2XS7A 5HJXA 5K20B 2YNGB 4EBEA 1RTDA 1EIYB 4KQZA 5G4DA 4X4NA 1V5IB 4KHMA 3BH6B 3NGUA 1ZAXA 2QIFA 1JIHA 4DN0A 3VCDA 4MYTA 4HT5A 2CJAA 2BBEA 1O27A 2DGOA 4ZN3A 1YNJA 2Y9HA 1X4FA 4Y3CA 3OVSA 1CEZA 3NXZA 1NB2A 5KG5A 4ES2A 2J6TA 3EYZA 1K1QA 4RW6A 4ZCKA 2MKJA 3HSZA 4DUYJ 5KFAA 3TRGA 1S7HA 4N77A 4BC9A 3S7RA 3OXLA 3H0GK 3PRBA 2PFFB 3C6TA 4ZKAA 2B9EA 3HO1A 4ZPBA 2XBPA 4EMDA 3UO0A 3HF5A 5IT9Y 3LWLA 4AL5A 1LWCA 2CQIA 4QPTA 2IFXA 2BV3A 2DR7A 5L9NA 3VQTA 2VPWB 2QLXA 1QD1A 4ZLNA 2V8DA 3RBDA 4B9UA 3QAEA 1IR0A 3A12A 3UCZP 2ROPA 2HNYA 4ECTA 2OLWA 1RA7A 4IUFA 2HVHA 1P9YA 4JI4J 5J2MB 4C3HK 3DXJA 1B7FA 3R6LB 2JA8C 1D9DA 3DRSB 4TY9A 5H1SV 4MTPA 1WQHA 1GMUA 2IRUA 2O5IA 2DXEA 2A2DA 1HWJA 3HK2A 3CMES 4DPTA 3M8PB 3FOFA 3W1YC 1Q86T 2BX6A 3IO1A 4P7TA 2KRRA 4GKJF 1U2FA 2WVBA 3PO3C 2VG6B 3M3YC 2M52A 4O2DA 3C6UA 3MEGB 4B17A 3SEOA 3D1HA 2B4UA 4WJBA 1H6KX 2ZDOA 2ADCA 2JA6A 1JJ4A 4TLRA 1DARA 2CQDA 3DLGA 2V6TA 1SVDA 5D78A 3PIPQ 1C0UB 1KKHA 2V2KA 2PC6A 3NS7B 3TTGA 4JI1J 1R0CB 4YB5A 2D3ZA 3V4IB 3M9OB 4U7UD 2PI5A 3I32A 1WKJA 2EC2A 2DHHA 1G4CA 2XZDB 3TI0A 3MM9A 1VQLS 2LXIA 2OPRA 3FZBA 4S0MA 3FCHA 4EFAC 3UDCA 1YJRA 3LUYA 4IQMA 1UWBB 3PW4A 4CO1A 2A0FB 1E6VB 3EZUA 3QSIA 3MMCB 1FFGB 2BVZA 3IBWA 3POTA 1CPZA 2Y0SL 1MMLA 4P10A 3PEJA 4FYWB 3J81Y 2R8HA 4BXXC 4A3DC 2ASDA 1PAUB 2UUTA 2DR6A 2CQ3A 5KG2A 3RAQA 3CC2S 1KFSA 3FKIC 1RAIB 3HSDA 1HQUA 2ZWPA 2IA0A 3ET6A 4I69A 1N36J 4OI0A 5DETA 2VUMK 3M1VB 2L48A 4OIXA 4DSEA 2XYGB 2N3OA 5J1NA 3ETOA 1RU2A 1PYOB 3BUEA 1G51A 2FHJD 2FLNA 2QYGA 4RNHA 1FFWB 2IIHA 1TL3B 3OBIA 3DKDA 4NXNJ 3D5MA 4AYBD 2I1RA 2FJDB 5F8GA 2LDYA 2HSEB 2VFVA 1TWCK 3R5BA 3PYDA 2KRBA 3PFOA 1ICEB 2JH3A 4USTA 2AJQA 5F3ZA 3HT0A 1BD6A 1LW0B 3T6BA 4C0BA 4R25A 1SC4B 5L9XA 1B4BA 5GAGU 3OR2A 2CZ9A 1NAQA 1M5VC 4DUZF 3KUEA 4OINA 4QWDA 3DM2A 2V67A 1KONA 2H9ZA 3LPXA 4BLBA 3I96A 3QGIA 3T6JA 5ETKA 3CW2C 1XXAA 2GHWA 2P9CA 3DRPA 3B4MA 2JC1A 2KZZA 1IBLF 3IMQJ 4NA2A 3KNGA 1SUQB 3MECA 4RBTA 5HMWA 2KXHA 4ILLA 1S1UA 4JI8F 2HHWA 3S1MC 2NQPA 1TFYA 8AT1B 2GO9A 4MKVA 4CO4A 2OMOA 3G9CA 1M1HA 2MTLA 3MZIA 2C2MB 2MYFA 1T9TA 2NCKL 1X5PA 2V4JA 2V8HA 3G96A 1QAYA 1OO0B 1UEKA 1U2CA 1XZQB 1HHQA 3GFZA 1RWXB 2Y0SD 3NKYA 1R6VA 3WIUA 2OTJS 5JUMA 1OIAA 3QZ7A 1RT2B 1ZPVA 4Y2IA 5DO2A 3MR3A 2J76E 3HHLB 2WVCA 2CQ0A 4KB4A 3CD5A 3MPVA 2DY9A 3HOUK 2DCUB 3JSMA 3MPYA 2M8DB 2F4VF 3MURP 3S1RC 1QUPA 1NKBA 1HNXF 1ZBSA 4Y0FA 1HQMA 4NEZA 2YNFB 3N0BA 3GTJA 4Y00A 4KR0B 2V2VA 2DRDA 2H4WB 4Q8FA 5IYBK 2X3GA 1SJ4P 2HZCA 2BE9B 3EJMA 3FGVA 4IDKA 4CLSA 1ZZNA 5K8OA 3N79A 5IOQA 2JFDA 1GNKA 3W8GA 3ZZPA 2CDRB 4CO0A 4YHHJ 3HVTA 3PJ9A 1Y1VC 5KFDA 4MMOA 3H90A 2AJ2A 1APSA 1U6ZA 4QR2A 1IBCB 3FSYA 2VC1A 5B7WA 2BW2A 5C24B 3OT9A 3W65A 4B3MJ 4CYUA 4DV7J 4NRUA 6FD1A 2QL7B 3BB5A 1UFWA 2OI2A 3O8WA 4RNMA 3OLBA 4JV5F 2W9CA 2WONA 2IVMA 1F7UA 3NAIA 1S99A 2FHMA 2VKZG 3H7HB 4NLTA 1N54B 1DY3A 1RCOB 2XMKA 3KK2B 2H5IB 3HJVA 2LEBA 3CIMA 4FKXA 2HQIA 4RJVA 1T9YA 3NWRA 1SKSA 1NEEA 4NZ6A 2D9PA 4JI7F 2ZNYA 4OZ0A 5KFFA 3PJWA 2BXJA 3V6KA 1TUVA 2EEYA 4X4UA 4ALZA 3N3YA 3WBZA 4F7VA 4A8WA 5JVHQ 1JJHA 1HBMA 1P9QC 1U1OA 2KYZA 2RF2B 3W9IA 4IOAQ 1RTHB 4NRTA 2O5DA 3EPGA 1BMQB 4OV6A 1UW9A 4WYLA 3AXKA 4NLPA 4CDIA 1CJKA 2YKMA 2HRTA 3Q2SC 1D8ZA 3M2VA 2QX0A 2CPZA 2HRYA 4X62F 2WCXA 3KG1A 2LMIA 4O4RA 3GYGA 2A68A 1IKYB 3AH5A 1U0HB 2PMWA 4DPWA 4NWBA 2ERRA 2DR5A 3DOKA 1F3FA 4CLPA 1E6YA 3RAXA 3EMTA 2NS1B 5KFRA 1N52B 4Z7CA 4LSLB 4DZDA 2V4RA 4ZLPA 3G8QA 2DGQA 2Y0BB 1T05B 1H38A 2CWKA 5E0OA 5CHCB 3VZIA 3WC0A 2V8PA 1PJ7A 4R5PA 5KT2A 3R5JB 2XNQA 4N47A 3GTPA 3FNNA 2OD4A 2JNJA 3I56S 1SJ3P 1HW9A 1U25A 3KUHA 3BGFA 1O2FB 1DLOA 4CH7A 4CT8A 4ZVEA 1VJQA 4ERDA 4KMHA 4K5RA 4JI6J 3HJFA 1KR4A 4HACB 3WZ0A 5C4JK 2KG1A 4ZPAA 3U1LA 4FBTA 1SB6A 2V6SA 1G1XA 5TMCA 2MGZB 1VH2A 2BKNA 4XIUA 3P96A 3ZZOA 4A3IC 4JYAJ 4B9SA 3GTMC 1TFWA 2QMWA 4LT6A 1WC0A 1J5EF 3GFYA 4DG1B 4ZIWA 2B4VA 1RYRA 1MROA 4DEZA 5HP1A 3IM9A 2VQEJ 3M8ZA 1ZTTA 4FDFA 1C1BB 4PWWA 2HURA 1VQ8S 4DDQA 1WTFA 1FX2A 4B3RJ 2HFSA 1S0VA 1OQ6A 4A8QA 3MFHA 3M2UA 2ROGA 3F73A 3CJKB 1B0TA 4WU2A 4UW2A 4IFVB 3L7OA 4A46A 2CPYA 5KG3A 5HO4A 2W7OA 2YPYA 4C7QA 3IWXA 1U26A 2QJ3A 2J7UA 4KM8A 2IAJA 4ES1A 3EX7B 1HBUB 3PR4A 4PQAA 3O44A 2KWAA 1VMBA 2GFFA 3DN9A 2ALYB 1SQEA 3N28A 2B51A 3I0SA 2XWXA 3OFHA 1V3RA 4DFMA 1YIJS 5A76A 2PFDA 3BYPA 4DMZA 1KHWA 3MWBA 1EI6A 1J98A 3U1MA 5FLMC 2DPIA 2NVQK 3H98A 3G71S 3VGTA 1CVJA 2ZH2A 1XNRJ 1O0PA 1GTHA 3MR6A 2FJWA 4Q8EA 4XO0A 1HHSA 3N6MA 3AH6A 1NK4A 3GZ7A 2QMUB 5HQMA 2D6FC 2UZAA 2BJ1A 3ZZTA 2YU9A 1KLMA 2ZE2A 3H25A 2MDAA 1NLKL 2DR9A 3CDBA 5C25A 1L3SA 4OYOA 4GT9A 1XR6A 1HMVB 5K8MA 4AQYF 4A8YA 2QC3A 3MM5B 4J9LA 3BV8A 4F2RA 2BE2A 2G1DA 3D9BA 3PW0A 2V5HG 2HNYB 2OAUA 1VQYA 5THWA 4EZ6A 3I0RA 1TWHC 3MMJA 5KG0A 3DLLQ 1I3QC 3DU5A 3HKWA 1HI1A 2BW7A 4YP3A 2QFJA 2W7PA 1JNRB 3KLHB 2VPYB 2F63A 7FDRA 1AT1B 1M5PC 4ZLJA 4GTCA 1P6TA 4QPXA 2EK1A 4OZ3A 1CBKA 1R0AA 4XLPA 3KK1A 2PD1A 1HWUA 5J1PA 2BMBA 4YFKA 2R7VA 2YKNA 4TQSA 2JA7A 2UP1A 2E5GA 1SH0A 1S5ZA 1O51A 2ZH8A 5DQIA 3TARA 2GCFA 4KGXB 3JSRA 4J9VA 3MM8B 2W4CA 2Z0GA 5C4XK 2Q6BA 1FE4A 3OR1A 4LF4J 3M2RB 2EBBA 1KEKA 3HVAA 5CD4A 2QYCA 5IOTA 1HWIA 2FHJA 5DQGA 2LU1A 1W2IA 2IJNA 1Z1ZA 3OL8A 3P45B 1IM6A 3SZYA 2CYYA 4OZLA 3UN3A 2UXDJ 1GXLA 3CD7A 5GADI 3HMJG 1JLCA 5JFEA 4F0KA 3POTB 4XDDA 2HYIB 1C0TA 3QBCA 3T9NA 3T1HF 4WP9A 3QNWB 4O0IA 4HLBA 4FYYB 3ZZYA 3M8SA 5IP7C 1M5OC 1YITS 2XCQA 4OJGA 1JB0C 1HQUB 3BYRA 3DCAA 3ET6B 4DQIA 1FRLA 1F5CA 3MM6A 1KC8T 5K5MA 3P49B 3MEDA 4TY8A 4UOHA 2XWYA 1UA1A 3VWSA 1CULB 4FYDA 1KVKA 3M05A 2C2OB 5KT3A 3Q23A 3NS5A 5I3QA 2D9OA 3KLGA 3QAUA 4PWDA 5C7PA 4LIWA 2LQBA 1GX6A 3E8OA 3HKZL 4WE1A 2CQBA 5ETVA 2VUMC 3V6JA 2D3UA 4M5HA 5KFVA 4JV2A 4QYZJ 3N4WA 4QIWL 2M88A 2DNPA 4YY3J 4YB7A 1R31A 3NOGA 1RU0A 2YNIA 1RTIA 1NK6A 2R3VA 1V3SA 3DM2B 4LK1A 2QG9B 1TWCC 2CVIA 4WWSA 3H8YA 3W2VB 1O24A 4DR5J 4H4MB 1NU4A 2DRBA 3VA7A 4GVBA 3DRPB 2I38A 2ASJA 4F4YA 2E29A 1IVZA 3LPEA 4CLKA 1FESA 2HHXA 2YQ0A 1TVRA 3TZWA 1S1UB 3GYNA 1KQSR 4URGA 4RWXA 1TL4A 4ECYA 2ZZTA 3KLIB 1P1TA 2V4JB 3OVAA 2GNKA 2MLYA 1RWPB 3TZYA 2E2HA 3TR5A 1SJFA 4OYMA 2PO4A 2W1BA 4DX8H 2CVEA 3T1YF 4G1QB 4MEXA 1MU2A 5I42A 2C3YA 3QFHA 3GIRA 1ZYQA 2GA7A 4DR7J 2FVSA 4OIPA 4KMAA 1FHTA 4BCAA 1I50A 4ECQA 3SXLA 4F8RA 4AUKA 2JFKA 1XN9A 2O67A 1Q8BA 1VI7A 1IR1A 4B9LA 3PXGa 3SV3A 2Q79A 1RJJA 5DZ6A 3JSMB 3RB0A 2QLFB 1MN9A 3ZTPA 1S6QA 1W2BR 4DXLA 2CPHA 1NBEB 3GCXP 1FWPA 4C0HA 4JI1F 1XR7A 1HARA 1U6BA 2FGOA 2K7JA 3C2PA 1LV5A 4DV1J 1JLFA 3I4HX 4QQBA 2ZOGA 1WEYA 2Q1LA 4WJ3M 2XMWA 3HKZD 3PHTA 1FT8A 4F26A 1BLUA 3C15A 3IBFB 2GAHC 4QIWD 2V9KA 3PZPA 3RYLA 1NJWA 3IWNC 1DJ0A 3HVTB 2JSXA 2LQ8A 2HEKA 2P8IA 1R8AA 3W7BA 3GV8B 4CLLA 3QT8A 3LP0B 5K14B 4ED6A 1RBLA 1VQKS 1MW7A 4BWJA 3IM8A 2CQ4A 4V1Ak 1VQ7S 5D8HB 4A4JA 4ZPCA 4AFFA 1RBAA 4J9NA 2WONB 4URSA 1HR0J 2HK3A 3HI9A 1Q0NA 2ADBA 4ZVPB 2HRUA 2GJFA 3GTGC 1Q79A 2EXUA 4K4YA 4G0VA 1XMOF 4O23A 3MGJA 2XG8A 2XHWA 2QL9B 1W26A 3DI6B 2YQ3A 1AB8A 4RL1A 2DR8A 1O25A 4XSZA 4LJZA 3V6HA 4FYXB 1I6HC 4K4UA 5M3FK 1OSCA 4QBUA 3IR5B 4A3GC 1WCMA 4K2XA 2DHAA 5IYCK 4P71A 5LL6d 1UPPA 8RUCA 5KG4A 2HHQA 5AE2A 3J81U 1Z2LA 2DO4A 4RKUC 1EQRA 3D0GE 3BZQA 1CJKB 1MWYA 2YKMB 1RHKB 1TKXA 4N76A 3Q8VA 4UTGA 2EBEA 2XI3A 2VG7B 3LA0A 2CNKB 2NXNA 1H2VZ 2MQOA 4GTLA 2OIHA 4OYWA 4JP8A 2JA6K 3DOKB 3G6YA 1TWAC 1EETB 3BSAA 1S0OA 2HMIA 1RWNB 2KZMA 4K4ZA 3BM7A 5SZTA 3OHBA 3EWGA 5G0RB 3BDPA 4QWEA 2JVRA 4WFAQ 1UFLA 2XSJB 3JAMY 3RW6A 4DV4F 3MHYA 3MUVP 3UPFA 2JOQA 2IYGA 2A6MA 4J9PA 2LCWA 3BH7B 1WC6A 4ICLB 3WHIA 4AXIA 1DLOB 1SC3B 3HFVA 2OPQB 5L1IA 4B3TJ 3HOZC 4I7FB 1OWXA 5A0YA 4A3MK 2RUGA 2AJFE 1JNZB 2E2JC 5I3UA 1P27B 2W8LA 4E0DA 4L76A 1OY8A 1LWFA 5GAHI 4E98A 1WD6A 2YWWA 2KFZA 4DX6A 3PO4A 4CO3A 3OTBA 3AA9A 3UDEA 4JI0F 5HL7Q 3TJ9A 2B9WA 5HQ8A 4PG5A 4JB8B 2R2RA 3G8SA 3CJ4A 2EG1A 2YXLA 4ED4A 1FKAF 2XCPA 4K4VA 2CJKA 3Q0AA 2O66A 1JXLA 3DFEA 2AYBA 4USMA 3I31A 1EH1A 1D1UA 5L39A 4ER8A 1RHMB 3RR7A 4YHHF 1M5KC 1QSSA 1DTQA 2VJUA 3RBXA 3CAGA 2EI5A 4NLVA 3KK3A 3C14A 3TYTA 1GMVA 4IH6A 2R92C 4TYAA 1WIHA 4O3OA 3ERED 4DV7F 5KFTA 1HBNA 1XBWA 4LF1A 4AE5A 3GTQA 2ZM6J 2ZVSA 4WKRA 3S15K 3I0SB 1T95A 4LUBA 5B0GA 2AW0A 2VFTA 4I6AA 3K2YA 2EFPA 4LR7A 4ZVHA 4KDDA 4PAAA 1L3VA 1S79A 4G7HA 4USWA 2G9OA 4ED8A 2RDDA 4ZVOB 4NYPA 5IP9K 4LBHA 1FRJA 5LXRA 2RMLA 1I3OB 2Q43A 3I5CA 5AT1B 1KLMB 4Y52C 2D74B 2QEXS 2ZH4A 5C25B 2HBRB 2IVYA 3EGNA 1PYSB 2P5VA 2GJ2A 2VJVA 2KFNA 4A3KK 2BE2B 3GR0A 2XYHB 1R8HA 2LQ5A 3GSIA 2RU3A 2YX4A 3RRHA 4J9RA 1MLAA 4ZJOA 2B7BB 1LWEB 1UEUA 2WBRA 5E2QA 1VISA 3I0RB 4OQJA 4N5SA 4WZQA 2YKOA 4LFBJ 2MJUA 3AXMA 1NHVA 5HL8A 2FY8A 3CULA 1FDAA 1RAHB 2M4MA 2QV6A 5DM7Q 5GAEI 1F2GA 5J2PA 2G2OA 4RPFA 3TJ8A 2DNYA 2V34A 3GTJK 2EG2A 4YN3B 1HQEA 3W9JA 4O44A 3CCQS 5KT4A 2EK6A 1ZOTA 1VRTB 1R0AB 4P2FA 1UEVA 3KK1B 3NNAA 5AXMA 2YKNB 4CLUA 3QX3A 3KXDA 5HMYA 3HZGA 3S8SA 3K8VA 5GMKa 3RBZA 3R3TA 4C48A 2FYXA 5B0AA 4J9KA 4F0MA 3MCOA 5MAOA 2ZD1A 1R6YA 4JI2F 2CQ1A 3W60A 4DOZA 2MQ8A 4RBVA 3KJVB 4RUHA 3M4XA 1BXNA 3OR1B 3QJJA 3EDRB 2W2MP 3FKBA 4X4TA 3I5BA 4DU7A 4FZBA 4DL6A 3W2WA 2MHNA 5J2NA 3RJMB 3DRRB 4IR1A 1R7IA 2AZ1A 4JYAF 4KSEB 2APOA 1XMBA 2C1EB 5HN0A 5HMZA 1IBAA 1K0VA 2YU9C 1U47A 5BXIA 4LF8J 1EK8A 2VPZB 4PXBA 3DGPA 3E2EA 3EPIA 1EX8A 2CA9A 4J90A 4B9NA 2Y1JA 2E7VA 2VQEF 3D6FB 1Q4RA 1HI8A 2E5LJ 1NDCA 2R9LA 1VQMS 4I2PA 1NJYA 1RE1B 4KHPJ 3S16C 3SSQA 2D7SA 3HVWA 4PG4A 3ENVA 2DY1A 2AHOB 4WBFA 1REVA 3K57A 3NGKA 1INNA 3P5BP 5GADU 4UUWA 1UV7A 5D4LA 2OSRA 2G1HA 1GAOA 3VAHA 1WF2A 3MEDB 4M5DB 5KOWA 1EKRA 4KGKA 2D1CA 3M9NB 4I67A 1FKOB 2L3MA 2IBOA 2JWNA 3VGUA 4RU2A 4OL8A 2MY8A 4OZNA 1SV5B 4PWDB 4Q4ZA 4PWUA 4J9UE 3LWMA 3NMRA 3GTKA 2BE7D 3T41A 4DI6A 1ZM3A 1VJEA 2RQCA 2XCOA 1H73A 2CWXA 2JA7C 1USMA 2CDQA 4YR3A 4FF1A 3HOWC 4OX9J 3MPDA 3FQKA 1XNRF 2C2NA 2MKHA 1WKKA 3UDLA 2YNIB 1RTIB 4X65J 4A3BC 1NRKA 2NVYA 1KSPA 1KDNA 1N56A 5HATA 2JLGA 1M0SA 4LQ9A 3GTPK 4NYOA 1FXLA 2CFAB 3CO9A 4OJ1A 1SKWA 1WHWA 5AJ3F 1TUWA 9ATCB 2JJ4D 4OFZA 1TR0A 1YI2S 2UUBF 4OZ2A 1TVRB 1NZAA 2AQ4A 2LQ9A 1S6PA 4MT1A 2I5JA 1WOSA 4X6AC 3MMLB 1R9TA 4DR2J 5KFQA 2RVJA 1ZAWA 2HFNA 2QSWA 3NCRA 3J7YI 1DRZA 1L3KA 3OFFA 1GFWB 2M70A 4A3CC 4FF4A 5F8NA 1MU2B 3PCOB 2LA6A 4DZ6A 1AXQA 3MMBA 1XMQJ 1WDDA 4MK7A 5E41A 1LWXA 2HHTA 4LFAJ 3THPA 3ENAA 4H4KC 1F9EB 2L9NA 1RGVA 1HYSA 3BP3A 3H42A 4DFPA 4OIOA 3UWTA 2QT7A 4PPDA 5HROB 1B99A 4LQ3A 2A10A 3SBMA 2MMYA 3CE8A 3ENWA 5IS2A 1U1MA 3R7NB 3DDKA 4GTDA 1LNQA 4JUZA 2NPFA 2GIFA 4NMLA 4CLZA 1J5OB 4LF4F 4CNZA 2DNHA 3AT1B 2YPZA 1VLYA 3K59A 1JLFB 2QMXA 2HNDB 2F8HA 5KFSA 3DRXA 2RU9A 3S01A 3IXQA 3EXYA 3LP2A 5DDOC 4LSZB 4UF4A 4USHA 1YZ6A 3CCJS 1IWAA 1NM2A 2XZWA 3C15B 4KO0B 3OL9A 4HYKA 1VS3A 3CDEA 3BPSP 2GZOA 2FVPA 1RTZA 5KFWA 4CLYA 3D1QA 3P3DA 3K5LA 5F8MA 2E2IA 3IGNA 1JMTA 2EKNA 3K7AC 2E1CA 5CXTA 4DBQA 4A3JC 4CLWA 2V50A 2W2NP 1JX4A 5C2GA 3V81A 4ZVRB 3DHXA 3I87A 4NLWA 3CQZC 2YNGA 2LP4A 1G3OA 2IPOB 1KN6A 1SMYA 4ZPTR 4KC5A 3HSGA 2MPUA 2PEBA 3IR6B 5C3EC 4RUCA 1RBOB 5L8RC 5FDLB 4MAKA 2B63C 4JV1A 1WC3A 3CJ8A 2LEAA 2UXCF 5C42B 3HOXK 2WVDA 1T0TV 1Y1WC 1FDDA 3FDSA 2DHGA 4P72A 4U7UK 1REGX 1CJVA 4GC6A 4D3GA 5DZ7A 1LXNA 4C3IK 3HDSA 1EKSA 2OP5A 1DURA 3MAAA 2DO0A 4YY3F 4USUA 3AB4B 1NCLA 2BM1A 2H1YA 3J80Y 3CJRA 4ZIVA 1B70B 1X9MA 2FGCA 3FVYA 1S1XB 4GO7X 4DSJA 4QWAA 2Z58B 3HOYK 4YDDB 2KG0A 2HS3A 5HK4A 4QJVA 3ONQA 4ZVSB 3EE3A 1ZTWA 3MM7B 2HLTA 5F0UA 4RNFA 3S14C 3AQOA 2VOPA 1Y9OA 1GK8A 3VAKA 1TWGK 1NXIA 2HMIB 4DL0C 1USOA 4KN7A 2LEPA 4BS2A 3CT9A 2O3DA 2W4PA 4A3EK 4QYRA 2E5HA 1H2TZ 1S1VB 2QA4S 2XLKA 4C8LA 3FKIA 3DRSA 1N32J 1NKEA 2D41A 2EW9A 4A3FK 4NLSA 1MG7A 2JC0A 1MMNA 2FDNA 4NL5A 5T14A 2GV1A 2B6AB 2K3KA 3AQPA 3QIPB 2BRKA 3TX0A 5CYJA 2X1FA 4NLYA 5I3UB 3H2UB 3MEGA 5TJ3A 2CQGA 3OPKA 3KUGA 1WF0A 1N6QB 1CC8A 4B3OB 5IT0A 2E1PA 4R0EA 5C44K 4ZH4A 4CQ1A 1IBMJ 1HA1A 3B54A 3R1LA 1YRTA 3TAPA 2G4BA 4ZVFA 1B3TA 2XQCA 4OHVA 4NLOA 1C0UA 2CPIA 2W7VA 2FJEB 3ZTSA 3V4IA 3SZ2A 1WCMC 4DV1F 5GAHU 4USIA 2BJ7A 4RUBA 4DL7A 2Q3PA 2OMLA 3HFZB 2WAQL 1TKTA 5FJ8K 4H54A 1M90T 2DNKA 4AL7A 3N0VA 1KTVA 3Q8YA 1N34F 2ALZA 4LK0A 2V4QA 1DTQB 3PEHA 1OPZA 5ETMA 1HKAA 3ILLA 3FZ2A 2R93C 1YJTA 3KOAA 1CS4A 1E6VA 2WZ1A 3MMCA 3TVZA 1K73T 2E5IA 2YX7A 3OVBA 4PXDA 1ZYRA 4BY7C 3FOEA 3N01A 1SXLA 4YUDA 3PV8A
chains in the Genus database with same CATH topology
1YX2A 1XZQB 1WORA 1XZQA 3GEIA 1WOSA 1PJ5A 3TTGA 4PABA 1VLOA 2GAHC 1WSVA 3GIRA 3A8JA 3A8KA 3A8IA 3TFJA 2GAGC 5L46A 3AD9C 1XZPB 4PAAA 1XZPA 3AD7C 1PJ7A 1V5VA 3GEEA 1WSRA 3TFHA 3TFIA 1VRQC 4P9SA 3AD8C 3GSIA 1X31C 3ADAC 1PJ6A 1WOPA 3GEHA 1WOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX2 A;  1XZQ B;  1WOR A;  1XZQ A;  3GEI A;  1WOS A;  1PJ5 A;  3TTG A;  4PAB A;  1VLO A;  2GAH C;  1WSV A;  3GIR A;  3A8J A;  3A8K A;  3A8I A;  3TFJ A;  2GAG C;  5L46 A;  3AD9 C;  1XZP B;  4PAA A;  1XZP A;  3AD7 C;  1PJ7 A;  1V5V A;  3GEE A;  1WSR A;  3TFH A;  3TFI A;  1VRQ C;  4P9S A;  3AD8 C;  3GSI A;  1X31 C;  3ADA C;  1PJ6 A;  1WOP A;  3GEH A;  1WOO A; 
#chains in the Genus database with same CATH topology
 3LAN A;  2E9Z A;  4XDC A;  3MD3 A;  4DPY A;  4C8Y A;  3NCQ A;  2PA8 L;  5M5Y K;  1PG5 B;  4RU9 A;  3I9Z A;  3GEI A;  4C6A A;  4TN2 A;  2BQ3 A;  3I55 S;  5JXS A;  4U8Y A;  4BBR C;  2HBQ B;  4KAR A;  1NJZ A;  5M2U A;  2GMJ A;  3CJ3 A;  1LFW A;  2H65 B;  1S4F A;  3MUT P;  1QJH A;  1LW0 A;  1KD1 T;  1HPZ A;  1C0A A;  3S2D K;  5E33 A;  2E2H K;  2W9B B;  3M4O K;  1ZM4 A;  1NK0 A;  1YJU A;  2HVI A;  2MSS A;  4P73 A;  3RB4 A;  2FVR A;  4NLD A;  1I50 K;  5F3T A;  1OSD A;  2JL9 A;  4OHZ A;  3NBP B;  2O1P A;  5EWG A;  1FNO A;  2GS8 A;  3L3C A;  1GX5 A;  1QTM A;  1Q1K A;  1WOP A;  2AJ1 A;  2LQJ A;  5EX0 A;  2BJE A;  2HWT A;  2XSF A;  3CMA S;  5IQ6 A;  3W3S A;  1Y1V A;  3H3V D;  2VL1 A;  2RHS B;  4C11 A;  2V8V A;  4O3R A;  4X64 F;  4M8L A;  2R7S A;  1DQA A;  1SUQ A;  5LMU J;  1D0E A;  2JEG A;  1BQN B;  1TMJ A;  3BF4 A;  2HAI A;  5ITH A;  4FP9 A;  4TKT A;  1SH2 A;  1HQE B;  5FD1 A;  4YFU A;  4BBS K;  4C45 A;  4ECS A;  5HAN A;  2K1R B;  1H2U X;  4WFX A;  4ZHR A;  1N88 A;  3S17 C;  5IYD C;  3HXA A;  1J2V A;  4EU0 A;  2RB7 A;  1XZQ A;  4B3T F;  4DU8 A;  4ZVT B;  2X1B A;  2YH0 A;  2J9C A;  2NXU A;  2AGQ A;  2B7C B;  3UN5 A;  3CCV S;  3A3P B;  2NUU G;  5E3P A;  1URR A;  3CC7 S;  2LYV A;  2B56 A;  5SUH A;  2CG8 A;  1LK7 A;  2CPX A;  1EAY C;  5ETT A;  5J2N B;  3W2W B;  1J6V A;  3QWU A;  1O6X A;  3RZD K;  5CHP A;  1QAJ A;  2DIV A;  1L3U A;  2YNF A;  3WIV A;  1RZM A;  2PT0 A;  2UXB F;  4DPO A;  2CG4 A;  4Q2L A;  3RZO K;  4GRS A;  3PIO Q;  2Z30 B;  3VR1 A;  3M9M B;  2MZR A;  5KT6 A;  4NXM F;  3Q3Q A;  2XB2 D;  2WBM A;  3T9Z A;  4FN5 A;  3QT7 A;  4OI2 A;  4YFX A;  1K8A T;  1HNZ J;  5ETN A;  3W66 A;  3MCM A;  3NWG A;  3UR3 C;  4PAB A;  1XR5 A;  2ZOM A;  5DGB A;  3LGM A;  1TMM A;  1EQ0 A;  1CJU B;  3A3N B;  3OUY A;  4NLR A;  4BY1 C;  3HX9 A;  1N5S A;  2ZZM A;  1ISE A;  1Q78 A;  2DKO B;  2V2Q A;  3R7S B;  5C24 A;  1OYE A;  1D3W A;  2QRR A;  1K83 C;  2J0Q D;  2UUC J;  2RE1 A;  4TU9 A;  1JXV A;  2NSB A;  3PO2 K;  4UOF A;  5GVQ A;  3S1Q K;  3B6B A;  3S2H K;  2KM8 C;  4K2J A;  4ZIT A;  2KJW A;  5FJ4 A;  2BZ2 A;  5HSP A;  3R6G B;  1JQG A;  4J91 A;  3CCS S;  5LMN J;  1IKW A;  1T02 A;  4WPA A;  4J9Q A;  3G6E S;  3GWC A;  5E3Q A;  1GT8 A;  1BWV A;  3ELH A;  2D3O R;  3H4D A;  2HGL A;  1JLA B;  1WC1 A;  2VB6 A;  2R7O A;  3QO9 A;  4K4X A;  2JEF A;  2AIR B;  4X66 J;  2VQF F;  2GQQ A;  2DGU A;  2F9D A;  3GTM A;  4RW4 A;  3R5C A;  3BGO P;  4DV2 F;  4ZPD A;  3TX8 A;  2ZUG A;  2X3D A;  1IUJ A;  3CJQ A;  1MN7 A;  4A3L C;  1I1G A;  2H4Y B;  1CSJ A;  2RJZ A;  4I2Q B;  1Q8I A;  1NO8 A;  2I5J B;  1TL1 B;  2ZH3 A;  5KFP A;  1Q81 T;  5LT5 A;  2COL A;  3AB2 B;  5L46 A;  3OHA A;  1U0H A;  5ETR A;  3U1N A;  3BKF A;  2DH7 A;  1R8C A;  3CNQ P;  2C3U A;  4LSL A;  1RWV B;  3NL0 A;  1T05 A;  2FHK A;  3RB3 A;  2E7X A;  1HYS B;  2YTC A;  3J7Y U;  3KKF A;  2X1G A;  2AV5 A;  4DV6 J;  3D6H B;  2CZ4 A;  1O2B A;  2R8G A;  3QFW A;  1VFJ A;  3BO2 A;  2ZIT A;  1NH8 A;  3VQS A;  4KHR A;  2F1F A;  4QR0 A;  1YJV A;  5D6G A;  4ID8 A;  1WWH A;  3JYT B;  1FDN A;  3SMZ A;  1D9A A;  1T3N A;  4HAC A;  3IP0 A;  3WC2 A;  3ITH A;  4JI5 F;  2WB1 D;  3A8I A;  3Q24 A;  1YJ9 S;  4TNO A;  2H51 B;  4DHV A;  4HL9 A;  2MGZ A;  3GTQ K;  1ZAV A;  5F8L A;  5DM6 Q;  1H7W A;  2CQ2 A;  5EGY A;  5DDR C;  4K0K F;  1UTA A;  2FQT A;  3IC1 A;  4LF8 F;  3UW1 A;  2K2P A;  4ZMM A;  2E5L F;  3OTD A;  1TWH A;  2DIT A;  1TKZ B;  3I4M K;  4L72 B;  4LVO P;  2X51 A;  1I3Q A;  4I0W A;  4MYU A;  4TYB A;  4ED2 A;  3B78 A;  1FEE A;  5KFU A;  3V81 B;  4WFB Q;  1TQL A;  4WZM A;  2VBW A;  3CJK A;  2BAB A;  3TFI A;  4IFV A;  2QLJ B;  3HD2 A;  3CB4 A;  1VK3 A;  3DLK B;  3LOU A;  3QT6 A;  2HFV A;  1XNQ J;  5EDW A;  1ZM2 A;  3SYZ A;  1SL0 A;  3NOC A;  3SCI E;  1HBU A;  5E7O B;  3W64 A;  1S9G B;  1IBK J;  5D4O A;  1NK5 A;  3A3O B;  4FXW A;  2ZH1 A;  4BDP A;  3GJQ B;  5KFY A;  1EB0 A;  1CJV B;  3V2U C;  1UMJ A;  4RLE A;  3MAA B;  2VIC A;  4OX9 F;  1L3T A;  4YDX A;  1D9F A;  2H5J B;  3HOX C;  2YKP A;  3BBF A;  3CVK A;  4X65 F;  2JEI A;  2V69 A;  4CZC A;  2XNR A;  1NPP A;  1ZM9 A;  3MOJ B;  1SKR A;  4PG7 A;  3GTO C;  4GZY A;  4HH1 A;  1S49 A;  2ABY A;  3NCP A;  4AND A;  2MEW A;  4QJV B;  3K0J A;  3PVX A;  3N0C A;  4YME A;  1PJ5 A;  2NYI A;  1RWW B;  5CAB A;  3UQS A;  1HMV A;  3MCN A;  3MM5 A;  2ZKU A;  3UI3 A;  2GSO A;  1U49 A;  1P8G A;  1FDB A;  1JLE A;  2UUA J;  2C3M A;  1VK8 A;  2WW8 A;  2HQ3 A;  2E2I C;  4M1K A;  3CDW A;  3SSR A;  2B9Y A;  3MEE A;  1HNV B;  3G8T A;  2P6T A;  4ILR A;  4KPY A;  4QIE A;  3M8Q B;  4DR2 F;  4GTB A;  2XS2 A;  1SKU B;  2F5G A;  1RWU A;  2E1R A;  3NAH A;  2MB0 B;  1PBA A;  4AYB L;  1LKZ A;  4DFJ A;  1AUD A;  2C2R A;  5KFB A;  3KLH A;  2CJQ A;  2WOM B;  1TWG C;  1WJ9 A;  2CPF A;  4KN4 A;  3ULH A;  3ICL A;  1XMQ F;  4ZP7 A;  1TP7 A;  4FYV B;  4QIG A;  2YWK A;  5CJ9 A;  2JA5 K;  4LFA F;  2OGU A;  1UVM A;  2KB2 A;  1Y7P A;  1BY9 A;  3JTN A;  4LF6 J;  2VUM A;  4NYZ A;  2JDJ A;  4MFB A;  2QGF B;  3GQC A;  3D0I E;  4ECW A;  1SL1 A;  2XLI A;  3MM8 A;  2BAC A;  4LSN B;  3TEH B;  3TQ1 A;  4DV3 F;  3LP1 A;  4DS5 A;  4X4Q A;  4WP3 A;  5LJ3 Y;  3M2R A;  3S1T A;  1TWC A;  4TLQ A;  2KL8 A;  3PW2 A;  2HWH A;  2I8E A;  1VBX A;  3TP2 A;  3AOA A;  3AA8 A;  4CRJ A;  1TKT B;  4QWC A;  2RNE A;  2FQQ B;  4C0O C;  1FD8 A;  2XO7 A;  4FF2 A;  5D0G A;  1U1N A;  4OYX A;  4GKJ J;  3GTK K;  4HEA 9;  2L9W A;  5ETS A;  2Z2Y B;  5F9L A;  2IHR 1;  2KHC A;  2N4C A;  1V5V A;  3ZFV A;  1RTJ A;  1CS4 B;  2ZWO A;  5D4P A;  4LRA A;  1GH8 A;  3L4K A;  4L3K A;  5AXL A;  2A69 A;  1HBO B;  1HIY A;  2WHO A;  2E9R X;  4KAT A;  2SXL A;  3F0N A;  1RT1 A;  2CPD A;  2DYA A;  4LRB A;  2HGM A;  3ADA C;  1QM9 A;  4RW7 A;  1WNE A;  3D54 A;  3J7A 1;  4NCG A;  2KU7 A;  2VIH A;  2MLZ A;  3TUJ C;  3THT A;  5U47 A;  1CUL A;  2EC0 A;  3DMJ A;  2MZQ A;  2DHX A;  2DGW A;  4ITS A;  1C1C B;  1AA1 B;  2JRS A;  3MOZ A;  2XTJ P;  1NPK A;  2CQH A;  1HD1 A;  3UR0 A;  2FY1 A;  3UNG C;  1BHN A;  3GJR B;  1N33 J;  1Q8L A;  1H0H B;  2CNL B;  2GAG C;  4OYA A;  2BKO A;  2JHE A;  1V3Z A;  4I56 A;  5D0H A;  5A8R A;  1NK9 A;  1HPZ B;  1S1W B;  4NZ0 A;  3MF5 A;  2HFU A;  4ZCI A;  2VG5 B;  5IM0 B;  3L9Z A;  4F3Q A;  3SV4 A;  3DU6 A;  3RB6 A;  3W2V A;  5A8K B;  4H4M A;  3CCT A;  5IOS A;  2DH8 A;  4C11 B;  3S2D C;  4CLT A;  4Q45 A;  2AGP A;  3M6U A;  3GTL C;  2QA4 G;  3KJN B;  4DCJ B;  3QPI A;  2ZBC A;  5HLF A;  5T7L B;  2VOO A;  2O01 C;  1Q7L B;  4B9T A;  2IVF B;  1Q5Y A;  1RB0 A;  3KLI A;  4WTY A;  2BJ3 A;  4XSX A;  2RH3 A;  4ZHR B;  1O28 A;  1FRI A;  4ZPV R;  4ZVQ B;  1SJ1 A;  3SZZ A;  3TO8 A;  1VC5 A;  4G1Q A;  2YWF A;  2ZKT A;  3TAM B;  3J80 U;  4MH8 A;  3GTG A;  1FKP B;  2R2S A;  2HQG A;  3BBC A;  1TWF C;  4ZP8 A;  4QCL A;  1FJG J;  4DUZ J;  2MST A;  5CD4 H;  2FUG 9;  2NUH A;  4CCH A;  4UZC A;  1SPB P;  3BP8 C;  1AFI A;  4RBU A;  5KT7 A;  4GO5 X;  3SFU A;  1A7G E;  3PYF A;  1YSJ A;  3AHP A;  4C8N A;  3AOD A;  5JVG Q;  2H54 B;  3F41 A;  1TTH B;  1EQM A;  3CTR A;  1S9E A;  4KJI A;  2JVO A;  5CA5 A;  2CIM A;  5IWA F;  4OI4 A;  4H4O B;  3PO3 K;  4KH0 B;  3KLE B;  4JI8 J;  3VGS A;  3M3Y K;  2XEX A;  1XQI A;  2CNO B;  4LF7 F;  3QLH B;  4AL6 A;  2OH2 A;  3EZO A;  1NB7 A;  1KRP A;  3RZD C;  1IWG A;  3QRR A;  2M3D A;  5IV3 A;  4MQ9 A;  1TWA A;  2KJV A;  4Y2M A;  2J6U A;  4CNY A;  3OUY B;  3I4N C;  3RGI A;  2VDH A;  4PXE A;  1PGZ A;  4MK9 A;  5CZX A;  4DQR A;  3TOQ A;  4HTI A;  1U24 A;  2ZOF A;  3N9U C;  2VBY A;  3LP0 A;  4KM9 A;  5K14 A;  2V9W A;  2VDI A;  3PM9 A;  3MMA B;  1WC5 A;  1RT3 B;  5KG7 A;  2N82 B;  5K8N A;  1I94 J;  5L1J A;  5LXY A;  3IBC B;  2NVX K;  2K8G A;  2B8Q A;  5K9F A;  2MLX A;  1FXR A;  1KQG B;  3MTK A;  5I3P A;  4DWI A;  2DGT A;  5D3G B;  4C8K A;  4RW8 A;  4OJ3 A;  2V8G A;  1IKW B;  4ED1 A;  2Z8Q A;  2I0X A;  4RWW A;  2WTF A;  2R4F A;  3PJX A;  4HDG A;  4BXX K;  3ISN D;  2W8K A;  3DDI A;  3PO2 C;  3QO9 B;  1U09 A;  3S1Q C;  1EHW A;  4NLQ A;  3Q8P B;  3DI6 A;  2NRE A;  3K5O A;  3T5J A;  4O0N A;  3FBC A;  3NNC A;  4RW4 B;  2HFO A;  4USV A;  4KTQ A;  2Y1L B;  4Y2K A;  2CZV C;  1JLB B;  4OHY A;  3AJD A;  5D77 A;  2NVT C;  2Q6C A;  4OI6 A;  4FNH A;  3BR8 A;  1ZA1 B;  2OPP B;  5LSO A;  2QO3 A;  5CZV A;  4IOC Q;  2RKI B;  1OMS A;  3B4D A;  2ZH7 A;  3E01 B;  2VG7 A;  2W7A A;  3ZNU A;  2VU5 A;  3LF0 A;  3KJQ B;  1KVJ A;  2DPJ A;  1RT6 A;  4JV5 J;  3GFH A;  5HBM A;  1QDU B;  2R92 A;  1EET A;  2Y1I A;  2GSU A;  2BKP A;  1U2R A;  2ZC4 A;  4K4S A;  2F9J A;  2RQK A;  3HOV C;  4O3Q A;  3EVM A;  5G0R A;  3PX4 A;  3FRY A;  3DXB A;  1LXJ A;  4YR0 A;  2DXF A;  4JI7 J;  3GSD A;  3SCK E;  2XSJ A;  3PRV A;  2XMJ A;  1FRH A;  4XAK A;  4CH0 S;  2F4F A;  3MR2 A;  3TAQ A;  2ZUE A;  3CC4 S;  4MKB A;  5DLF A;  2V2Z A;  4ICL A;  2RT3 A;  4WIL A;  1S1T B;  4ELT A;  1EFW A;  5A6W A;  1IW7 A;  2OPQ A;  3C16 B;  4EWT A;  4I7F A;  3RW7 A;  3QJP A;  2ZVI A;  2AGO A;  2VON A;  1Y3J A;  4DV5 J;  1FJE B;  3PFE A;  4OZJ A;  1N5Q A;  2ZH5 A;  3S1M K;  2IJR A;  5HJY A;  4PUO A;  1AUS L;  3CCE S;  3ITH B;  4X62 J;  4CWB A;  1VHF A;  4WIQ A;  3EZ5 A;  1IJF B;  4CI0 B;  5KFZ A;  3UVJ B;  3MUM P;  5DG8 A;  2K06 A;  1IN0 A;  4DS4 A;  4LRF A;  1O2A A;  1S97 A;  2RRB A;  2D3O 1;  4A93 C;  3NNH A;  3VV2 B;  3KG4 A;  3CGI A;  4KE5 A;  3MD1 A;  3D6M B;  2CJ9 A;  1JOE A;  1HNZ F;  3LAL A;  5JMN A;  2ZDP A;  3ENQ A;  3S1R K;  3JXO A;  3VVT A;  1VDH A;  4MK8 A;  2GW8 A;  3AAW B;  2OO4 A;  4EI2 A;  4M5L A;  1YJW S;  5GMD A;  1RAO A;  2PMH A;  2XMV A;  3SSS A;  2NXJ A;  3FRZ A;  3U02 A;  4U7C A;  4CH1 A;  5CYM B;  3GP9 A;  1U8S A;  3KLV A;  4G65 A;  2UUC F;  2J0S D;  4F2S A;  4Y7N K;  1KBR A;  3OEP A;  1D8Y A;  2DNN A;  1R43 A;  5DDQ C;  4IRK A;  2HHP A;  4P7V A;  3E51 A;  1TL7 B;  4C8O A;  3OD2 A;  1U45 A;  2BE5 A;  3Q8R B;  2HZV A;  3TFJ A;  2EWH A;  5LMN F;  4FZV A;  3NLC A;  4LF5 F;  3FUY A;  1FRM A;  2FTR A;  1SJQ A;  1RLC L;  4OLO A;  4UZB A;  1WUU A;  4TXS A;  3KNA A;  2FC8 A;  3OTO J;  3A8J A;  2JEJ A;  2ZEJ A;  4X66 F;  4G1P A;  4F4K A;  2HHH J;  2VFR A;  4F25 A;  3I82 A;  3CED A;  3MXH P;  1WQG A;  4E2F B;  1T94 A;  4O3N A;  3V5R A;  2FQO A;  2BAN B;  2QA1 A;  2AJ4 A;  4OLP A;  2PI4 A;  1H98 A;  4DV0 J;  3RZA A;  3A8E A;  2BJ8 A;  5IQQ A;  1B0P A;  3H0G C;  1JLE B;  2P9E A;  4J37 A;  4DSK A;  1OPI A;  1LWE A;  3MEE B;  4Y2C A;  1BQM B;  3D7S B;  4ZP6 A;  1CQN A;  4PQU B;  2MKC A;  4K8R A;  1Q7Y T;  3H59 A;  2H5E A;  1KOH A;  2GIQ A;  2FVQ A;  2MZJ A;  1FF2 A;  1QUV A;  1VRU B;  4RNN A;  1YCL A;  3HT3 A;  1VQ6 S;  3AJ2 A;  2ZBQ A;  4WK1 A;  4C3H C;  1VRT A;  3M30 B;  3H0P A;  1RAB B;  3JSB A;  2R7Z K;  2E7W A;  1F7V A;  2YNH B;  3ZO7 A;  4DV6 F;  1RT5 A;  1CJT A;  2A2C A;  4MFB B;  1RWK B;  3GII A;  1KNZ A;  2AWZ A;  4GMK A;  3MPW A;  3ETM A;  1RT7 B;  4AQY J;  3AFG A;  3E3X A;  4KGZ B;  1WF1 A;  4A8X A;  2R2T A;  4DLE A;  2AT1 B;  3KJV A;  2I6W A;  3LP1 B;  1WDT A;  3O2I A;  2Y1R I;  4RW9 A;  3H2V E;  2QLB B;  2FLP A;  3VZH A;  2VOD A;  3OW2 R;  3KJF B;  3DRR A;  4DLG A;  4F36 A;  1IQ0 A;  5GME A;  1SFO K;  4EO6 A;  1DCP A;  4FBU A;  2MKY A;  2R7W A;  3R2C J;  5KFO A;  3CSK A;  2ZJP Q;  3RBE A;  5F0W A;  4BHQ A;  3QRQ A;  4O4G A;  5AXK A;  1LOU A;  2CQC A;  2J0W A;  1VQ9 S;  1RTJ B;  2FJA B;  1UPM B;  1CC7 A;  4QR1 A;  3DLE B;  5DJB A;  4PEO A;  1UZD A;  5L1L A;  5KFM A;  2WB4 A;  2YQ1 A;  3BQ0 A;  1RT1 B;  2FLO A;  4A3I K;  2DHS A;  4P9S A;  3GTM K;  4RW7 B;  5E3C A;  3IRX A;  4RR5 A;  3CD0 A;  1H74 A;  2MKI A;  4M5D A;  4NCG B;  4DL4 A;  1XNQ F;  2WW4 A;  2G2Z A;  1HL6 A;  2ZBI A;  3DMJ B;  3EGW B;  1HLW A;  4P2X A;  4H4K A;  4BLG A;  1FKO A;  3ZC4 A;  3OLA A;  2LU2 A;  1SV5 A;  2OJ3 A;  1NDL A;  1N4L A;  4DPU A;  2KT5 A;  5B08 A;  3GYX B;  2HS4 A;  3OFE A;  1QSY A;  2DCL A;  4WF9 Q;  1RQ0 A;  2ZJQ Q;  4OMF G;  1HHT P;  3C66 A;  5A8R B;  1O26 A;  4NMX A;  4DUY F;  1ZBT A;  5F9N A;  1K44 A;  5LSR A;  2R8I A;  2XY5 A;  3OPF A;  3NUH A;  1VIO A;  3M32 A;  4HR2 A;  2HPU A;  4CT9 A;  4HHJ A;  2FLL A;  4HDH A;  2DH9 A;  3L7P A;  1OYD A;  3Q8Q B;  2A6O A;  1Y4Z B;  2CFA A;  3UDV A;  1VBK A;  1UL3 A;  3SDE B;  5J2Q A;  4JBC A;  4WFZ A;  3FJ2 A;  3RRK A;  2MZS A;  3Q22 A;  4C3K A;  1X4G A;  5FLM K;  1M5H A;  4FS1 A;  2A1B A;  3MDF A;  4WP8 A;  1CG2 A;  2RRA A;  2UUA F;  1LQ9 A;  5HLF B;  4ZVG A;  2XGQ A;  2XZT B;  5F8I A;  4JI4 F;  1T03 B;  2KXF A;  2BRL A;  2A6E A;  3L95 X;  4YB1 P;  3HSJ A;  3CQZ A;  4CM0 A;  1RAE B;  4QOT A;  1NSP A;  4C2M K;  1TKD A;  3GEE A;  4L6V 3;  1DQ9 A;  3G86 A;  5LJ5 Y;  4FXD A;  3OL7 A;  4W92 B;  2K3I A;  3HP6 A;  3N6N A;  3FBB A;  2B63 A;  5IZH A;  4X84 A;  2V94 A;  4LR2 A;  1J6X A;  2L08 A;  3WX8 A;  1A0O B;  1JKH B;  1Q53 A;  2NZC A;  1AZS B;  1B4A A;  3R27 A;  1Y1W A;  2LKZ A;  2PGC A;  4IRC A;  3CWJ A;  4PKD B;  2ACM A;  5ETQ A;  3Q89 A;  4LF6 F;  1TWH K;  4ECV A;  5IT9 U;  5HRO A;  3DOM A;  1I3Q K;  2CPJ A;  3Q86 A;  1S9E B;  3S1N K;  5I4M A;  5T41 A;  2AMC B;  1JJ2 R;  3GTY X;  1DCH A;  1J5O A;  1XWL A;  1DFD A;  3P4U B;  3IS9 B;  1IKX A;  3HOU C;  2HND A;  2RUS A;  4UOG A;  4YS2 A;  2EFN A;  2DK2 A;  2HHS A;  4KO0 A;  4WII A;  4I1T A;  4P6Q A;  1JWW A;  1QE1 B;  3BDE A;  1AB4 A;  4DL2 A;  1SIZ A;  3T1Y J;  3K8W A;  2X7I A;  4J9M A;  1K47 A;  2GQ2 A;  5IYB C;  5F41 A;  3U7J A;  1IR2 A;  4I4B A;  4ANC A;  3D2W A;  3M6V A;  2DNZ A;  4KIA A;  4O3S A;  4BKW A;  5A2Q Y;  2UVR A;  2V68 A;  5CQG A;  2MZ1 A;  3LGH A;  5LSL A;  2XGP A;  1VRQ C;  3H4B A;  1X0F A;  2G0I A;  1UVK A;  2CFX A;  1N36 F;  4Y2A A;  2RS8 A;  2A18 A;  2CJX B;  1B7Y B;  4EUV A;  3QID A;  2F7V A;  1BUX A;  5FDL A;  4RW8 B;  4Q2M A;  3JTP A;  3GLJ A;  3IPJ A;  4NE9 C;  1TAU A;  5C42 A;  1HNW J;  1VQ5 S;  4C98 A;  1WHV A;  3DOL A;  4MIB A;  4IRD A;  4NXN F;  1YKW A;  3BN4 A;  2J9E A;  5H9E J;  4IO9 Q;  3SI8 A;  1N33 F;  2EFO A;  2R8K A;  2GVD B;  3OTE A;  5IP7 K;  3ZNJ 1;  2GO8 A;  3G87 A;  1RIS A;  2GC8 A;  2AP6 A;  4OV1 A;  2FJB B;  2U1A A;  2NVX C;  2N4D A;  4KT0 C;  4DR4 J;  4P5A A;  2QSF A;  2ROE A;  2HQF A;  2WSF C;  1L0W A;  4ZK7 M;  3R8Y A;  2E1A A;  1S1X A;  3GIK A;  2EBG A;  1UW4 A;  2GGP B;  3QWP A;  1SL2 A;  3LH2 S;  1Y5L B;  3RAM A;  4AH6 A;  3SCL E;  1HNI A;  4ATN A;  4IG3 B;  2NSC A;  2OEL A;  3QJL A;  3KHL A;  1LW2 B;  1RT6 B;  2X1A A;  2DT9 A;  2R93 A;  1RSC A;  3MM7 A;  2ZC3 A;  2OEJ A;  2ZUF A;  2J0X A;  4PR6 A;  5HBM B;  2PEH A;  1WHX A;  2DB1 A;  2FIU A;  5M3M K;  1FA0 A;  4YEA A;  1GE9 A;  2AJ0 A;  5IT4 A;  1XMO J;  3KLF B;  1S1V A;  1S6U A;  3VAF A;  1RHU B;  4Q44 A;  1NHU A;  5KFC A;  5DG9 A;  4NCA A;  4KFB B;  1CQM A;  4RUA A;  2B6A A;  4OYP A;  4KKO B;  2OEM A;  3QIP A;  3W8P A;  3R5A A;  4IKA A;  2F3J A;  3LGN A;  4F4W A;  2F65 A;  4USJ C;  2BOP A;  1FJG F;  2DTJ A;  4NLU A;  3G82 B;  1X31 C;  4G7Z A;  4B3S J;  1N6Q A;  4B3O A;  3GU0 A;  4PUO B;  1PYT A;  2VC0 A;  4CLF A;  1VCT A;  2C22 A;  1RAG B;  2OFH X;  2AEF A;  3SCJ E;  4FF3 A;  3JST A;  4G7O A;  3O6Q A;  3UD3 P;  1XJW B;  4I68 A;  3HHE A;  2MJN A;  2UV8 G;  2KYX A;  2CRL A;  4N7T A;  4KMU A;  4OJH A;  3A8K A;  1X5O A;  2WSE C;  4HVZ A;  5C4J C;  5C2C A;  3G6V A;  4LMZ A;  2RS2 A;  2RRN A;  1IKV B;  2OFG X;  4PYA A;  3HM9 A;  4ZJQ A;  4DV4 J;  1W25 A;  1JLQ B;  3U27 A;  5BYQ A;  3RG6 A;  2KT2 A;  1T11 A;  1P1L A;  3HPO A;  3PW7 A;  1SJR A;  2MKK A;  2R7U A;  1YBA A;  4YR2 A;  1RHR B;  2QE5 A;  3OFG A;  3PW5 A;  2Z57 B;  1FRX A;  4C3L A;  2DEJ A;  4GC7 A;  2B4P A;  4DN9 A;  3TW0 A;  4OX7 A;  4LBP A;  4B3M F;  3VTI A;  4DSF A;  2OPS B;  2R8J A;  4M95 A;  3ISZ A;  1S9F A;  4JI0 J;  2ZFH A;  2W24 A;  1GMW D;  2VA2 A;  4IOB A;  1IQT A;  2B5J B;  1I94 F;  2G0J A;  4LF2 A;  1N0U A;  1WEZ A;  3H5Y A;  3GCW P;  2DNO A;  2YH1 A;  4LBI A;  1TEL A;  4NA3 A;  4XTT A;  4IFY B;  1UVL A;  1N5V A;  2H3E B;  2C2E A;  2DNM A;  3K17 A;  4Y7N C;  4X4V A;  4P52 A;  1UKU A;  5H9F K;  4F0H A;  4ID5 B;  4W90 B;  3NMA A;  4JOU A;  4A8K A;  3AJ1 A;  5CYQ B;  4TQR A;  4C9D A;  3QGH A;  2YVS A;  4XPE A;  1VYA A;  2CQP A;  2W9B A;  4KV8 A;  2K7K A;  2NVQ C;  1F2H A;  1RT4 A;  3R7B B;  1PIL A;  2BM0 A;  1FK9 B;  1X5S A;  3GTG K;  2EFV A;  4PCQ A;  1A6L A;  3NBP A;  2RSQ A;  5ADZ A;  3TA0 A;  1N8R T;  3VAG A;  1RUS A;  1I6H K;  4A8F A;  2C2D A;  1GXU A;  3FC9 A;  4A3G K;  1R27 B;  2LVW A;  1ITP A;  4IG0 B;  1BQN A;  4BLA A;  3CJ2 A;  1RHJ B;  3PDN A;  4M1X A;  4DQP A;  1K83 A;  1PBU A;  1T9U A;  2HW3 A;  3M8R A;  3HHL C;  2P9G A;  3TUZ C;  3IG1 A;  5J1E A;  1BS2 A;  1EP4 A;  1X4D A;  3TJA A;  2HZA A;  2B9X A;  2K1R A;  4NOH A;  2V6U A;  1RT5 B;  5IXU A;  3BSN A;  4ILM A;  2HQC A;  1CJT B;  4ZP9 A;  2CAJ A;  4FPR A;  1S12 A;  1DQ8 A;  1C2P A;  2IC3 A;  1ULR A;  1TWA K;  1IL2 A;  4AXJ A;  5E5N A;  3FK4 A;  4DV5 F;  4A8M P;  3PAC A;  4JI6 F;  3OSP A;  2XCR B;  2M2B A;  1F5A A;  4J3N A;  3ZTO A;  2R7Z C;  1VR6 A;  1NSK L;  2FB0 A;  4RW9 B;  3AY0 A;  5MLC V;  4QZV B;  3EXC X;  3L09 A;  1SQG A;  1FNM A;  1BDF A;  3FFI A;  2P5M A;  1ZS6 A;  5C5J A;  3MR5 A;  3BO3 A;  4GVL A;  3HOZ K;  3LQV A;  5C4X C;  2HKE A;  1RWO B;  3H2L A;  4O4G B;  2E2J K;  5KFH A;  2JX2 A;  1VGX A;  2XS5 A;  2XY6 A;  1MWQ A;  2EFQ A;  1URN A;  3DYA B;  2EPI A;  2RD5 C;  4CTA B;  1NDK A;  2HVZ A;  2VBZ A;  4OHX A;  4LRD A;  2XMA A;  1SFO C;  4B3R F;  5KFN A;  2AD9 A;  1Q5V A;  3TWZ A;  3D0H E;  2ZZN A;  1BGW A;  1CJU A;  5B0B A;  3KMQ A;  4JI2 J;  1NK8 A;  1H3D A;  3IRX B;  3G4S S;  1ZA2 B;  3HCX A;  1X9S A;  2UVU A;  5FLX Y;  1SBR A;  2KN4 A;  3IGV A;  4N56 A;  1JJC B;  3GV7 B;  1O5J A;  3M6W A;  1DHM A;  1NSA A;  1T9V A;  4M5J A;  4DR3 J;  5L1K A;  2N7Y A;  3F44 A;  3SFG A;  3LPY A;  3BS9 A;  3CJT A;  2ATL A;  1NK7 A;  2QLW A;  1DBD A;  3FCW A;  4C8M A;  4R0J A;  2GVZ A;  1DTT A;  1JVI A;  2R92 K;  2OHD A;  4PPZ A;  3FSI A;  4CO5 A;  1JLA A;  2I9S A;  2ZJR Q;  1JXE A;  3OTO F;  5ETL A;  2IM2 A;  3M32 B;  2HHH F;  1HW8 A;  3HHK A;  4KPC A;  1F0X A;  4RNO A;  4YG2 A;  1RTD B;  2RHQ B;  4ZS6 A;  1NJX A;  3SIP B;  4DX5 A;  5J2Q B;  3DGV A;  4DV0 F;  1HFE L;  4EBC A;  4DR1 J;  1B0V A;  2LXU A;  1TK8 A;  1VGY A;  3ILO A;  4JI3 J;  4I2Q A;  2CW0 A;  6AT1 B;  3HVR A;  1TL1 A;  4P74 A;  3BQ2 A;  1RKJ A;  2AF6 A;  3L4B C;  2O5J A;  3ZTR A;  1X60 A;  4Y52 K;  2C3O A;  2L41 A;  3T5H A;  4MKY A;  4L3N A;  1VOM A;  3KHR A;  1Y5I B;  1RYS A;  2VA3 A;  3KYL A;  4RW6 B;  3MFI A;  1WI8 A;  1SC6 A;  3GPA A;  3J81 j;  4GTA A;  1AFJ A;  2QTW A;  2V6A A;  2VZ9 A;  3AD9 C;  1U02 A;  3C6T B;  3DHW C;  2UVV A;  1XZP A;  3WOD A;  3P8B B;  1FRK A;  4EGL A;  3ZZR A;  5KFK A;  5M5W K;  4Q0B A;  4OYI A;  3H20 A;  3UD5 A;  4C2M C;  1LWC B;  1FO1 A;  4ELV A;  1KTQ A;  2AX1 A;  2UU9 J;  3GR1 A;  3R1H A;  3DOM B;  3R2D J;  2WSC C;  3OQ2 A;  2C3P A;  1UCN A;  4YB6 A;  4ANE A;  1KP6 A;  4OHW A;  3PY8 A;  1HI9 A;  4DSI A;  4DF4 A;  2B8P A;  3JYT A;  3G6X A;  5AJ3 J;  3TFH A;  4DJB A;  4F4A A;  3OV7 A;  2UUB J;  5M2P A;  4O3P A;  3GTO A;  4ES3 A;  1IKX B;  3MEK A;  2VV5 A;  2ZBR A;  3A4T A;  4OZ5 A;  4DFK A;  2GHP A;  3CPW R;  2VPX B;  3S1N C;  3D66 A;  4NX9 A;  3X3U A;  4AT1 B;  3T00 A;  1NUE A;  2UXD F;  1YBU A;  3D67 A;  3C6U B;  3D68 A;  5CAA A;  4RO0 A;  4ENO A;  2W2P P;  1TKZ A;  2FZK B;  2GQC A;  3D1O A;  2AEJ A;  2M9K A;  3BSO A;  3DLG B;  1X0P A;  1TWG A;  5DRK A;  2YU9 K;  2M8H A;  2RIL A;  3DLK A;  3TUP A;  1GQE A;  1YGY A;  4FVM A;  1S9G A;  4EO8 A;  4J9S A;  4CO2 A;  3MM9 B;  4LOW A;  3M8W A;  3DOL B;  3M8Y A;  2OPR B;  1NH7 A;  3S16 K;  4EYH B;  2E66 A;  1KQF B;  3A1Y G;  2PE8 A;  1UET A;  2XLJ A;  4RX6 A;  4ECX A;  4YFN A;  1KQ4 A;  4GKK J;  3MCS A;  4X4R A;  5BYS A;  2M5Y A;  5KFX A;  2G2Y A;  3GV5 B;  4HHU A;  6FDR A;  2VF3 A;  4PG6 A;  2J9D A;  1R89 A;  3DDN A;  4C4W A;  2PPB A;  1I5O B;  1WG1 A;  4FKY A;  1LFP A;  1HNI B;  3WDO A;  4KB7 A;  1XIQ A;  2Z4P A;  5HMX A;  3F56 A;  4DR5 F;  4DX7 A;  4N8O A;  1NJI T;  2DBB A;  4F4Z A;  2JA7 K;  5M5X K;  5IYC C;  3T5K A;  3L4J A;  2ZH6 A;  3ISN C;  3N6L A;  4IYQ A;  1DZ5 A;  3HOW K;  3QAT A;  5EGE A;  3DXS X;  1HWL A;  5B09 A;  4XCH A;  1WG5 A;  2UXC J;  2BJ9 A;  4A3B K;  3DLJ A;  5IOR A;  1HNV A;  3UE2 A;  3M8Q A;  3W63 A;  5DQH A;  1IS1 A;  4X4S A;  1UAW A;  3G4C A;  1WAC A;  4J9O A;  4ZA1 A;  4EZ9 A;  1RAD B;  3S6E A;  2JA6 C;  4ZCL A;  4XPC A;  2XMM A;  5HVH A;  2WOM A;  3BR9 A;  3BRE A;  4KAS A;  3EVW A;  4DR7 F;  3OR2 B;  3H40 A;  4G0W A;  3JS9 A;  3CJ5 A;  3T01 A;  4X6A K;  2Q66 A;  2DGX A;  1IE0 A;  3RU0 A;  3LW5 C;  1YG0 A;  2VFS A;  2DIS A;  3P6Y C;  1WSV A;  2XY7 A;  1BE4 A;  1DD5 A;  2IM0 A;  1F6T A;  3GE9 A;  2P8T A;  2N3L A;  5EHH A;  4ILD A;  1PSD A;  2ZNZ A;  4A3C K;  4A3M C;  2KO1 A;  3MEC B;  3H3V L;  3UFC X;  4LSN A;  3SQO P;  1RAJ A;  1GMW A;  1N48 A;  4NLX A;  2RQ4 A;  4IH7 A;  3OSN A;  1N5Y A;  3US5 A;  2G0C A;  1T8E A;  1YJN S;  4A8O A;  5D0E A;  3GON A;  5AE1 A;  2IYI A;  1Q82 T;  3GTL A;  4ETX A;  1VQN S;  4F04 B;  3PX6 A;  4EBD A;  2W25 A;  3H5S A;  2BA9 A;  4W98 A;  3VAI A;  1QAX A;  2M0G B;  3BGR A;  1HBO A;  2AEM A;  2HGN A;  1KWM A;  1U0S A;  2PN6 A;  3D28 A;  1N5T A;  4KB2 A;  3AOC A;  4WYW A;  4OIR A;  1C4A A;  1JLG A;  2AYG A;  4HKQ A;  3BKT A;  1J6W A;  1F9N A;  4LF9 J;  4ZDN A;  1S57 A;  4QU6 A;  1TWF A;  2GML A;  1HR0 F;  2WVE A;  3T3F A;  5DGA A;  2YWE A;  1S59 A;  3AOB A;  4IDK B;  1C1C A;  4UOC A;  4ZJL A;  1L5U A;  3K7A K;  1HNW F;  1PIE A;  4A3J K;  1DCO A;  1M1G A;  3O5T B;  1X7V A;  2JZ5 A;  3S15 C;  3PRD A;  2NPI A;  1UJ5 A;  3MPU B;  1N34 J;  4PYD A;  1OY6 A;  2YBV A;  1F93 A;  3CQZ K;  2C28 A;  4N8N A;  4JK1 A;  2QFI A;  4DR4 F;  1R0B G;  3IFE A;  5C3E K;  1S1W A;  2VHG A;  2CPE A;  1R8P A;  4KV8 B;  1RI7 A;  1OQ3 A;  1S0M A;  1RT4 B;  3QT5 A;  2B63 K;  5IP9 C;  2CJB A;  2VG5 A;  2Y3P A;  4V19 X;  2R7T A;  1KQK A;  4CYU B;  5IM0 A;  5A2Q U;  1XXB A;  1KHV A;  5HVF A;  1R8B A;  1F3V A;  5AE3 A;  2VFU A;  3LO3 A;  1UZH A;  1Y1W K;  1YNN A;  1F1B B;  4OI3 A;  5A8K A;  4WCE Q;  3UNY A;  1FEH A;  2W9C B;  3RTV A;  4RZR A;  2C42 A;  3O3L A;  1UA0 A;  2PA3 A;  1Y10 A;  4A3K C;  3CCU S;  3ZTQ A;  2OUG A;  2MY7 A;  1VQP S;  5T7L A;  2PMZ L;  5IV4 A;  1YK9 A;  2ZH9 A;  2R42 A;  3IG1 B;  5IFM A;  4K4W A;  5J1E B;  1EP4 B;  4FVC A;  2KM8 B;  2IA6 A;  2KI2 A;  1VC6 A;  4DL5 A;  1RP5 A;  3C46 A;  3R5D A;  4I6W A;  2UVW A;  3C8Y A;  5GAE U;  1OY9 A;  1HBM B;  3S14 K;  4LJM A;  4Z7Y A;  3CF5 Q;  5BR8 J;  3TAM A;  3GTJ C;  2IC3 B;  2B43 A;  3R5G A;  1TV6 A;  3HHN B;  3LAP A;  1FKP A;  1FWK A;  3CDA A;  5LM7 E;  1F5B A;  3THV A;  3B82 A;  2EVZ A;  1TZ0 A;  4B3S F;  1ZH5 A;  1TL5 A;  3M2V B;  1S4E A;  3T19 A;  1VQ4 S;  4QIV A;  1S10 A;  2FZC B;  4B9M A;  1XEZ A;  1Y3K A;  3JQM A;  4X64 J;  3FFI B;  2KFY A;  4WJ4 A;  3W9H A;  1E6Y B;  3UCU P;  2YX1 A;  5E3R A;  2RH6 A;  3MAQ A;  4H4O A;  3KLE A;  3CCM S;  1S76 D;  1FJ7 A;  3QLH A;  4R5P B;  3UCG A;  2GMH A;  1FTC A;  3H5X A;  4M5I A;  1X4C A;  2FVC A;  2Y3Y A;  4IO1 A;  3JAM U;  1QY7 A;  1WEX A;  4NI2 A;  3TA2 A;  1XPP A;  1NSQ A;  3ILJ A;  1RA6 A;  2JLF A;  2BQR A;  2R7R A;  4C3J K;  4U67 Q;  3FHZ A;  4U8V A;  1BGX T;  1WCM K;  2J9D E;  3KFW X;  1YZ7 A;  3CCZ A;  2MQM A;  5EX3 A;  5B0D A;  1S6O A;  2ZM6 F;  2QZ8 A;  4B9V A;  3DLH A;  3GIJ A;  2V0N A;  2MXY A;  1ELO A;  1KLN A;  3MMA A;  4ZN1 A;  4WTO B;  3VGV A;  3TA1 A;  1RT3 A;  2BYC A;  2UXB J;  2WB1 L;  1F9F A;  1UFK A;  4KGV B;  2RQM A;  3KHH A;  4Q5V A;  4R8U A;  4P75 A;  2R93 K;  2B4O A;  4NXM J;  2DRA A;  1TUG B;  5D3G A;  3KMS A;  1RU1 A;  2PMZ D;  1MRO B;  2GVZ B;  5HP1 B;  3DRY A;  1DTT B;  3CDU A;  1O8B A;  4DR6 J;  4M5M A;  2PII A;  4BY7 K;  1FVS A;  2LEC A;  2DGV A;  2MKS A;  3OXF A;  2N7C A;  3M2U B;  3W5Y A;  2CUY A;  4HT7 A;  1GEH A;  2C2Z B;  2F40 A;  2I2Y A;  1JLB A;  3TZZ A;  1MMD A;  3K7R A;  2FJV A;  4UQG A;  2XMT A;  4IQX A;  4WFY A;  1MSW D;  2OD6 A;  1UWA A;  2IAJ B;  1TK0 A;  3W61 A;  1MWZ A;  4OYZ A;  5KG1 A;  2OPP A;  4P5B A;  4BC7 A;  3K89 A;  3FQL A;  1S0N A;  4XLN A;  2KT3 A;  1K1S A;  2RKI A;  3TAN A;  3BBB A;  3E01 A;  2XHC A;  2FJX A;  4LFB F;  4PRF A;  3GTP C;  3J7Z 5;  2IM1 A;  4BBR K;  2A3J A;  4OX6 A;  3S0X A;  1U8W A;  1WKL A;  3AD8 C;  1FVQ A;  1B64 A;  5D4N A;  3BO4 A;  2GHV C;  1EJ7 L;  5D4D A;  2J8A A;  1ZPW X;  3FEX B;  2PDA A;  1XZP B;  3M7V A;  3RUB L;  3QRP A;  4J7C A;  2VQF J;  2GJI A;  4Q0B B;  4TU7 A;  3KG0 A;  2ZE2 B;  2DVI A;  4DV2 J;  2MZT A;  5A6P A;  5CH7 B;  1S1T A;  3I9V 9;  5IC4 B;  2DD8 S;  4NPO A;  3C16 A;  3Q8S B;  1G6B A;  3CJ0 A;  5HI7 A;  2BDP A;  4MEY A;  3GIM A;  2J7W A;  4B02 A;  5CCM A;  1VBY A;  3JTO A;  4NEY A;  5JVO A;  3G2X A;  2OSQ A;  3NY0 A;  2NYH A;  2Z2L A;  3X1L B;  3NP5 A;  1YDL A;  3EUN A;  2IJF A;  4U95 A;  4JV0 A;  3G4A A;  3K5N A;  3S17 K;  5IYD K;  1HI0 P;  4IH5 A;  3UVJ A;  4K50 A;  2PSZ A;  3PHE A;  4ED3 A;  5B0F A;  3HLU A;  3W5X A;  2E1M C;  2RIJ A;  3BKU A;  3R97 A;  3ORE A;  3NG8 A;  2XM3 A;  3H0G A;  1GXT A;  2XUL A;  1I51 B;  2XC9 A;  3WX4 A;  1YBT A;  1YWX A;  3HD1 A;  1FI4 A;  4PXC A;  1U1Q A;  3Q83 A;  1RAC B;  4L73 A;  4CP5 A;  4J5O A;  4KHP F;  2KTQ A;  4Y28 C;  5KTQ A;  4X4P A;  2IMW P;  5KFE A;  2Z2Z A;  3N5B A;  2W2Q P;  1RHQ B;  3NGS A;  4QYZ K;  1B4S A;  3K58 A;  5E68 A;  2Z2M A;  3O1L A;  5KFI A;  1C4C A;  4EEY A;  3T5L A;  5CYM A;  1XER A;  4JI5 J;  1QSL A;  1PKU A;  4AD6 A;  1EZZ B;  1SCJ B;  2WK4 A;  2P6S A;  4DR3 F;  3GEH A;  3RR8 A;  2FD2 A;  4DUT A;  1TL7 A;  4K0K J;  4BY1 K;  2JA5 A;  4LFC J;  1JLC B;  4UT4 A;  3V4M A;  1UJ4 A;  4QW8 A;  2HLU A;  1LK5 A;  4GTF A;  1VC0 A;  3QYY A;  1C0T B;  3L7U A;  3PYE A;  2LLZ A;  4EYI B;  1VLO A;  2V63 A;  1K83 K;  4MJK A;  2ACY A;  4USK A;  1BQX A;  2IY5 B;  5EN1 A;  3HHL D;  4KBI A;  1X4B A;  4M5G A;  3V6D A;  2HHU A;  3MM6 B;  4IR9 A;  4C3I C;  2BAN A;  4TY8 B;  2FPH X;  3IN5 A;  1PC5 A;  4ELU A;  4DR1 F;  1U4B A;  1RCX B;  3BPD A;  2ILY A;  5FLX U;  4JI3 F;  3KLG B;  2F8M A;  2LDI A;  2W01 A;  3PNI A;  3C3L A;  1H72 C;  3HOY C;  4UY8 5;  5HVG A;  1BQM A;  1HWK A;  3BEG B;  4PQU A;  4WE1 B;  1X4E A;  3EIC A;  2IDL A;  3B8H A;  3EGZ A;  4WKY A;  3EDQ B;  3PYG A;  4ED5 A;  2HWI A;  4RMF A;  3CJS A;  5E3A A;  1XXC A;  1ZET A;  3GIL A;  1U1P A;  1VRU A;  5A8W A;  4ECU A;  2AX0 A;  1VQS A;  4L74 A;  3IR7 B;  4OI1 A;  4A3L K;  3HFK A;  4M5K A;  3QZ8 A;  1T7P A;  3BJY A;  4A3E C;  1X4H A;  2DJW A;  3M30 A;  5FII A;  4KY3 A;  1UVI A;  2LFV A;  4HH0 A;  2YNH A;  2IBK A;  4A3F C;  7AT1 B;  3OL6 A;  5AXN A;  2QN6 B;  2UU9 F;  4M63 A;  1Q8K A;  3FBE A;  4GVB B;  4K7Q A;  1TU0 B;  1RT7 A;  4K4T A;  1QAI A;  5TMF A;  4G3I A;  5C44 C;  2NZ4 A;  2DNG A;  3K5P A;  1N5Y B;  3I5A A;  1QLN A;  5HAO A;  4X2B A;  1FWL A;  2KDO A;  4A47 A;  1YVF A;  4OIQ A;  4W4M A;  1X8D A;  2HHV A;  3NRB A;  2UV8 A;  2HNZ A;  1LEO A;  4OX8 A;  5HQL A;  3H5U A;  1FD2 A;  1FER A;  3UD4 P;  5I42 B;  3TVK A;  3LAK A;  3SQG A;  3RRG A;  5IC6 B;  3FCV A;  3NGT A;  1Z4U A;  4P2M A;  3PKY A;  2GIR A;  4Q7A A;  1FX4 A;  1QVF R;  4QU7 A;  5H9E K;  4Q43 A;  1U1L A;  1A9N B;  1RXO B;  3PTW A;  1RKI A;  2HQD A;  3BGR B;  3DLE A;  4F50 A;  4F67 A;  1WI6 A;  3ILI A;  2W9A A;  2MQL A;  4I64 A;  3ZXW A;  2FHO B;  2YKQ A;  2NVY K;  3VAM A;  2NR0 A;  1JLG B;  3J7A N;  5KFJ A;  3VHQ A;  1S6Q B;  2YKA A;  4G6V B;  1NKC A;  8ATC B;  4F3O A;  9RUB A;  2J8S A;  3PKM A;  2FC9 A;  2KHD A;  3QGP A;  4HI2 A;  3PR5 B;  2NLW A;  1S77 D;  4G0U A;  4DPX A;  2ILZ A;  5BJR A;  4DV3 J;  2BUN A;  4OZ1 A;  3VAJ A;  1CLF A;  4Z37 A;  3P5T L;  2AYE A;  5KAK A;  4ED7 A;  3TNV A;  3D6T B;  2ZFZ A;  3GFX A;  5DLG A;  3BGL A;  4MIW A;  4E8U A;  3EM1 A;  1R9T K;  1X4A A;  2VD3 A;  1X5T A;  5IOL A;  1UP1 A;  4GKK F;  2KXN B;  1IQZ A;  1ARO P;  1PO6 A;  3NS6 A;  2E9T A;  3KWM A;  1ZQ1 C;  4NOI A;  4Y34 A;  3NEK A;  4U6P A;  1K9M T;  1YLX A;  4F3M A;  4ZOS A;  2LA4 A;  4OYB A;  2GX8 A;  3SDE A;  3JB9 k;  3KHG A;  2E2H C;  3M4O C;  1W7W A;  1NDP A;  1Y5N B;  1XK8 A;  3EGV A;  2BR0 A;  1T3O A;  2J7K A;  4KAW X;  2ZHO A;  2OKQ A;  1I50 C;  1SIW B;  1FJC A;  3DLB A;  1T03 A;  3UN2 A;  1RK8 A;  2EFG A;  1S72 S;  5KFG A;  1FE0 A;  1N32 F;  1IM4 A;  3GTO K;  5KG6 A;  3TQE A;  4Y6I A;  2VAS A;  2VKR A;  4NA1 A;  4QWB A;  3V4G A;  3BSC A;  3MAH A;  2XI2 A;  3JSY A;  3D3B J;  2EKY A;  1IJE B;  1S48 A;  3MI7 X;  1TV6 B;  1JKH A;  4HI1 A;  1U1R A;  1AZS A;  3DNC A;  1HQ2 A;  1NME B;  1IXK A;  4BBS C;  1I6J A;  2E2I K;  1H7X A;  1TKX B;  2W2O P;  2DIU A;  2JA8 K;  1YX2 A;  3OXG A;  1YRX A;  3IAM 9;  5EUH A;  2AZ3 A;  4QW9 A;  1IBM F;  2NVX A;  2HVE A;  4CM2 A;  2CNN B;  3MR7 A;  2DNQ A;  5B0E A;  2GSN A;  2KH9 A;  5ETO A;  1IBL J;  5K8P A;  4KC6 A;  2HVD A;  4YOE A;  4HTJ A;  3HHD A;  4EK2 A;  3IS9 A;  5J2M A;  1SH3 A;  2B3T B;  3VF0 B;  3GG1 A;  2IM3 A;  3AD7 C;  2XYP B;  1V6H A;  3NGR A;  3PX0 A;  4ETZ A;  4N41 A;  4FNI A;  3M8P A;  4WU3 A;  2DEI A;  2HIQ A;  3RZO C;  4NI2 B;  1QE1 A;  3FBF A;  1BC6 A;  2E5J A;  4C97 A;  5A0Y B;  1FTR A;  3A13 A;  2VG6 A;  3W5Z A;  3CCW A;  3QQC D;  1WHY A;  2E44 A;  5DG7 A;  2AKW B;  2AYM A;  2KKH A;  1LWF B;  4B08 A;  2F4V J;  3D4J A;  1WEL A;  2C2K B;  2J6S A;  4BWM A;  1HNX J;  4LQY A;  1U48 A;  1ZZF A;  2DGS A;  4LF9 F;  4F02 A;  3FEZ A;  4NCB A;  4C3J C;  4KH1 B;  5IWA J;  1F60 B;  4R8U B;  1UJ6 A;  2WVF A;  1QTN B;  1RDR A;  3ZZZ A;  4TU8 A;  5EGH A;  4Y65 A;  4UUX A;  4LF7 J;  1I6V A;  1RWM B;  1OJ4 A;  4DCP B;  3ZZU A;  4A3D K;  1RAF B;  1VJW A;  1V9O A;  3QGG A;  2DNL A;  2GVD A;  3S2H C;  4HHH A;  1NZ8 A;  4K59 A;  4LIR A;  3FKI K;  4K5S A;  4WXW A;  3EVO A;  2POK A;  3FMW A;  1UWB A;  3KK3 B;  3CD6 S;  4LRC A;  5CCL A;  3C14 B;  4M94 A;  2DNR A;  3IRW P;  1WOR A;  4LRE A;  2G13 A;  4WFN Q;  4KYZ A;  4XK8 C;  3KDN A;  3LTO A;  3M6X A;  3R9L A;  2GGP A;  1HBN B;  2CXE A;  1KFD A;  2R7Q A;  2HBZ B;  4IG3 A;  4CIO A;  5EWF A;  4WK3 A;  1J27 A;  1LW2 A;  2CJY B;  3M1V A;  2YWH A;  1F9H A;  1NPR A;  5LMU F;  1YJ7 A;  2IRY A;  4ECZ A;  2R2U A;  2IDE A;  1MNE A;  1FCA A;  4X4O A;  5GAG I;  1TL3 A;  5D15 A;  3KLF A;  1SC1 B;  1YRU A;  3CIZ A;  4I6Y A;  4MKA A;  1WQF A;  2RDI A;  2B0G A;  1UVN A;  1VHI A;  2HIY A;  1PCA A;  3C19 A;  2BEF A;  1SI9 A;  4FXV A;  4KFB A;  3TVY A;  4BBY A;  5BR8 F;  2FZG B;  4KKO A;  4ZLL A;  1Z2Z A;  3GTL K;  3CCL S;  4C8Z A;  3GB0 A;  3CMQ A;  1Y0H A;  1VBZ A;  1FXD A;  3G82 A;  2VH7 A;  1UVJ A;  5RUB A;  3NGD A;  3GG0 A;  1ACM B;  1TK5 A;  2MQN A;  2RDJ A;  1O29 A;  3FSX A;  4U96 A;  5M2R A;  4A48 A;  2QA2 A;  3D3C J;  3HUL A;  1YQH A;  4FM9 A;  2IRX A;  1R3N A;  5D0R A;  5J2P B;  1X9W A;  2WAQ D;  3VAL A;  1TWF K;  3GDZ A;  4O44 B;  2CKW A;  3DC2 A;  1VQO S;  3IA0 A;  3K5M A;  1AYE A;  2HFZ A;  2JLE A;  2KVI A;  1IKV A;  1WSR A;  3KDO A;  1Q16 B;  4KRW A;  1T9W A;  1JLQ A;  2VUG A;  3GTQ C;  3T1A A;  1KOO A;  2D69 A;  4F4X A;  2HK2 A;  4PZV A;  2AU0 A;  2ZD1 B;  1RT2 A;  3OTC A;  2J5A A;  3HHL A;  3CO0 P;  3GMG A;  4YQW A;  2MHE A;  4Q5S A;  1N0V C;  3I4M C;  4DL3 A;  2OPS A;  4P2S A;  1NHK L;  4DQQ A;  1KVI A;  3QSY B;  2ASL A;  2B5J A;  4URQ U;  3PO5 A;  2PA8 D;  1Q95 G;  5EWE A;  3DGP B;  1Y1V K;  2XCA A;  3HXM A;  1J5E J;  1FNX H;  3I4N K;  1HD0 A;  4IFY A;  2R7Z A;  2RAQ A;  3WQP A;  3OJU A;  3EQL A;  3I6P A;  4V19 J;  2BOA A;  4DR6 F;  1G7C B;  3CCR S;  4MIA A;  4I2P B;  2BJD A;  3QMQ A;  1K0T A;  1RLD A;  2OTL S;  3J7Z T;  4ID5 A;  4QIF A;  2M7S A;  2MQP A;  2HBY B;  3LAJ A;  1REV B;  5CYQ A;  2MQQ A;  1M5S A;  2NXC A;  3V6D B;  4DQS A;  2W4D A;  3JQK A;  4KAI A;  1FFS B;  1SQF A;  1Y00 A;  1FK9 A;  4G1I A;  4ZCM A;  2IMO A;  3VVU A;  1JQW A;  2HAF A;  5KOX A;  1SFO A;  1T9X A;  4A8S A;  2WRM A;  5DDP C;  5ETP A;  2KVQ E;  1WOO A;  5KT5 A;  1WTB A;  2A6H A;  2OEK A;  2HS0 A;  1OS5 A;  1YHQ S;  5DS7 A;  5F8J A;  4LF5 J;  2NVT K;  4IG0 A;  1TAQ A;  2QL5 B;  5A8W B;  1U7L A;  1BWE A;  1YTY A;  5JJB A;  2UUW A;  4WXO A;  4TVA B;  3KK2 A;  1DAX A;  3CXC R;  2Y8W A;  3CUN A;  3HZE A;  1AW0 A;  4LR9 A;  4LR8 A;  2PHC B;  2XMU A;  4NLG A;  4DCO B;  1KS2 A;  3TUI C;  4ECR A;  2DXD A;  4FS2 A;  2RF2 A;  1WG4 A;  5F8H A;  1G2E A;  3BN7 A;  4PG8 A;  1RTH A;  4NAS A;  2ZBP A;  3IAS 9;  5KFL A;  3KTQ A;  1PC4 A;  4KGM A;  2JA5 C;  2U2F A;  3HOV K;  5LOQ A;  1S6P B;  1VIX A;  1D09 B;  4M5N A;  2NXE A;  3Q2T C;  2BQU A;  1GTE A;  1XC9 A;  1IKY A;  4L75 A;  5H9F J;  2ASY A;  4ZPW R;  3TEG A;  3MTJ A;  3BGU A;  4ED0 A;  3ZZ0 A;  1PJ6 A;  2HNZ B;  2LXF A;  7FD1 A;  2ZUA A;  3SQG B;  1Y11 A;  2ZHB A;  2ATC B;  3MMB B;  3TZX A;  2R7X A;  4DSL A;  2YWG A;  4Z2X A;  3DYA A;  3OJS A;  4CTA A;  1U6F A;  4DF8 A;  3N5F A;  5B0C A;  2VBX A;  4NZ7 A;  1BJT A;  2XO6 A;  3IWL A;  1U1K A;  3BQ1 A;  3GTK C;  1NND A;  1ROF A;  2H48 B;  3FEY B;  2F8E X;  4GFQ A;  4A93 K;  1EAR A;  2RGR A;  2Y8Y A;  1RAA B;  3W62 A;  1JK9 B;  2HG4 A;  4LLG A;  2CAD A;  1PAE X;  4GTE A;  3GJT B;  1ZXO A;  3I4P A;  4FPI A;  1S7I A;  4C2M A;  1IBK F;  3LP2 B;  2NVY C;  2P2C B;  4DDF A;  1ZVU A;  2YY3 A;  4U9R A;  4UQT A;  3PG9 A;  1M1K T;  5L38 A;  4LFC F;  3T02 A;  4DG1 A;  2ZHA A;  3LAM A;  3GJS B;  4LVN P;  3Q8U A;  1XTZ A;  1C1B A;  4KMD A;  4C3M A;  4D3H A;  4UY8 T;  2Z56 B;  3FMB A;  4ZVU B;  3T1H J;  3JQJ A;  1QVG R;  2L9D A;  1WC4 A;  5BYR A;  1R9T C;  2XS7 A;  5HJX A;  5K20 B;  2YNG B;  4EBE A;  1RTD A;  1EIY B;  4KQZ A;  5G4D A;  4X4N A;  1V5I B;  4KHM A;  3BH6 B;  3NGU A;  1ZAX A;  2QIF A;  1JIH A;  4DN0 A;  3VCD A;  4MYT A;  4HT5 A;  2CJA A;  2BBE A;  1O27 A;  2DGO A;  4ZN3 A;  1YNJ A;  2Y9H A;  1X4F A;  4Y3C A;  3OVS A;  1CEZ A;  3NXZ A;  1NB2 A;  5KG5 A;  4ES2 A;  2J6T A;  3EYZ A;  1K1Q A;  4RW6 A;  4ZCK A;  2MKJ A;  3HSZ A;  4DUY J;  5KFA A;  3TRG A;  1S7H A;  4N77 A;  4BC9 A;  3S7R A;  3OXL A;  3H0G K;  3PRB A;  2PFF B;  3C6T A;  4ZKA A;  2B9E A;  3HO1 A;  4ZPB A;  2XBP A;  4EMD A;  3UO0 A;  3HF5 A;  5IT9 Y;  3LWL A;  4AL5 A;  1LWC A;  2CQI A;  4QPT A;  2IFX A;  2BV3 A;  2DR7 A;  5L9N A;  3VQT A;  2VPW B;  2QLX A;  1QD1 A;  4ZLN A;  2V8D A;  3RBD A;  4B9U A;  3QAE A;  1IR0 A;  3A12 A;  3UCZ P;  2ROP A;  2HNY A;  4ECT A;  2OLW A;  1RA7 A;  4IUF A;  2HVH A;  1P9Y A;  4JI4 J;  5J2M B;  4C3H K;  3DXJ A;  1B7F A;  3R6L B;  2JA8 C;  1D9D A;  3DRS B;  4TY9 A;  5H1S V;  4MTP A;  1WQH A;  1GMU A;  2IRU A;  2O5I A;  2DXE A;  2A2D A;  1HWJ A;  3HK2 A;  3CME S;  4DPT A;  3M8P B;  3FOF A;  3W1Y C;  1Q86 T;  2BX6 A;  3IO1 A;  4P7T A;  2KRR A;  4GKJ F;  1U2F A;  2WVB A;  3PO3 C;  2VG6 B;  3M3Y C;  2M52 A;  4O2D A;  3C6U A;  3MEG B;  4B17 A;  3SEO A;  3D1H A;  2B4U A;  4WJB A;  1H6K X;  2ZDO A;  2ADC A;  2JA6 A;  1JJ4 A;  4TLR A;  1DAR A;  2CQD A;  3DLG A;  2V6T A;  1SVD A;  5D78 A;  3PIP Q;  1C0U B;  1KKH A;  2V2K A;  2PC6 A;  3NS7 B;  3TTG A;  4JI1 J;  1R0C B;  4YB5 A;  2D3Z A;  3V4I B;  3M9O B;  4U7U D;  2PI5 A;  3I32 A;  1WKJ A;  2EC2 A;  2DHH A;  1G4C A;  2XZD B;  3TI0 A;  3MM9 A;  1VQL S;  2LXI A;  2OPR A;  3FZB A;  4S0M A;  3FCH A;  4EFA C;  3UDC A;  1YJR A;  3LUY A;  4IQM A;  1UWB B;  3PW4 A;  4CO1 A;  2A0F B;  1E6V B;  3EZU A;  3QSI A;  3MMC B;  1FFG B;  2BVZ A;  3IBW A;  3POT A;  1CPZ A;  2Y0S L;  1MML A;  4P10 A;  3PEJ A;  4FYW B;  3J81 Y;  2R8H A;  4BXX C;  4A3D C;  2ASD A;  1PAU B;  2UUT A;  2DR6 A;  2CQ3 A;  5KG2 A;  3RAQ A;  3CC2 S;  1KFS A;  3FKI C;  1RAI B;  3HSD A;  1HQU A;  2ZWP A;  2IA0 A;  3ET6 A;  4I69 A;  1N36 J;  4OI0 A;  5DET A;  2VUM K;  3M1V B;  2L48 A;  4OIX A;  4DSE A;  2XYG B;  2N3O A;  5J1N A;  3ETO A;  1RU2 A;  1PYO B;  3BUE A;  1G51 A;  2FHJ D;  2FLN A;  2QYG A;  4RNH A;  1FFW B;  2IIH A;  1TL3 B;  3OBI A;  3DKD A;  4NXN J;  3D5M A;  4AYB D;  2I1R A;  2FJD B;  5F8G A;  2LDY A;  2HSE B;  2VFV A;  1TWC K;  3R5B A;  3PYD A;  2KRB A;  3PFO A;  1ICE B;  2JH3 A;  4UST A;  2AJQ A;  5F3Z A;  3HT0 A;  1BD6 A;  1LW0 B;  3T6B A;  4C0B A;  4R25 A;  1SC4 B;  5L9X A;  1B4B A;  5GAG U;  3OR2 A;  2CZ9 A;  1NAQ A;  1M5V C;  4DUZ F;  3KUE A;  4OIN A;  4QWD A;  3DM2 A;  2V67 A;  1KON A;  2H9Z A;  3LPX A;  4BLB A;  3I96 A;  3QGI A;  3T6J A;  5ETK A;  3CW2 C;  1XXA A;  2GHW A;  2P9C A;  3DRP A;  3B4M A;  2JC1 A;  2KZZ A;  1IBL F;  3IMQ J;  4NA2 A;  3KNG A;  1SUQ B;  3MEC A;  4RBT A;  5HMW A;  2KXH A;  4ILL A;  1S1U A;  4JI8 F;  2HHW A;  3S1M C;  2NQP A;  1TFY A;  8AT1 B;  2GO9 A;  4MKV A;  4CO4 A;  2OMO A;  3G9C A;  1M1H A;  2MTL A;  3MZI A;  2C2M B;  2MYF A;  1T9T A;  2NCK L;  1X5P A;  2V4J A;  2V8H A;  3G96 A;  1QAY A;  1OO0 B;  1UEK A;  1U2C A;  1XZQ B;  1HHQ A;  3GFZ A;  1RWX B;  2Y0S D;  3NKY A;  1R6V A;  3WIU A;  2OTJ S;  5JUM A;  1OIA A;  3QZ7 A;  1RT2 B;  1ZPV A;  4Y2I A;  5DO2 A;  3MR3 A;  2J76 E;  3HHL B;  2WVC A;  2CQ0 A;  4KB4 A;  3CD5 A;  3MPV A;  2DY9 A;  3HOU K;  2DCU B;  3JSM A;  3MPY A;  2M8D B;  2F4V F;  3MUR P;  3S1R C;  1QUP A;  1NKB A;  1HNX F;  1ZBS A;  4Y0F A;  1HQM A;  4NEZ A;  2YNF B;  3N0B A;  3GTJ A;  4Y00 A;  4KR0 B;  2V2V A;  2DRD A;  2H4W B;  4Q8F A;  5IYB K;  2X3G A;  1SJ4 P;  2HZC A;  2BE9 B;  3EJM A;  3FGV A;  4IDK A;  4CLS A;  1ZZN A;  5K8O A;  3N79 A;  5IOQ A;  2JFD A;  1GNK A;  3W8G A;  3ZZP A;  2CDR B;  4CO0 A;  4YHH J;  3HVT A;  3PJ9 A;  1Y1V C;  5KFD A;  4MMO A;  3H90 A;  2AJ2 A;  1APS A;  1U6Z A;  4QR2 A;  1IBC B;  3FSY A;  2VC1 A;  5B7W A;  2BW2 A;  5C24 B;  3OT9 A;  3W65 A;  4B3M J;  4CYU A;  4DV7 J;  4NRU A;  6FD1 A;  2QL7 B;  3BB5 A;  1UFW A;  2OI2 A;  3O8W A;  4RNM A;  3OLB A;  4JV5 F;  2W9C A;  2WON A;  2IVM A;  1F7U A;  3NAI A;  1S99 A;  2FHM A;  2VKZ G;  3H7H B;  4NLT A;  1N54 B;  1DY3 A;  1RCO B;  2XMK A;  3KK2 B;  2H5I B;  3HJV A;  2LEB A;  3CIM A;  4FKX A;  2HQI A;  4RJV A;  1T9Y A;  3NWR A;  1SKS A;  1NEE A;  4NZ6 A;  2D9P A;  4JI7 F;  2ZNY A;  4OZ0 A;  5KFF A;  3PJW A;  2BXJ A;  3V6K A;  1TUV A;  2EEY A;  4X4U A;  4ALZ A;  3N3Y A;  3WBZ A;  4F7V A;  4A8W A;  5JVH Q;  1JJH A;  1HBM A;  1P9Q C;  1U1O A;  2KYZ A;  2RF2 B;  3W9I A;  4IOA Q;  1RTH B;  4NRT A;  2O5D A;  3EPG A;  1BMQ B;  4OV6 A;  1UW9 A;  4WYL A;  3AXK A;  4NLP A;  4CDI A;  1CJK A;  2YKM A;  2HRT A;  3Q2S C;  1D8Z A;  3M2V A;  2QX0 A;  2CPZ A;  2HRY A;  4X62 F;  2WCX A;  3KG1 A;  2LMI A;  4O4R A;  3GYG A;  2A68 A;  1IKY B;  3AH5 A;  1U0H B;  2PMW A;  4DPW A;  4NWB A;  2ERR A;  2DR5 A;  3DOK A;  1F3F A;  4CLP A;  1E6Y A;  3RAX A;  3EMT A;  2NS1 B;  5KFR A;  1N52 B;  4Z7C A;  4LSL B;  4DZD A;  2V4R A;  4ZLP A;  3G8Q A;  2DGQ A;  2Y0B B;  1T05 B;  1H38 A;  2CWK A;  5E0O A;  5CHC B;  3VZI A;  3WC0 A;  2V8P A;  1PJ7 A;  4R5P A;  5KT2 A;  3R5J B;  2XNQ A;  4N47 A;  3GTP A;  3FNN A;  2OD4 A;  2JNJ A;  3I56 S;  1SJ3 P;  1HW9 A;  1U25 A;  3KUH A;  3BGF A;  1O2F B;  1DLO A;  4CH7 A;  4CT8 A;  4ZVE A;  1VJQ A;  4ERD A;  4KMH A;  4K5R A;  4JI6 J;  3HJF A;  1KR4 A;  4HAC B;  3WZ0 A;  5C4J K;  2KG1 A;  4ZPA A;  3U1L A;  4FBT A;  1SB6 A;  2V6S A;  1G1X A;  5TMC A;  2MGZ B;  1VH2 A;  2BKN A;  4XIU A;  3P96 A;  3ZZO A;  4A3I C;  4JYA J;  4B9S A;  3GTM C;  1TFW A;  2QMW A;  4LT6 A;  1WC0 A;  1J5E F;  3GFY A;  4DG1 B;  4ZIW A;  2B4V A;  1RYR A;  1MRO A;  4DEZ A;  5HP1 A;  3IM9 A;  2VQE J;  3M8Z A;  1ZTT A;  4FDF A;  1C1B B;  4PWW A;  2HUR A;  1VQ8 S;  4DDQ A;  1WTF A;  1FX2 A;  4B3R J;  2HFS A;  1S0V A;  1OQ6 A;  4A8Q A;  3MFH A;  3M2U A;  2ROG A;  3F73 A;  3CJK B;  1B0T A;  4WU2 A;  4UW2 A;  4IFV B;  3L7O A;  4A46 A;  2CPY A;  5KG3 A;  5HO4 A;  2W7O A;  2YPY A;  4C7Q A;  3IWX A;  1U26 A;  2QJ3 A;  2J7U A;  4KM8 A;  2IAJ A;  4ES1 A;  3EX7 B;  1HBU B;  3PR4 A;  4PQA A;  3O44 A;  2KWA A;  1VMB A;  2GFF A;  3DN9 A;  2ALY B;  1SQE A;  3N28 A;  2B51 A;  3I0S A;  2XWX A;  3OFH A;  1V3R A;  4DFM A;  1YIJ S;  5A76 A;  2PFD A;  3BYP A;  4DMZ A;  1KHW A;  3MWB A;  1EI6 A;  1J98 A;  3U1M A;  5FLM C;  2DPI A;  2NVQ K;  3H98 A;  3G71 S;  3VGT A;  1CVJ A;  2ZH2 A;  1XNR J;  1O0P A;  1GTH A;  3MR6 A;  2FJW A;  4Q8E A;  4XO0 A;  1HHS A;  3N6M A;  3AH6 A;  1NK4 A;  3GZ7 A;  2QMU B;  5HQM A;  2D6F C;  2UZA A;  2BJ1 A;  3ZZT A;  2YU9 A;  1KLM A;  2ZE2 A;  3H25 A;  2MDA A;  1NLK L;  2DR9 A;  3CDB A;  5C25 A;  1L3S A;  4OYO A;  4GT9 A;  1XR6 A;  1HMV B;  5K8M A;  4AQY F;  4A8Y A;  2QC3 A;  3MM5 B;  4J9L A;  3BV8 A;  4F2R A;  2BE2 A;  2G1D A;  3D9B A;  3PW0 A;  2V5H G;  2HNY B;  2OAU A;  1VQY A;  5THW A;  4EZ6 A;  3I0R A;  1TWH C;  3MMJ A;  5KG0 A;  3DLL Q;  1I3Q C;  3DU5 A;  3HKW A;  1HI1 A;  2BW7 A;  4YP3 A;  2QFJ A;  2W7P A;  1JNR B;  3KLH B;  2VPY B;  2F63 A;  7FDR A;  1AT1 B;  1M5P C;  4ZLJ A;  4GTC A;  1P6T A;  4QPX A;  2EK1 A;  4OZ3 A;  1CBK A;  1R0A A;  4XLP A;  3KK1 A;  2PD1 A;  1HWU A;  5J1P A;  2BMB A;  4YFK A;  2R7V A;  2YKN A;  4TQS A;  2JA7 A;  2UP1 A;  2E5G A;  1SH0 A;  1S5Z A;  1O51 A;  2ZH8 A;  5DQI A;  3TAR A;  2GCF A;  4KGX B;  3JSR A;  4J9V A;  3MM8 B;  2W4C A;  2Z0G A;  5C4X K;  2Q6B A;  1FE4 A;  3OR1 A;  4LF4 J;  3M2R B;  2EBB A;  1KEK A;  3HVA A;  5CD4 A;  2QYC A;  5IOT A;  1HWI A;  2FHJ A;  5DQG A;  2LU1 A;  1W2I A;  2IJN A;  1Z1Z A;  3OL8 A;  3P45 B;  1IM6 A;  3SZY A;  2CYY A;  4OZL A;  3UN3 A;  2UXD J;  1GXL A;  3CD7 A;  5GAD I;  3HMJ G;  1JLC A;  5JFE A;  4F0K A;  3POT B;  4XDD A;  2HYI B;  1C0T A;  3QBC A;  3T9N A;  3T1H F;  4WP9 A;  3QNW B;  4O0I A;  4HLB A;  4FYY B;  3ZZY A;  3M8S A;  5IP7 C;  1M5O C;  1YIT S;  2XCQ A;  4OJG A;  1JB0 C;  1HQU B;  3BYR A;  3DCA A;  3ET6 B;  4DQI A;  1FRL A;  1F5C A;  3MM6 A;  1KC8 T;  5K5M A;  3P49 B;  3MED A;  4TY8 A;  4UOH A;  2XWY A;  1UA1 A;  3VWS A;  1CUL B;  4FYD A;  1KVK A;  3M05 A;  2C2O B;  5KT3 A;  3Q23 A;  3NS5 A;  5I3Q A;  2D9O A;  3KLG A;  3QAU A;  4PWD A;  5C7P A;  4LIW A;  2LQB A;  1GX6 A;  3E8O A;  3HKZ L;  4WE1 A;  2CQB A;  5ETV A;  2VUM C;  3V6J A;  2D3U A;  4M5H A;  5KFV A;  4JV2 A;  4QYZ J;  3N4W A;  4QIW L;  2M88 A;  2DNP A;  4YY3 J;  4YB7 A;  1R31 A;  3NOG A;  1RU0 A;  2YNI A;  1RTI A;  1NK6 A;  2R3V A;  1V3S A;  3DM2 B;  4LK1 A;  2QG9 B;  1TWC C;  2CVI A;  4WWS A;  3H8Y A;  3W2V B;  1O24 A;  4DR5 J;  4H4M B;  1NU4 A;  2DRB A;  3VA7 A;  4GVB A;  3DRP B;  2I38 A;  2ASJ A;  4F4Y A;  2E29 A;  1IVZ A;  3LPE A;  4CLK A;  1FES A;  2HHX A;  2YQ0 A;  1TVR A;  3TZW A;  1S1U B;  3GYN A;  1KQS R;  4URG A;  4RWX A;  1TL4 A;  4ECY A;  2ZZT A;  3KLI B;  1P1T A;  2V4J B;  3OVA A;  2GNK A;  2MLY A;  1RWP B;  3TZY A;  2E2H A;  3TR5 A;  1SJF A;  4OYM A;  2PO4 A;  2W1B A;  4DX8 H;  2CVE A;  3T1Y F;  4G1Q B;  4MEX A;  1MU2 A;  5I42 A;  2C3Y A;  3QFH A;  3GIR A;  1ZYQ A;  2GA7 A;  4DR7 J;  2FVS A;  4OIP A;  4KMA A;  1FHT A;  4BCA A;  1I50 A;  4ECQ A;  3SXL A;  4F8R A;  4AUK A;  2JFK A;  1XN9 A;  2O67 A;  1Q8B A;  1VI7 A;  1IR1 A;  4B9L A;  3PXG a;  3SV3 A;  2Q79 A;  1RJJ A;  5DZ6 A;  3JSM B;  3RB0 A;  2QLF B;  1MN9 A;  3ZTP A;  1S6Q A;  1W2B R;  4DXL A;  2CPH A;  1NBE B;  3GCX P;  1FWP A;  4C0H A;  4JI1 F;  1XR7 A;  1HAR A;  1U6B A;  2FGO A;  2K7J A;  3C2P A;  1LV5 A;  4DV1 J;  1JLF A;  3I4H X;  4QQB A;  2ZOG A;  1WEY A;  2Q1L A;  4WJ3 M;  2XMW A;  3HKZ D;  3PHT A;  1FT8 A;  4F26 A;  1BLU A;  3C15 A;  3IBF B;  2GAH C;  4QIW D;  2V9K A;  3PZP A;  3RYL A;  1NJW A;  3IWN C;  1DJ0 A;  3HVT B;  2JSX A;  2LQ8 A;  2HEK A;  2P8I A;  1R8A A;  3W7B A;  3GV8 B;  4CLL A;  3QT8 A;  3LP0 B;  5K14 B;  4ED6 A;  1RBL A;  1VQK S;  1MW7 A;  4BWJ A;  3IM8 A;  2CQ4 A;  4V1A k;  1VQ7 S;  5D8H B;  4A4J A;  4ZPC A;  4AFF A;  1RBA A;  4J9N A;  2WON B;  4URS A;  1HR0 J;  2HK3 A;  3HI9 A;  1Q0N A;  2ADB A;  4ZVP B;  2HRU A;  2GJF A;  3GTG C;  1Q79 A;  2EXU A;  4K4Y A;  4G0V A;  1XMO F;  4O23 A;  3MGJ A;  2XG8 A;  2XHW A;  2QL9 B;  1W26 A;  3DI6 B;  2YQ3 A;  1AB8 A;  4RL1 A;  2DR8 A;  1O25 A;  4XSZ A;  4LJZ A;  3V6H A;  4FYX B;  1I6H C;  4K4U A;  5M3F K;  1OSC A;  4QBU A;  3IR5 B;  4A3G C;  1WCM A;  4K2X A;  2DHA A;  5IYC K;  4P71 A;  5LL6 d;  1UPP A;  8RUC A;  5KG4 A;  2HHQ A;  5AE2 A;  3J81 U;  1Z2L A;  2DO4 A;  4RKU C;  1EQR A;  3D0G E;  3BZQ A;  1CJK B;  1MWY A;  2YKM B;  1RHK B;  1TKX A;  4N76 A;  3Q8V A;  4UTG A;  2EBE A;  2XI3 A;  2VG7 B;  3LA0 A;  2CNK B;  2NXN A;  1H2V Z;  2MQO A;  4GTL A;  2OIH A;  4OYW A;  4JP8 A;  2JA6 K;  3DOK B;  3G6Y A;  1TWA C;  1EET B;  3BSA A;  1S0O A;  2HMI A;  1RWN B;  2KZM A;  4K4Z A;  3BM7 A;  5SZT A;  3OHB A;  3EWG A;  5G0R B;  3BDP A;  4QWE A;  2JVR A;  4WFA Q;  1UFL A;  2XSJ B;  3JAM Y;  3RW6 A;  4DV4 F;  3MHY A;  3MUV P;  3UPF A;  2JOQ A;  2IYG A;  2A6M A;  4J9P A;  2LCW A;  3BH7 B;  1WC6 A;  4ICL B;  3WHI A;  4AXI A;  1DLO B;  1SC3 B;  3HFV A;  2OPQ B;  5L1I A;  4B3T J;  3HOZ C;  4I7F B;  1OWX A;  5A0Y A;  4A3M K;  2RUG A;  2AJF E;  1JNZ B;  2E2J C;  5I3U A;  1P27 B;  2W8L A;  4E0D A;  4L76 A;  1OY8 A;  1LWF A;  5GAH I;  4E98 A;  1WD6 A;  2YWW A;  2KFZ A;  4DX6 A;  3PO4 A;  4CO3 A;  3OTB A;  3AA9 A;  3UDE A;  4JI0 F;  5HL7 Q;  3TJ9 A;  2B9W A;  5HQ8 A;  4PG5 A;  4JB8 B;  2R2R A;  3G8S A;  3CJ4 A;  2EG1 A;  2YXL A;  4ED4 A;  1FKA F;  2XCP A;  4K4V A;  2CJK A;  3Q0A A;  2O66 A;  1JXL A;  3DFE A;  2AYB A;  4USM A;  3I31 A;  1EH1 A;  1D1U A;  5L39 A;  4ER8 A;  1RHM B;  3RR7 A;  4YHH F;  1M5K C;  1QSS A;  1DTQ A;  2VJU A;  3RBX A;  3CAG A;  2EI5 A;  4NLV A;  3KK3 A;  3C14 A;  3TYT A;  1GMV A;  4IH6 A;  2R92 C;  4TYA A;  1WIH A;  4O3O A;  3ERE D;  4DV7 F;  5KFT A;  1HBN A;  1XBW A;  4LF1 A;  4AE5 A;  3GTQ A;  2ZM6 J;  2ZVS A;  4WKR A;  3S15 K;  3I0S B;  1T95 A;  4LUB A;  5B0G A;  2AW0 A;  2VFT A;  4I6A A;  3K2Y A;  2EFP A;  4LR7 A;  4ZVH A;  4KDD A;  4PAA A;  1L3V A;  1S79 A;  4G7H A;  4USW A;  2G9O A;  4ED8 A;  2RDD A;  4ZVO B;  4NYP A;  5IP9 K;  4LBH A;  1FRJ A;  5LXR A;  2RML A;  1I3O B;  2Q43 A;  3I5C A;  5AT1 B;  1KLM B;  4Y52 C;  2D74 B;  2QEX S;  2ZH4 A;  5C25 B;  2HBR B;  2IVY A;  3EGN A;  1PYS B;  2P5V A;  2GJ2 A;  2VJV A;  2KFN A;  4A3K K;  2BE2 B;  3GR0 A;  2XYH B;  1R8H A;  2LQ5 A;  3GSI A;  2RU3 A;  2YX4 A;  3RRH A;  4J9R A;  1MLA A;  4ZJO A;  2B7B B;  1LWE B;  1UEU A;  2WBR A;  5E2Q A;  1VIS A;  3I0R B;  4OQJ A;  4N5S A;  4WZQ A;  2YKO A;  4LFB J;  2MJU A;  3AXM A;  1NHV A;  5HL8 A;  2FY8 A;  3CUL A;  1FDA A;  1RAH B;  2M4M A;  2QV6 A;  5DM7 Q;  5GAE I;  1F2G A;  5J2P A;  2G2O A;  4RPF A;  3TJ8 A;  2DNY A;  2V34 A;  3GTJ K;  2EG2 A;  4YN3 B;  1HQE A;  3W9J A;  4O44 A;  3CCQ S;  5KT4 A;  2EK6 A;  1ZOT A;  1VRT B;  1R0A B;  4P2F A;  1UEV A;  3KK1 B;  3NNA A;  5AXM A;  2YKN B;  4CLU A;  3QX3 A;  3KXD A;  5HMY A;  3HZG A;  3S8S A;  3K8V A;  5GMK a;  3RBZ A;  3R3T A;  4C48 A;  2FYX A;  5B0A A;  4J9K A;  4F0M A;  3MCO A;  5MAO A;  2ZD1 A;  1R6Y A;  4JI2 F;  2CQ1 A;  3W60 A;  4DOZ A;  2MQ8 A;  4RBV A;  3KJV B;  4RUH A;  3M4X A;  1BXN A;  3OR1 B;  3QJJ A;  3EDR B;  2W2M P;  3FKB A;  4X4T A;  3I5B A;  4DU7 A;  4FZB A;  4DL6 A;  3W2W A;  2MHN A;  5J2N A;  3RJM B;  3DRR B;  4IR1 A;  1R7I A;  2AZ1 A;  4JYA F;  4KSE B;  2APO A;  1XMB A;  2C1E B;  5HN0 A;  5HMZ A;  1IBA A;  1K0V A;  2YU9 C;  1U47 A;  5BXI A;  4LF8 J;  1EK8 A;  2VPZ B;  4PXB A;  3DGP A;  3E2E A;  3EPI A;  1EX8 A;  2CA9 A;  4J90 A;  4B9N A;  2Y1J A;  2E7V A;  2VQE F;  3D6F B;  1Q4R A;  1HI8 A;  2E5L J;  1NDC A;  2R9L A;  1VQM S;  4I2P A;  1NJY A;  1RE1 B;  4KHP J;  3S16 C;  3SSQ A;  2D7S A;  3HVW A;  4PG4 A;  3ENV A;  2DY1 A;  2AHO B;  4WBF A;  1REV A;  3K57 A;  3NGK A;  1INN A;  3P5B P;  5GAD U;  4UUW A;  1UV7 A;  5D4L A;  2OSR A;  2G1H A;  1GAO A;  3VAH A;  1WF2 A;  3MED B;  4M5D B;  5KOW A;  1EKR A;  4KGK A;  2D1C A;  3M9N B;  4I67 A;  1FKO B;  2L3M A;  2IBO A;  2JWN A;  3VGU A;  4RU2 A;  4OL8 A;  2MY8 A;  4OZN A;  1SV5 B;  4PWD B;  4Q4Z A;  4PWU A;  4J9U E;  3LWM A;  3NMR A;  3GTK A;  2BE7 D;  3T41 A;  4DI6 A;  1ZM3 A;  1VJE A;  2RQC A;  2XCO A;  1H73 A;  2CWX A;  2JA7 C;  1USM A;  2CDQ A;  4YR3 A;  4FF1 A;  3HOW C;  4OX9 J;  3MPD A;  3FQK A;  1XNR F;  2C2N A;  2MKH A;  1WKK A;  3UDL A;  2YNI B;  1RTI B;  4X65 J;  4A3B C;  1NRK A;  2NVY A;  1KSP A;  1KDN A;  1N56 A;  5HAT A;  2JLG A;  1M0S A;  4LQ9 A;  3GTP K;  4NYO A;  1FXL A;  2CFA B;  3CO9 A;  4OJ1 A;  1SKW A;  1WHW A;  5AJ3 F;  1TUW A;  9ATC B;  2JJ4 D;  4OFZ A;  1TR0 A;  1YI2 S;  2UUB F;  4OZ2 A;  1TVR B;  1NZA A;  2AQ4 A;  2LQ9 A;  1S6P A;  4MT1 A;  2I5J A;  1WOS A;  4X6A C;  3MML B;  1R9T A;  4DR2 J;  5KFQ A;  2RVJ A;  1ZAW A;  2HFN A;  2QSW A;  3NCR A;  3J7Y I;  1DRZ A;  1L3K A;  3OFF A;  1GFW B;  2M70 A;  4A3C C;  4FF4 A;  5F8N A;  1MU2 B;  3PCO B;  2LA6 A;  4DZ6 A;  1AXQ A;  3MMB A;  1XMQ J;  1WDD A;  4MK7 A;  5E41 A;  1LWX A;  2HHT A;  4LFA J;  3THP A;  3ENA A;  4H4K C;  1F9E B;  2L9N A;  1RGV A;  1HYS A;  3BP3 A;  3H42 A;  4DFP A;  4OIO A;  3UWT A;  2QT7 A;  4PPD A;  5HRO B;  1B99 A;  4LQ3 A;  2A10 A;  3SBM A;  2MMY A;  3CE8 A;  3ENW A;  5IS2 A;  1U1M A;  3R7N B;  3DDK A;  4GTD A;  1LNQ A;  4JUZ A;  2NPF A;  2GIF A;  4NML A;  4CLZ A;  1J5O B;  4LF4 F;  4CNZ A;  2DNH A;  3AT1 B;  2YPZ A;  1VLY A;  3K59 A;  1JLF B;  2QMX A;  2HND B;  2F8H A;  5KFS A;  3DRX A;  2RU9 A;  3S01 A;  3IXQ A;  3EXY A;  3LP2 A;  5DDO C;  4LSZ B;  4UF4 A;  4USH A;  1YZ6 A;  3CCJ S;  1IWA A;  1NM2 A;  2XZW A;  3C15 B;  4KO0 B;  3OL9 A;  4HYK A;  1VS3 A;  3CDE A;  3BPS P;  2GZO A;  2FVP A;  1RTZ A;  5KFW A;  4CLY A;  3D1Q A;  3P3D A;  3K5L A;  5F8M A;  2E2I A;  3IGN A;  1JMT A;  2EKN A;  3K7A C;  2E1C A;  5CXT A;  4DBQ A;  4A3J C;  4CLW A;  2V50 A;  2W2N P;  1JX4 A;  5C2G A;  3V81 A;  4ZVR B;  3DHX A;  3I87 A;  4NLW A;  3CQZ C;  2YNG A;  2LP4 A;  1G3O A;  2IPO B;  1KN6 A;  1SMY A;  4ZPT R;  4KC5 A;  3HSG A;  2MPU A;  2PEB A;  3IR6 B;  5C3E C;  4RUC A;  1RBO B;  5L8R C;  5FDL B;  4MAK A;  2B63 C;  4JV1 A;  1WC3 A;  3CJ8 A;  2LEA A;  2UXC F;  5C42 B;  3HOX K;  2WVD A;  1T0T V;  1Y1W C;  1FDD A;  3FDS A;  2DHG A;  4P72 A;  4U7U K;  1REG X;  1CJV A;  4GC6 A;  4D3G A;  5DZ7 A;  1LXN A;  4C3I K;  3HDS A;  1EKS A;  2OP5 A;  1DUR A;  3MAA A;  2DO0 A;  4YY3 F;  4USU A;  3AB4 B;  1NCL A;  2BM1 A;  2H1Y A;  3J80 Y;  3CJR A;  4ZIV A;  1B70 B;  1X9M A;  2FGC A;  3FVY A;  1S1X B;  4GO7 X;  4DSJ A;  4QWA A;  2Z58 B;  3HOY K;  4YDD B;  2KG0 A;  2HS3 A;  5HK4 A;  4QJV A;  3ONQ A;  4ZVS B;  3EE3 A;  1ZTW A;  3MM7 B;  2HLT A;  5F0U A;  4RNF A;  3S14 C;  3AQO A;  2VOP A;  1Y9O A;  1GK8 A;  3VAK A;  1TWG K;  1NXI A;  2HMI B;  4DL0 C;  1USO A;  4KN7 A;  2LEP A;  4BS2 A;  3CT9 A;  2O3D A;  2W4P A;  4A3E K;  4QYR A;  2E5H A;  1H2T Z;  1S1V B;  2QA4 S;  2XLK A;  4C8L A;  3FKI A;  3DRS A;  1N32 J;  1NKE A;  2D41 A;  2EW9 A;  4A3F K;  4NLS A;  1MG7 A;  2JC0 A;  1MMN A;  2FDN A;  4NL5 A;  5T14 A;  2GV1 A;  2B6A B;  2K3K A;  3AQP A;  3QIP B;  2BRK A;  3TX0 A;  5CYJ A;  2X1F A;  4NLY A;  5I3U B;  3H2U B;  3MEG A;  5TJ3 A;  2CQG A;  3OPK A;  3KUG A;  1WF0 A;  1N6Q B;  1CC8 A;  4B3O B;  5IT0 A;  2E1P A;  4R0E A;  5C44 K;  4ZH4 A;  4CQ1 A;  1IBM J;  1HA1 A;  3B54 A;  3R1L A;  1YRT A;  3TAP A;  2G4B A;  4ZVF A;  1B3T A;  2XQC A;  4OHV A;  4NLO A;  1C0U A;  2CPI A;  2W7V A;  2FJE B;  3ZTS A;  3V4I A;  3SZ2 A;  1WCM C;  4DV1 F;  5GAH U;  4USI A;  2BJ7 A;  4RUB A;  4DL7 A;  2Q3P A;  2OML A;  3HFZ B;  2WAQ L;  1TKT A;  5FJ8 K;  4H54 A;  1M90 T;  2DNK A;  4AL7 A;  3N0V A;  1KTV A;  3Q8Y A;  1N34 F;  2ALZ A;  4LK0 A;  2V4Q A;  1DTQ B;  3PEH A;  1OPZ A;  5ETM A;  1HKA A;  3ILL A;  3FZ2 A;  2R93 C;  1YJT A;  3KOA A;  1CS4 A;  1E6V A;  2WZ1 A;  3MMC A;  3TVZ A;  1K73 T;  2E5I A;  2YX7 A;  3OVB A;  4PXD A;  1ZYR A;  4BY7 C;  3FOE A;  3N01 A;  1SXL A;  4YUD A;  3PV8 A; 
#chains in the Genus database with same CATH homology
 1YX2 A;  1XZQ B;  1WOR A;  1XZQ A;  3GEI A;  1WOS A;  1PJ5 A;  3TTG A;  4PAB A;  1VLO A;  2GAH C;  1WSV A;  3GIR A;  3A8J A;  3A8K A;  3A8I A;  3TFJ A;  2GAG C;  5L46 A;  3AD9 C;  1XZP B;  4PAA A;  1XZP A;  3AD7 C;  1PJ7 A;  1V5V A;  3GEE A;  1WSR A;  3TFH A;  3TFI A;  1VRQ C;  4P9S A;  3AD8 C;  3GSI A;  1X31 C;  3ADA C;  1PJ6 A;  1WOP A;  3GEH A;  1WOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...