3ADAC

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with sulfite
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3adaC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3adaC01
3TTGA 3ADAC 1XZQB 3TFIA 5L46A 4PABA 1XZPB 1WSRA 1WORA 3AD9C 1YX2A 3TFJA 1PJ6A 1X31C 1WOSA 3GSIA 1V5VA 3GEHA 1VRQC 1WSVA 3A8IA 3GIRA 1XZQA 4PAAA 3A8JA 2GAHC 1PJ7A 2GAGC 1XZPA 3GEEA 1PJ5A 1WOPA 3GEIA 1WOOA 4P9SA 3A8KA 3AD7C 1VLOA 3AD8C 3TFHA
chains in the Genus database with same CATH superfamily
4K8RA 5J2PA 4PR6A 4DFJA 3FCWA 1PYOB 1CVJA 4QU7A 1S9EB 4O3SA 2BUNA 4QBUA 3DDKA 2VFSA 1HQUA 1IJEB 5KFMA 2R2RA 1JLGB 3T1HF 5I3QA 3UR3C 5T41A 4HKQA 1J5OA 3M2VA 3IR5B 2KHDA 1V5IB 3CDBA 2HFUA 4ZVQB 2JLFA 1WHWA 4C9DA 5F0WA 3K5LA 2IVMA 4PG7A 1SL2A 3KHLA 1KEKA 4DR6J 1Q53A 3P5BP 3CJ3A 2GVDA 2LEPA 4UUWA 4Q4ZA 4Y65A 1SH0A 1SIWB 3PDNA 3GTPC 3D1OA 4QIWD 1BHNA 3QRPA 3GIMA 1M0SA 2EKYA 4KC6A 5FIIA 1XMOJ 4KPCA 3H5SA 4ZN1A 4JI6J 2R7UA 1MLAA 3D1QA 3SCIE 2VC1A 1O2BA 4ZJLA 2O01C 1TWGC 4P2SA 3MPYA 3CC4S 3GV5B 1TKDA 1NJZA 2IDLA 4F7VA 3J80U 2ZBIA 2R7QA 2ZH7A 3IC1A 3GYGA 3EXCX 1VBZA 3H5UA 4F3QA 1TWHK 3JTOA 3DI6B 4PG6A 2JVOA 3N4WA 3F73A 1X0PA 2IDEA 3NWGA 1VLOA 1SKRA 4IFVA 2IM1A 4B3OA 3S14K 4F36A 4LK0A 1HWJA 1FTCA 3BV8A 2YPZA 4ER8A 2L3MA 4E2FB 1HNIA 2VUMC 4RW6B 4BC9A 2NYHA 3N01A 2PA8D 1DQ9A 4HACA 2MGZA 2QLBB 3OL6A 4DS5A 1J27A 4FN5A 1XMQF 3H8YA 1EB0A 5F3ZA 2HRUA 5KFTA 2HHTA 5C44C 2NXNA 1JJ4A 5IYCC 3H0GC 2CQ4A 3PRBA 4OI0A 1GTEA 3RBEA 3M30A 1F3FA 4WZQA 5M5YK 2CPHA 4ZOSA 5LSOA 2CPYA 5H9FK 1YCLA 2XTJP 3Q86A 5IP9C 5I4MA 5IYDK 1JK9B 3KLEA 3P3DA 2GHWA 4DQQA 4UOHA 1S0MA 1ZQ1C 3DDIA 4OYZA 4CIOA 3W66A 4A8FA 3EUNA 2Y8WA 3M1VA 3ITHB 1ZA1B 1UVIA 3MECB 3CGIA 2D9OA 2DNKA 3GR0A 1DARA 1ACMB 1EAYC 4A3BC 1Y4ZB 3TUJC 4HH0A 3EM1A 1HYSB 2HK2A 2HFZA 1U1PA 2E2HC 1IM4A 1BXNA 1O2FB 3SCLE 3VAHA 3AQPA 3CT9A 1S9EA 5KFYA 3GJQB 5DO2A 3U1LA 1LWFB 3A8EA 4LR9A 1P8GA 1HI9A 1JLGA 3K2YA 2J9CA 4Y6IA 2R93K 1I6VA 2ABYA 1RHMB 1F7UA 2NVYA 3GJSB 4G65A 3CJ8A 5C42B 2IYGA 1OIAA 3QZ7A 3W8GA 4YN3B 3MM9B 3Q0AA 1LWXA 4DHVA 1RWMB 4QPXA 4LF5F 5JMNA 2IFXA 2YWHA 3BGUA 2BRLA 4I6WA 3SIPB 4LF6J 5LXRA 3EGVA 1SC3B 5D4OA 2V4RA 3T19A 1DQ8A 4DUTA 4PRFA 2I6WA 1RAEB 1HLWA 4ANEA 4JI8J 4P72A 4J9LA 2KHCA 3V6DB 4RUHA 5IQQA 5ITHA 2DEJA 2ZFHA 1VQSA 5SZTA 2NQPA 1RHJB 4NMLA 2ZE2B 4OYBA 4DL5A 2WVFA 2UUCF 2C2RA 5E5NA 3L3CA 1FKAF 2GO8A 5MLCV 4ZPDA 4K4VA 5K14B 4DX5A 2EI5A 2KDOA 4JB8B 2E1RA 2VKRA 2VOOA 2VC0A 4LSNB 2QMWA 4Q45A 1VIXA 5B7WA 3TAMA 3DI6A 5B0DA 1ZYQA 1S6QA 2NLWA 2QA4S 3UQSA 5C5JA 3J80Y 1BWVA 2LXIA 4F3MA 4MIAA 3DOKB 1IKWA 1RT3B 4OHXA 4RW6A 4CLFA 3PW0A 3MCOA 4C8ZA 2XYHB 2W7PA 4EEYA 3IBWA 1C1CB 4XTTA 4RNNA 5IOSA 3F44A 4IFYB 3J7YU 1JLEA 4OV1A 4KN7A 4F0KA 1K0VA 4RW9B 4Y52K 5KT2A 1BE4A 2V6SA 4EU0A 1X60A 2W1BA 3C16B 3FSYA 3GTYX 3WQPA 4QIEA 5IT9U 2E5LF 1P9QC 4QWDA 1R8PA 3GTQA 4P5BA 3CNQP 1NKCA 4OL8A 1HKAA 2X1BA 4OZJA 1EP4B 1D9AA 1F3VA 3W8PA 2DGWA 1RHUB 4N76A 1WSVA 3FFIB 4C3IC 4J9UE 3MUVP 2UUTA 1VQOS 2PE8A 2W2PP 4A8YA 5KFNA 5BXIA 1O27A 3MECA 2QJ3A 2L9DA 3TFIA 5H9FJ 2FJDB 2HBZB 1Q82T 2MQ8A 1S4EA 1HYSA 2V2KA 4TN2A 2OSQA 5F9NA 1HNXJ 1S72S 1BDFA 1X4EA 3TJ9A 2GW8A 3NWRA 3MTKA 3HSGA 3MMCB 4LOWA 1Y7PA 2VG5A 1LWFA 2HAFA 2U2FA 3GTPK 2HGLA 2LQ9A 3MF5A 3VGTA 3NGDA 1RT1B 3H25A 4RNOA 3MM9A 4ED7A 4FS1A 2FJBB 2W7VA 1TWGK 1UJ4A 1EZZB 3D9BA 3ULHA 2RRBA 2VD3A 1I94J 3GJTB 3PW5A 2QE5A 4QU6A 2KXHA 2Y9HA 5ETQA 3QIPB 3HOUC 2UVRA 4GMKA 4GVLA 3I5CA 4BLBA 2MHEA 4ANDA 3V6DA 2GHPA 5L38A 4KE5A 2IAJA 2VUMK 4F50A 4O23A 2ZE2A 1MN7A 3HHLA 2WOMA 3H3VL 2PEBA 3KG1A 4C98A 1N34J 2HHPA 2QSWA 3DU5A 4Q5SA 4USMA 5C44K 1UCNA 5IYCK 3H0GK 4DR2F 2NSCA 4IDKB 1ISEA 2AJ2A 1EQRA 2UU9F 3OTOJ 3I96A 2QV6A 4WJ3M 3QJPA 3I56S 2MLYA 1FA0A 2C3UA 4P9SA 3RTVA 5IP9K 1K73T 2QA4G 1A9NB 3EZ5A 2ZUGA 4PYDA 5C7PA 1EHWA 2XQCA 1VQKS 3DOKA 1RT3A 2UXBJ 3GEHA 4M5JA 3M2UB 1KSPA 3TP2A 4IFYA 2CQ2A 3PO3C 3PKYA 2ZUEA 1WTBA 1G6BA 1Y1VA 2VPXB 4YR0A 3IN5A 1ZTWA 3BSAA 2F4VJ 1NEEA 1WKKA 3LPYA 4RW9A 2AQ4A 3DM2B 1KFSA 4QPTA 2H54B 1NKBA 1LW0B 3C16A 4A3BK 2X51A 2E2HK 4DL0C 3ETMA 2YNFB 2WHOA 2XCRB 3K5MA 3VA7A 1EP4A 1U26A 2YX1A 1D0EA 1R0CB 2C2DA 5D3GB 3FFIA 2XNRA 2CDRB 2R7RA 2VG7B 4NYOA 5EWFA 1SC1B 2NXUA 4I1TA 1T3OA 4DQRA 4ETXA 2AJ1A 4ECXA 3FEXB 1K1QA 1R8HA 3SDEB 4GT9A 3CCJS 2VICA 2AJQA 4OI2A 1RTJB 1C0AA 1LWCB 3ENVA 4KGKA 2BBEA 1XJWB 1WD6A 1IN0A 1GTHA 3IR7B 3ONQA 3G71S 2JLEA 4Y0FA 3CCLS 2VODA 1O29A 3MMCA 3M4OC 4LF8J 2UVVA 3ERED 3CDEA 1NLKL 1GX6A 2ZBRA 1RT1A 3FGVA 2XS2A 2NVYC 1UWBB 4R5PB 3RAXA 1U1RA 4CH1A 1H2UX 1RWWB 1UJ6A 1AYEA 3PRDA 1BQNB 1HWIA 2D74B 2M8HA 3VTIA 3U1MA 2XG8A 1XQIA 3QIPA 8ATCB 4LF9J 1RE1B 4LF4J 3UPFA 1Q8KA 2GQQA 5K5MA 2K3KA 4DFKA 3EJMA 1AUSL 2LDIA 1TQLA 4B3MJ 3ET6B 1KFDA 2B56A 1UVJA 3OTEA 4LFCJ 3OD2A 2P6TA 3NG8A 4KM8A 3BH7B 2M9KA 3GTJA 1G3OA 4QR0A 1GMWA 2B9YA 4IDKA 1UWAA 3QWPA 3CCSS 3GILA 3MEDB 5KFZA 5D0RA 4JI3F 4ED6A 3EGZA 4X4NA 2ZM6J 2A6MA 3A3OB 3BP8C 1R8BA 2FJEB 4DN9A 3LP1B 4M8LA 3HK2A 2HQ3A 4F3OA 4X64J 2W4PA 2Z2LA 3KLIB 3G6ES 3Q89A 2BJ9A 3M2UA 4DJBA 1J5EJ 2OMOA 3P5TL 4C3IK 4J9RA 2EFNA 4EGLA 2NPFA 1PKUA 3UDLA 3UFCX 2CJKA 1RT4B 2GSUA 4B3SF 3DM2A 1WF1A 3M8RA 2ZH9A 1LW0A 1ZM2A 2E66A 1U45A 2PDAA 3OLAA 4N41A 2DRAA 4QWCA 3OFHA 1FCAA 5E3AA 3AJ1A 1LNQA 1UL3A 3GTQC 2LQ8A 2YNFA 5T14A 4JI5J 1APSA 1DTTB 1T9YA 1HR0F 1MMDA 2H48B 2MQPA 3MDFA 2OTLS 1YJNS 4MYTA 5D3GA 1IBAA 4UUXA 2CVIA 1Y5LB 3OSPA 3K0JA 1SB6A 1TL7B 1YZ6A 3LF0A 2R7XA 3OBIA 2FQTA 2GSOA 2ZUFA 3GDZA 1LW2B 3K8WA 1LWCA 3JQJA 3LO3A 1FXDA 3BS9A 4M5NA 1FRMA 3IBCB 1IBMJ 4DX6A 3RUBL 2DGXA 4C48A 3GLJA 1YJ7A 3HOUK 5KAKA 3QGHA 4X4SA 2RMLA 2XSJB 5J1PA 5I3UB 3R2CJ 1KVKA 4ED0A 4G0VA 5KFDA 3C8YA 3GIRA 2FVCA 2UZAA 3OXFA 2GMJA 1T95A 1AZSB 3GU0A 3ZZ0A 1UWBA 1F9HA 4MEYA 4J9VA 3TI0A 6FDRA 4I6AA 1U2CA 2L9WA 2EFQA 5M2UA 1WQHA 3TUPA 1K8AT 4OZ5A 2QSFA 1N33J 1BQNA 1ZAWA 2B7CB 3KNAA 4RW7B 1IWGA 2WK4A 3TR5A 2GZOA 4Y2MA 2ZH4A 1ELOA 1UFWA 4AE5A 2G0JA 4UOFA 3GTLA 5KFOA 4B3TJ 2C42A 1RA7A 3HKWA 4DV1F 2W7AA 3CWJA 2XMUA 4Q44A 5DG8A 3ET6A 4ZLPA 1EKSA 3IWXA 4KGMA 1XMBA 4NCAA 2MKCA 4ED5A 3PO3K 1YBAA 1YI2S 2V8DA 3CMAS 4X4QA 3IWNC 3Q8PB 4ZVGA 3AD7C 5ETOA 3BF4A 2FVSA 2HW3A 4J9KA 3MEDA 1M1KT 3HKZD 4D3GA 2P6SA 1VQNS 3KUEA 4FPRA 3PACA 3DXBA 2CQBA 3LP1A 2YKQA 4DUZJ 1EK8A 4WYWA 3JXOA 2YNHB 3PTWA 3PO5A 3BB5A 3IA0A 3AOAA 1S1XB 3THVA 1T8EA 1N48A 1TL3B 5MAOA 1FNMA 3LWMA 5G4DA 4U95A 4F2SA 4WBFA 5IOQA 1Y1VC 5CYQB 1Y9OA 4HL9A 1XPPA 5CXTA 3QSYB 1RT4A 2BJ7A 2FC8A 2V5HG 3THTA 5DDPC 1VH2A 5E41A 1RSCA 4PXBA 4X4UA 1SCJB 3CULA 2FDNA 2NVTC 5SUHA 3B8HA 1DCOA 1DQAA 1DTTA 1J2VA 5DQIA 3LPXA 1RCXB 2ZWPA 1HBNB 5CA5A 2BA9A 2LA6A 3TOQA 3M4OK 4KJIA 3QAUA 1RLCL 4K59A 1SBRA 1AB4A 4MK9A 3LUYA 5DQHA 1N32F 1TL7A 1VQ9S 2NVYK 4WU2A 1FJ7A 4AH6A 1SMYA 3VAKA 1XERA 4DV4F 4KH0B 3MWBA 4QJVB 4OIPA 1LW2A 2XCAA 1DURA 2PMZL 2FIUA 2J9EA 1KWMA 2A2CA 3MD3A 3OTBA 2GQ2A 4XK8C 2GIQA 1XR6A 1UV7A 3WC2A 1OWXA 5HQLA 3HLUA 4ED2A 1MSWD 2XSJA 5I3UA 1L3SA 4WILA 2DITA 2JEIA 3A13A 5KT7A 4FYWB 1V3ZA 1WHXA 1AZSA 3BBBA 1PC4A 1RA6A 2QX0A 1FXLA 2W4DA 3KHRA 3OXLA 1UFKA 1S6PB 3K89A 3TFHA 1PO6A 1Y3JA 3KLVA 1N5YB 3BZQA 5EHHA 3RZOC 1SJRA 5FDLB 4RW7A 2RDJA 1JKHB 1TKZA 3S1QC 2KG0A 1YTYA 1X5PA 1B99A 3BQ1A 1D9FA 5DRKA 1T3NA 2YH0A 5DJBA 3EPGA 2CZ9A 2PT0A 2I9SA 4YFNA 3HZGA 3H20A 1FF2A 2GIRA 3HI9A 3D28A 3S0XA 1RWKB 3A8IA 1NK5A 3CJQA 1PAUB 2HNDB 3BO2A 3BGFA 2GJ2A 1XBWA 3PYFA 3GTJC 5E3QA 3BDEA 2JA7A 3AFGA 1VC6A 2PD1A 4X2BA 2X1AA 3K17A 4ELTA 4I7FB 2CPJA 1S1WB 5L9NA 3O6QA 4Z7YA 3GTQK 3Q83A 1I1GA 2EC0A 1UEVA 1RACB 3UNGC 5B0GA 4HR2A 3TAPA 3VGUA 1UA0A 4DV5F 4X4VA 2Y1IA 5L8RC 1JLAA 1Q7YT 1OYDA 4OX9F 2CPZA 1NK0A 2YNHA 4UT4A 3A12A 4LBHA 1S1XA 1HI1A 1X4HA 1HWKA 5IYBC 1SQGA 1TL3A 2NCKL 1W25A 1S49A 3IR6B 4U7UD 1FRJA 3L7PA 5RUBA 1NB7A 4CP5A 1FVQA 3FRYA 2YPYA 2VA2A 2R7WA 4DSKA 3KWMA 1NZ8A 4C0OC 2AX1A 4DL2A 3OR1B 3M6XA 2HSEB 3RR8A 2JFDA 5BR8F 3HOXC 3EZUA 1TAQA 2WVDA 3I9ZA 1HBNA 3DC2A 3V5RA 4JYAF 1RQ0A 1SKUB 4DR1F 4U9RA 4GKJF 1NSQA 5J2NB 4PWUA 4F0HA 2FGCA 3S16C 2FGOA 2Z58B 1SFOC 4QJVA 4OIQA 3U27A 4CLLA 2KRBA 3L4BC 4ERDA 3OREA 3JB9k 1SJ4P 3MCMA 4PQUB 4ZPCA 4TYBA 3CUNA 2MYFA 4OI1A 1M5OC 3B78A 2OMLA 1Q86T 4OX6A 2DCUB 3TA0A 3PYEA 1WKLA 5DLGA 2CWXA 1UPPA 3NUHA 3QMQA 2X1GA 3DU6A 4DV2F 1PC5A 3IAM9 3R5CA 3RAMA 1S97A 3HF5A 3PEJA 4BLGA 4ZLLA 2EFGA 1N5YA 3CCTA 4ZPVR 5FDLA 1RU1A 4OHYA 1JKHA 3VAFA 1R89A 4QW8A 2KVQE 1EIYB 1HBOB 5F8IA 4DPWA 3W2VB 3I0RB 4ZP7A 5JJBA 4NLQA 2QC3A 3HX9A 2JSXA 1YJUA 2IC3B 4GKKJ 4X65J 5AE2A 4X62J 5A2QU 1HW8A 4MH8A 3EE3A 1A6LA 3VVTA 4W90B 2HNDA 2AP6A 1FNOA 2O5IA 4LR2A 1HQEB 4ILLA 4DFPA 3GYNA 2WW4A 1J6VA 1Y1VK 4Y2AA 1CJUB 4PKDB 3HFKA 3JAMU 4LUBA 3PHEA 3Q8SB 4XPEA 1N52B 1N36F 3SBMA 3HHNB 2E44A 2G2YA 3QBCA 5AJ3F 1S1WA 2HFNA 2W2MP 4LMZA 2CPDA 4JI4F 3MAHA 2NVTK 5KFUA 3MM6B 1RABB 2QFJA 2RILA 4FF3A 2E1MC 2VJVA 3S8SA 3OVBA 4GTCA 3D0GE 3JTNA 2OJ3A 3H4DA 1T7PA 4P5AA 1IBKF 2MZQA 1U49A 3CCRS 3MM8B 2C1EB 3QQCD 1JLCB 4WYLA 3R1HA 3MEGB 2VJUA 2XMAA 5D4PA 4DEZA 4Q0BB 1JLFB 4CLPA 4IR9A 2FLNA 2AGPA 2O1PA 3H59A 1F5AA 2JZ5A 3OR1A 2DK2A 4BHQA 2F7VA 1WG1A 2F65A 4A8SA 1ZAXA 4KMAA 2SXLA 4LRDA 2M4MA 6FD1A 3PW7A 2DNRA 1WUUA 5KFPA 3NAIA 3OL7A 3RBDA 1E6YB 3NGKA 5HSPA 4O0NA 3M7VA 2BJDA 1F93A 3G96A 3QLHB 5J2NA 2NXEA 4Y34A 3CEDA 1WI8A 1TUVA 2A6EA 2E5JA 4X66J 1B0VA 3LAMA 3G4CA 4BCAA 3RZOK 2P9GA 3G8TA 1B4SA 3S1QK 4A3MC 2BQUA 2VV5A 2MQMA 1N88A 1WEZA 4PQUA 2WCXA 2R8KA 2RB7A 3I0SA 3RRKA 3FKBA 1JOEA 1YZ7A 2ZDOA 4KH1B 3WIVA 4CZCA 5F8NA 2CQGA 1R6YA 2P2CB 3IGVA 3V4GA 4TY8B 3PCOB 2OFGX 3GP9A 4ED1A 4WXWA 1C4AA 2OD6A 2W01A 3SZYA 2HHHJ 1N5QA 1EH1A 3J7YI 2E1CA 1S4FA 2W9AA 2A6HA 3T1YF 3TQEA 3GTJK 2HS0A 5DZ7A 1CBKA 5KFIA 3M9OB 2ADCA 4ILMA 4OI6A 4NXNJ 4PG5A 3PKMA 1C1BB 3AAWB 5KFBA 1EQMA 4UQTA 1X7VA 1HBOA 2DISA 3SSSA 3LPEA 2DXFA 1RAOA 4Z7CA 2ASYA 2IC3A 4O44B 3M3YC 3PIOQ 2CDQA 1X4FA 4IR1A 4P73A 4EBCA 5GAHI 4CM2A 5IYBK 2MTLA 1KLMB 4OYPA 1HQEA 1CEZA 1EX8A 1SL0A 1RU0A 4B9UA 5K8PA 4USUA 4NLVA 2WAQL 1CJUA 3FC9A 5FD1A 2B0GA 2KG1A 2JA7C 3WBZA 2DHXA 1YJTA 3HOVC 1NCLA 4QWBA 2GJIA 2QMXA 1KVJA 2NVQC 3MM6A 1MU2B 3HOXK 4MYUA 3JAMY 1TZ0A 2HQDA 2D6FC 1RHRB 2LEBA 3N0CA 1RUSA 4M1XA 2ZUAA 1GT8A 3TUZC 3GIKA 5HO4A 4DI6A 3LWLA 1JLCA 5C4XC 5KOXA 1FJEB 1R43A 5D4DA 4L6V3 3MEGA 3O8WA 2EXUA 4ZVTB 4Q0BA 1JLFA 1VGYA 2VH7A 5IXUA 1U6ZA 3S16K 4PWDB 1SFOK 1F60B 1TL1B 2XSFA 3LALA 2RDIA 1SH3A 5HL8A 2O5JA 4KTQA 3KJFB 1FE0A 2V9KA 1VRQC 5HL7Q 3PW4A 2R8GA 4LFBF 3HSDA 3GONA 5C3EC 3VWSA 1TKXB 2Q79A 3AQOA 1E6YA 2PFFB 2Y3YA 1K9MT 4QWAA 4M1KA 2Q43A 4S0MA 2QO3A 4JP8A 3QLHA 2GAGC 4KM9A 2Z56B 2DNQA 2DH7A 2PSZA 3TA1A 5KG7A 1WCMA 1T94A 3CCVS 3LH2S 3KJQB 4EI2A 3W64A 2XZWA 4NLTA 2B4OA 2H5IB 5CYMA 1O26A 2PN6A 4DDQA 1ULRA 3DRYA 1TWHA 2W25A 4PQAA 5KFFA 4RBTA 2PFDA 3RU0A 4KV8A 1VRUA 3RW7A 2J7WA 1O24A 4TY8A 3ZZYA 4DR3F 1TV6B 2X1FA 3GYXB 3QT8A 3ILOA 1O25A 1UJ5A 4K0KF 2PIIA 1V3RA 2F5GA 4L73A 3QPIA 2ZOMA 3IFEA 1RTIA 1KTVA 5E3RA 4ZCKA 1S0NA 2E5IA 1I50C 2PI5A 2HIQA 3IMQJ 5TJ3A 4UF4A 1RWOB 1MWYA 1NB2A 1FRHA 4YY3J 1QAJA 1C1BA 4DQIA 5A8RB 4DOZA 1X4GA 3CC2S 1CPZA 2KI2A 3KK1A 1RHKB 3EDQB 1L3VA 1HQMA 2BX6A 2HHSA 1PCAA 2OPSB 5AE1A 4KRWA 2IVYA 4O44A 3RB0A 2MKHA 2B6AB 1R7IA 5U47A 2MSSA 2N4CA 2BYCA 1KLMA 5ETLA 3MR5A 2W8LA 3DLKB 5J1EB 2O5DA 1TL5A 2LXUA 5HVGA 3KUGA 3OTCA 4EUVA 1YBTA 3GIJA 3CSKA 2J76E 2PGCA 4NLYA 3TA2A 2WZ1A 4RUBA 1T05B 1MU2A 5IFMA 1T03B 2FY1A 2V50A 4IUFA 2R8JA 4GTBA 2BE5A 1JJHA 2D3ZA 2R7OA 2WTFA 4R8UB 4CQ1A 1U1MA 4FYDA 1JQWA 1LV5A 1R9TC 1QTMA 2OO4A 2BM0A 4ES1A 3CQZC 3OVAA 1MMNA 4FXVA 4PWDA 1QLNA 4ZP9A 2BKOA 3D6HB 2MZRA 1U02A 4K5SA 2FLLA 3B4DA 3J7A1 1IBCB 3KG4A 4A3MK 4DFMA 3TZXA 1NK6A 5IOLA 2YKAA 2POKA 1TKXA 1GQEA 5M5WK 2IVFB 4NA3A 5HANA 2WB1L 1HBUB 4MJKA 4KT0C 2PMHA 4M5IA 1HW9A 2DNLA 4QYZK 2CFXA 4WP9A 4CDIA 3ZO7A 1WKJA 2DJWA 5HMWA 3TO8A 3ADAC 4ZCLA 3DRSB 3N3YA 1D8ZA 2VBYA 3CD7A 2JJ4D 4LSLB 3MR6A 3PVXA 2ZVIA 2ZZTA 5K8MA 3NLCA 2LLZA 1LXJA 3VAGA 1R0AA 4A47A 3ZNUA 2M7SA 3R5GA 3KHHA 3Q2SC 2LDYA 1RYRA 4OJ3A 3GSIA 1QDUB 1S48A 3V2UC 3N79A 5E68A 1RJJA 4WU3A 1WG5A 3M3YK 2GMLA 3D5MA 3OSNA 4JBCA 2DB1A 4C45A 3CB4A 2UU9J 5HN0A 4RW8B 1VOMA 4NLUA 3D0HE 2IY5B 4ID5B 3G6YA 2K1RA 1VGXA 4EMDA 2ZH2A 3TARA 5F0UA 3TQ1A 1YHQS 3R5AA 3S1TA 4RW4B 2JA7K 3UWTA 4P6QA 4MFBB 3BN4A 2RKIA 3T9NA 3NCRA 4NCGA 5HP1B 3PNIA 5A8RA 3HOVK 1W2IA 2HK3A 2NVQK 3TVYA 1WHYA 3NGSA 2LXFA 4LQ3A 2Y0BB 2OPSA 3MOZA 1DD5A 4KKOB 3M8SA 5KFKA 3U02A 4K2XA 4UW2A 3MGJA 3I4MC 1WC1A 2QLJB 1UP1A 2B6AA 2V8GA 2EFVA 1FX2A 2DD8S 4KB7A 1DCPA 2CG8A 4DR6F 5C4XK 3JSTA 1RYSA 2CQ3A 3VAMA 5J1EA 2W9BB 3VVUA 5AXLA 2ZNZA 4O2DA 2YBVA 1NDKA 5M3FK 1OMSA 2XMWA 3TFJA 1HA1A 5HBMB 4CLSA 4YFUA 1CJKB 2JOQA 1XMOF 4JI6F 4RL1A 4I67A 3SSRA 4KIAA 4WCEQ 3POTB 4MK7A 1T05A 2D69A 5IS2A 1T03A 2ZKTA 5BJRA 3SI8A 4N8OA 2ROGA 3NS5A 4OQJA 3UDCA 2NREA 4USJC 1U0SA 5C3EK 4OIRA 5KG6A 2YWKA 3FUYA 4R8UA 3CCMS 1WIHA 2NPIA 4DR4J 4YP3A 2QIFA 3NBPB 4RJVA 3SQGA 1SQFA 1S79A 2UV8A 4TKTA 4LIRA 3Q2TC 1NK8A 2FHJA 3EDRB 1FT8A 2B63A 2E7XA 4XCHA 3BPDA 1Q78A 1DZ5A 4GTEA 3P45B 1TWGA 9RUBA 3M2RB 1RXOB 2AJ4A 1AUDA 4RMFA 3HMJG 3P8BB 4NLDA 2DR8A 5JUMA 4C3HC 3AH5A 3QRRA 1YITS 1HBUA 4V19X 1DLOB 1BUXA 3L4KA 2Z0GA 1RCOB 3P4UB 4OMFG 3BDPA 4C3JC 1GMUA 1VFJA 3DRSA 5AXKA 4WFAQ 3CDWA 3QRQA 2FC9A 1WEXA 5A6WA 2IJFA 4LSLA 2FZCB 4O4GB 1WCMC 1M5HA 2WVCA 1I50K 4KN4A 2PA3A 1L5UA 1SKWA 2I2YA 4YHHJ 4H4KC 1EKRA 4LVOP 2RS8A 4DPUA 4UOGA 2RQ4A 3UR0A 2AKWB 4WJBA 3C15B 4LQYA 2XMTA 3FOFA 4QYZJ 4N56A 3MURP 3DXJA 5LSRA 3V6KA 1WORA 1UA1A 2R7TA 1QD1A 5HJYA 1H0HB 2BE2B 1CS4B 3HCXA 3OFEA 4JI3J 2XGQA 3W3SA 4ID5A 2B9XA 2DNGA 1VHIA 4XO0A 2JLGA 1N6QB 2JL9A 3OEPA 5D0EA 3FDSA 1OY6A 2B4VA 1C0UB 2HVDA 1BC6A 4RW4A 3V81B 1G51A 4MFBA 2F8MA 5HP1A 2O67A 3W9IA 3K59A 1JX4A 3NL0A 4J3NA 5ETVA 2YWGA 3FZ2A 3NY0A 4F2RA 4IH5A 4KKOA 2E2HA 2YY3A 3UDVA 2L08A 3H2LA 1XR5A 5KG3A 2CIMA 3O1LA 2QL7B 4JOUA 2M70A 3D67A 4USHA 4LF6F 2VBWA 1UAWA 2I8EA 2ZZNA 3DGVA 4B02A 5EWGA 3I4HX 1R9TK 2W9BA 4JI8F 1D9DA 3CQZK 1Y3KA 2E9ZA 1H73A 3OHBA 3SFUA 1NDCA 1LK7A 5HBMA 5F8HA 4AYBD 1CJKA 2DRDA 3EQLA 2FZKB 4MAKA 5AXMA 5IT0A 2I1RA 3OW2R 3POTA 2KXNB 2AT1B 2G0CA 3HSJA 3MAAB 3I82A 2RH6A 3V4MA 1NU4A 1FXRA 3K5NA 4ZVOB 2H9ZA 2BJEA 2A10A 3IM9A 3NBPA 1OY8A 3RRGA 2VF3A 5D0GA 2RHQB 1MROB 2Z57B 4HTJA 4KGVB 5ETKA 4DSEA 1I51B 2ZC4A 1NJWA 4KGZB 3WC0A 2HFSA 2XS7A 4LF2A 1HL6A 3B6BA 2DTJA 4Q8EA 1D8YA 3CIMA 3OTDA 3KDNA 4E98A 4LRBA 1Q0NA 2GA7A 3L4JA 4A46A 4QCLA 4ZS6A 3VV2B 2V2QA 2AMCB 2EEYA 1DLOA 2DPIA 1Q5YA 4DX8H 1S9GB 3DYAB 2XLIA 4F0MA 2N3LA 2Z8QA 4C0BA 3OJSA 4G7ZA 2DIUA 3QZ8A 4HDGA 4AFFA 4YEAA 4AXJA 3GMGA 4X6AC 4O4GA 4BKWA 4NASA 2C2ZB 3KMQA 3EICA 3QIDA 4DV1J 4ZP6A 1U4BA 1QY7A 2FHOB 2NZ4A 4P71A 5K20B 2CXEA 1F0XA 4IG3B 3LAKA 2OFHX 1W7WA 3C15A 3N0BA 3MHYA 4QW9A 5DQGA 5HVHA 4KATA 4C8NA 3I4MK 2BE2A 1CS4A 2YH1A 2DY1A 3CAGA 3BSNA 3KUHA 3DLJA 3VZHA 3GFYA 3SYZA 4ZMMA 4JI2J 1FVSA 4A93C 1VISA 3JQMA 1TMJA 4EYHB 3K5PA 4DF8A 4R0EA 3GQCA 3G4SS 1C0TB 4F4YA 2AJFE 5ETSA 3PX4A 2CQHA 3TZWA 1Z2LA 1NJYA 1WOSA 1N5TA 1V5VA 1T11A 2ZBPA 5EDWA 1I94F 2DNZA 2MLZA 4ZIWA 5HJXA 1TUGB 2JVRA 1CC7A 2C2NA 2DPJA 5IWAJ 1SV5B 2CJBA 3CC7S 1XIQA 7FD1A 5LL6d 2XY6A 5HVFA 3KLHB 2VFUA 4ZKAA 1ZPWX 1VLYA 2CPXA 1T9UA 1Q5VA 4OLPA 4ZVFA 3Q24A 2OIHA 2L9NA 1HIYA 4HVZA 2HQGA 3CD6S 4FF1A 3MCSA 2HBQB 4I69A 1KQ4A 3ELHA 5HLFB 2AZ1A 2VBXA 3AXKA 4Y28C 1VC0A 4DSJA 1N32J 4EK2A 5L9XA 1HNZJ 4BY7C 3AB2B 3I6PA 1YJRA 4IRCA 3MAAA 1MWZA 1KVIA 3GE9A 3V4IB 1FFGB 4O3QA 4OJ1A 3IWLA 4C3HK 3MOJB 4ECWA 3RYLA 1UVNA 3OTOF 2MXYA 5KFSA 1HD0A 4LK1A 2W2OP 1B3TA 1MROA 4DG1B 4A3JC 4C3JK 2B63C 4DPXA 1S99A 3NS6A 1WCMK 2HNYA 2UXBF 3NCPA 3HHLD 4DV3J 4G1IA 5JFEA 5D78A 2AYMA 1SXLA 2GVZB 5K8NA 1Y5IB 4OI4A 2XB2D 3TJAA 1VIOA 3P6YC 4DL6A 3RB3A 3PO4A 2CZVC 1P1LA 2BMBA 2X3GA 1WTFA 2V67A 2HAIA 3DYAA 4K4SA 2YWFA 3BGRA 1H72C 3ICLA 2BVZA 2H51B 3CXCR 1KC8T 1Y00A 2HLTA 4IKAA 2J8AA 4RLEA 2CNNB 2ZC3A 4B3RJ 2KT3A 4HT7A 2A1BA 3EWGA 2BEFA 2B4UA 4IG3A 4ZVHA 1Q16B 3L9ZA 2ZNYA 3NP5A 1H98A 2WB1D 1UEKA 1N54B 4Q2MA 2C2OB 4CLUA 1O6XA 4DN0A 4KB4A 2LFVA 4A3DC 2F1FA 4AL6A 2XHWA 2KFNA 1VQPS 1ZAVA 4LT6A 5IV3A 2KFZA 3AHPA 2C3YA 4A4JA 2UP1A 1USMA 3M4XA 2ZJRQ 4L3KA 4TU9A 4RUCA 1Y5NB 4LF8F 4PG8A 1WNEA 1C0TA 4ECUA 4DV6J 1BQMB 1PJ6A 2EG1A 2R4FA 4ENOA 2MY8A 1JXLA 2R42A 2B5JA 3ZTPA 1NZAA 2CKWA 2ERRA 1Y10A 4Q5VA 5CH7B 1XZQB 3FEZA 2GFFA 3TZZA 2VASA 2D41A 1FD8A 4G1PA 3KJNB 4USVA 4C2MA 2HG4A 1XXCA 5DLFA 2UUWA 1AA1B 2W24A 4RNHA 4DQSA 3KHGA 4LF7F 4G1QB 3N5BA 2L41A 2JEJA 5IOTA 4K4WA 5GADU 5AXNA 4X4TA 3PO2C 1KDNA 2JNJA 2MKIA 5BR8J 3HOWC 2DXEA 4LF9F 1XNRF 2PI4A 4LF4F 1KHWA 4HI1A 2WONB 2F9JA 2FB0A 2JX2A 3M8QB 4NCBA 5DM7Q 3J7ZT 4ZH4A 4DCPB 4B3MF 4HEA9 3C66A 3MUMP 4LFCF 5HLFA 2M52A 3GFZA 4WTOB 3FSIA 5IP7C 1B4BA 5B0AA 3GFHA 4JV0A 2RUGA 3R9LA 2UV8G 5IV4A 2IRYA 3V4IA 2DNHA 2LQ5A 5HMYA 4O0IA 4ECTA 2G4BA 3K7AC 3EX7B 3PX0A 2DGUA 2K3IA 2MY7A 3L09A 3FQLA 1R8AA 4DG1A 2GQCA 4B9SA 3EVWA 3BGOP 2J9DE 1JB0C 3BQ2A 4IYQA 5KFWA 3W62A 5M2PA 4WFNQ 3VHQA 4X6AK 2VZ9A 2W2NP 3MUTP 4B17A 3NMRA 2XLJA 5ETMA 3PFEA 4MKVA 5EN1A 2GVZA 3MEEB 4GTAA 1GMWD 1QAXA 3OUYB 1BS2A 3LGNA 2FY8A 4HDHA 4DXLA 2XYGB 1RAHB 2P5MA 5A0YB 1RBLA 4JV5J 2OAUA 4JI5F 1SL1A 1YSJA 3AB4B 4N7TA 2V9WA 2QGFB 2MKKA 5DM6Q 4A93K 4QIWL 1NMEB 3C6UB 3C2PA 1NBEB 5KFGA 2V2VA 4ICLB 4ZPWR 3GPAA 2C22A 3H42A 2A6OA 1NHVA 1IKVB 4FZBA 2XULA 1LKZA 2HGNA 1RTDB 1YQHA 1M1HA 4NLRA 4I56A 2DEIA 4KHPJ 3I5BA 3G87A 4KARA 3H5XA 4WKYA 2VU5A 1ZH5A 2BXJA 3DHXA 3SCJE 1IBMF 2MZTA 2IBKA 3BYPA 3VQTA 5IT4A 1MWQA 2ATLA 4JI4J 3HVAA 3FBFA 2V63A 5GAHU 2W9CB 2WSFC 3ENAA 2VB6A 4K4XA 2PA8L 1BQMA 1ROFA 2Z30B 3ITHA 4F25A 1A0OB 4B9MA 3HOYC 1XTZA 1P27B 1IBKJ 1KNZA 4YB6A 4BY7K 1XZQA 5HI7A 2IMWP 2FHMA 5DS7A 1NXIA 5L39A 3S2HC 2ILYA 1FTRA 1S10A 3GTOA 2MZSA 2DXDA 3S7RA 2H4YB 2RF2B 4MKYA 5KFHA 1G4CA 4LVNP 4G1QA 4O3OA 2KN4A 1OQ6A 2OLWA 3CJRA 2UVWA 5IZHA 3GEIA 4A3JK 3HULA 2WONA 2KO1A 4B3TF 2NS1B 3DFEA 2B63K 3S17C 3MR3A 5C42A 4FVCA 3IS9B 4LIWA 4NWBA 2EBBA 5LT5A 3J7AN 1LK5A 2JWNA 4QWEA 1B70B 4NRTA 4DL4A 3KKFA 4KSEB 4JI7J 1FJGJ 1IBLJ 4A3IC 5E0OA 4DR7F 1CQMA 3KLGB 1UPMB 2WVEA 4WWSA 3OJUA 2CYYA 1JWWA 2FLOA 3L95X 2FLPA 3VGSA 1WHVA 3QFWA 1T9WA 2IHR1 4DUZF 3M8WA 2JFKA 4ZDNA 2OKQA 4OV6A 1I3QC 2EFOA 2Y8YA 2RVJA 3BGLA 5K14A 2CPFA 5I3PA 1FE4A 3CW2C 4LSNA 3MEEA 4HT5A 3O5TB 1SJQA 3ZXWA 2LA4A 1AFJA 2QLFB 5D15A 1TL4A 2XM3A 3EVOA 3OUYA 2WSCC 2J8SA 3T1YJ 4CNYA 1P6TA 2KJWA 2W7OA 5ETRA 5A0YA 4A3DK 4FYXB 2EC2A 4WFBQ 3DDNA 2C2EA 4KDDA 2GC8A 1U1LA 5BYSA 3DRRB 4RWXA 3N5FA 1K44A 2YU9A 3OT9A 3OPFA 4IOAQ 1ZZNA 2M2BA 1C1CA 1USOA 2V2ZA 1XNQJ 1RKJA 1URRA 1IUJA 4GRSA 3ILLA 4ID8A 5DDOC 3T6BA 2BKNA 2UVUA 1IKVA 3ZZTA 1IE0A 5KT5A 1CC8A 1VQ6S 1R27B 1RTDA 3HT0A 1UFLA 4PYAA 3BYRA 5KG4A 3A4TA 4F4XA 1FKPB 4O3PA 3SQOP 2JA8C 5M5XK 4RNFA 2JDJA 1NSKL 2I0XA 5LJ3Y 4F4AA 3GCWP 5DDQC 2B9WA 2E2IC 4TXSA 5IT9Y 2OI2A 2RRAA 1FRLA 2Q6BA 2MKYA 3PO2K 3BBCA 1F1BB 3HOWK 2H5JB 5CHPA 1ZM3A 4ZLNA 2VPWB 5THWA 2W9CA 1Q81T 2R7ZC 1VCTA 3BKFA 2QYCA 2AHOB 1JNZB 2R7VA 1HQ2A 4BS2A 1SKSA 3W5YA 1D09B 1WWHA 3MAQA 2J6UA 3FRZA 2NUUG 4U6PA 3D66A 5IP7K 2UXDF 3E2EA 5FLXU 4LR7A 5B0FA 2FVRA 5C2GA 4C2MC 3H5YA 2RF2A 1SH2A 4XDCA 2P9EA 3UCGA 2OPRB 3K7AK 1S59A 1FWKA 3D3BJ 1UVMA 1X5SA 1L3UA 2ATCB 1FO1A 4PPDA 1Y11A 4DV7F 4J9PA 3IS9A 2V34A 2ACMA 1IR2A 4OYAA 4DV0F 3W60A 3TVKA 1YRUA 5KFQA 1NK4A 3GTGA 3AH6A 5B0CA 2E5GA 3EPIA 2CZ4A 4EO8A 3I4PA 3FEYB 2BR0A 4P7VA 2HQIA 1EQ0A 2HVHA 1IW7A 3QT6A 1TWAA 4O3RA 1JLQB 5DZ6A 4CO3A 1W2BR 1QM9A 2XEXA 1HWUA 1ZPVA 3NGRA 4OJGA 4M63A 3CTRA 1HHSA 3FJ2A 1MG7A 5KOWA 1TMMA 1TKTB 4QQBA 2G1DA 4ZA1A 4HLBA 1UKUA 2KM8B 4OYOA 4XSXA 1CULB 1N8RT 1LWEB 1RT7B 1U1QA 1QJHA 4C97A 4NI2B 3ENWA 4ZVUB 1ZYRA 2MZ1A 4CLZA 4J9QA 3HOZC 4BBRC 4QOTA 2AWZA 4K0KJ 3F41A 2XMMA 2DNNA 4P52A 4OFZA 1EJ7L 5J2PB 4V1Ak 4NZ6A 4DF4A 3BKUA 3N0VA 4CM0A 4FNIA 3BEGB 5KFVA 4ECVA 4K5RA 2B8PA 3DNCA 5LMUF 2K7JA 2PC6A 3RZAA 2KZZA 2XMVA 3DRRA 3NXZA 4FYVB 2MSTA 3M2VB 3W2WB 3RGIA 2X3DA 1JLBB 3I4NC 3R8YA 1R31A 4UZBA 4LRFA 4CO0A 4P2FA 2LVWA 2R7SA 3HOYK 1RLDA 2ZH8A 4U67Q 2KT5A 3PZPA 5KFEA 3UCZP 4AT1B 4GC6A 4ECRA 1FKPA 3FSXA 3EMTA 3KNGA 4FKYA 1W26A 3S2HK 1SC6A 2V4JB 4CLKA 2J6SA 2VFRA 3N6NA 3Q8YA 2CJ9A 2UUAJ 4Q2LA 2MJUA 1FKOB 2CNOB 2MB0B 4NLOA 3S17K 4WP8A 2VG7A 2QFIA 5CJ9A 4DPTA 3VAIA 1SFOA 4G3IA 1EARA 4C8YA 3SDEA 3MMJA 4L72B 1QTNB 5BYQA 1RTJA 2CFAB 4ZPTR 1VBXA 3S1RC 3K5OA 4Y2KA 5CYJA 4RBUA 4F4KA 3PJ9A 3GTOC 4OYIA 4A3IK 4ITSA 1U1NA 4NZ0A 4YB5A 2D7SA 1T02A 2N7CA 2IMOA 5FLXY 3S1MC 2NSBA 2W4CA 2UUBJ 1OQ3A 1UZDA 2OEMA 2MEWA 4R5PA 4GKKF 4X65F 3FCVA 4XLNA 3ZTOA 3IXQA 3TAQA 2N82B 1G7CB 1I3QK 1S6UA 2GNKA 3LP0B 3NOGA 4LFAF 3TEGA 3B82A 3VGVA 2YKNB 2RU3A 2EVZA 4D3HA 3RW6A 1NAQA 1O51A 4OINA 2HHUA 4I68A 5HQ8A 4JI0J 5HK4A 2XCQA 3G8SA 1YRTA 3MFHA 3AODA 1C4CA 4M5LA 1H7WA 2JC1A 3RBZA 3AT1B 2WB4A 1Z1ZA 2AIRB 3DLHA 8AT1B 4A3KC 3NAHA 4OIOA 1TKTA 4K50A 5GAGI 4JV2A 1AFIA 1IKXB 3QGGA 2ZH3A 1LWEA 1SPBP 1RT7A 3FZBA 4NI2A 4EZ6A 3FBBA 3QJJA 1TWCC 2HBRB 3SFGA 1IR1A 2DR6A 2QG9B 2M3DA 3IAS9 1HNWJ 5HAOA 2E7VA 3HSZA 3KK3B 2VFTA 4HTIA 3QX3A 3BSOA 4PXEA 1IXKA 3NGUA 3G2XA 3NGTA 5LMNF 1H74A 2J0QD 1I5OB 3ZZZA 4FS2A 4U7UK 3K58A 3UNYA 3UVJB 4DL3A 4OZ1A 2GGPB 2JA8K 3CJ0A 3U1NA 3TJ8A 4P10A 2XMKA 2E2IK 3KLIA 3HD1A 1KR4A 2CAJA 1RWNB 3W2WA 2YU9C 1NDLA 1WF0A 3QJLA 1JLBA 2M5YA 3B4MA 2R7ZK 1TUWA 3I55S 1FRKA 3MPWA 1TWFA 4GTFA 2HZVA 5GMKa 2QEXS 2A18A 5A6PA 3C6TB 2IYIA 2ZJQQ 4FP9A 5F3TA 2F3JA 4M5DB 1Q7LB 1F9EB 2ZITA 2NZCA 3IP0A 3TX8A 1NJIT 4OZ2A 4X66F 2V4JA 4C2MK 4FF2A 1RDRA 3TZYA 4P2XA 4F26A 3O2IA 2VOPA 2XGPA 1Q8LA 1PJ5A 1FK9B 1FKOA 1FX4A 1VQ5S 2OELA 3R3TA 4IQMA 2MJNA 3CJ2A 4I4BA 5L1KA 2KWAA 3OPKA 2BABA 5I42B 1VHFA 3TAMB 2CFAA 2I38A 1S6QB 2QN6B 2HHHF 1RWPB 3WIUA 3QWUA 5D6GA 2YX7A 1HFEL 5LXYA 3Q3QA 3K7RA 1IKWB 2D1CA 4G0WA 4NXNF 5K9FA 2Z4PA 1U8SA 2CG4A 4K4UA 4DU7A 4JI1J 1WELA 2C2KB 3TEHB 1AT1B 1KTQA 2B51A 4MQ9A 4RPFA 3I32A 1VQ4S 1JLEB 1F5CA 1ZTTA 3HHEA 2YNGB 1OPIA 3C14B 2ASLA 1X4BA 4KC5A 4USKA 1S0VA 2DBBA 2RRNA 1S1VB 1J98A 1RAAB 1PILA 3S1NC 1SUQB 3NNCA 3LP0A 4QIVA 5IM0B 3V6JA 3HOZK 4BBRK 2YKNA 3GTGC 4NLWA 2YNIB 2AD9A 1KBRA 3HM9A 1UEUA 1H2TZ 4Z37A 1TWAC 1MNEA 1PJ7A 1WC0A 1HBMB 5ETTA 1WQGA 3ISND 2R2TA 5EGHA 3PG9A 5L1JA 2DR5A 4PWWA 4F4WA 5D0HA 2VQFF 1X31C 1TFWA 1IKXA 4M5MA 4J90A 2FJVA 4BBYA 4OZLA 4AQYJ 2J6TA 3ZC4A 1FRXA 3HD2A 2ZH5A 2BE9B 3UN5A 2ZEJA 3I4NK 2Q3PA 3MM7B 2GS8A 3ILJA 2YWEA 2XHCA 2VA3A 4IRDA 3W9HA 3KK3A 1N5VA 3S2DC 1O2AA 2LU1A 2XZTB 4YB7A 4M95A 3UVJA 1S0OA 4GTLA 2H4WB 1UW9A 2VG5B 4WE1B 2GGPA 5LOQA 2ZH6A 4J37A 2YXLA 2BRKA 7AT1B 4KMUA 3H3VD 5KT4A 1LOUA 5KG0A 4ELUA 2B8QA 2LECA 3MPDA 3CD5A 1Y0HA 4CRJA 5HROB 2G0IA 3JS9A 2BDPA 2CQ1A 3BH6B 5F8JA 1XZPB 1RAGB 2WSEC 2B3TB 5CYQA 3D54A 2L48A 3A8JA 4OZ0A 3DLEB 3C6TA 2KZMA 1YGYA 5LJ5Y 1RI7A 1K1SA 2HFOA 1WF2A 1RHQB 4CNZA 2UXCF 4M5DA 2U1AA 1KQKA 3HPOA 3R7NB 2P9CA 3S1RK 3FKIC 4NXMJ 1OS5A 2H65B 5E3CA 3HKZL 1MN9A 3MPVA 2CVEA 1UZHA 4DUYF 1S9FA 4W98A 2G13A 1WACA 4AL5A 4Q8FA 3GTOK 2IAJB 1RWUA 2XWXA 3HHLB 4YQWA 3RZDC 2WOMB 1FK9A 4IQXA 3S1MK 2F40A 4WJ4A 1IQZA 1PBAA 3PV8A 4HYKA 3LANA 4B9NA 3BR8A 2JA5C 5I42A 2AEMA 4E8UA 4BWMA 2DNMA 4XDDA 1VQMS 2C3PA 2E9RX 2CQCA 5D8HB 1PG5B 1X5TA 3US5A 1YDLA 4GO7X 4G0UA 4YY3F 1UTAA 4A3KK 4TQSA 3ZZOA 2YNGA 3C14A 2M8DB 4DR5J 2DH9A 1S6PA 3N28A 3QATA 5KTQA 2IIHA 1S1VA 4LJZA 1TWCK 1SUQA 1I50A 5IM0A 2FZGB 4C4WA 4HHHA 3THPA 2YNIA 3NCQA 4X4RA 1J6XA 2MKSA 3H90A 5KG1A 4DCJB 1RZMA 1PIEA 4RWWA 2BJ1A 4NMXA 2IA6A 4FZVA 2VDHA 3CMES 1HBMA 3BREA 3FCHA 2HQCA 5F9LA 1DFDA 2QA1A 3HVRA 2R9LA 2DYAA 3TVZA 1M90T 4PG4A 1OY9A 2GIFA 2QMUB 2KM8C 1JQGA 1XEZA 1H7XA 2YU9K 1YVFA 2ZBQA 4FDFA 4C8LA 4ETZA 4EWTA 3MM7A 1VQLS 1LXNA 4FPIA 4DSLA 2OP5A 4ZK7M 1B0PA 2YQ1A 4Y7NC 4NA1A 4I7FA 5CHCB 2W8KA 3KJVB 1HARA 4HH1A 1U8WA 4WE1A 4KAWX 1JXVA 1U48A 5GAEI 1URNA 4DS4A 3HHKA 1CJTB 3C3LA 4V19J 5GADI 4B9TA 2DGOA 4IH6A 1M5KC 5HROA 2HZCA 4RKUC 1S7IA 1SJ3P 4B08A 4MTPA 1XZPA 1R9TA 4J7CA 2HHWA 3CQZA 1BWEA 2MHNA 2AGQA 1TWFC 3Q8VA 3DLEA 4PPZA 1M1GA 1X5OA 3UI3A 4TNOA 1NSPA 3T6JA 1RU2A 4OYXA 5CZVA 4CI0B 3T1HJ 1KP6A 5IC4B 2RJZA 4I6YA 3UCUP 2HRYA 3EGWB 1NDPA 1RK8A 2ZKUA 5KG2A 2Y3PA 4DX7A 2KFYA 1F9NA 2YTCA 2EKNA 4RO0A 3AXMA 2WRMA 4BLAA 1X9MA 4GFQA 3OR2B 2Y1LB 4NZ7A 2OTJS 2OSRA 1OYEA 3S1NK 4C8MA 3GTGK 3MZIA 2BANB 2P5VA 1QUPA 2ASJA 2BW7A 4C3MA 4Z2XA 1R8CA 1TWAK 4URSA 3O3LA 2FVPA 4A8WA 4UY85 5A8KB 4A3LC 1RTZA 3CO9A 1OSDA 4PEOA 5EWEA 3AD8C 1TK8A 2RT3A 4FF4A 2KU7A 4OI3A 2V4QA 1ZXOA 4EFAC 4M5HA 2OD4A 2XYPB 4L3NA 4YFKA 4KMHA 4ZPAA 4UTGA 4W4MA 4WP3A 4DDFA 1WC4A 2HHVA 3D6MB 1Q79A 2CA9A 1RAIB 4A3GC 4DBQA 1XN9A 1IVZA 4YB1P 3S2DK 4TU7A 2HEKA 4U8YA 2RIJA 3W2VA 3TW0A 3I0RA 1XMQJ 4LRAA 4XIUA 3SMZA 3CPWR 2Y1JA 5AT1B 3T00A 2XBPA 1G1XA 2W2QP 5CD4H 4ED4A 2B43A 3CCES 1VS3A 3QT5A 1KS2A 4OYWA 4UOCA 4OZNA 3NMAA 3ZZUA 1O0PA 3J81j 4BWJA 2RNEA 2KYZA 4DR4F 4C0HA 4M5GA 5A2QY 3DCAA 4I2PB 3SSQA 1HPZB 3TX0A 2MDAA 3K57A 1SIZA 2JH3A 3E01B 3KJVA 1YJ9S 3FKIK 3ZNJ1 4ES2A 1VJQA 3SV4A 4L75A 3JYTB 3BSCA 4BXXC 3F56A 3LA0A 5E7OB 1CJTA 2CQIA 3VALA 1WDDA 3RZDK 1Q95G 4N77A 1YG0A 4CLYA 3MM8A 3VAJA 1YX2A 5L1LA 4WXOA 2D9PA 3OQ2A 2X7IA 2VIHA 3FHZA 5T7LB 1S1UB 3VZIA 2JA5K 1QVGR 3JSYA 5H9EK 2FHJD 2HGMA 5EX0A 1H38A 4LF7J 5E33A 2XO6A 2FPHX 2CNLB 1PSDA 3VQSA 4ZP8A 1XNRJ 2EWHA 4NOHA 2G1HA 2HNZB 2V6AA 3M6WA 4ZVRB 1BJTA 4YHHF 1NKEA 5EGEA 3MM5B 4ILRA 2R3VA 2LYVA 1QSSA 4KHMA 3W1YC 3HFZB 4LF5J 2RQKA 3BP3A 3SXLA 4A8MP 4C3KA 2XC9A 1S1TB 2BV3A 3OR2A 1FERA 1F2GA 3LOUA 3E51A 2HRTA 1CSJA 1GXLA 3P49B 3WX4A 1YBUA 3GZ7A 2ACYA 4N5SA 4H4KA 3VCDA 5F8MA 4OIXA 2R8HA 1TP7A 4DQPA 2ZOGA 4RNMA 5CZXA 1YJVA 2BANA 1JJ2R 1WDTA 3R5JB 3BR9A 3H98A 2UUCJ 4P7TA 1WC3A 5A8KA 1IR0A 1V6HA 2IRXA 1DHMA 3M6UA 3MR7A 1B4AA 2KRRA 2HYIB 3H2VE 2PMZD 2HHXA 2PPBA 1FJCA 1RTHB 1RWXB 4PUOB 3GTKA 3CMQA 3BBFA 1IS1A 4R25A 1RB0A 2J0XA 1LFWA 4EBDA 2IPOB 2FQOA 3D1HA 2DNOA 4I0WA 3EVMA 5F8GA 3W5ZA 2QRRA 4OLOA 2ROEA 4C11B 4Y7NK 2ASDA 1K47A 5CAAA 3GWCA 1EI6A 1U0HB 4IOBA 5KFRA 3R2DJ 2RH3A 1YNNA 1FDBA 2LP4A 2KVIA 4ZVEA 3DKDA 4OX8A 2VDIA 2E5LJ 1I3OB 4YMEA 3RAQA 1UW4A 2V69A 1N0VC 4DWIA 3JQKA 1TWFK 1FWLA 4I2PA 1HHQA 4HHUA 3SCKE 1HPZA 3UD4P 1C2PA 1PAEX 4WPAA 3E01A 2WBRA 3QNWB 4MIBA 3P96A 2IM3A 4GVBB 3DLBA 3NKYA 2MQOA 2R2SA 3JYTA 2MQLA 3EGNA 2H3EB 4CO1A 4KASA 1NH7A 1X4AA 1DY3A 3M8PB 2V94A 3G6XA 2DHSA 5A8WB 2E5HA 3W9JA 1NK9A 4YFXA 1QUVA 2BZ2A 2VQEF 2JA6A 4RR5A 3X3UA 3X1LB 5T7LA 1S1UA 2RSQA 4RZRA 5KT3A 1TL1A 1TKZB 4QR1A 2GO9A 2Q1LA 3BUEA 4ZHRB 5DGAA 2IJNA 3PW2A 2QTWA 3R97A 1KOOA 2HNZA 2V8PA 3MM5A 1Z2ZA 2HHQA 4RX6A 2LQJA 5AE3A 2NUHA 3HHDA 4A3LK 2RQMA 3HHLC 5CD4A 2YKMB 2D3OR 5KFLA 4GO5X 2EFPA 5J2MB 3SZ2A 4LR8A 1TK0A 5H9EJ 1S1TA 2DH8A 4MMOA 3I5AA 1ZS6A 1X4DA 4DR7J 2XLKA 4ECQA 2CNKB 4MK8A 3RB4A 1KD1T 4DL7A 2XS5A 4JI2F 4A3GK 2GJFA 5E2QA 1AXQA 1DJ0A 3CCQS 4G7OA 2MKJA 1JLAB 1U1OA 2CPEA 2KB2A 3SV3A 5DG7A 4J91A 4U96A 1SQEA 4WFZA 3AA8A 3MFIA 2GMHA 2PO4A 4KAIA 1TV6A 1N5SA 4DR2J 5F8LA 1VI7A 3AJ2A 2XCPA 4I2QB 3QAEA 2WBMA 1RTHA 5B09A 4MKBA 5LM7E 1R3NA 4PUOA 5IWAF 3IRXB 3WDOA 4LJMA 1PGZA 4MT1A 2NVXA 3AY0A 3T02A 3ILIA 2FHKA 4WIQA 4C11A 2NYIA 2R92A 1S5ZA 2ALZA 3G6VA 4A8XA 3QFHA 5ETPA 1U0HA 1REVB 3OL8A 2P8IA 1VQ7S 8RUCA 4BXXK 1EETB 2NXCA 4ZCMA 2MQQA 3OV7A 2HPUA 3HXAA 1HNZF 2RD5C 3KYLA 3AJDA 1X0FA 3H2UB 1AW0A 2F9DA 1NPPA 3NRBA 5IQ6A 2F8HA 3CCUS 1O28A 1RWVB 1DBDA 3DLKA 4CLTA 2H1YA 1VYAA 4EO6A 2VFVA 3MMLB 2NR0A 3BKTA 2LU2A 2HIYA 5JVOA 4FBUA 1TTHB 2FQQB 3J81U 7FDRA 2BQ3A 1Q1KA 1Q8BA 2ZVSA 4GVBA 2GHVC 3GV8B 1B64A 4KHRA 3GV7B 2R2UA 4JK1A 3KDOA 4TU8A 4DV3F 4ZIVA 3UN2A 3M8PA 1IL2A 3G9CA 5EGYA 4OHWA 1H3DA 3J7Z5 3CJTA 5A8WA 2COLA 2UXDJ 2V6TA 1PYSB 2BE7D 2OPPB 1NSAA 4KBIA 2MLXA 4HHJA 4PXDA 2ZH1A 1XK8A 2RDDA 3DOLB 4NYZA 4ZHRA 2M0GB 3W5XA 5CCMA 1K0TA 4DV7J 3WX8A 3TYTA 1NPKA 1H6KX 1VRTB 2K8GA 5IC6B 4B3RF 4DV0J 3TNVA 5GMEA 4K2JA 2YKMA 2HZAA 3KMSA 3GJRB 4AXIA 3ZFVA 3A3PB 5J2MA 3T1AA 1T0TV 2HFVA 3FNNA 2ZHBA 4G7HA 1FRIA 2D3O1 4X4OA 4UY8T 2XO7A 4FXWA 4R0JA 4KPYA 1O8BA 3GTMA 4A3CC 3AA9A 4QZVB 4A8OA 3G8QA 4BC7A 3GCXP 4L74A 4B9LA 1GNKA 1AROP 3ZZRA 3BO4A 1VK3A 1T9TA 4DV6F 3PRVA 3CJSA 1G2EA 2OPQB 5F41A 4ECZA 1KKHA 2HMIB 1KQGB 4X84A 4IO1A 6AT1B 4CTAB 2KL8A 1U47A 2QZ8A 3DLLQ 4ELVA 4RW8A 4I2QA 5GAGU 5A76A 1S12A 2C3MA 1T9XA 3IRXA 3GTKC 1F9FA 5KFCA 4OHVA 5LMUJ 3BPSP 3MEKA 2BOPA 4A48A 2ZOFA 1KQSR 2FUG9 5H1SV 3SEOA 3ZZPA 2CJYB 2LQBA 1QSLA 3T5JA 2F63A 1BY9A 1REVA 2BQRA 1FFSB 3PYGA 4PABA 3IM8A 4USIA 4XSZA 4UZCA 5DDRC 2KXFA 4LSZB 1U24A 3R6LB 1EETA 4B3SJ 1NJXA 3HDSA 1ZZFA 1X9SA 1NRKA 3M8YA 4NLPA 1S76D 4NE9C 4Y00A 2DVIA 1U09A 1QSYA 1HI8A 2DGQA 4RU2A 1VR6A 1JNRB 2CJAA 1CG2A 2GSNA 3G4AA 1HR0J 2G9OA 3C46A 2QLWA 3TRGA 3LAPA 2ZD1B 2OEKA 3M9NB 2AYGA 3KTQA 1VBYA 4Q7AA 3I0SB 4K4TA 2AW0A 3KOAA 4QIGA 4C6AA 3TUIC 2OHDA 1FHTA 3CCZA 2HS4A 5B08A 2RE1A 4GTDA 4F04B 4RBVA 2RUSA 1YNJA 5C25B 1GXTA 3J81Y 2WAQD 1U2RA 2CQPA 4AL7A 1R0BG 2AU0A 1FESA 3KK2B 2FJWA 2XCOA 1GK8A 1KQFB 2OPPA 2JA6C 4H4MB 2EPIA 2K2PA 2AZ3A 4JV5F 2DNPA 1REGX 3S15C 1RISA 3DOLA 1KRPA 3T41A 2O66A 2ZDPA 2EK6A 3M2RA 2GV1A 3VF0B 1X8DA 2CPIA 3GTLC 1OSCA 2YKPA 2RU9A 1VRTA 4DLEA 2VHGA 4U7CA 3VR1A 3NNAA 5KFJA 4WZMA 1SJ1A 4CO2A 2RQCA 4CO5A 1B7FA 1U7LA 4LFAJ 3BJYA 3RG6A 4QR2A 4I64A 3V6HA 2XI2A 4KHPF 3H7HB 4ZVSB 4IOCQ 5M2RA 1RGVA 4A8QA 3O44A 2FJXA 3IRWP 5BYRA 4K7QA 4Y3CA 5G0RB 3EZOA 1RT5B 4F02A 3CD0A 4NX9A 4CWBA 2JC0A 2DHGA 3NNHA 4K4YA 1XXBA 4LF1A 1ZBTA 4M5KA 3RBXA 2IM2A 3A1YG 1WQFA 2OPQA 2HMIA 1PYTA 4CLWA 5TMFA 4F4ZA 2DO0A 3CJ5A 4CTAA 4WKRA 1NO8A 3Q23A 4ED3A 1JJCB 1HNXF 5LMNJ 3ETOA 1UETA 1V3SA 1JIHA 1M5PC 2Y1RI 2QYGA 4A8KA 1RBOB 1N6QA 1AB8A 1BMQB 4A3EC 4JUZA 4F67A 4YG2A 3W65A 1F7VA 1VQ8S 1C0UA 2NVXC 3GIIA 4MEXA 3V81A 1DTQB 4TYAA 4KB2A 2R92C 3OVSA 2HVIA 3HJVA 2HKEA 1DCHA 1BD6A 2DGVA 1KLNA 4RUAA 4PXCA 5KFXA 1NM2A 2XZDB 1FFWB 2KKHA 2N7YA 1BGXT 4LBPA 1Q8IA 4USWA 5HMXA 4NLGA 4FKXA 4J9SA 4KMDA 3R6GB 4K4ZA 2RHSB 4JI7F 2EBGA 1FJGF 4H4OB 3IO1A 2N4DA 4WF9Q 5EUHA 1IBLF 1U25A 1Y1WA 5L1IA 1Z4UA 2ILZA 1K83A 5CYMB 1MMLA 4YR2A 3N6LA 2ZD1A 2B9EA 2EK1A 3W61A 3H0PA 5C4JC 2JEGA 3M9MB 1ZETA 4BY1C 1HWLA 5HMZA 3MMBB 1N34F 4KV8B 3CDAA 1ZM4A 1VRUB 4XAKA 2MPUA 4OX7A 2J0SD 4DV4J 1QVFR 1O5JA 5C25A 1TR0A 5J1NA 2GCFA 1RTIB 5D4LA 1SJFA 3KK2A 3BM7A 2DR9A 2E29A 4YOEA 2MQNA 2E2JC 3B54A 4H4MA 4KYZA 3ZTRA 2CQDA 1S7HA 3I31A 1I3QA 4A3CK 3LQVA 3M05A 3KK1B 3GB0A 1VC5A 4AYBL 2CJXB 1FI4A 1UVLA 3HP6A 1HHTP 4FYYB 1XNQF 1ZBSA 2KTQA 2C28A 5HATA 2F4VF 4CT8A 3DXSX 4TVAB 5B0BA 3PX6A 1GH8A 1TAUA 1GX5A 3FK4A 1WOOA 2YWWA 3GR1A 2VONA 1WG4A 3RJMB 1OJ4A 4OZ3A 4LQ9A 1S9GA 2Y0SL 1UMJA 3EYZA 4URQU 4USTA 5DG9A 3HVTB 2EG2A 1GMVA 3GTKK 4ECYA 2KYXA 1PBUA 2JEFA 3GTMC 5G0RA 3T3FA 1RT5A 2C2MB 2VQFJ 4GC7A 1M5SA 2ZBCA 3HXMA 3UW1A 2F4FA 4ZVPB 4YUDA 2VKZG 1WC5A 1RT2B 3TTGA 5J2QB 3SZZA 1GXUA 1I6HC 3M6VA 4O3NA 2E2IA 3HO1A 3G82B 5JXSA 1SI9A 2K7KA 4NEZA 4IRKA 4ZPBA 4DV5J 2R7ZA 2BJ3A 4OX9J 5IORA 2DR7A 1DTQA 2DNYA 2JRSA 4IH7A 4Q43A 2XI3A 2DO4A 5ETNA 2ZWOA 1L0WA 4M94A 2DY9A 3S01A 2RGRA 1U2FA 1ZM9A 4KGXB 5C24B 2Z2YB 5D4NA 4W92B 3MMAB 1SV5A 1S57A 3EXYA 3LGHA 3MPUB 2UXCJ 1RBAA 5GAEU 2VG6B 5E3PA 2KH9A 3KLHA 4H4OA 3R27A 4DSIA 2MZJA 2IRUA 4DUYJ 2GX8A 1NH8A 2JA6K 1BGWA 4FBTA 4FM9A 2FD2A 3JSBA 4WIIA 1OO0B 1HMVB 1R0AB 4MIWA 3L7UA 3S15K 5D77A 4JYAJ 2CWKA 4DR1J 3D3CJ 2QLXA 4P75A 3GTLK 2HWIA 3KFWX 4GKJJ 1XXAA 1N0UA 3MMBA 1TVRB 1F2HA 2IA0A 3PJXA 4KY3A 3UDEA 4C3LA 4AD6A 3A8KA 2DRBA 1VMBA 2HS3A 2K1RB 1KHVA 3RRHA 2XY7A 3QGPA 2ZM6F 3TANA 1F5BA 1LFPA 3DHWC 1WJ9A 4BBSC 3KXDA 1F6TA 4CH7A 4YS2A 3OL9A 2RKIB 3OHAA 1TFYA 4NCGB 4Y2IA 4X64F 4J5OA 2J9DA 1IQTA 2VUGA 2RS2A 3RB6A 2E9TA 1J5EF 1FDDA 5LSLA 4ALZA 1YWXA 4ED8A 1P9YA 3T5LA 5EX3A 3PFOA 4DV2J 2Q66A 1NPRA 3NEKA 3PY8A 1CQNA 2P8TA 3M32B 4H54A 2I5JB 2AYEA 5L46A 4CH0S 1P1TA 4WK1A 5ADZA 2J5AA 4AUKA 1S6OA 3GG1A 2NXJA 2FVQA 2FYXA 4NLXA 4EZ9A 3UN3A 2V6UA 3HVTA 2D3UA 4HI2A 4A3EK 2LCWA 2UUAF 1GEHA 3CIZA 2CRLA 4E0DA 3JTPA 2NVXK 3NOCA 5DGBA 4X4PA 3K8VA 2V68A 3OFGA 4ZJOA 2R92K 2AGOA 2BW2A 1VQYA 2QL9B 1WSRA 1IQ0A 4NL5A 1RT2A 3T9ZA 4WFYA 5J2QA 2A69A 3SQGB 1SC4B 4DCOB 4ZJQA 5DETA 2PMWA 3I87A 4JV1A 1N36J 3FOEA 2R93A 5FJ4A 3G82A 5AJ3J 3MTJA 2A68A 4B9VA 1ZA2B 3IG1B 4CO4A 3DRXA 2ZJPQ 2BOAA 3GSDA 1WOPA 2EW9A 3AOBA 2Z2ZA 3D2WA 3G86A 2IJRA 3D4JA 3HZEA 3BO3A 2QT7A 4KO0B 2CJQA 4YDXA 2UUBF 1L3TA 4YDDB 5C4JK 1Q4RA 5TMCA 3Q8QB 1YK9A 5FJ8K 1VDHA 3D6FB 4BY1K 3H4BA 3CVKA 4LRCA 4CT9A 5C24A 1RT6B 3DRPB 4J9MA 1LEOA 2RAQA 3MMAA 4ZITA 1N33F 2APOA 3LTOA 4URGA 4JI0F 2V0NA 1IKYB 2VG6A 3CJKB 2BM1A 3FMBA 1NHUA 2YQ0A 3RR7A 1NNDA 1Y1WC 1JMTA 3M8QA 1IWAA 2E2JK 2J0WA 2VPZB 1HMVA 1CJVB 5JVGQ 1YIJS 1K83C 3UD5A 1BLUA 4DZ6A 1U6FA 4UQGA 1ITPA 1TU0B 3ZTQA 4A3FC 1TVRA 1NHKL 3MR2A 4DPYA 1GAOA 4ILDA 4OYMA 1I6JA 1HNWF 3LGMA 3U7JA 3FMWA 3Q8UA 2H5EA 2K06A 3PXGa 1IM6A 5FLMC 3F0NA 3A3NB 2OGUA 1RAFB 4U8VA 4C8KA 4N47A 2EBEA 2HQFA 3PR5B 2A2DA 1FDAA 1U1KA 2XNQA 3ISNC 3HJFA 1TWCA 2GAHC 1CLFA 3S6EA 4NOIA 3GTMK 1MW7A 4TLQA 1VK8A 1LQ9A 3CE8A 2LKZA 2G2OA 4ES3A 1YKWA 3DGPB 4WK3A 4IG0B 1YRXA 3M32A 2YKOA 2I5JA 4NA2A 4CCHA 2LEAA 2AV5A 2AF6A 3R7BB 1EFWA 1I6HK 4P74A 3I9V9 2E1PA 2R8IA 4Y2CA 3JSMB 2LMIA 2IBOA 3JSRA 2G2ZA 3WHIA 5KFAA 2BJ8A 3R5DA 2DCLA 3PJWA 3C6UA 3CO0P 4ICLA 5JVHQ 2XMJA 1RADB 1HD1A 3CJ4A 2HVEA 3DOMB 1X4CA 2B7BB 4KR0B 3ZTSA 1B0TA 2MMYA 2OUGA 3T5KA 4YR3A 3NS7B 3C19A 3R1LA 1M5VC 4KFBB 4DLGA 2V8HA 4LBIA 9ATCB 1UVKA 3GTPA 1TELA 1QAYA 2Z2MA 4NYPA 3IGNA 2PEHA 1E6VB 4KQZA 2YQ3A 2DIVA 1QE1B 3OXGA 2BACA 1H2VZ 1DAXA 3IG1A 3L7OA 2YX4A 1HNVB 4JI1F 3D7SB 2ADBA 3LW5C 2KT2A 4DPOA 4KO0A 2E1AA 4EBEA 1FEEA 4OHZA 3FQKA 4DU8A 2DKOB 3DLGB 3UE2A 1VJEA 4RU9A 2ZZMA 2IM0A 1QAIA 4CYUB 3QO9B 5KG5A 1B7YB 1RT6A 3DRPA 4DZDA 2VUMA 3QYYA 2QL5B 2DHAA 3CDUA 1IKYA 1KN6A 1FNXH 2WW8A 3CJKA 3ISZA 2E7WA 1WC6A 4LLGA 1YJWS 1CJVA 3LP2B 4BBSK 4LFBJ 3H0GA 3E8OA 1NK7A 3BN7A 1TWHC 4DSFA 3MD1A 4AQYF 2CW0A 2VL1A 2DHHA 4NEYA 3AD9C 4PZVA 3S14C 4P2MA 1YLXA 4TQRA 2BKPA 2V8VA 4PAAA 1RP5A 1KONA 1D1UA 3IBFB 1IJFB 5KT6A 2AYBA 3D0IE 3R5BA 1N56A 3KLGA 3IPJA 3KLFB 3HT3A 4NPOA 3T5HA 2OH2A 4ANCA 5M3MK 1R6VA 1NUEA 1SVDA 3DMJB 2FJAB 3WODA 3MCNA 4XPCA 4DR3J 4ATNA 4ECSA 4TY9A 2DGTA 3H40A 1FWPA 3KG0A 3PM9A 3E3XA 3OFFA 3DGPA 2HWHA 5IYDC 4IG0A 2CUYA 2FTRA 1OPZA 2ZHOA 1ICEB 1XC9A 1S77D 5CQGA 1HQUB 2PHCB 1FEHA 4OJHA 1J6WA 3W63A 3ENQA 4NXMF 3OLBA 3JSMA 4ZLJA 1J5OB 1WI6A 3N6MA 3PYDA 1L3KA 3PEHA 2ALYB 2YVSA 1INNA 2HBYB 4IO9Q 2AJ0A 5HQMA 3DOMA 3GEEA 3CF5Q 4L76A 1JVIA 2ROPA 2AX0A 3HVWA 5GVQA 1V9OA 5CABA 1X9WA 2QA2A 4WTYA 2Y0SD 3FBCA 1GFWB 2C3OA 2GVDB 4EYIB 3FKIA 4KFBA 3T01A 2O3DA 3PIPQ 5GMDA 1ZOTA 3D6TB 4G6VB 4ZCIA 3W7BA 5K8OA 4LREA 1A7GE 2R93C 4FNHA 4PCQA 1E6VA 4F8RA 2VBZA 1QE1A 3Q8RB 2HNYB 4GZYA 1XWLA 1TK5A 2HWTA 3UD3P 2AEJA 1Y1WK 1HNVA 2Q6CA 2HURA 4BDPA 3CCWA 1K83K 2JA5A 1ZVUA 2ZFZA 4MKAA 4NLSA 1BQXA 3D68A 2AEFA 2JHEA 4DR5F 3GG0A 1KOHA 3QT7A 4A3FK 3WZ0A 2VQEJ 3DN9A 1XR7A 4O4RA 3DLGA 3PHTA 4FXDA 4IFVB 4B3OB 4CYUA 3QO9A 2F8EX 3TWZA 1RKIA 4J9NA 2XWYA 1GE9A 1HNIB 5B0EA 1FD2A 3MXHP 5CCLA 2OPRA 5FLMK 3BGRB 1VJWA 1WEYA 4HACB 2MGZB 1T9VA 1HI0P 4FVMA 3QSIA 2A3JA 2ZHAA 3LAJA 2VPYB 3LP2A 2HVZA 3GFXA 4C7QA 3PR4A 4X62F 2B4PA 2XY5A 4XLPA 3FVYA 1FDNA 3M30B 3HFVA 2OEJA 4DMZA 4WFXA 1VBKA 1RAJA 4ZN3A 3N9UC 2HLUA 1JLQA 2J7UA 3KLEB 2J7KA 2M88A 3AOCA 3M8ZA 2KJVA 4C8OA 1D3WA 1JXEA 2WVBA 5C2CA 3KLFA 3FBEA 2N3OA 2DGSA 4QYRA 4QIFA 2DT9A 3MI7X 1CULA 3M1VB 1DRZA 3QGIA 4TLRA 4Y52C 1U6BA 3DMJA 3UO0A 3Q22A 2A0FB 4J9OA 2B5JB 1N4LA 3R7SB 2CADA 4NRUA 4N8NA 2CQ0A 3BQ0A
chains in the Genus database with same CATH topology
3TTGA 3ADAC 1XZQB 3TFIA 5L46A 4PABA 1XZPB 1WSRA 1WORA 3AD9C 1YX2A 3TFJA 1PJ6A 1X31C 1WOSA 3GSIA 1V5VA 3GEHA 1VRQC 1WSVA 3A8IA 3GIRA 1XZQA 4PAAA 3A8JA 2GAHC 1PJ7A 2GAGC 1XZPA 3GEEA 1PJ5A 1WOPA 3GEIA 1WOOA 4P9SA 3A8KA 3AD7C 1VLOA 3AD8C 3TFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTG A;  3ADA C;  1XZQ B;  3TFI A;  5L46 A;  4PAB A;  1XZP B;  1WSR A;  1WOR A;  3AD9 C;  1YX2 A;  3TFJ A;  1PJ6 A;  1X31 C;  1WOS A;  3GSI A;  1V5V A;  3GEH A;  1VRQ C;  1WSV A;  3A8I A;  3GIR A;  1XZQ A;  4PAA A;  3A8J A;  2GAH C;  1PJ7 A;  2GAG C;  1XZP A;  3GEE A;  1PJ5 A;  1WOP A;  3GEI A;  1WOO A;  4P9S A;  3A8K A;  3AD7 C;  1VLO A;  3AD8 C;  3TFH A; 
#chains in the Genus database with same CATH topology
 4K8R A;  5J2P A;  4PR6 A;  4DFJ A;  3FCW A;  1PYO B;  1CVJ A;  4QU7 A;  1S9E B;  4O3S A;  2BUN A;  4QBU A;  3DDK A;  2VFS A;  1HQU A;  1IJE B;  5KFM A;  2R2R A;  1JLG B;  3T1H F;  5I3Q A;  3UR3 C;  5T41 A;  4HKQ A;  1J5O A;  3M2V A;  3IR5 B;  2KHD A;  1V5I B;  3CDB A;  2HFU A;  4ZVQ B;  2JLF A;  1WHW A;  4C9D A;  5F0W A;  3K5L A;  2IVM A;  4PG7 A;  1SL2 A;  3KHL A;  1KEK A;  4DR6 J;  1Q53 A;  3P5B P;  3CJ3 A;  2GVD A;  2LEP A;  4UUW A;  4Q4Z A;  4Y65 A;  1SH0 A;  1SIW B;  3PDN A;  3GTP C;  3D1O A;  4QIW D;  1BHN A;  3QRP A;  3GIM A;  1M0S A;  2EKY A;  4KC6 A;  5FII A;  1XMO J;  4KPC A;  3H5S A;  4ZN1 A;  4JI6 J;  2R7U A;  1MLA A;  3D1Q A;  3SCI E;  2VC1 A;  1O2B A;  4ZJL A;  2O01 C;  1TWG C;  4P2S A;  3MPY A;  3CC4 S;  3GV5 B;  1TKD A;  1NJZ A;  2IDL A;  4F7V A;  3J80 U;  2ZBI A;  2R7Q A;  2ZH7 A;  3IC1 A;  3GYG A;  3EXC X;  1VBZ A;  3H5U A;  4F3Q A;  1TWH K;  3JTO A;  3DI6 B;  4PG6 A;  2JVO A;  3N4W A;  3F73 A;  1X0P A;  2IDE A;  3NWG A;  1VLO A;  1SKR A;  4IFV A;  2IM1 A;  4B3O A;  3S14 K;  4F36 A;  4LK0 A;  1HWJ A;  1FTC A;  3BV8 A;  2YPZ A;  4ER8 A;  2L3M A;  4E2F B;  1HNI A;  2VUM C;  4RW6 B;  4BC9 A;  2NYH A;  3N01 A;  2PA8 D;  1DQ9 A;  4HAC A;  2MGZ A;  2QLB B;  3OL6 A;  4DS5 A;  1J27 A;  4FN5 A;  1XMQ F;  3H8Y A;  1EB0 A;  5F3Z A;  2HRU A;  5KFT A;  2HHT A;  5C44 C;  2NXN A;  1JJ4 A;  5IYC C;  3H0G C;  2CQ4 A;  3PRB A;  4OI0 A;  1GTE A;  3RBE A;  3M30 A;  1F3F A;  4WZQ A;  5M5Y K;  2CPH A;  4ZOS A;  5LSO A;  2CPY A;  5H9F K;  1YCL A;  2XTJ P;  3Q86 A;  5IP9 C;  5I4M A;  5IYD K;  1JK9 B;  3KLE A;  3P3D A;  2GHW A;  4DQQ A;  4UOH A;  1S0M A;  1ZQ1 C;  3DDI A;  4OYZ A;  4CIO A;  3W66 A;  4A8F A;  3EUN A;  2Y8W A;  3M1V A;  3ITH B;  1ZA1 B;  1UVI A;  3MEC B;  3CGI A;  2D9O A;  2DNK A;  3GR0 A;  1DAR A;  1ACM B;  1EAY C;  4A3B C;  1Y4Z B;  3TUJ C;  4HH0 A;  3EM1 A;  1HYS B;  2HK2 A;  2HFZ A;  1U1P A;  2E2H C;  1IM4 A;  1BXN A;  1O2F B;  3SCL E;  3VAH A;  3AQP A;  3CT9 A;  1S9E A;  5KFY A;  3GJQ B;  5DO2 A;  3U1L A;  1LWF B;  3A8E A;  4LR9 A;  1P8G A;  1HI9 A;  1JLG A;  3K2Y A;  2J9C A;  4Y6I A;  2R93 K;  1I6V A;  2ABY A;  1RHM B;  1F7U A;  2NVY A;  3GJS B;  4G65 A;  3CJ8 A;  5C42 B;  2IYG A;  1OIA A;  3QZ7 A;  3W8G A;  4YN3 B;  3MM9 B;  3Q0A A;  1LWX A;  4DHV A;  1RWM B;  4QPX A;  4LF5 F;  5JMN A;  2IFX A;  2YWH A;  3BGU A;  2BRL A;  4I6W A;  3SIP B;  4LF6 J;  5LXR A;  3EGV A;  1SC3 B;  5D4O A;  2V4R A;  3T19 A;  1DQ8 A;  4DUT A;  4PRF A;  2I6W A;  1RAE B;  1HLW A;  4ANE A;  4JI8 J;  4P72 A;  4J9L A;  2KHC A;  3V6D B;  4RUH A;  5IQQ A;  5ITH A;  2DEJ A;  2ZFH A;  1VQS A;  5SZT A;  2NQP A;  1RHJ B;  4NML A;  2ZE2 B;  4OYB A;  4DL5 A;  2WVF A;  2UUC F;  2C2R A;  5E5N A;  3L3C A;  1FKA F;  2GO8 A;  5MLC V;  4ZPD A;  4K4V A;  5K14 B;  4DX5 A;  2EI5 A;  2KDO A;  4JB8 B;  2E1R A;  2VKR A;  2VOO A;  2VC0 A;  4LSN B;  2QMW A;  4Q45 A;  1VIX A;  5B7W A;  3TAM A;  3DI6 A;  5B0D A;  1ZYQ A;  1S6Q A;  2NLW A;  2QA4 S;  3UQS A;  5C5J A;  3J80 Y;  1BWV A;  2LXI A;  4F3M A;  4MIA A;  3DOK B;  1IKW A;  1RT3 B;  4OHX A;  4RW6 A;  4CLF A;  3PW0 A;  3MCO A;  4C8Z A;  2XYH B;  2W7P A;  4EEY A;  3IBW A;  1C1C B;  4XTT A;  4RNN A;  5IOS A;  3F44 A;  4IFY B;  3J7Y U;  1JLE A;  4OV1 A;  4KN7 A;  4F0K A;  1K0V A;  4RW9 B;  4Y52 K;  5KT2 A;  1BE4 A;  2V6S A;  4EU0 A;  1X60 A;  2W1B A;  3C16 B;  3FSY A;  3GTY X;  3WQP A;  4QIE A;  5IT9 U;  2E5L F;  1P9Q C;  4QWD A;  1R8P A;  3GTQ A;  4P5B A;  3CNQ P;  1NKC A;  4OL8 A;  1HKA A;  2X1B A;  4OZJ A;  1EP4 B;  1D9A A;  1F3V A;  3W8P A;  2DGW A;  1RHU B;  4N76 A;  1WSV A;  3FFI B;  4C3I C;  4J9U E;  3MUV P;  2UUT A;  1VQO S;  2PE8 A;  2W2P P;  4A8Y A;  5KFN A;  5BXI A;  1O27 A;  3MEC A;  2QJ3 A;  2L9D A;  3TFI A;  5H9F J;  2FJD B;  2HBZ B;  1Q82 T;  2MQ8 A;  1S4E A;  1HYS A;  2V2K A;  4TN2 A;  2OSQ A;  5F9N A;  1HNX J;  1S72 S;  1BDF A;  1X4E A;  3TJ9 A;  2GW8 A;  3NWR A;  3MTK A;  3HSG A;  3MMC B;  4LOW A;  1Y7P A;  2VG5 A;  1LWF A;  2HAF A;  2U2F A;  3GTP K;  2HGL A;  2LQ9 A;  3MF5 A;  3VGT A;  3NGD A;  1RT1 B;  3H25 A;  4RNO A;  3MM9 A;  4ED7 A;  4FS1 A;  2FJB B;  2W7V A;  1TWG K;  1UJ4 A;  1EZZ B;  3D9B A;  3ULH A;  2RRB A;  2VD3 A;  1I94 J;  3GJT B;  3PW5 A;  2QE5 A;  4QU6 A;  2KXH A;  2Y9H A;  5ETQ A;  3QIP B;  3HOU C;  2UVR A;  4GMK A;  4GVL A;  3I5C A;  4BLB A;  2MHE A;  4AND A;  3V6D A;  2GHP A;  5L38 A;  4KE5 A;  2IAJ A;  2VUM K;  4F50 A;  4O23 A;  2ZE2 A;  1MN7 A;  3HHL A;  2WOM A;  3H3V L;  2PEB A;  3KG1 A;  4C98 A;  1N34 J;  2HHP A;  2QSW A;  3DU5 A;  4Q5S A;  4USM A;  5C44 K;  1UCN A;  5IYC K;  3H0G K;  4DR2 F;  2NSC A;  4IDK B;  1ISE A;  2AJ2 A;  1EQR A;  2UU9 F;  3OTO J;  3I96 A;  2QV6 A;  4WJ3 M;  3QJP A;  3I56 S;  2MLY A;  1FA0 A;  2C3U A;  4P9S A;  3RTV A;  5IP9 K;  1K73 T;  2QA4 G;  1A9N B;  3EZ5 A;  2ZUG A;  4PYD A;  5C7P A;  1EHW A;  2XQC A;  1VQK S;  3DOK A;  1RT3 A;  2UXB J;  3GEH A;  4M5J A;  3M2U B;  1KSP A;  3TP2 A;  4IFY A;  2CQ2 A;  3PO3 C;  3PKY A;  2ZUE A;  1WTB A;  1G6B A;  1Y1V A;  2VPX B;  4YR0 A;  3IN5 A;  1ZTW A;  3BSA A;  2F4V J;  1NEE A;  1WKK A;  3LPY A;  4RW9 A;  2AQ4 A;  3DM2 B;  1KFS A;  4QPT A;  2H54 B;  1NKB A;  1LW0 B;  3C16 A;  4A3B K;  2X51 A;  2E2H K;  4DL0 C;  3ETM A;  2YNF B;  2WHO A;  2XCR B;  3K5M A;  3VA7 A;  1EP4 A;  1U26 A;  2YX1 A;  1D0E A;  1R0C B;  2C2D A;  5D3G B;  3FFI A;  2XNR A;  2CDR B;  2R7R A;  2VG7 B;  4NYO A;  5EWF A;  1SC1 B;  2NXU A;  4I1T A;  1T3O A;  4DQR A;  4ETX A;  2AJ1 A;  4ECX A;  3FEX B;  1K1Q A;  1R8H A;  3SDE B;  4GT9 A;  3CCJ S;  2VIC A;  2AJQ A;  4OI2 A;  1RTJ B;  1C0A A;  1LWC B;  3ENV A;  4KGK A;  2BBE A;  1XJW B;  1WD6 A;  1IN0 A;  1GTH A;  3IR7 B;  3ONQ A;  3G71 S;  2JLE A;  4Y0F A;  3CCL S;  2VOD A;  1O29 A;  3MMC A;  3M4O C;  4LF8 J;  2UVV A;  3ERE D;  3CDE A;  1NLK L;  1GX6 A;  2ZBR A;  1RT1 A;  3FGV A;  2XS2 A;  2NVY C;  1UWB B;  4R5P B;  3RAX A;  1U1R A;  4CH1 A;  1H2U X;  1RWW B;  1UJ6 A;  1AYE A;  3PRD A;  1BQN B;  1HWI A;  2D74 B;  2M8H A;  3VTI A;  3U1M A;  2XG8 A;  1XQI A;  3QIP A;  8ATC B;  4LF9 J;  1RE1 B;  4LF4 J;  3UPF A;  1Q8K A;  2GQQ A;  5K5M A;  2K3K A;  4DFK A;  3EJM A;  1AUS L;  2LDI A;  1TQL A;  4B3M J;  3ET6 B;  1KFD A;  2B56 A;  1UVJ A;  3OTE A;  4LFC J;  3OD2 A;  2P6T A;  3NG8 A;  4KM8 A;  3BH7 B;  2M9K A;  3GTJ A;  1G3O A;  4QR0 A;  1GMW A;  2B9Y A;  4IDK A;  1UWA A;  3QWP A;  3CCS S;  3GIL A;  3MED B;  5KFZ A;  5D0R A;  4JI3 F;  4ED6 A;  3EGZ A;  4X4N A;  2ZM6 J;  2A6M A;  3A3O B;  3BP8 C;  1R8B A;  2FJE B;  4DN9 A;  3LP1 B;  4M8L A;  3HK2 A;  2HQ3 A;  4F3O A;  4X64 J;  2W4P A;  2Z2L A;  3KLI B;  3G6E S;  3Q89 A;  2BJ9 A;  3M2U A;  4DJB A;  1J5E J;  2OMO A;  3P5T L;  4C3I K;  4J9R A;  2EFN A;  4EGL A;  2NPF A;  1PKU A;  3UDL A;  3UFC X;  2CJK A;  1RT4 B;  2GSU A;  4B3S F;  3DM2 A;  1WF1 A;  3M8R A;  2ZH9 A;  1LW0 A;  1ZM2 A;  2E66 A;  1U45 A;  2PDA A;  3OLA A;  4N41 A;  2DRA A;  4QWC A;  3OFH A;  1FCA A;  5E3A A;  3AJ1 A;  1LNQ A;  1UL3 A;  3GTQ C;  2LQ8 A;  2YNF A;  5T14 A;  4JI5 J;  1APS A;  1DTT B;  1T9Y A;  1HR0 F;  1MMD A;  2H48 B;  2MQP A;  3MDF A;  2OTL S;  1YJN S;  4MYT A;  5D3G A;  1IBA A;  4UUX A;  2CVI A;  1Y5L B;  3OSP A;  3K0J A;  1SB6 A;  1TL7 B;  1YZ6 A;  3LF0 A;  2R7X A;  3OBI A;  2FQT A;  2GSO A;  2ZUF A;  3GDZ A;  1LW2 B;  3K8W A;  1LWC A;  3JQJ A;  3LO3 A;  1FXD A;  3BS9 A;  4M5N A;  1FRM A;  3IBC B;  1IBM J;  4DX6 A;  3RUB L;  2DGX A;  4C48 A;  3GLJ A;  1YJ7 A;  3HOU K;  5KAK A;  3QGH A;  4X4S A;  2RML A;  2XSJ B;  5J1P A;  5I3U B;  3R2C J;  1KVK A;  4ED0 A;  4G0V A;  5KFD A;  3C8Y A;  3GIR A;  2FVC A;  2UZA A;  3OXF A;  2GMJ A;  1T95 A;  1AZS B;  3GU0 A;  3ZZ0 A;  1UWB A;  1F9H A;  4MEY A;  4J9V A;  3TI0 A;  6FDR A;  4I6A A;  1U2C A;  2L9W A;  2EFQ A;  5M2U A;  1WQH A;  3TUP A;  1K8A T;  4OZ5 A;  2QSF A;  1N33 J;  1BQN A;  1ZAW A;  2B7C B;  3KNA A;  4RW7 B;  1IWG A;  2WK4 A;  3TR5 A;  2GZO A;  4Y2M A;  2ZH4 A;  1ELO A;  1UFW A;  4AE5 A;  2G0J A;  4UOF A;  3GTL A;  5KFO A;  4B3T J;  2C42 A;  1RA7 A;  3HKW A;  4DV1 F;  2W7A A;  3CWJ A;  2XMU A;  4Q44 A;  5DG8 A;  3ET6 A;  4ZLP A;  1EKS A;  3IWX A;  4KGM A;  1XMB A;  4NCA A;  2MKC A;  4ED5 A;  3PO3 K;  1YBA A;  1YI2 S;  2V8D A;  3CMA S;  4X4Q A;  3IWN C;  3Q8P B;  4ZVG A;  3AD7 C;  5ETO A;  3BF4 A;  2FVS A;  2HW3 A;  4J9K A;  3MED A;  1M1K T;  3HKZ D;  4D3G A;  2P6S A;  1VQN S;  3KUE A;  4FPR A;  3PAC A;  3DXB A;  2CQB A;  3LP1 A;  2YKQ A;  4DUZ J;  1EK8 A;  4WYW A;  3JXO A;  2YNH B;  3PTW A;  3PO5 A;  3BB5 A;  3IA0 A;  3AOA A;  1S1X B;  3THV A;  1T8E A;  1N48 A;  1TL3 B;  5MAO A;  1FNM A;  3LWM A;  5G4D A;  4U95 A;  4F2S A;  4WBF A;  5IOQ A;  1Y1V C;  5CYQ B;  1Y9O A;  4HL9 A;  1XPP A;  5CXT A;  3QSY B;  1RT4 A;  2BJ7 A;  2FC8 A;  2V5H G;  3THT A;  5DDP C;  1VH2 A;  5E41 A;  1RSC A;  4PXB A;  4X4U A;  1SCJ B;  3CUL A;  2FDN A;  2NVT C;  5SUH A;  3B8H A;  1DCO A;  1DQA A;  1DTT A;  1J2V A;  5DQI A;  3LPX A;  1RCX B;  2ZWP A;  1HBN B;  5CA5 A;  2BA9 A;  2LA6 A;  3TOQ A;  3M4O K;  4KJI A;  3QAU A;  1RLC L;  4K59 A;  1SBR A;  1AB4 A;  4MK9 A;  3LUY A;  5DQH A;  1N32 F;  1TL7 A;  1VQ9 S;  2NVY K;  4WU2 A;  1FJ7 A;  4AH6 A;  1SMY A;  3VAK A;  1XER A;  4DV4 F;  4KH0 B;  3MWB A;  4QJV B;  4OIP A;  1LW2 A;  2XCA A;  1DUR A;  2PMZ L;  2FIU A;  2J9E A;  1KWM A;  2A2C A;  3MD3 A;  3OTB A;  2GQ2 A;  4XK8 C;  2GIQ A;  1XR6 A;  1UV7 A;  3WC2 A;  1OWX A;  5HQL A;  3HLU A;  4ED2 A;  1MSW D;  2XSJ A;  5I3U A;  1L3S A;  4WIL A;  2DIT A;  2JEI A;  3A13 A;  5KT7 A;  4FYW B;  1V3Z A;  1WHX A;  1AZS A;  3BBB A;  1PC4 A;  1RA6 A;  2QX0 A;  1FXL A;  2W4D A;  3KHR A;  3OXL A;  1UFK A;  1S6P B;  3K89 A;  3TFH A;  1PO6 A;  1Y3J A;  3KLV A;  1N5Y B;  3BZQ A;  5EHH A;  3RZO C;  1SJR A;  5FDL B;  4RW7 A;  2RDJ A;  1JKH B;  1TKZ A;  3S1Q C;  2KG0 A;  1YTY A;  1X5P A;  1B99 A;  3BQ1 A;  1D9F A;  5DRK A;  1T3N A;  2YH0 A;  5DJB A;  3EPG A;  2CZ9 A;  2PT0 A;  2I9S A;  4YFN A;  3HZG A;  3H20 A;  1FF2 A;  2GIR A;  3HI9 A;  3D28 A;  3S0X A;  1RWK B;  3A8I A;  1NK5 A;  3CJQ A;  1PAU B;  2HND B;  3BO2 A;  3BGF A;  2GJ2 A;  1XBW A;  3PYF A;  3GTJ C;  5E3Q A;  3BDE A;  2JA7 A;  3AFG A;  1VC6 A;  2PD1 A;  4X2B A;  2X1A A;  3K17 A;  4ELT A;  4I7F B;  2CPJ A;  1S1W B;  5L9N A;  3O6Q A;  4Z7Y A;  3GTQ K;  3Q83 A;  1I1G A;  2EC0 A;  1UEV A;  1RAC B;  3UNG C;  5B0G A;  4HR2 A;  3TAP A;  3VGU A;  1UA0 A;  4DV5 F;  4X4V A;  2Y1I A;  5L8R C;  1JLA A;  1Q7Y T;  1OYD A;  4OX9 F;  2CPZ A;  1NK0 A;  2YNH A;  4UT4 A;  3A12 A;  4LBH A;  1S1X A;  1HI1 A;  1X4H A;  1HWK A;  5IYB C;  1SQG A;  1TL3 A;  2NCK L;  1W25 A;  1S49 A;  3IR6 B;  4U7U D;  1FRJ A;  3L7P A;  5RUB A;  1NB7 A;  4CP5 A;  1FVQ A;  3FRY A;  2YPY A;  2VA2 A;  2R7W A;  4DSK A;  3KWM A;  1NZ8 A;  4C0O C;  2AX1 A;  4DL2 A;  3OR1 B;  3M6X A;  2HSE B;  3RR8 A;  2JFD A;  5BR8 F;  3HOX C;  3EZU A;  1TAQ A;  2WVD A;  3I9Z A;  1HBN A;  3DC2 A;  3V5R A;  4JYA F;  1RQ0 A;  1SKU B;  4DR1 F;  4U9R A;  4GKJ F;  1NSQ A;  5J2N B;  4PWU A;  4F0H A;  2FGC A;  3S16 C;  2FGO A;  2Z58 B;  1SFO C;  4QJV A;  4OIQ A;  3U27 A;  4CLL A;  2KRB A;  3L4B C;  4ERD A;  3ORE A;  3JB9 k;  1SJ4 P;  3MCM A;  4PQU B;  4ZPC A;  4TYB A;  3CUN A;  2MYF A;  4OI1 A;  1M5O C;  3B78 A;  2OML A;  1Q86 T;  4OX6 A;  2DCU B;  3TA0 A;  3PYE A;  1WKL A;  5DLG A;  2CWX A;  1UPP A;  3NUH A;  3QMQ A;  2X1G A;  3DU6 A;  4DV2 F;  1PC5 A;  3IAM 9;  3R5C A;  3RAM A;  1S97 A;  3HF5 A;  3PEJ A;  4BLG A;  4ZLL A;  2EFG A;  1N5Y A;  3CCT A;  4ZPV R;  5FDL A;  1RU1 A;  4OHY A;  1JKH A;  3VAF A;  1R89 A;  4QW8 A;  2KVQ E;  1EIY B;  1HBO B;  5F8I A;  4DPW A;  3W2V B;  3I0R B;  4ZP7 A;  5JJB A;  4NLQ A;  2QC3 A;  3HX9 A;  2JSX A;  1YJU A;  2IC3 B;  4GKK J;  4X65 J;  5AE2 A;  4X62 J;  5A2Q U;  1HW8 A;  4MH8 A;  3EE3 A;  1A6L A;  3VVT A;  4W90 B;  2HND A;  2AP6 A;  1FNO A;  2O5I A;  4LR2 A;  1HQE B;  4ILL A;  4DFP A;  3GYN A;  2WW4 A;  1J6V A;  1Y1V K;  4Y2A A;  1CJU B;  4PKD B;  3HFK A;  3JAM U;  4LUB A;  3PHE A;  3Q8S B;  4XPE A;  1N52 B;  1N36 F;  3SBM A;  3HHN B;  2E44 A;  2G2Y A;  3QBC A;  5AJ3 F;  1S1W A;  2HFN A;  2W2M P;  4LMZ A;  2CPD A;  4JI4 F;  3MAH A;  2NVT K;  5KFU A;  3MM6 B;  1RAB B;  2QFJ A;  2RIL A;  4FF3 A;  2E1M C;  2VJV A;  3S8S A;  3OVB A;  4GTC A;  3D0G E;  3JTN A;  2OJ3 A;  3H4D A;  1T7P A;  4P5A A;  1IBK F;  2MZQ A;  1U49 A;  3CCR S;  3MM8 B;  2C1E B;  3QQC D;  1JLC B;  4WYL A;  3R1H A;  3MEG B;  2VJU A;  2XMA A;  5D4P A;  4DEZ A;  4Q0B B;  1JLF B;  4CLP A;  4IR9 A;  2FLN A;  2AGP A;  2O1P A;  3H59 A;  1F5A A;  2JZ5 A;  3OR1 A;  2DK2 A;  4BHQ A;  2F7V A;  1WG1 A;  2F65 A;  4A8S A;  1ZAX A;  4KMA A;  2SXL A;  4LRD A;  2M4M A;  6FD1 A;  3PW7 A;  2DNR A;  1WUU A;  5KFP A;  3NAI A;  3OL7 A;  3RBD A;  1E6Y B;  3NGK A;  5HSP A;  4O0N A;  3M7V A;  2BJD A;  1F93 A;  3G96 A;  3QLH B;  5J2N A;  2NXE A;  4Y34 A;  3CED A;  1WI8 A;  1TUV A;  2A6E A;  2E5J A;  4X66 J;  1B0V A;  3LAM A;  3G4C A;  4BCA A;  3RZO K;  2P9G A;  3G8T A;  1B4S A;  3S1Q K;  4A3M C;  2BQU A;  2VV5 A;  2MQM A;  1N88 A;  1WEZ A;  4PQU A;  2WCX A;  2R8K A;  2RB7 A;  3I0S A;  3RRK A;  3FKB A;  1JOE A;  1YZ7 A;  2ZDO A;  4KH1 B;  3WIV A;  4CZC A;  5F8N A;  2CQG A;  1R6Y A;  2P2C B;  3IGV A;  3V4G A;  4TY8 B;  3PCO B;  2OFG X;  3GP9 A;  4ED1 A;  4WXW A;  1C4A A;  2OD6 A;  2W01 A;  3SZY A;  2HHH J;  1N5Q A;  1EH1 A;  3J7Y I;  2E1C A;  1S4F A;  2W9A A;  2A6H A;  3T1Y F;  3TQE A;  3GTJ K;  2HS0 A;  5DZ7 A;  1CBK A;  5KFI A;  3M9O B;  2ADC A;  4ILM A;  4OI6 A;  4NXN J;  4PG5 A;  3PKM A;  1C1B B;  3AAW B;  5KFB A;  1EQM A;  4UQT A;  1X7V A;  1HBO A;  2DIS A;  3SSS A;  3LPE A;  2DXF A;  1RAO A;  4Z7C A;  2ASY A;  2IC3 A;  4O44 B;  3M3Y C;  3PIO Q;  2CDQ A;  1X4F A;  4IR1 A;  4P73 A;  4EBC A;  5GAH I;  4CM2 A;  5IYB K;  2MTL A;  1KLM B;  4OYP A;  1HQE A;  1CEZ A;  1EX8 A;  1SL0 A;  1RU0 A;  4B9U A;  5K8P A;  4USU A;  4NLV A;  2WAQ L;  1CJU A;  3FC9 A;  5FD1 A;  2B0G A;  2KG1 A;  2JA7 C;  3WBZ A;  2DHX A;  1YJT A;  3HOV C;  1NCL A;  4QWB A;  2GJI A;  2QMX A;  1KVJ A;  2NVQ C;  3MM6 A;  1MU2 B;  3HOX K;  4MYU A;  3JAM Y;  1TZ0 A;  2HQD A;  2D6F C;  1RHR B;  2LEB A;  3N0C A;  1RUS A;  4M1X A;  2ZUA A;  1GT8 A;  3TUZ C;  3GIK A;  5HO4 A;  4DI6 A;  3LWL A;  1JLC A;  5C4X C;  5KOX A;  1FJE B;  1R43 A;  5D4D A;  4L6V 3;  3MEG A;  3O8W A;  2EXU A;  4ZVT B;  4Q0B A;  1JLF A;  1VGY A;  2VH7 A;  5IXU A;  1U6Z A;  3S16 K;  4PWD B;  1SFO K;  1F60 B;  1TL1 B;  2XSF A;  3LAL A;  2RDI A;  1SH3 A;  5HL8 A;  2O5J A;  4KTQ A;  3KJF B;  1FE0 A;  2V9K A;  1VRQ C;  5HL7 Q;  3PW4 A;  2R8G A;  4LFB F;  3HSD A;  3GON A;  5C3E C;  3VWS A;  1TKX B;  2Q79 A;  3AQO A;  1E6Y A;  2PFF B;  2Y3Y A;  1K9M T;  4QWA A;  4M1K A;  2Q43 A;  4S0M A;  2QO3 A;  4JP8 A;  3QLH A;  2GAG C;  4KM9 A;  2Z56 B;  2DNQ A;  2DH7 A;  2PSZ A;  3TA1 A;  5KG7 A;  1WCM A;  1T94 A;  3CCV S;  3LH2 S;  3KJQ B;  4EI2 A;  3W64 A;  2XZW A;  4NLT A;  2B4O A;  2H5I B;  5CYM A;  1O26 A;  2PN6 A;  4DDQ A;  1ULR A;  3DRY A;  1TWH A;  2W25 A;  4PQA A;  5KFF A;  4RBT A;  2PFD A;  3RU0 A;  4KV8 A;  1VRU A;  3RW7 A;  2J7W A;  1O24 A;  4TY8 A;  3ZZY A;  4DR3 F;  1TV6 B;  2X1F A;  3GYX B;  3QT8 A;  3ILO A;  1O25 A;  1UJ5 A;  4K0K F;  2PII A;  1V3R A;  2F5G A;  4L73 A;  3QPI A;  2ZOM A;  3IFE A;  1RTI A;  1KTV A;  5E3R A;  4ZCK A;  1S0N A;  2E5I A;  1I50 C;  2PI5 A;  2HIQ A;  3IMQ J;  5TJ3 A;  4UF4 A;  1RWO B;  1MWY A;  1NB2 A;  1FRH A;  4YY3 J;  1QAJ A;  1C1B A;  4DQI A;  5A8R B;  4DOZ A;  1X4G A;  3CC2 S;  1CPZ A;  2KI2 A;  3KK1 A;  1RHK B;  3EDQ B;  1L3V A;  1HQM A;  2BX6 A;  2HHS A;  1PCA A;  2OPS B;  5AE1 A;  4KRW A;  2IVY A;  4O44 A;  3RB0 A;  2MKH A;  2B6A B;  1R7I A;  5U47 A;  2MSS A;  2N4C A;  2BYC A;  1KLM A;  5ETL A;  3MR5 A;  2W8L A;  3DLK B;  5J1E B;  2O5D A;  1TL5 A;  2LXU A;  5HVG A;  3KUG A;  3OTC A;  4EUV A;  1YBT A;  3GIJ A;  3CSK A;  2J76 E;  2PGC A;  4NLY A;  3TA2 A;  2WZ1 A;  4RUB A;  1T05 B;  1MU2 A;  5IFM A;  1T03 B;  2FY1 A;  2V50 A;  4IUF A;  2R8J A;  4GTB A;  2BE5 A;  1JJH A;  2D3Z A;  2R7O A;  2WTF A;  4R8U B;  4CQ1 A;  1U1M A;  4FYD A;  1JQW A;  1LV5 A;  1R9T C;  1QTM A;  2OO4 A;  2BM0 A;  4ES1 A;  3CQZ C;  3OVA A;  1MMN A;  4FXV A;  4PWD A;  1QLN A;  4ZP9 A;  2BKO A;  3D6H B;  2MZR A;  1U02 A;  4K5S A;  2FLL A;  3B4D A;  3J7A 1;  1IBC B;  3KG4 A;  4A3M K;  4DFM A;  3TZX A;  1NK6 A;  5IOL A;  2YKA A;  2POK A;  1TKX A;  1GQE A;  5M5W K;  2IVF B;  4NA3 A;  5HAN A;  2WB1 L;  1HBU B;  4MJK A;  4KT0 C;  2PMH A;  4M5I A;  1HW9 A;  2DNL A;  4QYZ K;  2CFX A;  4WP9 A;  4CDI A;  3ZO7 A;  1WKJ A;  2DJW A;  5HMW A;  3TO8 A;  3ADA C;  4ZCL A;  3DRS B;  3N3Y A;  1D8Z A;  2VBY A;  3CD7 A;  2JJ4 D;  4LSL B;  3MR6 A;  3PVX A;  2ZVI A;  2ZZT A;  5K8M A;  3NLC A;  2LLZ A;  1LXJ A;  3VAG A;  1R0A A;  4A47 A;  3ZNU A;  2M7S A;  3R5G A;  3KHH A;  3Q2S C;  2LDY A;  1RYR A;  4OJ3 A;  3GSI A;  1QDU B;  1S48 A;  3V2U C;  3N79 A;  5E68 A;  1RJJ A;  4WU3 A;  1WG5 A;  3M3Y K;  2GML A;  3D5M A;  3OSN A;  4JBC A;  2DB1 A;  4C45 A;  3CB4 A;  2UU9 J;  5HN0 A;  4RW8 B;  1VOM A;  4NLU A;  3D0H E;  2IY5 B;  4ID5 B;  3G6Y A;  2K1R A;  1VGX A;  4EMD A;  2ZH2 A;  3TAR A;  5F0U A;  3TQ1 A;  1YHQ S;  3R5A A;  3S1T A;  4RW4 B;  2JA7 K;  3UWT A;  4P6Q A;  4MFB B;  3BN4 A;  2RKI A;  3T9N A;  3NCR A;  4NCG A;  5HP1 B;  3PNI A;  5A8R A;  3HOV K;  1W2I A;  2HK3 A;  2NVQ K;  3TVY A;  1WHY A;  3NGS A;  2LXF A;  4LQ3 A;  2Y0B B;  2OPS A;  3MOZ A;  1DD5 A;  4KKO B;  3M8S A;  5KFK A;  3U02 A;  4K2X A;  4UW2 A;  3MGJ A;  3I4M C;  1WC1 A;  2QLJ B;  1UP1 A;  2B6A A;  2V8G A;  2EFV A;  1FX2 A;  2DD8 S;  4KB7 A;  1DCP A;  2CG8 A;  4DR6 F;  5C4X K;  3JST A;  1RYS A;  2CQ3 A;  3VAM A;  5J1E A;  2W9B B;  3VVU A;  5AXL A;  2ZNZ A;  4O2D A;  2YBV A;  1NDK A;  5M3F K;  1OMS A;  2XMW A;  3TFJ A;  1HA1 A;  5HBM B;  4CLS A;  4YFU A;  1CJK B;  2JOQ A;  1XMO F;  4JI6 F;  4RL1 A;  4I67 A;  3SSR A;  4KIA A;  4WCE Q;  3POT B;  4MK7 A;  1T05 A;  2D69 A;  5IS2 A;  1T03 A;  2ZKT A;  5BJR A;  3SI8 A;  4N8O A;  2ROG A;  3NS5 A;  4OQJ A;  3UDC A;  2NRE A;  4USJ C;  1U0S A;  5C3E K;  4OIR A;  5KG6 A;  2YWK A;  3FUY A;  4R8U A;  3CCM S;  1WIH A;  2NPI A;  4DR4 J;  4YP3 A;  2QIF A;  3NBP B;  4RJV A;  3SQG A;  1SQF A;  1S79 A;  2UV8 A;  4TKT A;  4LIR A;  3Q2T C;  1NK8 A;  2FHJ A;  3EDR B;  1FT8 A;  2B63 A;  2E7X A;  4XCH A;  3BPD A;  1Q78 A;  1DZ5 A;  4GTE A;  3P45 B;  1TWG A;  9RUB A;  3M2R B;  1RXO B;  2AJ4 A;  1AUD A;  4RMF A;  3HMJ G;  3P8B B;  4NLD A;  2DR8 A;  5JUM A;  4C3H C;  3AH5 A;  3QRR A;  1YIT S;  1HBU A;  4V19 X;  1DLO B;  1BUX A;  3L4K A;  2Z0G A;  1RCO B;  3P4U B;  4OMF G;  3BDP A;  4C3J C;  1GMU A;  1VFJ A;  3DRS A;  5AXK A;  4WFA Q;  3CDW A;  3QRQ A;  2FC9 A;  1WEX A;  5A6W A;  2IJF A;  4LSL A;  2FZC B;  4O4G B;  1WCM C;  1M5H A;  2WVC A;  1I50 K;  4KN4 A;  2PA3 A;  1L5U A;  1SKW A;  2I2Y A;  4YHH J;  4H4K C;  1EKR A;  4LVO P;  2RS8 A;  4DPU A;  4UOG A;  2RQ4 A;  3UR0 A;  2AKW B;  4WJB A;  3C15 B;  4LQY A;  2XMT A;  3FOF A;  4QYZ J;  4N56 A;  3MUR P;  3DXJ A;  5LSR A;  3V6K A;  1WOR A;  1UA1 A;  2R7T A;  1QD1 A;  5HJY A;  1H0H B;  2BE2 B;  1CS4 B;  3HCX A;  3OFE A;  4JI3 J;  2XGQ A;  3W3S A;  4ID5 A;  2B9X A;  2DNG A;  1VHI A;  4XO0 A;  2JLG A;  1N6Q B;  2JL9 A;  3OEP A;  5D0E A;  3FDS A;  1OY6 A;  2B4V A;  1C0U B;  2HVD A;  1BC6 A;  4RW4 A;  3V81 B;  1G51 A;  4MFB A;  2F8M A;  5HP1 A;  2O67 A;  3W9I A;  3K59 A;  1JX4 A;  3NL0 A;  4J3N A;  5ETV A;  2YWG A;  3FZ2 A;  3NY0 A;  4F2R A;  4IH5 A;  4KKO A;  2E2H A;  2YY3 A;  3UDV A;  2L08 A;  3H2L A;  1XR5 A;  5KG3 A;  2CIM A;  3O1L A;  2QL7 B;  4JOU A;  2M70 A;  3D67 A;  4USH A;  4LF6 F;  2VBW A;  1UAW A;  2I8E A;  2ZZN A;  3DGV A;  4B02 A;  5EWG A;  3I4H X;  1R9T K;  2W9B A;  4JI8 F;  1D9D A;  3CQZ K;  1Y3K A;  2E9Z A;  1H73 A;  3OHB A;  3SFU A;  1NDC A;  1LK7 A;  5HBM A;  5F8H A;  4AYB D;  1CJK A;  2DRD A;  3EQL A;  2FZK B;  4MAK A;  5AXM A;  5IT0 A;  2I1R A;  3OW2 R;  3POT A;  2KXN B;  2AT1 B;  2G0C A;  3HSJ A;  3MAA B;  3I82 A;  2RH6 A;  3V4M A;  1NU4 A;  1FXR A;  3K5N A;  4ZVO B;  2H9Z A;  2BJE A;  2A10 A;  3IM9 A;  3NBP A;  1OY8 A;  3RRG A;  2VF3 A;  5D0G A;  2RHQ B;  1MRO B;  2Z57 B;  4HTJ A;  4KGV B;  5ETK A;  4DSE A;  1I51 B;  2ZC4 A;  1NJW A;  4KGZ B;  3WC0 A;  2HFS A;  2XS7 A;  4LF2 A;  1HL6 A;  3B6B A;  2DTJ A;  4Q8E A;  1D8Y A;  3CIM A;  3OTD A;  3KDN A;  4E98 A;  4LRB A;  1Q0N A;  2GA7 A;  3L4J A;  4A46 A;  4QCL A;  4ZS6 A;  3VV2 B;  2V2Q A;  2AMC B;  2EEY A;  1DLO A;  2DPI A;  1Q5Y A;  4DX8 H;  1S9G B;  3DYA B;  2XLI A;  4F0M A;  2N3L A;  2Z8Q A;  4C0B A;  3OJS A;  4G7Z A;  2DIU A;  3QZ8 A;  4HDG A;  4AFF A;  4YEA A;  4AXJ A;  3GMG A;  4X6A C;  4O4G A;  4BKW A;  4NAS A;  2C2Z B;  3KMQ A;  3EIC A;  3QID A;  4DV1 J;  4ZP6 A;  1U4B A;  1QY7 A;  2FHO B;  2NZ4 A;  4P71 A;  5K20 B;  2CXE A;  1F0X A;  4IG3 B;  3LAK A;  2OFH X;  1W7W A;  3C15 A;  3N0B A;  3MHY A;  4QW9 A;  5DQG A;  5HVH A;  4KAT A;  4C8N A;  3I4M K;  2BE2 A;  1CS4 A;  2YH1 A;  2DY1 A;  3CAG A;  3BSN A;  3KUH A;  3DLJ A;  3VZH A;  3GFY A;  3SYZ A;  4ZMM A;  4JI2 J;  1FVS A;  4A93 C;  1VIS A;  3JQM A;  1TMJ A;  4EYH B;  3K5P A;  4DF8 A;  4R0E A;  3GQC A;  3G4S S;  1C0T B;  4F4Y A;  2AJF E;  5ETS A;  3PX4 A;  2CQH A;  3TZW A;  1Z2L A;  1NJY A;  1WOS A;  1N5T A;  1V5V A;  1T11 A;  2ZBP A;  5EDW A;  1I94 F;  2DNZ A;  2MLZ A;  4ZIW A;  5HJX A;  1TUG B;  2JVR A;  1CC7 A;  2C2N A;  2DPJ A;  5IWA J;  1SV5 B;  2CJB A;  3CC7 S;  1XIQ A;  7FD1 A;  5LL6 d;  2XY6 A;  5HVF A;  3KLH B;  2VFU A;  4ZKA A;  1ZPW X;  1VLY A;  2CPX A;  1T9U A;  1Q5V A;  4OLP A;  4ZVF A;  3Q24 A;  2OIH A;  2L9N A;  1HIY A;  4HVZ A;  2HQG A;  3CD6 S;  4FF1 A;  3MCS A;  2HBQ B;  4I69 A;  1KQ4 A;  3ELH A;  5HLF B;  2AZ1 A;  2VBX A;  3AXK A;  4Y28 C;  1VC0 A;  4DSJ A;  1N32 J;  4EK2 A;  5L9X A;  1HNZ J;  4BY7 C;  3AB2 B;  3I6P A;  1YJR A;  4IRC A;  3MAA A;  1MWZ A;  1KVI A;  3GE9 A;  3V4I B;  1FFG B;  4O3Q A;  4OJ1 A;  3IWL A;  4C3H K;  3MOJ B;  4ECW A;  3RYL A;  1UVN A;  3OTO F;  2MXY A;  5KFS A;  1HD0 A;  4LK1 A;  2W2O P;  1B3T A;  1MRO A;  4DG1 B;  4A3J C;  4C3J K;  2B63 C;  4DPX A;  1S99 A;  3NS6 A;  1WCM K;  2HNY A;  2UXB F;  3NCP A;  3HHL D;  4DV3 J;  4G1I A;  5JFE A;  5D78 A;  2AYM A;  1SXL A;  2GVZ B;  5K8N A;  1Y5I B;  4OI4 A;  2XB2 D;  3TJA A;  1VIO A;  3P6Y C;  4DL6 A;  3RB3 A;  3PO4 A;  2CZV C;  1P1L A;  2BMB A;  2X3G A;  1WTF A;  2V67 A;  2HAI A;  3DYA A;  4K4S A;  2YWF A;  3BGR A;  1H72 C;  3ICL A;  2BVZ A;  2H51 B;  3CXC R;  1KC8 T;  1Y00 A;  2HLT A;  4IKA A;  2J8A A;  4RLE A;  2CNN B;  2ZC3 A;  4B3R J;  2KT3 A;  4HT7 A;  2A1B A;  3EWG A;  2BEF A;  2B4U A;  4IG3 A;  4ZVH A;  1Q16 B;  3L9Z A;  2ZNY A;  3NP5 A;  1H98 A;  2WB1 D;  1UEK A;  1N54 B;  4Q2M A;  2C2O B;  4CLU A;  1O6X A;  4DN0 A;  4KB4 A;  2LFV A;  4A3D C;  2F1F A;  4AL6 A;  2XHW A;  2KFN A;  1VQP S;  1ZAV A;  4LT6 A;  5IV3 A;  2KFZ A;  3AHP A;  2C3Y A;  4A4J A;  2UP1 A;  1USM A;  3M4X A;  2ZJR Q;  4L3K A;  4TU9 A;  4RUC A;  1Y5N B;  4LF8 F;  4PG8 A;  1WNE A;  1C0T A;  4ECU A;  4DV6 J;  1BQM B;  1PJ6 A;  2EG1 A;  2R4F A;  4ENO A;  2MY8 A;  1JXL A;  2R42 A;  2B5J A;  3ZTP A;  1NZA A;  2CKW A;  2ERR A;  1Y10 A;  4Q5V A;  5CH7 B;  1XZQ B;  3FEZ A;  2GFF A;  3TZZ A;  2VAS A;  2D41 A;  1FD8 A;  4G1P A;  3KJN B;  4USV A;  4C2M A;  2HG4 A;  1XXC A;  5DLF A;  2UUW A;  1AA1 B;  2W24 A;  4RNH A;  4DQS A;  3KHG A;  4LF7 F;  4G1Q B;  3N5B A;  2L41 A;  2JEJ A;  5IOT A;  4K4W A;  5GAD U;  5AXN A;  4X4T A;  3PO2 C;  1KDN A;  2JNJ A;  2MKI A;  5BR8 J;  3HOW C;  2DXE A;  4LF9 F;  1XNR F;  2PI4 A;  4LF4 F;  1KHW A;  4HI1 A;  2WON B;  2F9J A;  2FB0 A;  2JX2 A;  3M8Q B;  4NCB A;  5DM7 Q;  3J7Z T;  4ZH4 A;  4DCP B;  4B3M F;  4HEA 9;  3C66 A;  3MUM P;  4LFC F;  5HLF A;  2M52 A;  3GFZ A;  4WTO B;  3FSI A;  5IP7 C;  1B4B A;  5B0A A;  3GFH A;  4JV0 A;  2RUG A;  3R9L A;  2UV8 G;  5IV4 A;  2IRY A;  3V4I A;  2DNH A;  2LQ5 A;  5HMY A;  4O0I A;  4ECT A;  2G4B A;  3K7A C;  3EX7 B;  3PX0 A;  2DGU A;  2K3I A;  2MY7 A;  3L09 A;  3FQL A;  1R8A A;  4DG1 A;  2GQC A;  4B9S A;  3EVW A;  3BGO P;  2J9D E;  1JB0 C;  3BQ2 A;  4IYQ A;  5KFW A;  3W62 A;  5M2P A;  4WFN Q;  3VHQ A;  4X6A K;  2VZ9 A;  2W2N P;  3MUT P;  4B17 A;  3NMR A;  2XLJ A;  5ETM A;  3PFE A;  4MKV A;  5EN1 A;  2GVZ A;  3MEE B;  4GTA A;  1GMW D;  1QAX A;  3OUY B;  1BS2 A;  3LGN A;  2FY8 A;  4HDH A;  4DXL A;  2XYG B;  1RAH B;  2P5M A;  5A0Y B;  1RBL A;  4JV5 J;  2OAU A;  4JI5 F;  1SL1 A;  1YSJ A;  3AB4 B;  4N7T A;  2V9W A;  2QGF B;  2MKK A;  5DM6 Q;  4A93 K;  4QIW L;  1NME B;  3C6U B;  3C2P A;  1NBE B;  5KFG A;  2V2V A;  4ICL B;  4ZPW R;  3GPA A;  2C22 A;  3H42 A;  2A6O A;  1NHV A;  1IKV B;  4FZB A;  2XUL A;  1LKZ A;  2HGN A;  1RTD B;  1YQH A;  1M1H A;  4NLR A;  4I56 A;  2DEI A;  4KHP J;  3I5B A;  3G87 A;  4KAR A;  3H5X A;  4WKY A;  2VU5 A;  1ZH5 A;  2BXJ A;  3DHX A;  3SCJ E;  1IBM F;  2MZT A;  2IBK A;  3BYP A;  3VQT A;  5IT4 A;  1MWQ A;  2ATL A;  4JI4 J;  3HVA A;  3FBF A;  2V63 A;  5GAH U;  2W9C B;  2WSF C;  3ENA A;  2VB6 A;  4K4X A;  2PA8 L;  1BQM A;  1ROF A;  2Z30 B;  3ITH A;  4F25 A;  1A0O B;  4B9M A;  3HOY C;  1XTZ A;  1P27 B;  1IBK J;  1KNZ A;  4YB6 A;  4BY7 K;  1XZQ A;  5HI7 A;  2IMW P;  2FHM A;  5DS7 A;  1NXI A;  5L39 A;  3S2H C;  2ILY A;  1FTR A;  1S10 A;  3GTO A;  2MZS A;  2DXD A;  3S7R A;  2H4Y B;  2RF2 B;  4MKY A;  5KFH A;  1G4C A;  4LVN P;  4G1Q A;  4O3O A;  2KN4 A;  1OQ6 A;  2OLW A;  3CJR A;  2UVW A;  5IZH A;  3GEI A;  4A3J K;  3HUL A;  2WON A;  2KO1 A;  4B3T F;  2NS1 B;  3DFE A;  2B63 K;  3S17 C;  3MR3 A;  5C42 A;  4FVC A;  3IS9 B;  4LIW A;  4NWB A;  2EBB A;  5LT5 A;  3J7A N;  1LK5 A;  2JWN A;  4QWE A;  1B70 B;  4NRT A;  4DL4 A;  3KKF A;  4KSE B;  4JI7 J;  1FJG J;  1IBL J;  4A3I C;  5E0O A;  4DR7 F;  1CQM A;  3KLG B;  1UPM B;  2WVE A;  4WWS A;  3OJU A;  2CYY A;  1JWW A;  2FLO A;  3L95 X;  2FLP A;  3VGS A;  1WHV A;  3QFW A;  1T9W A;  2IHR 1;  4DUZ F;  3M8W A;  2JFK A;  4ZDN A;  2OKQ A;  4OV6 A;  1I3Q C;  2EFO A;  2Y8Y A;  2RVJ A;  3BGL A;  5K14 A;  2CPF A;  5I3P A;  1FE4 A;  3CW2 C;  4LSN A;  3MEE A;  4HT5 A;  3O5T B;  1SJQ A;  3ZXW A;  2LA4 A;  1AFJ A;  2QLF B;  5D15 A;  1TL4 A;  2XM3 A;  3EVO A;  3OUY A;  2WSC C;  2J8S A;  3T1Y J;  4CNY A;  1P6T A;  2KJW A;  2W7O A;  5ETR A;  5A0Y A;  4A3D K;  4FYX B;  2EC2 A;  4WFB Q;  3DDN A;  2C2E A;  4KDD A;  2GC8 A;  1U1L A;  5BYS A;  3DRR B;  4RWX A;  3N5F A;  1K44 A;  2YU9 A;  3OT9 A;  3OPF A;  4IOA Q;  1ZZN A;  2M2B A;  1C1C A;  1USO A;  2V2Z A;  1XNQ J;  1RKJ A;  1URR A;  1IUJ A;  4GRS A;  3ILL A;  4ID8 A;  5DDO C;  3T6B A;  2BKN A;  2UVU A;  1IKV A;  3ZZT A;  1IE0 A;  5KT5 A;  1CC8 A;  1VQ6 S;  1R27 B;  1RTD A;  3HT0 A;  1UFL A;  4PYA A;  3BYR A;  5KG4 A;  3A4T A;  4F4X A;  1FKP B;  4O3P A;  3SQO P;  2JA8 C;  5M5X K;  4RNF A;  2JDJ A;  1NSK L;  2I0X A;  5LJ3 Y;  4F4A A;  3GCW P;  5DDQ C;  2B9W A;  2E2I C;  4TXS A;  5IT9 Y;  2OI2 A;  2RRA A;  1FRL A;  2Q6B A;  2MKY A;  3PO2 K;  3BBC A;  1F1B B;  3HOW K;  2H5J B;  5CHP A;  1ZM3 A;  4ZLN A;  2VPW B;  5THW A;  2W9C A;  1Q81 T;  2R7Z C;  1VCT A;  3BKF A;  2QYC A;  2AHO B;  1JNZ B;  2R7V A;  1HQ2 A;  4BS2 A;  1SKS A;  3W5Y A;  1D09 B;  1WWH A;  3MAQ A;  2J6U A;  3FRZ A;  2NUU G;  4U6P A;  3D66 A;  5IP7 K;  2UXD F;  3E2E A;  5FLX U;  4LR7 A;  5B0F A;  2FVR A;  5C2G A;  4C2M C;  3H5Y A;  2RF2 A;  1SH2 A;  4XDC A;  2P9E A;  3UCG A;  2OPR B;  3K7A K;  1S59 A;  1FWK A;  3D3B J;  1UVM A;  1X5S A;  1L3U A;  2ATC B;  1FO1 A;  4PPD A;  1Y11 A;  4DV7 F;  4J9P A;  3IS9 A;  2V34 A;  2ACM A;  1IR2 A;  4OYA A;  4DV0 F;  3W60 A;  3TVK A;  1YRU A;  5KFQ A;  1NK4 A;  3GTG A;  3AH6 A;  5B0C A;  2E5G A;  3EPI A;  2CZ4 A;  4EO8 A;  3I4P A;  3FEY B;  2BR0 A;  4P7V A;  2HQI A;  1EQ0 A;  2HVH A;  1IW7 A;  3QT6 A;  1TWA A;  4O3R A;  1JLQ B;  5DZ6 A;  4CO3 A;  1W2B R;  1QM9 A;  2XEX A;  1HWU A;  1ZPV A;  3NGR A;  4OJG A;  4M63 A;  3CTR A;  1HHS A;  3FJ2 A;  1MG7 A;  5KOW A;  1TMM A;  1TKT B;  4QQB A;  2G1D A;  4ZA1 A;  4HLB A;  1UKU A;  2KM8 B;  4OYO A;  4XSX A;  1CUL B;  1N8R T;  1LWE B;  1RT7 B;  1U1Q A;  1QJH A;  4C97 A;  4NI2 B;  3ENW A;  4ZVU B;  1ZYR A;  2MZ1 A;  4CLZ A;  4J9Q A;  3HOZ C;  4BBR C;  4QOT A;  2AWZ A;  4K0K J;  3F41 A;  2XMM A;  2DNN A;  4P52 A;  4OFZ A;  1EJ7 L;  5J2P B;  4V1A k;  4NZ6 A;  4DF4 A;  3BKU A;  3N0V A;  4CM0 A;  4FNI A;  3BEG B;  5KFV A;  4ECV A;  4K5R A;  2B8P A;  3DNC A;  5LMU F;  2K7J A;  2PC6 A;  3RZA A;  2KZZ A;  2XMV A;  3DRR A;  3NXZ A;  4FYV B;  2MST A;  3M2V B;  3W2W B;  3RGI A;  2X3D A;  1JLB B;  3I4N C;  3R8Y A;  1R31 A;  4UZB A;  4LRF A;  4CO0 A;  4P2F A;  2LVW A;  2R7S A;  3HOY K;  1RLD A;  2ZH8 A;  4U67 Q;  2KT5 A;  3PZP A;  5KFE A;  3UCZ P;  4AT1 B;  4GC6 A;  4ECR A;  1FKP A;  3FSX A;  3EMT A;  3KNG A;  4FKY A;  1W26 A;  3S2H K;  1SC6 A;  2V4J B;  4CLK A;  2J6S A;  2VFR A;  3N6N A;  3Q8Y A;  2CJ9 A;  2UUA J;  4Q2L A;  2MJU A;  1FKO B;  2CNO B;  2MB0 B;  4NLO A;  3S17 K;  4WP8 A;  2VG7 A;  2QFI A;  5CJ9 A;  4DPT A;  3VAI A;  1SFO A;  4G3I A;  1EAR A;  4C8Y A;  3SDE A;  3MMJ A;  4L72 B;  1QTN B;  5BYQ A;  1RTJ A;  2CFA B;  4ZPT R;  1VBX A;  3S1R C;  3K5O A;  4Y2K A;  5CYJ A;  4RBU A;  4F4K A;  3PJ9 A;  3GTO C;  4OYI A;  4A3I K;  4ITS A;  1U1N A;  4NZ0 A;  4YB5 A;  2D7S A;  1T02 A;  2N7C A;  2IMO A;  5FLX Y;  3S1M C;  2NSB A;  2W4C A;  2UUB J;  1OQ3 A;  1UZD A;  2OEM A;  2MEW A;  4R5P A;  4GKK F;  4X65 F;  3FCV A;  4XLN A;  3ZTO A;  3IXQ A;  3TAQ A;  2N82 B;  1G7C B;  1I3Q K;  1S6U A;  2GNK A;  3LP0 B;  3NOG A;  4LFA F;  3TEG A;  3B82 A;  3VGV A;  2YKN B;  2RU3 A;  2EVZ A;  4D3H A;  3RW6 A;  1NAQ A;  1O51 A;  4OIN A;  2HHU A;  4I68 A;  5HQ8 A;  4JI0 J;  5HK4 A;  2XCQ A;  3G8S A;  1YRT A;  3MFH A;  3AOD A;  1C4C A;  4M5L A;  1H7W A;  2JC1 A;  3RBZ A;  3AT1 B;  2WB4 A;  1Z1Z A;  2AIR B;  3DLH A;  8AT1 B;  4A3K C;  3NAH A;  4OIO A;  1TKT A;  4K50 A;  5GAG I;  4JV2 A;  1AFI A;  1IKX B;  3QGG A;  2ZH3 A;  1LWE A;  1SPB P;  1RT7 A;  3FZB A;  4NI2 A;  4EZ6 A;  3FBB A;  3QJJ A;  1TWC C;  2HBR B;  3SFG A;  1IR1 A;  2DR6 A;  2QG9 B;  2M3D A;  3IAS 9;  1HNW J;  5HAO A;  2E7V A;  3HSZ A;  3KK3 B;  2VFT A;  4HTI A;  3QX3 A;  3BSO A;  4PXE A;  1IXK A;  3NGU A;  3G2X A;  3NGT A;  5LMN F;  1H74 A;  2J0Q D;  1I5O B;  3ZZZ A;  4FS2 A;  4U7U K;  3K58 A;  3UNY A;  3UVJ B;  4DL3 A;  4OZ1 A;  2GGP B;  2JA8 K;  3CJ0 A;  3U1N A;  3TJ8 A;  4P10 A;  2XMK A;  2E2I K;  3KLI A;  3HD1 A;  1KR4 A;  2CAJ A;  1RWN B;  3W2W A;  2YU9 C;  1NDL A;  1WF0 A;  3QJL A;  1JLB A;  2M5Y A;  3B4M A;  2R7Z K;  1TUW A;  3I55 S;  1FRK A;  3MPW A;  1TWF A;  4GTF A;  2HZV A;  5GMK a;  2QEX S;  2A18 A;  5A6P A;  3C6T B;  2IYI A;  2ZJQ Q;  4FP9 A;  5F3T A;  2F3J A;  4M5D B;  1Q7L B;  1F9E B;  2ZIT A;  2NZC A;  3IP0 A;  3TX8 A;  1NJI T;  4OZ2 A;  4X66 F;  2V4J A;  4C2M K;  4FF2 A;  1RDR A;  3TZY A;  4P2X A;  4F26 A;  3O2I A;  2VOP A;  2XGP A;  1Q8L A;  1PJ5 A;  1FK9 B;  1FKO A;  1FX4 A;  1VQ5 S;  2OEL A;  3R3T A;  4IQM A;  2MJN A;  3CJ2 A;  4I4B A;  5L1K A;  2KWA A;  3OPK A;  2BAB A;  5I42 B;  1VHF A;  3TAM B;  2CFA A;  2I38 A;  1S6Q B;  2QN6 B;  2HHH F;  1RWP B;  3WIU A;  3QWU A;  5D6G A;  2YX7 A;  1HFE L;  5LXY A;  3Q3Q A;  3K7R A;  1IKW B;  2D1C A;  4G0W A;  4NXN F;  5K9F A;  2Z4P A;  1U8S A;  2CG4 A;  4K4U A;  4DU7 A;  4JI1 J;  1WEL A;  2C2K B;  3TEH B;  1AT1 B;  1KTQ A;  2B51 A;  4MQ9 A;  4RPF A;  3I32 A;  1VQ4 S;  1JLE B;  1F5C A;  1ZTT A;  3HHE A;  2YNG B;  1OPI A;  3C14 B;  2ASL A;  1X4B A;  4KC5 A;  4USK A;  1S0V A;  2DBB A;  2RRN A;  1S1V B;  1J98 A;  1RAA B;  1PIL A;  3S1N C;  1SUQ B;  3NNC A;  3LP0 A;  4QIV A;  5IM0 B;  3V6J A;  3HOZ K;  4BBR K;  2YKN A;  3GTG C;  4NLW A;  2YNI B;  2AD9 A;  1KBR A;  3HM9 A;  1UEU A;  1H2T Z;  4Z37 A;  1TWA C;  1MNE A;  1PJ7 A;  1WC0 A;  1HBM B;  5ETT A;  1WQG A;  3ISN D;  2R2T A;  5EGH A;  3PG9 A;  5L1J A;  2DR5 A;  4PWW A;  4F4W A;  5D0H A;  2VQF F;  1X31 C;  1TFW A;  1IKX A;  4M5M A;  4J90 A;  2FJV A;  4BBY A;  4OZL A;  4AQY J;  2J6T A;  3ZC4 A;  1FRX A;  3HD2 A;  2ZH5 A;  2BE9 B;  3UN5 A;  2ZEJ A;  3I4N K;  2Q3P A;  3MM7 B;  2GS8 A;  3ILJ A;  2YWE A;  2XHC A;  2VA3 A;  4IRD A;  3W9H A;  3KK3 A;  1N5V A;  3S2D C;  1O2A A;  2LU1 A;  2XZT B;  4YB7 A;  4M95 A;  3UVJ A;  1S0O A;  4GTL A;  2H4W B;  1UW9 A;  2VG5 B;  4WE1 B;  2GGP A;  5LOQ A;  2ZH6 A;  4J37 A;  2YXL A;  2BRK A;  7AT1 B;  4KMU A;  3H3V D;  5KT4 A;  1LOU A;  5KG0 A;  4ELU A;  2B8Q A;  2LEC A;  3MPD A;  3CD5 A;  1Y0H A;  4CRJ A;  5HRO B;  2G0I A;  3JS9 A;  2BDP A;  2CQ1 A;  3BH6 B;  5F8J A;  1XZP B;  1RAG B;  2WSE C;  2B3T B;  5CYQ A;  3D54 A;  2L48 A;  3A8J A;  4OZ0 A;  3DLE B;  3C6T A;  2KZM A;  1YGY A;  5LJ5 Y;  1RI7 A;  1K1S A;  2HFO A;  1WF2 A;  1RHQ B;  4CNZ A;  2UXC F;  4M5D A;  2U1A A;  1KQK A;  3HPO A;  3R7N B;  2P9C A;  3S1R K;  3FKI C;  4NXM J;  1OS5 A;  2H65 B;  5E3C A;  3HKZ L;  1MN9 A;  3MPV A;  2CVE A;  1UZH A;  4DUY F;  1S9F A;  4W98 A;  2G13 A;  1WAC A;  4AL5 A;  4Q8F A;  3GTO K;  2IAJ B;  1RWU A;  2XWX A;  3HHL B;  4YQW A;  3RZD C;  2WOM B;  1FK9 A;  4IQX A;  3S1M K;  2F40 A;  4WJ4 A;  1IQZ A;  1PBA A;  3PV8 A;  4HYK A;  3LAN A;  4B9N A;  3BR8 A;  2JA5 C;  5I42 A;  2AEM A;  4E8U A;  4BWM A;  2DNM A;  4XDD A;  1VQM S;  2C3P A;  2E9R X;  2CQC A;  5D8H B;  1PG5 B;  1X5T A;  3US5 A;  1YDL A;  4GO7 X;  4G0U A;  4YY3 F;  1UTA A;  4A3K K;  4TQS A;  3ZZO A;  2YNG A;  3C14 A;  2M8D B;  4DR5 J;  2DH9 A;  1S6P A;  3N28 A;  3QAT A;  5KTQ A;  2IIH A;  1S1V A;  4LJZ A;  1TWC K;  1SUQ A;  1I50 A;  5IM0 A;  2FZG B;  4C4W A;  4HHH A;  3THP A;  2YNI A;  3NCQ A;  4X4R A;  1J6X A;  2MKS A;  3H90 A;  5KG1 A;  4DCJ B;  1RZM A;  1PIE A;  4RWW A;  2BJ1 A;  4NMX A;  2IA6 A;  4FZV A;  2VDH A;  3CME S;  1HBM A;  3BRE A;  3FCH A;  2HQC A;  5F9L A;  1DFD A;  2QA1 A;  3HVR A;  2R9L A;  2DYA A;  3TVZ A;  1M90 T;  4PG4 A;  1OY9 A;  2GIF A;  2QMU B;  2KM8 C;  1JQG A;  1XEZ A;  1H7X A;  2YU9 K;  1YVF A;  2ZBQ A;  4FDF A;  4C8L A;  4ETZ A;  4EWT A;  3MM7 A;  1VQL S;  1LXN A;  4FPI A;  4DSL A;  2OP5 A;  4ZK7 M;  1B0P A;  2YQ1 A;  4Y7N C;  4NA1 A;  4I7F A;  5CHC B;  2W8K A;  3KJV B;  1HAR A;  4HH1 A;  1U8W A;  4WE1 A;  4KAW X;  1JXV A;  1U48 A;  5GAE I;  1URN A;  4DS4 A;  3HHK A;  1CJT B;  3C3L A;  4V19 J;  5GAD I;  4B9T A;  2DGO A;  4IH6 A;  1M5K C;  5HRO A;  2HZC A;  4RKU C;  1S7I A;  1SJ3 P;  4B08 A;  4MTP A;  1XZP A;  1R9T A;  4J7C A;  2HHW A;  3CQZ A;  1BWE A;  2MHN A;  2AGQ A;  1TWF C;  3Q8V A;  3DLE A;  4PPZ A;  1M1G A;  1X5O A;  3UI3 A;  4TNO A;  1NSP A;  3T6J A;  1RU2 A;  4OYX A;  5CZV A;  4CI0 B;  3T1H J;  1KP6 A;  5IC4 B;  2RJZ A;  4I6Y A;  3UCU P;  2HRY A;  3EGW B;  1NDP A;  1RK8 A;  2ZKU A;  5KG2 A;  2Y3P A;  4DX7 A;  2KFY A;  1F9N A;  2YTC A;  2EKN A;  4RO0 A;  3AXM A;  2WRM A;  4BLA A;  1X9M A;  4GFQ A;  3OR2 B;  2Y1L B;  4NZ7 A;  2OTJ S;  2OSR A;  1OYE A;  3S1N K;  4C8M A;  3GTG K;  3MZI A;  2BAN B;  2P5V A;  1QUP A;  2ASJ A;  2BW7 A;  4C3M A;  4Z2X A;  1R8C A;  1TWA K;  4URS A;  3O3L A;  2FVP A;  4A8W A;  4UY8 5;  5A8K B;  4A3L C;  1RTZ A;  3CO9 A;  1OSD A;  4PEO A;  5EWE A;  3AD8 C;  1TK8 A;  2RT3 A;  4FF4 A;  2KU7 A;  4OI3 A;  2V4Q A;  1ZXO A;  4EFA C;  4M5H A;  2OD4 A;  2XYP B;  4L3N A;  4YFK A;  4KMH A;  4ZPA A;  4UTG A;  4W4M A;  4WP3 A;  4DDF A;  1WC4 A;  2HHV A;  3D6M B;  1Q79 A;  2CA9 A;  1RAI B;  4A3G C;  4DBQ A;  1XN9 A;  1IVZ A;  4YB1 P;  3S2D K;  4TU7 A;  2HEK A;  4U8Y A;  2RIJ A;  3W2V A;  3TW0 A;  3I0R A;  1XMQ J;  4LRA A;  4XIU A;  3SMZ A;  3CPW R;  2Y1J A;  5AT1 B;  3T00 A;  2XBP A;  1G1X A;  2W2Q P;  5CD4 H;  4ED4 A;  2B43 A;  3CCE S;  1VS3 A;  3QT5 A;  1KS2 A;  4OYW A;  4UOC A;  4OZN A;  3NMA A;  3ZZU A;  1O0P A;  3J81 j;  4BWJ A;  2RNE A;  2KYZ A;  4DR4 F;  4C0H A;  4M5G A;  5A2Q Y;  3DCA A;  4I2P B;  3SSQ A;  1HPZ B;  3TX0 A;  2MDA A;  3K57 A;  1SIZ A;  2JH3 A;  3E01 B;  3KJV A;  1YJ9 S;  3FKI K;  3ZNJ 1;  4ES2 A;  1VJQ A;  3SV4 A;  4L75 A;  3JYT B;  3BSC A;  4BXX C;  3F56 A;  3LA0 A;  5E7O B;  1CJT A;  2CQI A;  3VAL A;  1WDD A;  3RZD K;  1Q95 G;  4N77 A;  1YG0 A;  4CLY A;  3MM8 A;  3VAJ A;  1YX2 A;  5L1L A;  4WXO A;  2D9P A;  3OQ2 A;  2X7I A;  2VIH A;  3FHZ A;  5T7L B;  1S1U B;  3VZI A;  2JA5 K;  1QVG R;  3JSY A;  5H9E K;  2FHJ D;  2HGM A;  5EX0 A;  1H38 A;  4LF7 J;  5E33 A;  2XO6 A;  2FPH X;  2CNL B;  1PSD A;  3VQS A;  4ZP8 A;  1XNR J;  2EWH A;  4NOH A;  2G1H A;  2HNZ B;  2V6A A;  3M6W A;  4ZVR B;  1BJT A;  4YHH F;  1NKE A;  5EGE A;  3MM5 B;  4ILR A;  2R3V A;  2LYV A;  1QSS A;  4KHM A;  3W1Y C;  3HFZ B;  4LF5 J;  2RQK A;  3BP3 A;  3SXL A;  4A8M P;  4C3K A;  2XC9 A;  1S1T B;  2BV3 A;  3OR2 A;  1FER A;  1F2G A;  3LOU A;  3E51 A;  2HRT A;  1CSJ A;  1GXL A;  3P49 B;  3WX4 A;  1YBU A;  3GZ7 A;  2ACY A;  4N5S A;  4H4K A;  3VCD A;  5F8M A;  4OIX A;  2R8H A;  1TP7 A;  4DQP A;  2ZOG A;  4RNM A;  5CZX A;  1YJV A;  2BAN A;  1JJ2 R;  1WDT A;  3R5J B;  3BR9 A;  3H98 A;  2UUC J;  4P7T A;  1WC3 A;  5A8K A;  1IR0 A;  1V6H A;  2IRX A;  1DHM A;  3M6U A;  3MR7 A;  1B4A A;  2KRR A;  2HYI B;  3H2V E;  2PMZ D;  2HHX A;  2PPB A;  1FJC A;  1RTH B;  1RWX B;  4PUO B;  3GTK A;  3CMQ A;  3BBF A;  1IS1 A;  4R25 A;  1RB0 A;  2J0X A;  1LFW A;  4EBD A;  2IPO B;  2FQO A;  3D1H A;  2DNO A;  4I0W A;  3EVM A;  5F8G A;  3W5Z A;  2QRR A;  4OLO A;  2ROE A;  4C11 B;  4Y7N K;  2ASD A;  1K47 A;  5CAA A;  3GWC A;  1EI6 A;  1U0H B;  4IOB A;  5KFR A;  3R2D J;  2RH3 A;  1YNN A;  1FDB A;  2LP4 A;  2KVI A;  4ZVE A;  3DKD A;  4OX8 A;  2VDI A;  2E5L J;  1I3O B;  4YME A;  3RAQ A;  1UW4 A;  2V69 A;  1N0V C;  4DWI A;  3JQK A;  1TWF K;  1FWL A;  4I2P A;  1HHQ A;  4HHU A;  3SCK E;  1HPZ A;  3UD4 P;  1C2P A;  1PAE X;  4WPA A;  3E01 A;  2WBR A;  3QNW B;  4MIB A;  3P96 A;  2IM3 A;  4GVB B;  3DLB A;  3NKY A;  2MQO A;  2R2S A;  3JYT A;  2MQL A;  3EGN A;  2H3E B;  4CO1 A;  4KAS A;  1NH7 A;  1X4A A;  1DY3 A;  3M8P B;  2V94 A;  3G6X A;  2DHS A;  5A8W B;  2E5H A;  3W9J A;  1NK9 A;  4YFX A;  1QUV A;  2BZ2 A;  2VQE F;  2JA6 A;  4RR5 A;  3X3U A;  3X1L B;  5T7L A;  1S1U A;  2RSQ A;  4RZR A;  5KT3 A;  1TL1 A;  1TKZ B;  4QR1 A;  2GO9 A;  2Q1L A;  3BUE A;  4ZHR B;  5DGA A;  2IJN A;  3PW2 A;  2QTW A;  3R97 A;  1KOO A;  2HNZ A;  2V8P A;  3MM5 A;  1Z2Z A;  2HHQ A;  4RX6 A;  2LQJ A;  5AE3 A;  2NUH A;  3HHD A;  4A3L K;  2RQM A;  3HHL C;  5CD4 A;  2YKM B;  2D3O R;  5KFL A;  4GO5 X;  2EFP A;  5J2M B;  3SZ2 A;  4LR8 A;  1TK0 A;  5H9E J;  1S1T A;  2DH8 A;  4MMO A;  3I5A A;  1ZS6 A;  1X4D A;  4DR7 J;  2XLK A;  4ECQ A;  2CNK B;  4MK8 A;  3RB4 A;  1KD1 T;  4DL7 A;  2XS5 A;  4JI2 F;  4A3G K;  2GJF A;  5E2Q A;  1AXQ A;  1DJ0 A;  3CCQ S;  4G7O A;  2MKJ A;  1JLA B;  1U1O A;  2CPE A;  2KB2 A;  3SV3 A;  5DG7 A;  4J91 A;  4U96 A;  1SQE A;  4WFZ A;  3AA8 A;  3MFI A;  2GMH A;  2PO4 A;  4KAI A;  1TV6 A;  1N5S A;  4DR2 J;  5F8L A;  1VI7 A;  3AJ2 A;  2XCP A;  4I2Q B;  3QAE A;  2WBM A;  1RTH A;  5B09 A;  4MKB A;  5LM7 E;  1R3N A;  4PUO A;  5IWA F;  3IRX B;  3WDO A;  4LJM A;  1PGZ A;  4MT1 A;  2NVX A;  3AY0 A;  3T02 A;  3ILI A;  2FHK A;  4WIQ A;  4C11 A;  2NYI A;  2R92 A;  1S5Z A;  2ALZ A;  3G6V A;  4A8X A;  3QFH A;  5ETP A;  1U0H A;  1REV B;  3OL8 A;  2P8I A;  1VQ7 S;  8RUC A;  4BXX K;  1EET B;  2NXC A;  4ZCM A;  2MQQ A;  3OV7 A;  2HPU A;  3HXA A;  1HNZ F;  2RD5 C;  3KYL A;  3AJD A;  1X0F A;  3H2U B;  1AW0 A;  2F9D A;  1NPP A;  3NRB A;  5IQ6 A;  2F8H A;  3CCU S;  1O28 A;  1RWV B;  1DBD A;  3DLK A;  4CLT A;  2H1Y A;  1VYA A;  4EO6 A;  2VFV A;  3MML B;  2NR0 A;  3BKT A;  2LU2 A;  2HIY A;  5JVO A;  4FBU A;  1TTH B;  2FQQ B;  3J81 U;  7FDR A;  2BQ3 A;  1Q1K A;  1Q8B A;  2ZVS A;  4GVB A;  2GHV C;  3GV8 B;  1B64 A;  4KHR A;  3GV7 B;  2R2U A;  4JK1 A;  3KDO A;  4TU8 A;  4DV3 F;  4ZIV A;  3UN2 A;  3M8P A;  1IL2 A;  3G9C A;  5EGY A;  4OHW A;  1H3D A;  3J7Z 5;  3CJT A;  5A8W A;  2COL A;  2UXD J;  2V6T A;  1PYS B;  2BE7 D;  2OPP B;  1NSA A;  4KBI A;  2MLX A;  4HHJ A;  4PXD A;  2ZH1 A;  1XK8 A;  2RDD A;  3DOL B;  4NYZ A;  4ZHR A;  2M0G B;  3W5X A;  5CCM A;  1K0T A;  4DV7 J;  3WX8 A;  3TYT A;  1NPK A;  1H6K X;  1VRT B;  2K8G A;  5IC6 B;  4B3R F;  4DV0 J;  3TNV A;  5GME A;  4K2J A;  2YKM A;  2HZA A;  3KMS A;  3GJR B;  4AXI A;  3ZFV A;  3A3P B;  5J2M A;  3T1A A;  1T0T V;  2HFV A;  3FNN A;  2ZHB A;  4G7H A;  1FRI A;  2D3O 1;  4X4O A;  4UY8 T;  2XO7 A;  4FXW A;  4R0J A;  4KPY A;  1O8B A;  3GTM A;  4A3C C;  3AA9 A;  4QZV B;  4A8O A;  3G8Q A;  4BC7 A;  3GCX P;  4L74 A;  4B9L A;  1GNK A;  1ARO P;  3ZZR A;  3BO4 A;  1VK3 A;  1T9T A;  4DV6 F;  3PRV A;  3CJS A;  1G2E A;  2OPQ B;  5F41 A;  4ECZ A;  1KKH A;  2HMI B;  1KQG B;  4X84 A;  4IO1 A;  6AT1 B;  4CTA B;  2KL8 A;  1U47 A;  2QZ8 A;  3DLL Q;  4ELV A;  4RW8 A;  4I2Q A;  5GAG U;  5A76 A;  1S12 A;  2C3M A;  1T9X A;  3IRX A;  3GTK C;  1F9F A;  5KFC A;  4OHV A;  5LMU J;  3BPS P;  3MEK A;  2BOP A;  4A48 A;  2ZOF A;  1KQS R;  2FUG 9;  5H1S V;  3SEO A;  3ZZP A;  2CJY B;  2LQB A;  1QSL A;  3T5J A;  2F63 A;  1BY9 A;  1REV A;  2BQR A;  1FFS B;  3PYG A;  4PAB A;  3IM8 A;  4USI A;  4XSZ A;  4UZC A;  5DDR C;  2KXF A;  4LSZ B;  1U24 A;  3R6L B;  1EET A;  4B3S J;  1NJX A;  3HDS A;  1ZZF A;  1X9S A;  1NRK A;  3M8Y A;  4NLP A;  1S76 D;  4NE9 C;  4Y00 A;  2DVI A;  1U09 A;  1QSY A;  1HI8 A;  2DGQ A;  4RU2 A;  1VR6 A;  1JNR B;  2CJA A;  1CG2 A;  2GSN A;  3G4A A;  1HR0 J;  2G9O A;  3C46 A;  2QLW A;  3TRG A;  3LAP A;  2ZD1 B;  2OEK A;  3M9N B;  2AYG A;  3KTQ A;  1VBY A;  4Q7A A;  3I0S B;  4K4T A;  2AW0 A;  3KOA A;  4QIG A;  4C6A A;  3TUI C;  2OHD A;  1FHT A;  3CCZ A;  2HS4 A;  5B08 A;  2RE1 A;  4GTD A;  4F04 B;  4RBV A;  2RUS A;  1YNJ A;  5C25 B;  1GXT A;  3J81 Y;  2WAQ D;  1U2R A;  2CQP A;  4AL7 A;  1R0B G;  2AU0 A;  1FES A;  3KK2 B;  2FJW A;  2XCO A;  1GK8 A;  1KQF B;  2OPP A;  2JA6 C;  4H4M B;  2EPI A;  2K2P A;  2AZ3 A;  4JV5 F;  2DNP A;  1REG X;  3S15 C;  1RIS A;  3DOL A;  1KRP A;  3T41 A;  2O66 A;  2ZDP A;  2EK6 A;  3M2R A;  2GV1 A;  3VF0 B;  1X8D A;  2CPI A;  3GTL C;  1OSC A;  2YKP A;  2RU9 A;  1VRT A;  4DLE A;  2VHG A;  4U7C A;  3VR1 A;  3NNA A;  5KFJ A;  4WZM A;  1SJ1 A;  4CO2 A;  2RQC A;  4CO5 A;  1B7F A;  1U7L A;  4LFA J;  3BJY A;  3RG6 A;  4QR2 A;  4I64 A;  3V6H A;  2XI2 A;  4KHP F;  3H7H B;  4ZVS B;  4IOC Q;  5M2R A;  1RGV A;  4A8Q A;  3O44 A;  2FJX A;  3IRW P;  5BYR A;  4K7Q A;  4Y3C A;  5G0R B;  3EZO A;  1RT5 B;  4F02 A;  3CD0 A;  4NX9 A;  4CWB A;  2JC0 A;  2DHG A;  3NNH A;  4K4Y A;  1XXB A;  4LF1 A;  1ZBT A;  4M5K A;  3RBX A;  2IM2 A;  3A1Y G;  1WQF A;  2OPQ A;  2HMI A;  1PYT A;  4CLW A;  5TMF A;  4F4Z A;  2DO0 A;  3CJ5 A;  4CTA A;  4WKR A;  1NO8 A;  3Q23 A;  4ED3 A;  1JJC B;  1HNX F;  5LMN J;  3ETO A;  1UET A;  1V3S A;  1JIH A;  1M5P C;  2Y1R I;  2QYG A;  4A8K A;  1RBO B;  1N6Q A;  1AB8 A;  1BMQ B;  4A3E C;  4JUZ A;  4F67 A;  4YG2 A;  3W65 A;  1F7V A;  1VQ8 S;  1C0U A;  2NVX C;  3GII A;  4MEX A;  3V81 A;  1DTQ B;  4TYA A;  4KB2 A;  2R92 C;  3OVS A;  2HVI A;  3HJV A;  2HKE A;  1DCH A;  1BD6 A;  2DGV A;  1KLN A;  4RUA A;  4PXC A;  5KFX A;  1NM2 A;  2XZD B;  1FFW B;  2KKH A;  2N7Y A;  1BGX T;  4LBP A;  1Q8I A;  4USW A;  5HMX A;  4NLG A;  4FKX A;  4J9S A;  4KMD A;  3R6G B;  4K4Z A;  2RHS B;  4JI7 F;  2EBG A;  1FJG F;  4H4O B;  3IO1 A;  2N4D A;  4WF9 Q;  5EUH A;  1IBL F;  1U25 A;  1Y1W A;  5L1I A;  1Z4U A;  2ILZ A;  1K83 A;  5CYM B;  1MML A;  4YR2 A;  3N6L A;  2ZD1 A;  2B9E A;  2EK1 A;  3W61 A;  3H0P A;  5C4J C;  2JEG A;  3M9M B;  1ZET A;  4BY1 C;  1HWL A;  5HMZ A;  3MMB B;  1N34 F;  4KV8 B;  3CDA A;  1ZM4 A;  1VRU B;  4XAK A;  2MPU A;  4OX7 A;  2J0S D;  4DV4 J;  1QVF R;  1O5J A;  5C25 A;  1TR0 A;  5J1N A;  2GCF A;  1RTI B;  5D4L A;  1SJF A;  3KK2 A;  3BM7 A;  2DR9 A;  2E29 A;  4YOE A;  2MQN A;  2E2J C;  3B54 A;  4H4M A;  4KYZ A;  3ZTR A;  2CQD A;  1S7H A;  3I31 A;  1I3Q A;  4A3C K;  3LQV A;  3M05 A;  3KK1 B;  3GB0 A;  1VC5 A;  4AYB L;  2CJX B;  1FI4 A;  1UVL A;  3HP6 A;  1HHT P;  4FYY B;  1XNQ F;  1ZBS A;  2KTQ A;  2C28 A;  5HAT A;  2F4V F;  4CT8 A;  3DXS X;  4TVA B;  5B0B A;  3PX6 A;  1GH8 A;  1TAU A;  1GX5 A;  3FK4 A;  1WOO A;  2YWW A;  3GR1 A;  2VON A;  1WG4 A;  3RJM B;  1OJ4 A;  4OZ3 A;  4LQ9 A;  1S9G A;  2Y0S L;  1UMJ A;  3EYZ A;  4URQ U;  4UST A;  5DG9 A;  3HVT B;  2EG2 A;  1GMV A;  3GTK K;  4ECY A;  2KYX A;  1PBU A;  2JEF A;  3GTM C;  5G0R A;  3T3F A;  1RT5 A;  2C2M B;  2VQF J;  4GC7 A;  1M5S A;  2ZBC A;  3HXM A;  3UW1 A;  2F4F A;  4ZVP B;  4YUD A;  2VKZ G;  1WC5 A;  1RT2 B;  3TTG A;  5J2Q B;  3SZZ A;  1GXU A;  1I6H C;  3M6V A;  4O3N A;  2E2I A;  3HO1 A;  3G82 B;  5JXS A;  1SI9 A;  2K7K A;  4NEZ A;  4IRK A;  4ZPB A;  4DV5 J;  2R7Z A;  2BJ3 A;  4OX9 J;  5IOR A;  2DR7 A;  1DTQ A;  2DNY A;  2JRS A;  4IH7 A;  4Q43 A;  2XI3 A;  2DO4 A;  5ETN A;  2ZWO A;  1L0W A;  4M94 A;  2DY9 A;  3S01 A;  2RGR A;  1U2F A;  1ZM9 A;  4KGX B;  5C24 B;  2Z2Y B;  5D4N A;  4W92 B;  3MMA B;  1SV5 A;  1S57 A;  3EXY A;  3LGH A;  3MPU B;  2UXC J;  1RBA A;  5GAE U;  2VG6 B;  5E3P A;  2KH9 A;  3KLH A;  4H4O A;  3R27 A;  4DSI A;  2MZJ A;  2IRU A;  4DUY J;  2GX8 A;  1NH8 A;  2JA6 K;  1BGW A;  4FBT A;  4FM9 A;  2FD2 A;  3JSB A;  4WII A;  1OO0 B;  1HMV B;  1R0A B;  4MIW A;  3L7U A;  3S15 K;  5D77 A;  4JYA J;  2CWK A;  4DR1 J;  3D3C J;  2QLX A;  4P75 A;  3GTL K;  2HWI A;  3KFW X;  4GKJ J;  1XXA A;  1N0U A;  3MMB A;  1TVR B;  1F2H A;  2IA0 A;  3PJX A;  4KY3 A;  3UDE A;  4C3L A;  4AD6 A;  3A8K A;  2DRB A;  1VMB A;  2HS3 A;  2K1R B;  1KHV A;  3RRH A;  2XY7 A;  3QGP A;  2ZM6 F;  3TAN A;  1F5B A;  1LFP A;  3DHW C;  1WJ9 A;  4BBS C;  3KXD A;  1F6T A;  4CH7 A;  4YS2 A;  3OL9 A;  2RKI B;  3OHA A;  1TFY A;  4NCG B;  4Y2I A;  4X64 F;  4J5O A;  2J9D A;  1IQT A;  2VUG A;  2RS2 A;  3RB6 A;  2E9T A;  1J5E F;  1FDD A;  5LSL A;  4ALZ A;  1YWX A;  4ED8 A;  1P9Y A;  3T5L A;  5EX3 A;  3PFO A;  4DV2 J;  2Q66 A;  1NPR A;  3NEK A;  3PY8 A;  1CQN A;  2P8T A;  3M32 B;  4H54 A;  2I5J B;  2AYE A;  5L46 A;  4CH0 S;  1P1T A;  4WK1 A;  5ADZ A;  2J5A A;  4AUK A;  1S6O A;  3GG1 A;  2NXJ A;  2FVQ A;  2FYX A;  4NLX A;  4EZ9 A;  3UN3 A;  2V6U A;  3HVT A;  2D3U A;  4HI2 A;  4A3E K;  2LCW A;  2UUA F;  1GEH A;  3CIZ A;  2CRL A;  4E0D A;  3JTP A;  2NVX K;  3NOC A;  5DGB A;  4X4P A;  3K8V A;  2V68 A;  3OFG A;  4ZJO A;  2R92 K;  2AGO A;  2BW2 A;  1VQY A;  2QL9 B;  1WSR A;  1IQ0 A;  4NL5 A;  1RT2 A;  3T9Z A;  4WFY A;  5J2Q A;  2A69 A;  3SQG B;  1SC4 B;  4DCO B;  4ZJQ A;  5DET A;  2PMW A;  3I87 A;  4JV1 A;  1N36 J;  3FOE A;  2R93 A;  5FJ4 A;  3G82 A;  5AJ3 J;  3MTJ A;  2A68 A;  4B9V A;  1ZA2 B;  3IG1 B;  4CO4 A;  3DRX A;  2ZJP Q;  2BOA A;  3GSD A;  1WOP A;  2EW9 A;  3AOB A;  2Z2Z A;  3D2W A;  3G86 A;  2IJR A;  3D4J A;  3HZE A;  3BO3 A;  2QT7 A;  4KO0 B;  2CJQ A;  4YDX A;  2UUB F;  1L3T A;  4YDD B;  5C4J K;  1Q4R A;  5TMC A;  3Q8Q B;  1YK9 A;  5FJ8 K;  1VDH A;  3D6F B;  4BY1 K;  3H4B A;  3CVK A;  4LRC A;  4CT9 A;  5C24 A;  1RT6 B;  3DRP B;  4J9M A;  1LEO A;  2RAQ A;  3MMA A;  4ZIT A;  1N33 F;  2APO A;  3LTO A;  4URG A;  4JI0 F;  2V0N A;  1IKY B;  2VG6 A;  3CJK B;  2BM1 A;  3FMB A;  1NHU A;  2YQ0 A;  3RR7 A;  1NND A;  1Y1W C;  1JMT A;  3M8Q A;  1IWA A;  2E2J K;  2J0W A;  2VPZ B;  1HMV A;  1CJV B;  5JVG Q;  1YIJ S;  1K83 C;  3UD5 A;  1BLU A;  4DZ6 A;  1U6F A;  4UQG A;  1ITP A;  1TU0 B;  3ZTQ A;  4A3F C;  1TVR A;  1NHK L;  3MR2 A;  4DPY A;  1GAO A;  4ILD A;  4OYM A;  1I6J A;  1HNW F;  3LGM A;  3U7J A;  3FMW A;  3Q8U A;  2H5E A;  2K06 A;  3PXG a;  1IM6 A;  5FLM C;  3F0N A;  3A3N B;  2OGU A;  1RAF B;  4U8V A;  4C8K A;  4N47 A;  2EBE A;  2HQF A;  3PR5 B;  2A2D A;  1FDA A;  1U1K A;  2XNQ A;  3ISN C;  3HJF A;  1TWC A;  2GAH C;  1CLF A;  3S6E A;  4NOI A;  3GTM K;  1MW7 A;  4TLQ A;  1VK8 A;  1LQ9 A;  3CE8 A;  2LKZ A;  2G2O A;  4ES3 A;  1YKW A;  3DGP B;  4WK3 A;  4IG0 B;  1YRX A;  3M32 A;  2YKO A;  2I5J A;  4NA2 A;  4CCH A;  2LEA A;  2AV5 A;  2AF6 A;  3R7B B;  1EFW A;  1I6H K;  4P74 A;  3I9V 9;  2E1P A;  2R8I A;  4Y2C A;  3JSM B;  2LMI A;  2IBO A;  3JSR A;  2G2Z A;  3WHI A;  5KFA A;  2BJ8 A;  3R5D A;  2DCL A;  3PJW A;  3C6U A;  3CO0 P;  4ICL A;  5JVH Q;  2XMJ A;  1RAD B;  1HD1 A;  3CJ4 A;  2HVE A;  3DOM B;  1X4C A;  2B7B B;  4KR0 B;  3ZTS A;  1B0T A;  2MMY A;  2OUG A;  3T5K A;  4YR3 A;  3NS7 B;  3C19 A;  3R1L A;  1M5V C;  4KFB B;  4DLG A;  2V8H A;  4LBI A;  9ATC B;  1UVK A;  3GTP A;  1TEL A;  1QAY A;  2Z2M A;  4NYP A;  3IGN A;  2PEH A;  1E6V B;  4KQZ A;  2YQ3 A;  2DIV A;  1QE1 B;  3OXG A;  2BAC A;  1H2V Z;  1DAX A;  3IG1 A;  3L7O A;  2YX4 A;  1HNV B;  4JI1 F;  3D7S B;  2ADB A;  3LW5 C;  2KT2 A;  4DPO A;  4KO0 A;  2E1A A;  4EBE A;  1FEE A;  4OHZ A;  3FQK A;  4DU8 A;  2DKO B;  3DLG B;  3UE2 A;  1VJE A;  4RU9 A;  2ZZM A;  2IM0 A;  1QAI A;  4CYU B;  3QO9 B;  5KG5 A;  1B7Y B;  1RT6 A;  3DRP A;  4DZD A;  2VUM A;  3QYY A;  2QL5 B;  2DHA A;  3CDU A;  1IKY A;  1KN6 A;  1FNX H;  2WW8 A;  3CJK A;  3ISZ A;  2E7W A;  1WC6 A;  4LLG A;  1YJW S;  1CJV A;  3LP2 B;  4BBS K;  4LFB J;  3H0G A;  3E8O A;  1NK7 A;  3BN7 A;  1TWH C;  4DSF A;  3MD1 A;  4AQY F;  2CW0 A;  2VL1 A;  2DHH A;  4NEY A;  3AD9 C;  4PZV A;  3S14 C;  4P2M A;  1YLX A;  4TQR A;  2BKP A;  2V8V A;  4PAA A;  1RP5 A;  1KON A;  1D1U A;  3IBF B;  1IJF B;  5KT6 A;  2AYB A;  3D0I E;  3R5B A;  1N56 A;  3KLG A;  3IPJ A;  3KLF B;  3HT3 A;  4NPO A;  3T5H A;  2OH2 A;  4ANC A;  5M3M K;  1R6V A;  1NUE A;  1SVD A;  3DMJ B;  2FJA B;  3WOD A;  3MCN A;  4XPC A;  4DR3 J;  4ATN A;  4ECS A;  4TY9 A;  2DGT A;  3H40 A;  1FWP A;  3KG0 A;  3PM9 A;  3E3X A;  3OFF A;  3DGP A;  2HWH A;  5IYD C;  4IG0 A;  2CUY A;  2FTR A;  1OPZ A;  2ZHO A;  1ICE B;  1XC9 A;  1S77 D;  5CQG A;  1HQU B;  2PHC B;  1FEH A;  4OJH A;  1J6W A;  3W63 A;  3ENQ A;  4NXM F;  3OLB A;  3JSM A;  4ZLJ A;  1J5O B;  1WI6 A;  3N6M A;  3PYD A;  1L3K A;  3PEH A;  2ALY B;  2YVS A;  1INN A;  2HBY B;  4IO9 Q;  2AJ0 A;  5HQM A;  3DOM A;  3GEE A;  3CF5 Q;  4L76 A;  1JVI A;  2ROP A;  2AX0 A;  3HVW A;  5GVQ A;  1V9O A;  5CAB A;  1X9W A;  2QA2 A;  4WTY A;  2Y0S D;  3FBC A;  1GFW B;  2C3O A;  2GVD B;  4EYI B;  3FKI A;  4KFB A;  3T01 A;  2O3D A;  3PIP Q;  5GMD A;  1ZOT A;  3D6T B;  4G6V B;  4ZCI A;  3W7B A;  5K8O A;  4LRE A;  1A7G E;  2R93 C;  4FNH A;  4PCQ A;  1E6V A;  4F8R A;  2VBZ A;  1QE1 A;  3Q8R B;  2HNY B;  4GZY A;  1XWL A;  1TK5 A;  2HWT A;  3UD3 P;  2AEJ A;  1Y1W K;  1HNV A;  2Q6C A;  2HUR A;  4BDP A;  3CCW A;  1K83 K;  2JA5 A;  1ZVU A;  2ZFZ A;  4MKA A;  4NLS A;  1BQX A;  3D68 A;  2AEF A;  2JHE A;  4DR5 F;  3GG0 A;  1KOH A;  3QT7 A;  4A3F K;  3WZ0 A;  2VQE J;  3DN9 A;  1XR7 A;  4O4R A;  3DLG A;  3PHT A;  4FXD A;  4IFV B;  4B3O B;  4CYU A;  3QO9 A;  2F8E X;  3TWZ A;  1RKI A;  4J9N A;  2XWY A;  1GE9 A;  1HNI B;  5B0E A;  1FD2 A;  3MXH P;  5CCL A;  2OPR A;  5FLM K;  3BGR B;  1VJW A;  1WEY A;  4HAC B;  2MGZ B;  1T9V A;  1HI0 P;  4FVM A;  3QSI A;  2A3J A;  2ZHA A;  3LAJ A;  2VPY B;  3LP2 A;  2HVZ A;  3GFX A;  4C7Q A;  3PR4 A;  4X62 F;  2B4P A;  2XY5 A;  4XLP A;  3FVY A;  1FDN A;  3M30 B;  3HFV A;  2OEJ A;  4DMZ A;  4WFX A;  1VBK A;  1RAJ A;  4ZN3 A;  3N9U C;  2HLU A;  1JLQ A;  2J7U A;  3KLE B;  2J7K A;  2M88 A;  3AOC A;  3M8Z A;  2KJV A;  4C8O A;  1D3W A;  1JXE A;  2WVB A;  5C2C A;  3KLF A;  3FBE A;  2N3O A;  2DGS A;  4QYR A;  4QIF A;  2DT9 A;  3MI7 X;  1CUL A;  3M1V B;  1DRZ A;  3QGI A;  4TLR A;  4Y52 C;  1U6B A;  3DMJ A;  3UO0 A;  3Q22 A;  2A0F B;  4J9O A;  2B5J B;  1N4L A;  3R7S B;  2CAD A;  4NRU A;  4N8N A;  2CQ0 A;  3BQ0 A; 
#chains in the Genus database with same CATH homology
 3TTG A;  3ADA C;  1XZQ B;  3TFI A;  5L46 A;  4PAB A;  1XZP B;  1WSR A;  1WOR A;  3AD9 C;  1YX2 A;  3TFJ A;  1PJ6 A;  1X31 C;  1WOS A;  3GSI A;  1V5V A;  3GEH A;  1VRQ C;  1WSV A;  3A8I A;  3GIR A;  1XZQ A;  4PAA A;  3A8J A;  2GAH C;  1PJ7 A;  2GAG C;  1XZP A;  3GEE A;  1PJ5 A;  1WOP A;  3GEI A;  1WOO A;  4P9S A;  3A8K A;  3AD7 C;  1VLO A;  3AD8 C;  3TFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...