3ADAC

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with sulfite
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOSINE OXIDASE ALPHA SUBUNIT
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 50
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3adaC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3adaC01
1WOOA 3GEHA 3GEIA 1PJ7A 3GSIA 1V5VA 3AD9C 3TFHA 2GAHC 3TTGA 1XZQB 1PJ6A 3ADAC 1WOPA 1XZPB 1YX2A 3GEEA 3GIRA 1X31C 3AD8C 1WORA 1WSVA 1VLOA 1WSRA 3A8JA 4PAAA 2GAGC 1VRQC 1PJ5A 1XZQA 5L46A 3AD7C 1XZPA 3A8KA 4P9SA 3TFJA 3A8IA 4PABA 3TFIA 1WOSA
chains in the Genus database with same CATH superfamily
2C3UA 3AH6A 3D4JA 5C3EK 2Q43A 3BBBA 2E2IC 3SQGA 2G0CA 2R2UA 3HKZD 1SFOC 4LRBA 2F7VA 3R9LA 2UXDJ 4ILMA 3PO3C 4U7UK 4UQGA 5B0FA 1MN9A 4MQ9A 5I4MA 5LMNF 3ZZYA 1O29A 4KMHA 4Y28C 4GTAA 1KDNA 1RGVA 1YZ7A 1WEZA 3PJ9A 2B9WA 2ZEJA 2E44A 2UZAA 5KFQA 3T1HF 3ILIA 4I67A 1FO1A 4A8XA 1QE1B 2ASJA 2YNFA 1JQGA 3Q2SC 4Q4ZA 1QSLA 2J8SA 1RWMB 1WJ9A 2ZJRQ 2E29A 1FWLA 3J80Y 1FRIA 4IFYB 2CZ9A 1Q78A 3W5XA 3WIVA 3H2UB 3IRXB 1NHVA 4L72B 4CO0A 1NXIA 3M6XA 3HOYK 2CDRB 3ZZ0A 4TQSA 2GGPA 4DV0J 1LFWA 4I69A 4JI5J 1HWLA 3OVAA 2FC9A 3C3LA 1J6VA 5F8MA 3KHLA 4ECXA 5U47A 4HI2A 1QSYA 2MQNA 2M88A 3J7AN 1N5SA 4R0JA 4HTIA 1RU0A 1FESA 2MKJA 3RTVA 1HBOB 1TL1A 3GJSB 2FB0A 4WZMA 2PEBA 1RTJA 3W8GA 2WZ1A 3OFGA 2E9TA 1S76D 4ZLLA 4B3RJ 1IKYA 5KFMA 4OI2A 1HYSA 1F6TA 4WYWA 4JV0A 5D0RA 2ZH1A 1Q8KA 2XC9A 2R7UA 3GTGC 5FJ4A 1UVLA 2Y9HA 2I8EA 4U95A 3MMLB 2ZOGA 2JA7C 2IVFB 2R8IA 4C9DA 3OXFA 3BN7A 4MFBB 1G7CB 4OLPA 4DCJB 1H74A 5G0RB 2BRLA 3G4SS 1X4EA 2Z0GA 2DY1A 3SXLA 2CFXA 1SUQB 2XS2A 4PXCA 1KD1T 4CTAA 2QLFB 4DV3J 3FOFA 5EWEA 4ANEA 4FF1A 2ZH8A 2DH9A 1S79A 1B4AA 2WAQD 4A46A 5DM6Q 2AMCB 4IR1A 1U47A 1G4CA 2YWKA 4QR2A 2AJQA 2KG1A 1QTNB 1CJVB 1KEKA 2E5HA 4M5DA 1HMVB 4DL7A 1U1OA 3MM6A 2DH8A 1UPMB 1N8RT 4RUAA 3I56S 1D9DA 4DQIA 3FHZA 1VH2A 2DNRA 1PAUB 4B9SA 2GSNA 1HNXJ 3P5TL 4DV1F 2UVUA 3D1QA 1BJTA 2NVXC 4N56A 3BR8A 3OR1A 1YWXA 5ETRA 4F0KA 4C8LA 2F4VJ 1T0TV 3DFEA 5LXRA 4YEAA 1P1LA 2KT3A 1RT2A 1SC3B 4QIGA 2RRBA 1X60A 2HURA 4NRTA 3I55S 4A3KK 4OIQA 2ZBRA 1YJRA 2IMOA 2M5YA 2FDNA 1JLBB 2VFSA 1QUPA 1XXBA 5DO2A 3Q8SB 4WBFA 3PIOQ 3TZZA 1FWPA 1M1HA 1Q5VA 1DQ9A 3EQLA 3F73A 5JUMA 3MM8B 5IOSA 4U6PA 5HL7Q 4FYDA 1KP6A 3UE2A 1VC6A 1S1TA 5J2PB 5KOXA 3EGNA 4TY9A 2DT9A 3TWZA 2YNIB 1Y1VC 1UVIA 2DGVA 5E2QA 3Q8PB 1LFPA 3GPAA 2GVZB 3EPGA 2B5JB 5A0YB 4OV1A 3JS9A 1HQMA 4NLQA 2RRAA 2QSFA 3OREA 1T3OA 3OTDA 2RQCA 2NLWA 3EXYA 3VA7A 4F25A 1VLYA 1VGYA 1KFSA 4RNFA 4ZH4A 2OEKA 3T5HA 3W2WB 3U1NA 5KOWA 2BKOA 2OPRA 1CQMA 5L46A 4GFQA 1SFOA 1X5TA 3CO0P 4U67Q 1NAQA 3KJQB 4O3PA 4DX7A 3H0GA 5HL8A 1CJUB 3ZTRA 2HNZA 3I0SB 4CLPA 1HBUB 2UVWA 1NCLA 2WW4A 2KWAA 2VOPA 5CYMB 1JQWA 5K9FA 2DEIA 4DQQA 4OX6A 1Q8BA 2MLZA 4Q45A 2ZJQQ 2XTJP 1DFDA 3MUVP 2HFSA 1QAYA 3PXGa 3CF5Q 1JKHA 5A8KA 3A8KA 4TU8A 2XZDB 3KJFB 3QSYB 5KT7A 4ELVA 3G82B 3M32B 3TP2A 1TL3B 5CH7B 3NGKA 2DNZA 1EETA 1V9OA 5B0BA 2YKMA 3DMJA 2ZM6J 1NDLA 2UV8G 2JSXA 2Z2YB 4RNOA 3KJVB 3EZUA 3DOKA 1KWMA 4ED4A 3ZTOA 3QGPA 2K3KA 2YWFA 2FUG9 3PHEA 1NJIT 3Q8YA 1UL3A 3A3OB 1WWHA 4FXWA 2XMMA 2I0XA 5J2QA 4KGMA 2R7OA 1U45A 4I2QB 1C1BB 4QR0A 3GSIA 1WEXA 4XK8C 3KHGA 1MROB 4JI7J 3PTWA 1K1SA 1R31A 1IR1A 2W1BA 3GIKA 3I4HX 4DSLA 1Q82T 1MWQA 4A93C 1S6OA 2Y0BB 4YHHJ 1KS2A 3GTYX 4HHHA 3NLCA 5DQGA 1WI8A 3G2XA 3OVSA 2FPHX 4DPOA 4MKVA 3TW0A 2FGOA 5CZXA 5DJBA 3RGIA 3I9V9 2EFGA 1RTDA 4OZ0A 2KM8C 1NJXA 1IBMJ 3BGRB 1S6UA 1B4SA 1TU0B 4G0VA 4USKA 2XSJA 1NLKL 3C15B 2ZOFA 1L3TA 4QIVA 1YBAA 2F8EX 3K7RA 3TQ1A 4Z2XA 1UW4A 3OTCA 5IQQA 2IHR1 5JXSA 3RAXA 4ETXA 1J5OB 3AA8A 5L9XA 1WKKA 3LP2A 2W4DA 4HHJA 4DG1B 1B0PA 4XDDA 1YLXA 1P8GA 4PQUB 2IDEA 1IBKF 4LSZB 3CCSS 1SH3A 2H48B 2XB2D 5J2MB 1U1QA 1WDTA 1SQEA 1RP5A 2UV8A 4FP9A 1XNRJ 2DHAA 3DGPB 2E7XA 4WE1A 2QLBB 2AX0A 4QWEA 4RPFA 3H40A 4RUBA 1T05A 4NLYA 3M1VA 1R8CA 3LA0A 3EDRB 3VGUA 4DL6A 3FBFA 3C8YA 5K14A 3KK3A 3THTA 5AJ3J 5EDWA 4LQ9A 3VVUA 1VBYA 5KT4A 5HVFA 2FJBB 1S59A 2AWZA 2D3OR 3CJSA 1X9MA 3KG4A 2G1HA 4BY1C 2YKQA 4DR7J 2MEWA 2CQ1A 3EVMA 2E5IA 4X65J 1MMNA 4KSEB 3RBEA 3PW4A 3NBPA 2W7PA 3I87A 2PMWA 2VFVA 1NH7A 4Q5VA 1XMOJ 3IC1A 3M8ZA 5M5XK 1WORA 4ZDNA 2OPPB 2QEXS 4HL9A 2JA6C 1Y5LB 5BYQA 2FGCA 3S16C 4ES1A 2C3OA 4CI0B 3DXSX 3HOUC 4I4BA 1RQ0A 2IFXA 2AEMA 1YRXA 2VQEF 1H7XA 1FNXH 3M9MB 4Z37A 4ED7A 3ZNUA 3BGOP 4NL5A 2UUAJ 3N3YA 4GZYA 4J3NA 1YSJA 3KLGB 4PPZA 3WX8A 3C14B 3GJQB 1OS5A 3M2RB 5CYJA 3LP0B 4CO1A 3PR5B 1IWAA 3S2HC 3OW2R 3IAS9 5GADI 1FRLA 4K2XA 1X4HA 4J9LA 1JWWA 1DTTA 2K2PA 1C4CA 2YPYA 3QLHA 1LEOA 5M3MK 4OHZA 3J7YU 5CABA 4RW8A 2KVIA 4TNOA 1U24A 3H2LA 1S1VA 2OHDA 1YJ7A 4AL5A 4YG2A 3ZNJ1 1N5TA 1N6QA 2QTWA 2ZZNA 4K7QA 3HHNB 1WKLA 2QV6A 3D6FB 1KQFB 1BQNA 1S1XA 4OHVA 2CADA 5KFIA 2V67A 2N3OA 1JLQA 1Q1KA 2NXUA 2OFHX 3UR3C 4A3IC 4GO7X 4YB5A 3FVYA 2EBGA 5C3EC 2ALYB 1CEZA 4IFVB 4WFXA 1UVMA 2GMHA 1NJWA 1XTZA 1ZA2B 6AT1B 2O01C 5IYCK 3I31A 4LFAJ 4IRCA 4NXNJ 4G1QB 4DL2A 2QJ3A 3DDNA 3ENQA 1X9SA 1I50K 3HDSA 4Y2MA 4F04B 1D9FA 4DX5A 4DV6J 2WB1L 4UOGA 5H9FJ 1VQ9S 2A2DA 5A8WB 1XNQJ 1WC6A 2QA1A 2BJ8A 4K0KF 1NK0A 4ALZA 1QAIA 2J0XA 4LSNB 2VICA 1VCTA 1MMDA 3VAHA 1KTVA 1Y3JA 4J9KA 1TV6A 4LF9F 3I32A 1V5IB 1GFWB 1VK8A 4O3SA 3MR2A 2J0WA 4KHMA 4RW6B 1QAXA 2E66A 4E2FB 2R4FA 5KT5A 3OLBA 2AJ2A 3FBEA 3R5JB 1F7UA 2UVRA 2MKSA 4F3QA 2VBZA 5DRKA 3HOYC 3OTOJ 2W2MP 1HNZJ 1U8WA 3MMBA 4B9MA 1XPPA 3RW7A 2XO6A 4A3FK 3IR7B 1UCNA 1GTEA 2HFVA 3PO2K 2XCRB 3HT0A 3AD9C 2IDLA 1T7PA 2MKIA 1HNIB 2QZ8A 1JJHA 2DNPA 1EHWA 4ZKAA 1O28A 1S7IA 1VQ4S 3CDAA 2AJFE 2OAUA 3CIZA 5FDLB 1VISA 2E2JK 2BW2A 4FZBA 3BREA 1CULA 5IOQA 3ENWA 4C3MA 4DLEA 4K2JA 1HBMB 4B3OB 1CJTA 4M63A 4BDPA 1J2VA 3VGSA 2PHCB 3BPSP 3H5UA 4WWSA 4JI6F 5B0CA 1HI0P 2HFZA 3DRRA 1EQRA 2CVIA 3GCWP 2W4PA 2WOMA 4Y00A 2HLTA 3SSQA 3CCQS 2YNGA 4Y34A 3BP8C 4ECWA 2RDIA 3ZC4A 4B9LA 1XN9A 3MMAA 2PFFB 2POKA 5JJBA 5ITHA 4J37A 2M52A 1KBRA 2Z57B 1B4BA 5HN0A 1ULRA 3LWLA 3OTBA 2M0GB 3MEEB 1KVKA 5HBMA 4HYKA 2H54B 2ZH7A 2M7SA 1TL4A 4O3OA 4M95A 4P5BA 2UUCF 3GIIA 3M7VA 4KARA 4A8WA 3LGHA 3NCQA 2HBRB 1D09B 2CPHA 2ZNYA 3AFGA 2GHWA 1SJQA 1FDBA 3ETMA 1J6WA 5F9LA 4LF4F 2JOQA 5I42B 9ATCB 1SJ1A 2ATCB 4DQPA 1TKTB 1UWBB 2R92C 3V4MA 2JA6A 1QJHA 2JVRA 1J5EJ 1RT5B 5T41A 1FRXA 1RZMA 3W64A 3CUNA 4N77A 2JWNA 2MQQA 4LFCF 3V6DA 1XZPB 5ETKA 3WC0A 1PBAA 2RQ4A 2NPIA 3NNAA 4ZA1A 4A3KC 3GTJK 3CB4A 1R8AA 5EN1A 3A8JA 1C1CB 1U0HB 2HBQB 3KMSA 4B3TF 4EYHB 2WSFC 2LQJA 3M4XA 5KFLA 2VPWB 1VQMS 1VOMA 1UFLA 2XNQA 4RW9A 3W9JA 2W2NP 4QBUA 2AZ3A 1N0UA 1S49A 4OZ1A 3FMWA 3N4WA 1HI8A 3DYAB 4GC7A 2ILYA 2HHWA 2XZTB 4Q2MA 4Y6IA 2DYAA 3FC9A 4WPAA 4ED5A 3TOQA 1U6BA 4DI6A 5BR8J 2GSUA 4P74A 3NAHA 2QL5B 1RA6A 4WIQA 5EX3A 3OD2A 2A6EA 1NM2A 1RCXB 3DRYA 1RHQB 3MCSA 1NHUA 1FD2A 5LSLA 2QA4S 5IT9U 4YR0A 3KK1B 4N5SA 4KM8A 5EUHA 1TKZB 4Q44A 3V5RA 3AODA 3BKFA 1ZS6A 2QLWA 3W66A 1VJWA 1RWWB 3CJRA 2OI2A 1JLAA 1RT7B 3JYTA 4LR2A 3P8BB 1LW2B 2B7BB 5M2PA 1E6VB 4ZVFA 3OHBA 4ZVHA 3CQZA 1HARA 1TWAA 3AA9A 2DGQA 1RT6B 1K1QA 1N34J 2PT0A 3HVWA 1A7GE 3VV2B 2QSWA 1Q81T 4MKAA 3W2VA 4LBPA 2E5GA 2IA6A 2X3DA 1HNVB 1TKXA 1HR0F 1KLMB 1JJ4A 3GTMA 1T9WA 2KT5A 3PX4A 1ZAVA 3GZ7A 3O1LA 1YX2A 4B9TA 3N9UC 2UUBJ 1WEYA 3K5NA 3AH5A 4LR9A 3MPYA 4K4VA 4IH6A 4LK1A 3A13A 3V6KA 2GIRA 3H5YA 4DFJA 4BBSK 4JOUA 4X4OA 3C16A 1FWKA 5KG5A 1NZ8A 2NS1B 1T03B 1IL2A 5CYQB 4ELUA 1J98A 1MU2B 3IWLA 2GGPB 3T3FA 4OZ2A 2DIUA 6FDRA 4ZJOA 3LGMA 2DGWA 4Y2KA 2PA8L 2HK2A 5KAKA 2M9KA 1P9YA 3UVJB 1YK9A 1YVFA 2LU1A 2FJWA 1EFWA 3HFVA 2MMYA 1VQSA 4B9UA 1OY8A 2YKPA 3GCXP 3C66A 4A8FA 1WD6A 3QWPA 2ZHOA 4RLEA 2ADCA 2DGTA 1I6HK 1O2AA 5IT9Y 4RKUC 1TL1B 1IBKJ 1KRPA 1NUEA 2VU5A 2R8GA 1URRA 4DV5J 1FE0A 3ZZTA 3TR5A 4JI0F 1SL2A 3HHLB 4M5LA 4WP3A 3GTPA 2UXBF 2XI2A 3GIRA 5IYDK 1HWKA 1LNQA 3MM5A 2KTQA 1CQNA 4LF7J 3OL6A 1RWNB 3FCHA 4FM9A 2WCXA 4OJGA 1K44A 3CDUA 3K5MA 4U7CA 2EFVA 4CH1A 1VIOA 3PYEA 2R92A 3LGNA 2GV1A 3P45B 2XMTA 3IWXA 2XYHB 1EQMA 4CTAB 1FJGJ 1FRHA 4Y2CA 1FX2A 4DU7A 1C0UB 3IGVA 3T1YJ 4F4ZA 3GFZA 1VBXA 3OL7A 4QPTA 1WG5A 2FQOA 1Y1WA 4YR3A 3FK4A 1KVIA 3MM6B 5KFXA 2F40A 2D69A 3QO9B 3SFUA 4ANDA 2CPDA 3D5MA 3MAHA 2QL9B 4HT7A 4N41A 3Q23A 4DR4F 3GTOK 1EP4B 1GEHA 5E3QA 1T11A 5DQHA 1FT8A 2C2ZB 3CCZA 3OR1B 1HHQA 4CZCA 3NS7B 1WHWA 4M5HA 2UXCF 3HVTA 1IJEB 2HQDA 5ETTA 5M5WK 3GV8B 2VDIA 1FFSB 1RAHB 3H42A 1Q53A 2ZKUA 2GNKA 3D6MB 4I0WA 4DV2J 4KH0B 3R2DJ 2IJFA 3H90A 1DCHA 1KSPA 5GMDA 4NASA 1U1MA 3A8IA 1OY6A 4WJ4A 4UOHA 3R6LB 2J6SA 2A6OA 3CCWA 1TTHB 4NLGA 1LK5A 1WG4A 4J9MA 4LBIA 4X2BA 3OXGA 2VPXB 3I9ZA 1TFWA 1RACB 3AD8C 2QC3A 1S9EB 4OYZA 4X84A 4ZK7M 3QYYA 1LW0B 1AUDA 1CBKA 2VC1A 1FX4A 4UUWA 2AGOA 3ZZPA 4PQAA 1GMWA 3GFHA 2COLA 3UDLA 1GMVA 3FSIA 1DQ8A 1SKWA 3AY0A 3E2EA 4WYLA 3O44A 4OLOA 3MCMA 1Q79A 3QFHA 1R9TK 2E9ZA 3WX4A 1IKWA 2HBZB 2J6UA 4D3HA 4C8YA 2NVYK 3SDEB 2JNJA 5I3UA 3BN4A 4WTYA 2YKOA 1I6JA 1YDLA 2NPFA 4NXMF 4PYAA 5A2QY 2PI4A 1I51B 2OMLA 4J9NA 4JK1A 4KMDA 2SXLA 1DLOB 1K83K 1S12A 1JLCB 1RTHA 1I50C 2MB0B 3AJDA 1JK9B 1QE1A 3AT1B 4OYXA 3ETOA 1FTCA 4OHXA 2HAIA 2BKPA 2HHQA 4GRSA 2NYIA 4AQYF 3SI8A 4PRFA 1XMQF 2MZQA 4MT1A 1MMLA 2MLYA 3SCJE 2WB1D 2V2KA 4NA2A 3ZZOA 4ZCMA 3IRXA 2DTJA 2JA5K 1QDUB 1GXTA 4CM2A 1R0CB 2NXNA 1F2HA 2IYGA 2BE2B 4KRWA 4FDFA 4DPTA 4C8ZA 1G3OA 3W62A 3HULA 3UN3A 2EK6A 1RT4B 3P3DA 3UN5A 4TU7A 4KH1B 3DOMB 5LXYA 4YMEA 1C4AA 2Z2LA 4EYIB 3M6UA 4B08A 4A3JK 4IO9Q 3FNNA 4A3FC 3LAMA 3BGUA 4NRUA 2RHQB 4CIOA 3PO2C 5KFCA 2HHHJ 4ECVA 1WCMK 1XJWB 1K9MT 4L3NA 2VUMK 1ZA1B 3KLHB 2DNHA 4DFPA 4H4MB 2E1AA 1S57A 4YFKA 1Q16B 5HP1A 2DO4A 2E2JC 4USIA 2HEKA 3PNIA 4K59A 8RUCA 1I94F 2V6SA 2VJUA 2CJAA 1PILA 2X7IA 4USUA 2VONA 2G2YA 3RB4A 3R8YA 1SL1A 3DRSA 2XQCA 2U1AA 4TLQA 1RTDB 2J7KA 4NLXA 1FEEA 2CQ0A 2HZCA 5DDQC 5G0RA 1ZOTA 1D8YA 1WKJA 3GWCA 4DR1J 4QIFA 3T5JA 1SUQA 3TAMA 4YS2A 4W90B 4IH5A 1TK0A 4G7HA 5SUHA 2CFAB 3P96A 3TAQA 1L5UA 4KDDA 1HQ2A 1TZ0A 2CPZA 1GTHA 5C24B 4PYDA 3MTKA 2HPUA 2CNNB 1HMVA 2VPYB 5DM7Q 2YU9A 3TJ8A 1NJZA 3HK2A 3OL9A 4GKJF 5E41A 4DS4A 2BXJA 2Z30B 1VQLS 1DARA 4F26A 2XWXA 1Z2LA 4F3MA 2EKYA 1REGX 5J1PA 3TA1A 1T05B 1BS2A 4JI1F 1EIYB 2F9DA 3D28A 3H25A 1ZM2A 5KFDA 1EKSA 3SFGA 1Q8LA 1WELA 5KG2A 3KK3B 4DR2F 1LV5A 2JZ5A 4LF5F 4LR7A 4ZVEA 2BE5A 2EK1A 3LPEA 3EZOA 4X4VA 2I2YA 3EVOA 4B9VA 3O8WA 2VBYA 1FF2A 2JJ4D 4GTFA 4QWAA 2CQ3A 3S8SA 4B3TJ 2J5AA 4X66F 2R9LA 1JLBA 2QFIA 3IBFB 2HBYB 3UDEA 4CWBA 3N0BA 2I5JB 1LQ9A 1QM9A 3OV7A 2NXEA 2YWEA 4N8NA 2VQFF 3GTJC 5LJ5Y 3MM8A 5IXUA 2YNHB 1DQAA 1U1LA 2QYGA 4A3MK 2ZUAA 2DO0A 3THPA 3E8OA 3QX3A 5FLMK 2C3MA 4EBEA 3J7YI 1SQGA 2B5JA 1T9YA 5A0YA 3G6XA 1LWXA 4DUZJ 1S5ZA 2FYXA 2H5EA 1E6YB 4V1Ak 2V8VA 3QMQA 4CLWA 4MEYA 2YVSA 3TNVA 4QWDA 4K4SA 1U4BA 1DTTB 3V81B 1CJUA 3I0SA 4MTPA 4K5SA 5KFSA 4FVCA 1HBUA 2RMLA 2LVWA 5DS7A 4ZPCA 1AB8A 2W9CB 5CYMA 1TWHA 1N4LA 4X4PA 4G7OA 1YIJS 4OI4A 3GR1A 3NS5A 4Y65A 1U49A 3T9NA 2LFVA 5D8HB 4RU9A 3ZZZA 1I50A 2JC0A 4R8UA 1R89A 2ZH9A 4HEA9 4OYMA 4F2RA 1RB0A 3G82A 3M32A 1TL3A 3QZ8A 2IIHA 1KHVA 3T19A 2AW0A 2DRDA 1GNKA 5KTQA 2DCLA 4KKOB 1DRZA 1VGXA 4KFBB 2R7ZK 2FZKB 2KVQE 3CE8A 3RJMB 2JRSA 1HR0J 2RH6A 4HHUA 1RT3B 4YQWA 3JSMB 2VOOA 4P9SA 2CQIA 4CH7A 2UXDF 4ETZA 5E3PA 1T94A 5HAOA 3KLFB 1JLEB 4I2QA 1C1BA 3S2DK 3L7UA 2J7WA 1IM4A 2VKRA 2KDOA 3HHKA 4K4XA 1MROA 3MCOA 2QMUB 4PG7A 2WRMA 2RUGA 2PN6A 5K20B 4QYRA 1TELA 4USVA 4KHPJ 1IQTA 3BM7A 1RI7A 3HOVK 3H0PA 1WOPA 4URGA 2LDYA 4DPWA 2VG7B 2B63A 4MYTA 4MJKA 3R27A 1F1BB 4BBSC 4QW8A 2RU3A 1NSQA 4PCQA 4KT0C 1VIXA 1JIHA 3MMBB 1FCAA 3JSTA 1ZYQA 3BGRA 4R5PB 4Y2IA 2XMVA 2BA9A 3A8EA 4JI5F 1SVDA 1V3SA 3C15A 4A3DK 1G6BA 1X4BA 2IJNA 2ZDOA 1GX6A 1EQ0A 1RBLA 1N54B 1ZZNA 1JLGA 2PA8D 3CC2S 3DLJA 1RBOB 1J5OA 4DN9A 4DG1A 4M94A 3DU5A 4ZVOB 5M2UA 3CTRA 4TY8B 4DSEA 1BHNA 3U1MA 5J2MA 3R2CJ 2YNGB 4B3RF 2LQ9A 1ZAWA 3AXKA 3CW2C 2Y8YA 2W7OA 1T9XA 2R7TA 5IYDC 3OT9A 5F8GA 3DLKB 2RQKA 3NL0A 1U1NA 2G2ZA 2ACYA 1B3TA 1NRKA 3MMCB 1O8BA 2D74B 1F9NA 1I3QA 4Q0BB 8AT1B 2BUNA 4LQYA 2XG8A 5AXKA 2MHNA 2XS7A 3QFWA 3GJRB 4LF6J 4Q43A 1JXLA 4TYAA 2R7XA 2GMJA 4ITSA 1FEHA 4I2PB 1U2CA 2OH2A 4KIAA 4UT4A 2GSOA 2D3O1 1NK4A 4DV3F 1ZM3A 1AROP 3RR7A 2WVDA 3NEKA 2GO9A 4BCAA 4L3KA 2JLFA 5F8IA 1AUSL 4QIWD 3H7HB 2F4FA 4CH0S 4HH1A 3QIPA 2UXCJ 2CPYA 3I0RA 4USJC 2VG6A 3BDPA 2OPPA 2O5IA 2FZCB 3D3BJ 5KG4A 2UU9J 3CMAS 2DPJA 3W9HA 5HVGA 2XLKA 1FRJA 3GTOC 4USMA 4FKYA 1RAIB 1HNXF 1FFGB 1RKJA 5F8HA 4K4WA 3NWRA 3R1HA 2ZITA 4RW7A 3BKUA 5RUBA 3KLGA 3KNGA 2F4VF 3C14A 4YFXA 5B0DA 1S4FA 1WACA 3DLHA 4DEZA 3AJ2A 4X62F 4I6YA 4RBVA 4LRAA 3IPJA 2ZJPQ 2H51B 1CS4B 3Q0AA 3VZIA 1SKUB 4L6V3 1RSCA 2V69A 2ZUFA 4UY85 4DFKA 4KHRA 4RW9B 5ETQA 2CPJA 2E1RA 1RHKB 3MOZA 1TWFA 3AHPA 3AB4B 3S01A 4WFBQ 4A8OA 1D0EA 1EZZB 5GADU 3D9BA 2QA4G 4ZCKA 3MAQA 4IFVA 4ZVGA 1BE4A 4OI6A 4Y7NK 1N32F 2UP1A 1R9TC 2V68A 3EX7B 5B0GA 3C6TA 3H98A 4G1QA 2L9WA 4NLSA 2NVYC 2OEMA 4OX8A 2GJFA 4NLTA 1IQ0A 4WFZA 2XNRA 5A8WA 1FVSA 3IGNA 3BP3A 1NJYA 2E2HA 3T9ZA 4WCEQ 1OQ6A 3GR0A 1RU2A 1HQUA 4LSNA 4P2SA 5M3FK 4WILA 4RL1A 1RBAA 1KQKA 2RNEA 4ELTA 1JLAB 3JYTB 1VC5A 1HWUA 4KV8B 5A8RA 7FD1A 1U48A 1TP7A 3IM9A 7FDRA 4P7VA 3EUNA 3M3YK 5L38A 1B64A 3BO2A 5C4XK 5HMYA 5AE1A 4LQ3A 2E5JA 2BRKA 3P49B 1RKIA 4PXEA 4Y0FA 2AEJA 2JA5C 2YX4A 3OFEA 2ZM6F 3KG1A 3BS9A 5D0EA 1SKSA 3E51A 4IO1A 4A3EK 1WC5A 3PM9A 1JOEA 1HWJA 3VQSA 2CPFA 1JB0C 3TJ9A 2DNMA 2ZFHA 5FDLA 1UWAA 2HHSA 2R8KA 4A3JC 4K50A 2GVDB 3T41A 1HBMA 3NGTA 4B3OA 1S9FA 2DH7A 1L3UA 3GV7B 2HYIB 1WCMC 2B8PA 4ZIVA 4JI7F 2VUMC 2GZOA 4DPXA 2NXJA 3GMGA 3J7A1 5EGYA 5H9EK 3MR5A 1IR0A 3H8YA 4X4SA 1BQXA 2ZD1B 2ZC4A 5HK4A 3EXCX 4NCGB 2L08A 1R0BG 3BO3A 4BLAA 4DJBA 4AT1B 2BZ2A 4D3GA 4YB6A 2RJZA 2A69A 3QJPA 2CG4A 3TI0A 2BVZA 1Q5YA 3CD6S 1OIAA 2HNYB 3D68A 1N48A 2WVFA 1NSAA 2RDDA 3ITHB 3VQTA 1IBMF 3MEEA 3Q8UA 4RJVA 5KFVA 2ZOMA 1HIYA 3W5ZA 3Q8RB 2OLWA 1PYSB 4KY3A 2YQ1A 1FNMA 3RZOC 2Z8QA 2NYHA 5AXMA 3WHIA 3SZYA 4FS2A 5IP9K 2R7VA 2LYVA 1OJ4A 3MM5B 1GH8A 2BJEA 2DHHA 3DC2A 3FJ2A 3JTOA 4EEYA 3QNWB 1TKTA 1R6YA 1UWBA 4H4KC 3MURP 2XM3A 1KONA 4O4GB 1RAGB 5IOLA 1XNRF 4ECRA 5L39A 1APSA 1RT5A 2BQUA 3OR2B 3UDCA 1AXQA 2YY3A 3GTKK 1XZPA 4UTGA 1NB2A 1JNRB 2F1FA 4QPXA 1BXNA 1WHVA 4DZDA 3IFEA 5KFUA 5AJ3F 4TQRA 1LWEB 4CLUA 3HZEA 2G0JA 1F9HA 3NGUA 4PABA 2IYIA 2V5HG 1YGYA 1N5VA 2BE7D 2EFQA 1C1CA 1U0HA 4RWXA 4DR7F 4AUKA 3PKMA 2YWHA 4C3IK 1DHMA 2JFKA 3J7Z5 4X65F 1L0WA 4A8KA 2QFJA 1ZBTA 3OPFA 4NI2B 3DLEB 2AGQA 1XMOF 1TQLA 3BR9A 2APOA 3DYAA 4ID8A 4A3MC 4LBHA 4NLOA 2VODA 4NLRA 4ZS6A 2HHVA 4Z7CA 4A3CK 2DR8A 5IZHA 5FLMC 1BD6A 4ZN3A 5AE2A 1VJEA 1FK9A 3VGVA 2C42A 2DNQA 1OSCA 2F8HA 2WBRA 4WFNQ 2UUAF 3QRPA 3JAMY 3G86A 1CSJA 3C19A 2W2PP 1DY3A 3B78A 2XCAA 4MIWA 1N56A 5GAGU 1NK6A 2QMXA 5CA5A 3DNCA 2YPZA 1ZETA 1DJ0A 1XZQB 2PGCA 3CCVS 2OEJA 3KK1A 4NLUA 4WJBA 4LJZA 3MTJA 1TUVA 2D1CA 3PDNA 3TUIC 1G51A 3PX0A 4QR1A 5IS2A 3S0XA 1RT7A 3GTQA 1WSVA 1EAYC 2B8QA 1RHMB 1PJ5A 1LW2A 1IKWB 2M3DA 2HS3A 1E6VA 3IG1A 3R5CA 4WZQA 3M8RA 2OP5A 2X1BA 1X5OA 1SKRA 2IRXA 3S15K 3AOCA 3BEGB 4C45A 4GTCA 5I3UB 4KMUA 2CZ4A 4MEXA 1RT6A 4RUHA 3IO1A 3BQ1A 3PY8A 3E3XA 3QT6A 1KQSR 2XWYA 4G0WA 1WF2A 5H9FK 1HLWA 2LXIA 3Q86A 1M5OC 2R7ZC 5JFEA 5EWGA 4LLGA 3S1QK 3T6BA 2KI2A 4LFAF 2YH1A 4NXNF 1TWCA 1EH1A 3N6MA 5C2GA 3T6JA 1HNVA 1RTHB 3JQMA 1H2UX 1KLMA 3B8HA 4RNMA 4CO5A 1WF0A 3DRXA 4DV6F 4OFZA 3J81j 2C2RA 5LSRA 3LAPA 3W5YA 4ZPAA 4KGZB 2KU7A 1VRTB 3ZTSA 1XNQF 5IYBC 2P8IA 2NVTK 4ZP8A 5LMUJ 3HOXK 1EKRA 2MZJA 3S2DC 5KFEA 1H7WA 1MWZA 3VAJA 2NSBA 1T03A 1VS3A 2VUGA 5CYQA 4C2MA 5KFJA 3CCTA 1MU2A 3HOVC 4RW4B 2VUMA 1S6QB 4Q5SA 2W24A 1RHUB 3VCDA 1TR0A 1NSKL 5DLGA 3UVJA 1RE1B 2C3PA 2V6AA 2KG0A 2YWWA 4I7FB 5F0UA 1F7VA 4C0BA 2Y3YA 2LECA 3QZ7A 3PRDA 3OTOF 3OVBA 5B08A 1HNZF 2R2TA 4U9RA 4IUFA 1C0AA 3RRHA 4ZN1A 4FPIA 2Y1LB 5HP1B 3HHLA 4DV7F 2OKQA 4J9QA 1QD1A 1RWKB 4IR9A 3T5LA 4IKAA 2A1BA 2R3VA 3LQVA 2ALZA 4I56A 3KMQA 2RILA 3QGIA 4P2XA 3PRVA 3N0CA 5ADZA 1IR2A 3VAMA 3MFHA 3LF0A 3W61A 3DRSB 1AZSA 4DZ6A 4J9RA 1RT1B 2J9EA 4KAIA 5KFWA 3MWBA 3DXJA 4CLZA 2V9WA 2ZH2A 4BBYA 1LOUA 2FLPA 4QOTA 2R93A 2MY7A 3TAMB 3NCRA 4O3QA 5DGAA 4A8YA 1FHTA 1RABB 3IAM9 1C0UA 4M5JA 5C4JK 3NMRA 2N7CA 3BGLA 5HSPA 3CULA 3CCUS 3CJ4A 1M90T 2NUUG 3HXMA 3CJ5A 5IT4A 2ASLA 3U1LA 2ZNZA 3QO9A 4ECYA 1J6XA 4HLBA 4K4TA 3K59A 3GFXA 4J7CA 1EP4A 1XQIA 4TU9A 1USOA 4IRDA 2NUHA 3UFCX 1J27A 3M2UB 3I5AA 3GYGA 1F9FA 3SSSA 1Y00A 2JLEA 2GIQA 2OPQB 3KXDA 4MMOA 2W8LA 4GC6A 5FLXU 1TWGK 3GP9A 5THWA 1DD5A 1CPZA 4X62J 4NYPA 2JFDA 1J5EF 2LEPA 4RNHA 1EX8A 5CCMA 3BH7B 4NEZA 3KLEB 1NH8A 2IY5B 2BX6A 1V3ZA 2WHOA 4NLVA 1SFOK 2NZ4A 4K4YA 3FEYB 3BO4A 1TK5A 3H0GK 4JUZA 3CXCR 3C46A 2X51A 2P6TA 1O24A 3FKIA 3CCES 2HVHA 1S9EA 1JNZB 2P9EA 1X4FA 1OPIA 4ES2A 3SYZA 1S1WA 1LW0A 1B99A 2DR5A 4NZ6A 5KFYA 3PO4A 1FRKA 1SH0A 3TQEA 2XBPA 1N32J 3EICA 2J9CA 2C22A 2Y1JA 2ROGA 3CJKB 1NPPA 2JA8K 3F56A 4H4OB 4FVMA 2G1DA 2E2IA 1PGZA 1ZZFA 2DNGA 3GQCA 1S7HA 4AD6A 1OY9A 4X6AK 3SDEA 1NKEA 5MAOA 4Y7NC 5EX0A 2ACMA 5BR8F 2B0GA 1HHTP 2B4PA 1YBTA 4UOCA 4KC5A 4BWMA 4J9UE 5L1KA 2UUTA 5KG7A 4OQJA 1ISEA 2J0SD 1DLOA 2F63A 1JLCA 3S1MK 4WIIA 1GX5A 5AXNA 4LFBJ 1YG0A 4AL6A 1D1UA 4F0MA 3Q22A 1SH2A 3IR5B 3K7AC 4R8UB 3D1HA 2CPIA 3HX9A 4GKKJ 4C3KA 2F8MA 4M1KA 4KASA 2CW0A 1GMUA 1IKXB 3L09A 5CCLA 2AIRB 2C2NA 5ETLA 1S9GB 4PR6A 4LJMA 3N6NA 4GVBB 5IV4A 1KTQA 1S77D 2BE2A 5DG9A 2IPOB 4FF3A 3M3YC 5IWAJ 1RT4A 5C4XC 1XXCA 2V50A 3DOMA 2B43A 1SJ4P 4JI3J 1WQFA 1N34F 4ZPWR 2CWKA 4IG0B 3TFHA 2XY7A 4A3EC 5HANA 4OHYA 1VBZA 2R8JA 4NYZA 3KLHA 1F93A 4H4MA 3K57A 5J2NB 1I1GA 2UUBF 2J7UA 1IS1A 3CDBA 2V34A 4Y2AA 4HTJA 1GXLA 3L7OA 3ZO7A 3PZPA 3GTGA 4DPYA 2AX1A 5A6WA 3DDKA 2QE5A 4JV1A 3M6VA 4G3IA 5DDOC 2JA7A 1FTRA 3R6GB 5IV3A 4F4YA 5KFZA 2QMWA 2XY6A 1W26A 2YKAA 2O3DA 1KC8T 4FXDA 2IVYA 4F0HA 2EFNA 2CFAA 2FC8A 1JLGB 4NMXA 4NYOA 3HOZK 1S6PA 4DU8A 4C48A 2L3MA 5ETSA 5C24A 1U7LA 1FFWB 3M2VA 3M9OB 4ZHRB 4NMLA 1HD0A 3LALA 5L8RC 2HLUA 4DV5F 5KFFA 2LKZA 4L75A 5IQ6A 5IT0A 2MXYA 1KNZA 2V8DA 4DLGA 1UETA 4EO6A 3CCLS 3HJVA 1HI9A 5IP9C 1CJKB 2ZDPA 4DL3A 5M5YK 3DKDA 5GMKa 4BS2A 2RF2A 2NVXA 1RAJA 3RRKA 4LF7F 4LF8J 1EI6A 4KB2A 2J8AA 1SCJB 2W9BA 4G6VB 1U1RA 4JI4J 3SCLE 2G2OA 4O23A 2GFFA 3PRBA 3GEHA 3PKYA 1YKWA 2YH0A 3AOAA 1ZM4A 2QIFA 3GTKC 2CQHA 1FJGF 3BB5A 3UD5A 2KFZA 2I5JA 3GTLK 3T1YF 1HQEB 2M8HA 3NGRA 1TAUA 4URSA 4YDXA 4BLGA 2MKYA 3QIPB 4ERDA 3DCAA 3I0RB 4OJ1A 2VG6B 2YNHA 1X31C 3BJYA 2NQPA 4DOZA 5DLFA 3W1YC 3UD4P 1HNWJ 1BC6A 1NDPA 2CYYA 3VTIA 1H72C 4C3IC 3NRBA 1S97A 1RYRA 3NXZA 2W25A 1LK7A 2FQTA 2BJ9A 3HXAA 5TMFA 3HSZA 4AYBD 5DDRC 1Y1VA 2FHMA 3IXQA 2RB7A 4RW7B 3MUTP 4BXXK 5IFMA 1E6YA 1X5PA 3EM1A 2RAQA 4QYZJ 4YY3J 4A3CC 2V4RA 2HVZA 1O2FB 4W98A 2OD4A 2ROPA 5EGHA 2GCFA 4X4QA 2NVQK 3ZFVA 3DI6B 3R7SB 3M8QB 2DRBA 3V81A 4DV2F 3S1NK 1NDKA 2ZH4A 2KYXA 3QT5A 3HT3A 2V6TA 3MEDB 4WTOB 2W9CA 2VASA 4AE5A 1TUGB 2A3JA 4GO5X 2W9AA 3MDFA 3KJNB 1H2VZ 5D4DA 4WFAQ 3AQPA 3SV4A 2F9JA 2PE8A 3VGTA 3JQKA 3D3CJ 4OZJA 3R5DA 4P2FA 3N0VA 2AYBA 3MF5A 4ZLJA 1C0TB 3QAEA 4KBIA 4PG4A 3SCKE 5HQLA 4XPEA 1L3SA 4XPCA 3OL8A 2BACA 2WK4A 1ZQ1C 4NA1A 2M4MA 2HG4A 4GT9A 1IN0A 4KKOA 1SJRA 1S0VA 4KFBA 1U2RA 3BSCA 1X8DA 3C6TB 3VF0B 1M5SA 3W63A 4IDKB 3S15C 2BQ3A 1X7VA 1RT3A 3JSMA 3GIJA 4OIPA 2I9SA 4LIRA 3EYZA 2B4UA 1Z2ZA 1JXEA 4HI1A 4PPDA 1YJTA 2AHOB 2ZH3A 5I3QA 3KLFA 1JLEA 2YX1A 2AF6A 3LP1A 3ILJA 3S1QC 3TA0A 3TZYA 2XYPB 2RS2A 4KB4A 4P72A 1HQUB 3TO8A 2DNNA 3FEXB 5K8MA 5A8RB 4ZCIA 4OI3A 2JEJA 2NXCA 4CLLA 2E7WA 1UW9A 2NVTC 2VG7A 4C8KA 3HOXC 3IN5A 4NLWA 4X4UA 4QJVB 3MPWA 2EEYA 3GEEA 3QPIA 1WC4A 3HJFA 5ETVA 1KR4A 3I5BA 3ICLA 2A0FB 3R7BB 2MYFA 4U96A 5D4OA 1N33J 3L4KA 1YCLA 2FZGB 2OELA 4R5PA 2XLIA 1T95A 1M1KT 2KXFA 4FBUA 1F5BA 2GIFA 1D8ZA 5SZTA 4DV7J 4ZLPA 4FBTA 3KWMA 1SJFA 1MLAA 4ICLB 5D3GB 4V19X 1BQMB 4U7UD 1FA0A 2ZVIA 3AJ1A 2CXEA 3P4UB 1R0AB 1K73T 3K2YA 1W25A 2AP6A 2HHHF 2OSRA 4TY8A 4C11B 5EWFA 2DISA 3WBZA 5JVHQ 2H4WB 2B3TB 4QWCA 2XZWA 4LRCA 2BYCA 3MD3A 1XR6A 4USTA 3KG0A 3NP5A 2ZHBA 3GJTB 3DLKA 2KRRA 2HK3A 5L1LA 3MMCA 4UZBA 4C3HK 4NWBA 4Q0BA 5B0AA 4E8UA 1K0TA 4Q7AA 1RYSA 2GAHC 1L3KA 1NNDA 2EFPA 1BDFA 2WONA 4O0IA 4OZNA 2CNOB 2MJNA 2HWIA 5HLFB 3SIPB 3THVA 4DR1F 4I2PA 2Q1LA 5GAHU 4F4XA 1B0TA 2E1MC 2RDJA 3FOEA 3FBCA 4C3JK 5C4JC 4KQZA 2X1GA 4C6AA 4XLPA 2MSSA 4M1XA 1Y9OA 4K8RA 4CP5A 2KYZA 3HPOA 2ZBIA 4U8VA 3PYFA 1NPRA 4OV6A 1Q0NA 1VHIA 2BANA 4LRFA 2J6TA 1V6HA 4DR3J 1SBRA 1UKUA 1IQZA 2GO8A 4IRKA 1R8BA 3TVKA 3HHDA 2EBBA 4P52A 1DTQB 3AOBA 3TX0A 3NOGA 2PSZA 1IKVB 4LVNP 3IS9A 4PWDB 1TWGC 1Y5IB 5D0GA 2AJ4A 3K5PA 3N5BA 4BLBA 3C6UB 5JVOA 2D9OA 2C2KB 1NHKL 1CS4A 2RGRA 4FYXB 2GHPA 4JYAJ 5FD1A 2P9CA 3H0GC 5KG0A 1Y5NB 3EDQB 3CIMA 4PG8A 1M5PC 1KLNA 1NEEA 3FFIB 3FRYA 2CA9A 5GAGI 1U0SA 4H54A 4JI2J 2Q66A 2HFOA 3FRZA 4P73A 3SEOA 3OJSA 5KG6A 2HMIB 4DQSA 1FE4A 3MZIA 3NAIA 5D0HA 4B3MJ 1Q7LB 1O25A 1D9AA 2PI5A 1YJWS 3HO1A 1FK9B 1UA0A 4LK0A 4P5AA 1VQ5S 4DUZF 4XO0A 2JA8C 3FBBA 3CQZK 1TWAK 4RBTA 3S17K 5E68A 2HAFA 4ZP6A 1F60B 2XMKA 2ZFZA 4I68A 3I4NK 2RH3A 1WC3A 2DVIA 4X6AC 1SV5B 5C42B 2Z4PA 2HQFA 5IC6B 2JHEA 3M4OK 4EBCA 4LIWA 1UFWA 2HHXA 2EW9A 5GAEU 2MGZA 3GTMK 2AJ1A 3V4IB 3DM2B 2GJ2A 3HD2A 4GTBA 4M5GA 4ZJQA 3S1MC 2V0NA 4IYQA 2CJBA 5E5NA 4KV8A 1A9NB 4YDDB 1FKOB 3TVZA 3BZQA 4YFNA 4DS5A 1EK8A 5DZ6A 4Q8FA 3IG1B 4F02A 2VFUA 4NZ7A 1WIHA 2F5GA 1WHXA 2BM0A 2Y3PA 3HZGA 2P5MA 2O5DA 3BUEA 2ERRA 4WJ3M 4QZVB 1YBUA 4OZLA 2CNLB 3BDEA 3HMJG 1FKPB 2OMOA 4A47A 5IORA 1VBKA 4MK7A 5IC4B 2DHSA 2MLXA 3TVYA 2AT1B 1UV7A 2FY1A 2G4BA 2GQ2A 4DSFA 3R5AA 1A6LA 4BY7K 5K8OA 1TVRB 3E01B 1OO0B 4PKDB 3LUYA 1GMWD 2OJ3A 2GVDA 3OHAA 5D6GA 5EHHA 1LWCB 4ZLNA 1N36J 2AD9A 2F3JA 2VV5A 4WXOA 1T8EA 3SCIE 3GTPK 1TUWA 1UAWA 2IAJB 4TN2A 4QWBA 2MZSA 1XR7A 2RKIA 3WODA 4KHPF 4G1PA 2ZD1A 3DU6A 3UNGC 4FKXA 4NCGA 1VI7A 4UUXA 5CJ9A 3TYTA 2PMZL 2K1RA 3AB2B 2N4DA 4C8OA 3T1AA 2E9RX 1Z1ZA 4XTTA 4UZCA 5HI7A 1REVB 3R1LA 4RR5A 2R92K 2DD8S 2HNYA 3ZTQA 4DHVA 5M2RA 2IM3A 3ITHA 1UJ5A 1OSDA 2DGUA 3RBZA 1U2FA 1YTYA 1DCPA 3FCVA 3W8PA 1N5YA 1CC8A 4KR0B 3BBCA 2HNDB 4B9NA 2BEFA 1Y1WK 3CGIA 2HZVA 4IH7A 4PUOA 1P1TA 1DAXA 1NB7A 1Y7PA 3M8PB 2ZH5A 1U6FA 3POTB 3HOZC 3RUBL 2QGFB 1O6XA 2RT3A 3QJJA 1AZSB 3HP6A 3SZZA 3W3SA 1RHRB 2AU0A 3HFKA 3JQJA 3OFHA 1N0VC 4RZRA 2E5LF 1QTMA 4O4GA 3B4MA 5J1EB 2GHVC 4QIWL 3OR2A 5IP7K 4KC6A 3CDEA 2J0QD 3DLLQ 2CRLA 3BSOA 4PG6A 1B7YB 1K8AT 3MAAA 3KYLA 3RB6A 3WQPA 2RHSB 2IC3B 1INNA 5HMXA 3L4BC 4DFMA 1LWEA 1TWGA 5KFGA 3CMES 4PZVA 4WK1A 4LF6F 4PWUA 1P6TA 2JDJA 2DHXA 2KN4A 3MEKA 4EWTA 1RHJB 3CJ0A 1TL7B 3LW5C 2XS5A 2DR9A 2B51A 4UQTA 1W7WA 3TUJC 3GTLC 3FSXA 4DX6A 2ATLA 1W2IA 1KQGB 1TK8A 3G8SA 3UW1A 3N28A 3PG9A 4NI2A 3DLEA 4M5MA 2MQMA 1BUXA 2PDAA 1Q86T 3ENAA 1N88A 1WF1A 3MPDA 5A6PA 3VAIA 2FJVA 4PEOA 3RU0A 2AYEA 2DGSA 2HQ3A 3ULHA 5CAAA 2UU9F 2PA3A 3KUEA 4NE9C 3VR1A 1R43A 2R2SA 2B6AB 2HQGA 2IVMA 2DEJA 1WSRA 4BXXC 4OIXA 1SJ3P 3NUHA 2W01A 4AL7A 4M5IA 3MR7A 1RWPB 4KN7A 2MQLA 3G8TA 3KHHA 1WDDA 4OI1A 2V4JB 4ZJLA 1PSDA 1NK5A 2QL7B 5DG8A 2NVQC 2DXEA 4X4NA 2Y1IA 1XZQA 1MG7A 2CG8A 3S1NC 4I64A 4ECZA 1S1WB 3CCJS 4DR5F 1WOSA 5C25B 1WOOA 1XXAA 4USWA 1F5CA 3KKFA 2JVOA 4E98A 3P5BP 4O3NA 4ZVTB 2IJRA 3CPWR 1FVQA 2DKOB 4FN5A 1ZPWX 2BW7A 2EBEA 1FRMA 2GJIA 2FVCA 2WW8A 5D4LA 2MJUA 3WC2A 2V63A 2VFRA 3G4AA 5GMEA 4WKRA 1R6VA 1M0SA 5IM0B 4IG3B 3EGVA 3NOCA 3M6WA 4EGLA 1LXNA 3PJXA 2OO4A 1NO8A 2QYCA 1KOOA 3F44A 4LRDA 1IJFB 5IYCC 2XMAA 2LQ5A 4CYUB 5DDPC 3DOLB 5K5MA 4B3SJ 4FYWB 4F67A 2WVEA 2A10A 3PO5A 1X5SA 2EVZA 4G7ZA 3LO3A 1HD1A 5H9EJ 2DJWA 1XR5A 3K58A 5HQ8A 3ZTPA 3K5OA 1VRTA 2OTLS 1RJJA 1WI6A 1RLCL 1NKBA 2DGOA 4F3OA 4NLPA 2Y1RI 1VDHA 1OPZA 2BABA 1S10A 2H5IB 5ETMA 3TEHB 3PW2A 4RW4A 1JJ2R 1S6QA 1LWFA 1YJ9S 5MLCV 4ER8A 3QT8A 4FYYB 5KFBA 4W92B 1ZH5A 2VG5B 2NZCA 2QLJB 4DL5A 4LSLB 3UWTA 4J9PA 4EUVA 1U6ZA 2U2FA 4I7FA 3HM9A 2DB1A 3QGHA 3DLGB 1FJCA 1VQPS 4QIEA 3GG0A 4C3LA 5F3ZA 4ZPTR 4NEYA 4ATNA 4KB7A 4DWIA 1DBDA 2A68A 3A3NB 2QRRA 3W65A 3NCPA 4DPUA 1YHQS 3CD7A 1WG1A 2MKHA 4ZVRB 3ADAC 3UD3P 2Y8WA 2RD5C 1VHFA 3BF4A 4HH0A 3SMZA 4YFUA 4ED0A 2PPBA 2YU9K 5ETPA 4UW2A 1KVJA 2OIHA 5F8NA 3HSGA 5LJ3Y 1ICEB 2PO4A 3J81U 4P7TA 2CUYA 1RT1A 2MQPA 2KO1A 2DITA 1GQEA 4OYPA 2CPXA 5E3AA 2MPUA 2M2BA 3MHYA 2QT7A 2OFGX 2I1RA 4FNIA 3L95X 1JXVA 1PJ6A 2KZMA 4C98A 3LPYA 1X4CA 1UVJA 4CLKA 4C3HC 1RLDA 2BMBA 2BDPA 3D6TB 3UR0A 3OQ2A 2HHPA 2HW3A 4CO3A 2CAJA 2B4OA 1S6PB 4OX9J 1ZTWA 4DQRA 3M2VB 5C44K 2G9OA 2V2ZA 4HDGA 3BV8A 1AFJA 4RO0A 3ET6B 4R0EA 1UA1A 2AYGA 4ID5B 2RE1A 2R7QA 4C3JC 4KO0B 4OIRA 4XAKA 3MXHP 3GTLA 3MM7A 4OYOA 1HWIA 2RF2B 3M2UA 1PBUA 2WVBA 1MW7A 4DR6J 3KLIA 1RAEB 1VC0A 3Q2TC 7AT1B 2OPQA 3CJ8A 2FTRA 4JV5J 2W9BB 2FHJD 1S4EA 1RISA 2B9XA 4WKYA 2Y0SL 4OI0A 2MSTA 1SL0A 1X4GA 3LPXA 1RAAB 1YQHA 2ABYA 1V3RA 4ED8A 5T7LB 4A4JA 1Z4UA 8ATCB 2HVDA 3KLEA 4LMZA 1H2TZ 2CKWA 3G6ES 3K17A 3Q89A 1YNJA 4BKWA 1U02A 4ZVUB 4OX7A 4PXBA 4MK9A 3ENVA 5KFTA 3G96A 2LLZA 3LAKA 3U7JA 2LCWA 5LMNJ 3DHWC 1TWHK 2R7SA 3J81Y 4ZPDA 3H20A 4F2SA 3KTQA 4FF4A 1NMEB 1QSSA 3T1HJ 2X1AA 4CT9A 3WZ0A 1IE0A 2CQPA 1VQOS 4EZ6A 2G0IA 3CJKA 4RWWA 1ZPVA 2D9PA 4H4OA 4J9VA 5E3CA 5KFNA 1KFDA 1ELOA 2EKNA 1OYEA 3HHEA 5F0WA 5JVGQ 3D0GE 2MZTA 4S0MA 2HQIA 3B6BA 4HACB 4M8LA 1S72S 3MGJA 2RVJA 3IBWA 4NLDA 3KUGA 4GTLA 3SSRA 4IOAQ 5D77A 4DUTA 1USMA 3CEDA 1VR6A 3CQZC 3OLAA 1TWAC 4GVLA 3VZHA 2OSQA 3S17C 4A3LK 2VD3A 1VQ8S 3I4NC 1B7FA 3CMQA 2CJKA 1BGWA 2HVEA 1O2BA 5D78A 3M4OC 4EZ9A 3MMJA 2OTJS 1M5KC 3GTMC 2ZE2B 5I3PA 4QCLA 4OHWA 1HPZB 2EPIA 2ROEA 2B63K 1IKXA 2BR0A 3TFJA 1S9GA 4KN4A 1S1UB 1P9QC 4GVBA 2GS8A 4PWWA 2VFTA 1BWEA 1O51A 2K06A 4N7TA 1KHWA 1NZAA 3NMAA 1O0PA 4FS1A 4X64F 4A8QA 2CVEA 4L73A 4QW9A 3CSKA 1N5QA 3S1TA 5LM7E 4NPOA 4ILDA 4J9OA 3UCZP 2MQ8A 3D7SB 3CNQP 1VQNS 1MWYA 2NSCA 1GK8A 3LP1B 2CQ2A 2R7WA 3NNCA 1TFYA 2PC6A 4W4MA 1WQGA 4IG0A 4DL4A 2XCPA 4PG5A 5IOTA 3DHXA 3TFIA 1TMJA 1Y10A 1F3FA 4BY7C 2HSEB 3KFWX 2YKNB 4ZPVR 2WTFA 1EARA 2R2RA 5J2NA 1VQKS 1U8SA 1S0NA 2KXNB 3D67A 1XC9A 3GSDA 5LMUF 2FD2A 2WVCA 1GXUA 3GYNA 4ED3A 4FPRA 5C7PA 2AKWB 2AEFA 3GTPC 1NBEB 1TKDA 3PFOA 4A8MP 4DV1J 2FVSA 4CM0A 5E3RA 4F7VA 5DZ7A 1YRTA 2FHJA 3JTPA 4CO2A 2RSQA 1IUJA 2KM8B 4JI8F 1I3QK 2Z58B 2XO7A 3D0IE 2B9EA 4O44B 3KK2A 5KFHA 3JSBA 3QRRA 3RZDK 3L9ZA 1I6HC 6FD1A 4HT5A 2PMZD 1HBNA 1MSWD 4OMFG 4IQMA 3VALA 3KNAA 3W7BA 2OGUA 4ZHRA 4I6AA 3B4DA 2KJWA 3MEGA 1GT8A 3MPUB 4LR8A 4F8RA 1X0FA 2E5LJ 1Y1WC 2ASYA 5GAHI 4KGVB 2HS0A 1HL6A 4CT8A 3VAKA 1CJKA 4WF9Q 3D6HB 3H4BA 3O3LA 3RBXA 5F8LA 3D0HE 2B56A 3OUYB 3M8WA 1PYOB 4KMAA 3N01A 2ZBPA 4M5KA 3MCNA 1UJ4A 3EJMA 4NOHA 1R8PA 5AXLA 4ZP9A 3MECA 1Q7YT 2WONB 2OPSB 4CLSA 2W4CA 5IP7C 3GONA 3FCWA 3H3VL 3JSRA 3Q8QB 3QRQA 2GX8A 3SZ2A 2LQBA 1BY9A 1HQEA 2DNLA 3JXOA 3M8SA 3DLBA 4TVAB 4WU2A 1ITPA 3KUHA 2KJVA 3N5FA 1ZVUA 3T5KA 2BV3A 3IR6B 2EI5A 2HRYA 1RTIB 5B09A 2VB6A 3GTJA 2V6UA 2I38A 2BANB 3KDNA 3UI3A 3GIMA 4IOCQ 1NDCA 2ILZA 3TZXA 1JX4A 1ZYRA 2V2VA 3K5LA 3CO9A 5HO4A 1TWFK 4LVOP 1TAQA 5F9NA 3M30B 3DRPB 3BYRA 1K0VA 4L74A 1YJVA 5ETOA 4Y52K 5HROB 2ZBQA 5FJ8K 2HGLA 4M5NA 3MM9A 2K3IA 2KH9A 3IS9B 2M70A 4GMKA 2IM0A 4QU7A 4USHA 4PAAA 2LEAA 4O2DA 2D3UA 3VAGA 2XI3A 3DI6A 3SQGB 3M8QA 1VRUA 4HKQA 1B70B 4DR5J 3ZZUA 2HZAA 1XK8A 3MEDA 2KRBA 4URQU 2GQQA 3BQ2A 4C0OC 3PYGA 3CJTA 3PYDA 3LANA 3G6VA 2E2HK 1UVNA 3I5CA 5K8NA 1RAFB 3S1RK 2CJ9A 4DUYF 2XSFA 4Z7YA 2CQBA 1URNA 2FHOB 4CDIA 1MN7A 3PFEA 2FLNA 1O26A 1C0TA 4N47A 2R7RA 2MY8A 2KFYA 3QIDA 5GAEI 2A6HA 3RRGA 2H4YB 2YX7A 2FY8A 1VK3A 3AXMA 1KQ4A 2YNFB 5DGBA 2LXFA 2FIUA 3UNYA 4OZ3A 1XWLA 1ZTTA 1X0PA 1TL5A 1VFJA 2CPEA 1P27B 1SB6A 3A1YG 1F5AA 5CZVA 1JVIA 3VVTA 1XIQA 3H4DA 4IDKA 2CQGA 1DURA 3VAFA 4XDCA 1F9EB 1JLFA 3WIUA 2MGZB 2BOAA 4FZVA 4CLYA 4XCHA 4CRJA 1UZDA 1FXRA 1PAEX 4EO8A 4NCAA 1K83C 3HKWA 3IM8A 3X3UA 3GU0A 4CO4A 3T01A 4LFBF 1BWVA 4LUBA 5TMCA 5KT6A 4Q2LA 1U1KA 2IM2A 3GYXB 1W2BR 4GKKF 5F41A 3SQOP 4C4WA 3HOWK 1T9UA 4A8SA 5C2CA 2ZC3A 4QJVA 4ANCA 4A48A 1GAOA 1RTJB 3FKBA 1FERA 3QWUA 3EMTA 3B82A 1IKYB 3FZBA 4OIOA 1HYSB 3IWNC 4G1IA 1AB4A 1H38A 3W9IA 2P2CB 1Y0HA 1PIEA 3NKYA 2ZUGA 2XY5A 1T3NA 2IRUA 3HFZB 5KFKA 2J76E 4OJ3A 3NG8A 5LT5A 5IWAF 3MOJB 3L4JA 2PFDA 2NREA 4J9SA 3HD1A 2GQCA 4ICLA 2CIMA 4DBQA 5D3GA 2CJXB 4O4RA 1BQMA 4JI3F 4JB8B 1K47A 3R5BA 2I6WA 2BQRA 4TYBA 1R0AA 3FEZA 2N7YA 3ISND 4KPYA 4C11A 4A3GK 4NZ0A 2RKIB 2LEBA 3OBIA 5KG1A 1SXLA 3BQ0A 1CLFA 2IRYA 4DXLA 2YU9C 2DNKA 2L9DA 4M5DB 3CCRS 2K1RB 1IVZA 2DPIA 3I6PA 1H6KX 4ZOSA 1WTBA 1YRUA 1QY7A 4WXWA 5A2QU 4BWJA 3PV8A 1PC5A 2VDHA 3MUMP 2VQEJ 4DF8A 4V19J 4ILRA 4DCOB 3OSNA 3N6LA 2XHWA 5HLFA 1N5YB 4BC9A 1RA7A 1KKHA 2V8HA 2HHUA 5GVQA 3VWSA 1YI2S 4GTDA 1CC7A 4PUOB 1QVGR 1RT2B 4WK3A 1T9VA 2IM1A 5KFAA 5D15A 4DF4A 3GILA 5BXIA 2EC2A 1NKCA 3CWJA 5C44C 5LSOA 4ZVQB 4ECQA 3FGVA 1M5HA 2W7AA 1YJNS 4AH6A 3X1LB 2EG2A 2MZRA 5J1NA 4AXIA 3H5XA 2XMWA 4LOWA 2KT2A 1X9WA 4KYZA 3ZXWA 2Q3PA 1VMBA 3CJ2A 3HVRA 4N8OA 3GTOA 4KATA 3C2PA 4EBDA 3M9NB 2NCKL 1DTQA 1S1TB 3NY0A 3I4MK 4LF8F 3PW0A 1IKVA 3K0JA 3MAAB 2DNOA 2AJ0A 3GLJA 4PWDA 3DDIA 3O2IA 2ZHAA 1NU4A 2DIVA 4JI4F 3UO0A 4F50A 3C6UA 4DV4F 3BPDA 2XGQA 1M1GA 4HR2A 4YUDA 1Q4RA 2LXUA 1ZBSA 3HHLD 4AYBL 2LDIA 1FKAF 4XLNA 3QQCD 2Y0SD 2KB2A 2P6SA 2YTCA 1R27B 3UDVA 3T02A 2O5JA 1F2GA 2OPRB 2WBMA 4ZP7A 2QX0A 2HIQA 4KAWX 2ZUEA 2D41A 1R8HA 2HNZB 3FFIA 4FYVB 4CLTA 1SC4B 2V8GA 3EE3A 5E7OB 2V94A 2ZKTA 1TWHC 4K0KJ 3EPIA 1BGXT 3F0NA 1HNWF 2HMIA 3Q8VA 5BYSA 4QYZK 3GTQK 4NOIA 2VHGA 2JH3A 4LF9J 3S14K 4AXJA 1AW0A 3BSNA 1U25A 3V6HA 1JKHB 5A8KB 4BBRK 3EWGA 1R9TA 4IFYA 3R7NB 2V9KA 2DRAA 4YY3F 1RWUA 2VIHA 2BKNA 4C8NA 1SV5A 1WHYA 3OTEA 4CLFA 2W2OP 5C42A 2ZBCA 1EETB 4ZCLA 3QSIA 4F4AA 2NVYA 2X3GA 2YKMB 3DMJB 3IP0A 4HVZA 1TWCK 3LAJA 3DOKB 3O6QA 1C2PA 5AE3A 4A3LC 3V4IA 3DM2A 2A2CA 3L7PA 1JMTA 2W2QP 2GC8A 2O67A 4QQBA 5J2QB 1FKOA 5ETNA 1K83A 1QVFR 2G13A 4IQXA 4ECUA 2Q79A 1UVKA 4X64J 4C2MK 2LMIA 4JI6J 2BBEA 2XCQA 3GE9A 1HBOA 2WB4A 3JB9k 3CJQA 4A3BK 2BE9B 1SC1B 3MFIA 1UJ6A 3A4TA 4OINA 2RU9A 1RTZA 1H98A 2BJ7A 2B63C 2XCOA 3US5A 2KL8A 3ILLA 2VF3A 2IA0A 3K8WA 1FKPA 4DSIA 2WSEC 2JA5A 2O66A 2XMUA 4RUCA 2H65B 3DGVA 4EU0A 5KT3A 2O1PA 2D7SA 4J5OA 2FLLA 2FVPA 2VL1A 2D3ZA 2VBWA 1TVRA 4WFYA 3E01A 4MFBA 2LQ8A 2CDQA 2BJ1A 1LWCA 4NX9A 2C2EA 1IBCB 3QT7A 2C2MB 4J90A 2XSJB 1AFIA 2DNYA 2UUCJ 1UEVA 1T02A 2AYMA 2IAJA 2FHKA 2DY9A 1WCMA 4CQ1A 3RZOK 4ENOA 3O5TB 4C0HA 1LWFB 4P2MA 2K7JA 4JI8J 2YBVA 4LF4J 3LP2B 4P71A 1CJVA 2A6MA 3H59A 2JEIA 4HDHA 2AGPA 1IBLF 2Z2MA 1XERA 3OXLA 2J9DA 4EMDA 2KKHA 3PEHA 2H5JB 1REVA 4JBCA 2LA4A 3OSPA 2R93K 3MPVA 4WE1B 1SPBP 2IBKA 1N33F 2CQDA 3TRGA 4ZVSB 9RUBA 3MD1A 4ZVPB 3NS6A 3UCGA 2ADBA 1I3QC 2HGNA 4LFCJ 3GG1A 4A3DC 3M1VB 5CXTA 1NK7A 2HNDA 2QG9B 5JMNA 2HRUA 5CD4H 3BYPA 3VHQA 4B17A 3TTGA 5K14B 3RZDC 3PCOB 5KFPA 3M8PA 3P6YC 1O5JA 2HKEA 2YQ0A 3POTA 2HS4A 3CAGA 5D4NA 2DCUB 2W8KA 2FQQB 3S7RA 2BM1A 1UP1A 3Q3QA 2BOPA 3NBPB 2OD6A 2B7CB 4OYBA 3G9CA 4ECSA 5J1EA 4MKBA 1I5OB 3A3PB 3UN2A 2RRNA 2E1PA 4H4KA 2PIIA 4DSJA 3FQKA 3NGSA 1FDNA 1YJUA 3BBFA 3TAPA 5J2PA 2L9NA 3PHTA 3CVKA 1OQ3A 4C8MA 2YNIA 2IC3A 2GVZA 2MKCA 3SBMA 4YB7A 1Y4ZB 4R25A 4WP8A 2Z2ZA 1MNEA 1EJ7L 4Y3CA 1VQ6S 2C2DA 1TL7A 4TKTA 3ONQA 2AV5A 2RUSA 3W2WA 3FKIK 4KGKA 1FD8A 1F0XA 3MM7B 1SC6A 3HI9A 5FIIA 5T14A 4DX8H 4EI2A 1U26A 3RYLA 3KLIB 3H3VD 2CNKB 1SMYA 2GAGC 3FQLA 3AD7C 3QLHB 4OYWA 3EGZA 4EFAC 2X1FA 2UUWA 2XLJA 3HKZL 2OUGA 4RW8B 3N79A 1S1VB 1V5VA 4DR3F 2QA2A 1UFKA 1TWFC 1N6QB 1YZ6A 3BKTA 2XEXA 1NK8A 2E2IK 3K8VA 2B6AA 3TEGA 2HFNA 4Y52C 2H3EB 1HW8A 2CZVC 1U09A 1BQNB 1S1XB 2V4QA 2C1EB 1FXLA 3QATA 4ZPBA 2Q6CA 5EGEA 1JLQB 3BH6B 3HCXA 2BJDA 1AA1B 1R3NA 5B0EA 3A12A 1I3OB 2V4JA 4OZ5A 4FXVA 3HLUA 3PO3K 4DUYJ 5G4DA 2A18A 1FNOA 3HVAA 1PC4A 1KOHA 3GEIA 2DR7A 1S48A 3KJVA 4WP9A 5K8PA 2EXUA 5C25A 4JYAF 5KFRA 2AQ4A 3V2UC 5KT2A 2LA6A 4YN3B 3GV5B 2IBOA 3W60A 1RWXB 2E2HC 3MR6A 1WUUA 3S1RC 2V8PA 4JI2F 5IYBK 4RMFA 3AQOA 2MZ1A 4MAKA 3BSAA 4KJIA 1ACMB 2AZ1A 2CQCA 3RR8A 1VRQC 3NNHA 2KFNA 5IM0A 4IG3A 4B3MF 1SIWB 3NWGA 4E0DA 3FMBA 1TV6B 4DCPB 3UPFA 3ZZRA 3IBCB 4PXDA 1WC0A 1WQHA 5HQMA 3R5GA 4CYUA 3MI7X 3DOLA 2R7ZA 4K4ZA 2PEHA 5E0OA 2N3LA 1H0HB 3V6JA 2HQCA 2HGMA 4C7QA 4KM9A 2XGPA 3EVWA 3UCUP 2ZVSA 5C5JA 3RG6A 3RAQA 3RBDA 1DCOA 4DV0F 2K7KA 4DSKA 3PEJA 1H3DA 1HKAA 5FLXY 2ZZMA 3EGWB 3CD0A 4DMZA 2VJVA 4JI0J 2VA2A 5DETA 1UMJA 2HFUA 5HMZA 1XMBA 3QBCA 2UXBJ 1FI4A 4WU3A 5CHCB 2MKKA 1RCOB 3IMQJ 2HIYA 1N52B 1CULB 1CJTB 2XHCA 1ZXOA 2VG5A 4MYUA 3GTGK 3F41A 3HOWC 3CDWA 4LSLA 3DRRB 4PQUA 3LTOA 2JA7K 3RAMA 2WOMB 4ILLA 5HJXA 3KOAA 3DLGA 5L9NA 3M8YA 4G0UA 2V2QA 3DGPA 2WAQL 4RNNA 3CC4S 4O0NA 1WNEA 1HA1A 4P6QA 4DDFA 5H1SV 1AYEA 1Q95G 4KE5A 4TXSA 3TZWA 3MMAB 4KGXB 3KLVA 1VYAA 1IM6A 3RW6A 3DN9A 3KDOA 4XIUA 3K89A 1UEKA 4DN0A 3U27A 4LREA 4KTQA 2BJ3A 3TUPA 2N82B 1RAOA 1N36F 3D54A 5HBMB 3GFYA 2B9YA 2R8HA 2NR0A 1L3VA 3JTNA 1RWOB 3PJWA 4A3GC 4FNHA 2RIJA 2QO3A 1HI1A 3L3CA 3I96A 4MIBA 4DR4J 3FUYA 4CNYA 1S0OA 2IMWP 1O27A 2FVQA 1KN6A 2NVXK 3M05A 2FVRA 2FJDB 3V4GA 4YP3A 3QAUA 3G71S 2YXLA 5HVHA 3IRWP 1EB0A 3KK2B 2F65A 3PR4A 5L1JA 2D6FC 3TANA 3G87A 2PD1A 1HBNB 4ZMMA 2ZWPA 3HSDA 3ISZA 3V6DB 3OEPA 3TX8A 1RUSA 4AFFA 1S99A 3MEGB 4K4UA 3ET6A 1H73A 4ID5A 1OWXA 2JL9A 2CJYB 3M2RA 4MK8A 3LP0A 4KO0A 3SV3A 4QU6A 1YNNA 4CNZA 3MR3A 2FJAB 4LT6A 3B54A 5TJ3A 2FLOA 1Y1VK 3ERED 3MECB 4BHQA 4DV4J 3Q83A 1LKZA 5T7LA 4RX6A 2E7VA 3I4PA 2MQOA 4ES3A 3I4MC 4C97A 1F3VA 3Q24A 4MIAA 3HSJA 1ZM9A 2C28A 2ZZTA 2ZH6A 4J91A 4B02A 1RADB 3D66A 1NSPA 2Z56B 3RB3A 4MH8A 3GB0A 1U1PA 3OFFA 4NXMJ 2XYGB 5E33A 4NCBA 5KFOA 4EK2A 1D3WA 1WTFA 1XEZA 2KXHA 2YWGA 2JEFA 4UY8T 1PG5B 2XULA 3DXBA 4Q8EA 2HRTA 4AQYJ 3PVXA 2QN6B 3MM9B 1NK9A 1TMMA 3CCMS 3K7AK 1IBAA 5B7WA 1XMQJ 1SQFA 1UZHA 3LWMA 1QUVA 4RU2A 2ASDA 5DG7A 2VBXA 4F4WA 3CD5A 1VQ7S 1OMSA 3ISNC 4F36A 3GTQC 4HACA 3PW7A 4TLRA 2KHDA 2RS8A 3S14C 1VRUB 2MDAA 1QAJA 3UQSA 2L41A 5F3TA 1SI9A 2JEGA 2HVIA 2DK2A 4RW6A 3FSYA 4BBRC 1RXOB 3PACA 3QGGA 2P9GA 1BMQB 4NA3A 3PIPQ 2P8TA 4FF2A 2VPZB 1T9TA 2ZWOA 2DBBA 4CCHA 3JSYA 1OYDA 2JX2A 1TWCC 1XBWA 4G65A 4I1TA 1HW9A 4I6WA 2FJEB 5KG3A 3WDOA 2H1YA 2MHEA 3W2VB 2QLXA 2YQ3A 2VZ9A 2ZE2A 3R97A 1HNIA 5CQGA 2K8GA 2HHTA 1TKXB 2GA7A 2RQMA 2CQ4A 1HPZA 3BGFA 4A93K 1ZAXA 3FZ2A 5AT1B 3ELHA 3GDZA 1I94J 2C2OB 1S1UA 1I6VA 2DHGA 1JJCB 2VH7A 1X4AA 3NGDA 4ECTA 1S0MA 4ED6A 2GW8A 4C2MC 1Y11A 5BYRA 5F8JA 1FDDA 3C16B 1VJQA 2VA3A 2R42A 4A3BC 1PJ7A 1IW7A 1YITS 1RDRA 2EFOA 3I82A 1LXJA 3TA2A 1PO6A 5HATA 2J9DE 4YHHF 1JLFB 4UF4A 3LH2S 1UEUA 5LL6d 3HF5A 2WSCC 3IA0A 2M8DB 1IXKA 2LP4A 3RZAA 3U02A 2EG1A 4B3SF 1G1XA 1PYTA 3G6YA 5HJYA 1HFEL 3D1OA 2YKNA 2KHCA 4X4RA 3EZ5A 1ROFA 4YB1P 3TUZC 1FDAA 5D4PA 2CWXA 2DR6A 4BC7A 3HHLC 1IBLJ 5L1IA 1CVJA 3JAMU 4GKJJ 3R3TA 4KPCA 5A76A 2L48A 1PCAA 5CD4A 4OYIA 4P10A 1SIZA 3S6EA 4RBUA 4K5RA 3PW5A 2E1CA 1FXDA 4JI1J 4L76A 5CHPA 4F4KA 1UTAA 5I42A 2XMJA 3G4CA 4O44A 4DR2J 1FJEB 1VQYA 1RK8A 4ED2A 4LF5J 3AAWB 5LOQA 2R93C 4OL8A 2W7VA 2B4VA 1Q8IA 2HWHA 4O3RA 3OJUA 4X66J 1G2EA 3G8QA 3FDSA 3KHRA 4BY1K 4ED1A 5HMWA 4UOFA 2KZZA 4XSXA 2HWTA 3CJ3A 2VQFJ 2PMHA 3CT9A 1VLOA 2VKZG 5BJRA 4ZITA 1B0VA 1CG2A 4YR2A 1Y3KA 4GTEA 2JA6K 1NPKA 3OUYA 4JV2A 3S16K 3TARA 4DL0C 3HOUK 1UPPA 1GE9A 4U8YA 3T00A 4OYAA 2OPSA 1R7IA 1BLUA 4LF1A 4X4TA 2DGXA 3HVTB 3LOUA 2EC0A 1FJ7A 4N76A 2DXDA 4P75A 1RU1A 3J80U 2FJXA 2H9ZA 4XSZA 1M5VC 2Q6BA 2EWHA 4IOBA 3QJLA 1IWGA 2GMLA 3GTKA 3H2VE 3S2HK 3PX6A 1A0OB 4OJHA 2VC0A 1WC1A 4OX9F 4YOEA 4JP8A 3RB0A 1RTIA 3D2WA 1DZ5A 2UVVA 2C3YA 1AT1B 2LU2A 4LF2A 2P5VA 2N4CA 5DQIA 3FKIC 3CC7S 4DDQA 3TJAA 3J7ZT 3H5SA 3M30A 3DRPA 1PKUA 5HROA 3OPKA 4ZIWA 3ILOA 1X4DA 4DR6F 2JLGA 2JC1A 1QLNA 2CJQA 1HHSA 4MKYA 2MTLA 2DXFA 1TKZA 4JV5F 4A3IK 1RWVB
chains in the Genus database with same CATH topology
1WOOA 3GEHA 3GEIA 1PJ7A 3GSIA 1V5VA 3AD9C 3TFHA 2GAHC 3TTGA 1XZQB 1PJ6A 3ADAC 1WOPA 1XZPB 1YX2A 3GEEA 3GIRA 1X31C 3AD8C 1WORA 1WSVA 1VLOA 1WSRA 3A8JA 4PAAA 2GAGC 1VRQC 1PJ5A 1XZQA 5L46A 3AD7C 1XZPA 3A8KA 4P9SA 3TFJA 3A8IA 4PABA 3TFIA 1WOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOO A;  3GEH A;  3GEI A;  1PJ7 A;  3GSI A;  1V5V A;  3AD9 C;  3TFH A;  2GAH C;  3TTG A;  1XZQ B;  1PJ6 A;  3ADA C;  1WOP A;  1XZP B;  1YX2 A;  3GEE A;  3GIR A;  1X31 C;  3AD8 C;  1WOR A;  1WSV A;  1VLO A;  1WSR A;  3A8J A;  4PAA A;  2GAG C;  1VRQ C;  1PJ5 A;  1XZQ A;  5L46 A;  3AD7 C;  1XZP A;  3A8K A;  4P9S A;  3TFJ A;  3A8I A;  4PAB A;  3TFI A;  1WOS A; 
#chains in the Genus database with same CATH topology
 2C3U A;  3AH6 A;  3D4J A;  5C3E K;  2Q43 A;  3BBB A;  2E2I C;  3SQG A;  2G0C A;  2R2U A;  3HKZ D;  1SFO C;  4LRB A;  2F7V A;  3R9L A;  2UXD J;  4ILM A;  3PO3 C;  4U7U K;  4UQG A;  5B0F A;  1MN9 A;  4MQ9 A;  5I4M A;  5LMN F;  3ZZY A;  1O29 A;  4KMH A;  4Y28 C;  4GTA A;  1KDN A;  1RGV A;  1YZ7 A;  1WEZ A;  3PJ9 A;  2B9W A;  2ZEJ A;  2E44 A;  2UZA A;  5KFQ A;  3T1H F;  3ILI A;  4I67 A;  1FO1 A;  4A8X A;  1QE1 B;  2ASJ A;  2YNF A;  1JQG A;  3Q2S C;  4Q4Z A;  1QSL A;  2J8S A;  1RWM B;  1WJ9 A;  2ZJR Q;  2E29 A;  1FWL A;  3J80 Y;  1FRI A;  4IFY B;  2CZ9 A;  1Q78 A;  3W5X A;  3WIV A;  3H2U B;  3IRX B;  1NHV A;  4L72 B;  4CO0 A;  1NXI A;  3M6X A;  3HOY K;  2CDR B;  3ZZ0 A;  4TQS A;  2GGP A;  4DV0 J;  1LFW A;  4I69 A;  4JI5 J;  1HWL A;  3OVA A;  2FC9 A;  3C3L A;  1J6V A;  5F8M A;  3KHL A;  4ECX A;  5U47 A;  4HI2 A;  1QSY A;  2MQN A;  2M88 A;  3J7A N;  1N5S A;  4R0J A;  4HTI A;  1RU0 A;  1FES A;  2MKJ A;  3RTV A;  1HBO B;  1TL1 A;  3GJS B;  2FB0 A;  4WZM A;  2PEB A;  1RTJ A;  3W8G A;  2WZ1 A;  3OFG A;  2E9T A;  1S76 D;  4ZLL A;  4B3R J;  1IKY A;  5KFM A;  4OI2 A;  1HYS A;  1F6T A;  4WYW A;  4JV0 A;  5D0R A;  2ZH1 A;  1Q8K A;  2XC9 A;  2R7U A;  3GTG C;  5FJ4 A;  1UVL A;  2Y9H A;  2I8E A;  4U95 A;  3MML B;  2ZOG A;  2JA7 C;  2IVF B;  2R8I A;  4C9D A;  3OXF A;  3BN7 A;  4MFB B;  1G7C B;  4OLP A;  4DCJ B;  1H74 A;  5G0R B;  2BRL A;  3G4S S;  1X4E A;  2Z0G A;  2DY1 A;  3SXL A;  2CFX A;  1SUQ B;  2XS2 A;  4PXC A;  1KD1 T;  4CTA A;  2QLF B;  4DV3 J;  3FOF A;  5EWE A;  4ANE A;  4FF1 A;  2ZH8 A;  2DH9 A;  1S79 A;  1B4A A;  2WAQ D;  4A46 A;  5DM6 Q;  2AMC B;  4IR1 A;  1U47 A;  1G4C A;  2YWK A;  4QR2 A;  2AJQ A;  2KG1 A;  1QTN B;  1CJV B;  1KEK A;  2E5H A;  4M5D A;  1HMV B;  4DL7 A;  1U1O A;  3MM6 A;  2DH8 A;  1UPM B;  1N8R T;  4RUA A;  3I56 S;  1D9D A;  4DQI A;  3FHZ A;  1VH2 A;  2DNR A;  1PAU B;  4B9S A;  2GSN A;  1HNX J;  3P5T L;  4DV1 F;  2UVU A;  3D1Q A;  1BJT A;  2NVX C;  4N56 A;  3BR8 A;  3OR1 A;  1YWX A;  5ETR A;  4F0K A;  4C8L A;  2F4V J;  1T0T V;  3DFE A;  5LXR A;  4YEA A;  1P1L A;  2KT3 A;  1RT2 A;  1SC3 B;  4QIG A;  2RRB A;  1X60 A;  2HUR A;  4NRT A;  3I55 S;  4A3K K;  4OIQ A;  2ZBR A;  1YJR A;  2IMO A;  2M5Y A;  2FDN A;  1JLB B;  2VFS A;  1QUP A;  1XXB A;  5DO2 A;  3Q8S B;  4WBF A;  3PIO Q;  3TZZ A;  1FWP A;  1M1H A;  1Q5V A;  1DQ9 A;  3EQL A;  3F73 A;  5JUM A;  3MM8 B;  5IOS A;  4U6P A;  5HL7 Q;  4FYD A;  1KP6 A;  3UE2 A;  1VC6 A;  1S1T A;  5J2P B;  5KOX A;  3EGN A;  4TY9 A;  2DT9 A;  3TWZ A;  2YNI B;  1Y1V C;  1UVI A;  2DGV A;  5E2Q A;  3Q8P B;  1LFP A;  3GPA A;  2GVZ B;  3EPG A;  2B5J B;  5A0Y B;  4OV1 A;  3JS9 A;  1HQM A;  4NLQ A;  2RRA A;  2QSF A;  3ORE A;  1T3O A;  3OTD A;  2RQC A;  2NLW A;  3EXY A;  3VA7 A;  4F25 A;  1VLY A;  1VGY A;  1KFS A;  4RNF A;  4ZH4 A;  2OEK A;  3T5H A;  3W2W B;  3U1N A;  5KOW A;  2BKO A;  2OPR A;  1CQM A;  5L46 A;  4GFQ A;  1SFO A;  1X5T A;  3CO0 P;  4U67 Q;  1NAQ A;  3KJQ B;  4O3P A;  4DX7 A;  3H0G A;  5HL8 A;  1CJU B;  3ZTR A;  2HNZ A;  3I0S B;  4CLP A;  1HBU B;  2UVW A;  1NCL A;  2WW4 A;  2KWA A;  2VOP A;  5CYM B;  1JQW A;  5K9F A;  2DEI A;  4DQQ A;  4OX6 A;  1Q8B A;  2MLZ A;  4Q45 A;  2ZJQ Q;  2XTJ P;  1DFD A;  3MUV P;  2HFS A;  1QAY A;  3PXG a;  3CF5 Q;  1JKH A;  5A8K A;  3A8K A;  4TU8 A;  2XZD B;  3KJF B;  3QSY B;  5KT7 A;  4ELV A;  3G82 B;  3M32 B;  3TP2 A;  1TL3 B;  5CH7 B;  3NGK A;  2DNZ A;  1EET A;  1V9O A;  5B0B A;  2YKM A;  3DMJ A;  2ZM6 J;  1NDL A;  2UV8 G;  2JSX A;  2Z2Y B;  4RNO A;  3KJV B;  3EZU A;  3DOK A;  1KWM A;  4ED4 A;  3ZTO A;  3QGP A;  2K3K A;  2YWF A;  2FUG 9;  3PHE A;  1NJI T;  3Q8Y A;  1UL3 A;  3A3O B;  1WWH A;  4FXW A;  2XMM A;  2I0X A;  5J2Q A;  4KGM A;  2R7O A;  1U45 A;  4I2Q B;  1C1B B;  4QR0 A;  3GSI A;  1WEX A;  4XK8 C;  3KHG A;  1MRO B;  4JI7 J;  3PTW A;  1K1S A;  1R31 A;  1IR1 A;  2W1B A;  3GIK A;  3I4H X;  4DSL A;  1Q82 T;  1MWQ A;  4A93 C;  1S6O A;  2Y0B B;  4YHH J;  1KS2 A;  3GTY X;  4HHH A;  3NLC A;  5DQG A;  1WI8 A;  3G2X A;  3OVS A;  2FPH X;  4DPO A;  4MKV A;  3TW0 A;  2FGO A;  5CZX A;  5DJB A;  3RGI A;  3I9V 9;  2EFG A;  1RTD A;  4OZ0 A;  2KM8 C;  1NJX A;  1IBM J;  3BGR B;  1S6U A;  1B4S A;  1TU0 B;  4G0V A;  4USK A;  2XSJ A;  1NLK L;  3C15 B;  2ZOF A;  1L3T A;  4QIV A;  1YBA A;  2F8E X;  3K7R A;  3TQ1 A;  4Z2X A;  1UW4 A;  3OTC A;  5IQQ A;  2IHR 1;  5JXS A;  3RAX A;  4ETX A;  1J5O B;  3AA8 A;  5L9X A;  1WKK A;  3LP2 A;  2W4D A;  4HHJ A;  4DG1 B;  1B0P A;  4XDD A;  1YLX A;  1P8G A;  4PQU B;  2IDE A;  1IBK F;  4LSZ B;  3CCS S;  1SH3 A;  2H48 B;  2XB2 D;  5J2M B;  1U1Q A;  1WDT A;  1SQE A;  1RP5 A;  2UV8 A;  4FP9 A;  1XNR J;  2DHA A;  3DGP B;  2E7X A;  4WE1 A;  2QLB B;  2AX0 A;  4QWE A;  4RPF A;  3H40 A;  4RUB A;  1T05 A;  4NLY A;  3M1V A;  1R8C A;  3LA0 A;  3EDR B;  3VGU A;  4DL6 A;  3FBF A;  3C8Y A;  5K14 A;  3KK3 A;  3THT A;  5AJ3 J;  5EDW A;  4LQ9 A;  3VVU A;  1VBY A;  5KT4 A;  5HVF A;  2FJB B;  1S59 A;  2AWZ A;  2D3O R;  3CJS A;  1X9M A;  3KG4 A;  2G1H A;  4BY1 C;  2YKQ A;  4DR7 J;  2MEW A;  2CQ1 A;  3EVM A;  2E5I A;  4X65 J;  1MMN A;  4KSE B;  3RBE A;  3PW4 A;  3NBP A;  2W7P A;  3I87 A;  2PMW A;  2VFV A;  1NH7 A;  4Q5V A;  1XMO J;  3IC1 A;  3M8Z A;  5M5X K;  1WOR A;  4ZDN A;  2OPP B;  2QEX S;  4HL9 A;  2JA6 C;  1Y5L B;  5BYQ A;  2FGC A;  3S16 C;  4ES1 A;  2C3O A;  4CI0 B;  3DXS X;  3HOU C;  4I4B A;  1RQ0 A;  2IFX A;  2AEM A;  1YRX A;  2VQE F;  1H7X A;  1FNX H;  3M9M B;  4Z37 A;  4ED7 A;  3ZNU A;  3BGO P;  4NL5 A;  2UUA J;  3N3Y A;  4GZY A;  4J3N A;  1YSJ A;  3KLG B;  4PPZ A;  3WX8 A;  3C14 B;  3GJQ B;  1OS5 A;  3M2R B;  5CYJ A;  3LP0 B;  4CO1 A;  3PR5 B;  1IWA A;  3S2H C;  3OW2 R;  3IAS 9;  5GAD I;  1FRL A;  4K2X A;  1X4H A;  4J9L A;  1JWW A;  1DTT A;  2K2P A;  1C4C A;  2YPY A;  3QLH A;  1LEO A;  5M3M K;  4OHZ A;  3J7Y U;  5CAB A;  4RW8 A;  2KVI A;  4TNO A;  1U24 A;  3H2L A;  1S1V A;  2OHD A;  1YJ7 A;  4AL5 A;  4YG2 A;  3ZNJ 1;  1N5T A;  1N6Q A;  2QTW A;  2ZZN A;  4K7Q A;  3HHN B;  1WKL A;  2QV6 A;  3D6F B;  1KQF B;  1BQN A;  1S1X A;  4OHV A;  2CAD A;  5KFI A;  2V67 A;  2N3O A;  1JLQ A;  1Q1K A;  2NXU A;  2OFH X;  3UR3 C;  4A3I C;  4GO7 X;  4YB5 A;  3FVY A;  2EBG A;  5C3E C;  2ALY B;  1CEZ A;  4IFV B;  4WFX A;  1UVM A;  2GMH A;  1NJW A;  1XTZ A;  1ZA2 B;  6AT1 B;  2O01 C;  5IYC K;  3I31 A;  4LFA J;  4IRC A;  4NXN J;  4G1Q B;  4DL2 A;  2QJ3 A;  3DDN A;  3ENQ A;  1X9S A;  1I50 K;  3HDS A;  4Y2M A;  4F04 B;  1D9F A;  4DX5 A;  4DV6 J;  2WB1 L;  4UOG A;  5H9F J;  1VQ9 S;  2A2D A;  5A8W B;  1XNQ J;  1WC6 A;  2QA1 A;  2BJ8 A;  4K0K F;  1NK0 A;  4ALZ A;  1QAI A;  2J0X A;  4LSN B;  2VIC A;  1VCT A;  1MMD A;  3VAH A;  1KTV A;  1Y3J A;  4J9K A;  1TV6 A;  4LF9 F;  3I32 A;  1V5I B;  1GFW B;  1VK8 A;  4O3S A;  3MR2 A;  2J0W A;  4KHM A;  4RW6 B;  1QAX A;  2E66 A;  4E2F B;  2R4F A;  5KT5 A;  3OLB A;  2AJ2 A;  3FBE A;  3R5J B;  1F7U A;  2UVR A;  2MKS A;  4F3Q A;  2VBZ A;  5DRK A;  3HOY C;  3OTO J;  2W2M P;  1HNZ J;  1U8W A;  3MMB A;  4B9M A;  1XPP A;  3RW7 A;  2XO6 A;  4A3F K;  3IR7 B;  1UCN A;  1GTE A;  2HFV A;  3PO2 K;  2XCR B;  3HT0 A;  3AD9 C;  2IDL A;  1T7P A;  2MKI A;  1HNI B;  2QZ8 A;  1JJH A;  2DNP A;  1EHW A;  4ZKA A;  1O28 A;  1S7I A;  1VQ4 S;  3CDA A;  2AJF E;  2OAU A;  3CIZ A;  5FDL B;  1VIS A;  2E2J K;  2BW2 A;  4FZB A;  3BRE A;  1CUL A;  5IOQ A;  3ENW A;  4C3M A;  4DLE A;  4K2J A;  1HBM B;  4B3O B;  1CJT A;  4M63 A;  4BDP A;  1J2V A;  3VGS A;  2PHC B;  3BPS P;  3H5U A;  4WWS A;  4JI6 F;  5B0C A;  1HI0 P;  2HFZ A;  3DRR A;  1EQR A;  2CVI A;  3GCW P;  2W4P A;  2WOM A;  4Y00 A;  2HLT A;  3SSQ A;  3CCQ S;  2YNG A;  4Y34 A;  3BP8 C;  4ECW A;  2RDI A;  3ZC4 A;  4B9L A;  1XN9 A;  3MMA A;  2PFF B;  2POK A;  5JJB A;  5ITH A;  4J37 A;  2M52 A;  1KBR A;  2Z57 B;  1B4B A;  5HN0 A;  1ULR A;  3LWL A;  3OTB A;  2M0G B;  3MEE B;  1KVK A;  5HBM A;  4HYK A;  2H54 B;  2ZH7 A;  2M7S A;  1TL4 A;  4O3O A;  4M95 A;  4P5B A;  2UUC F;  3GII A;  3M7V A;  4KAR A;  4A8W A;  3LGH A;  3NCQ A;  2HBR B;  1D09 B;  2CPH A;  2ZNY A;  3AFG A;  2GHW A;  1SJQ A;  1FDB A;  3ETM A;  1J6W A;  5F9L A;  4LF4 F;  2JOQ A;  5I42 B;  9ATC B;  1SJ1 A;  2ATC B;  4DQP A;  1TKT B;  1UWB B;  2R92 C;  3V4M A;  2JA6 A;  1QJH A;  2JVR A;  1J5E J;  1RT5 B;  5T41 A;  1FRX A;  1RZM A;  3W64 A;  3CUN A;  4N77 A;  2JWN A;  2MQQ A;  4LFC F;  3V6D A;  1XZP B;  5ETK A;  3WC0 A;  1PBA A;  2RQ4 A;  2NPI A;  3NNA A;  4ZA1 A;  4A3K C;  3GTJ K;  3CB4 A;  1R8A A;  5EN1 A;  3A8J A;  1C1C B;  1U0H B;  2HBQ B;  3KMS A;  4B3T F;  4EYH B;  2WSF C;  2LQJ A;  3M4X A;  5KFL A;  2VPW B;  1VQM S;  1VOM A;  1UFL A;  2XNQ A;  4RW9 A;  3W9J A;  2W2N P;  4QBU A;  2AZ3 A;  1N0U A;  1S49 A;  4OZ1 A;  3FMW A;  3N4W A;  1HI8 A;  3DYA B;  4GC7 A;  2ILY A;  2HHW A;  2XZT B;  4Q2M A;  4Y6I A;  2DYA A;  3FC9 A;  4WPA A;  4ED5 A;  3TOQ A;  1U6B A;  4DI6 A;  5BR8 J;  2GSU A;  4P74 A;  3NAH A;  2QL5 B;  1RA6 A;  4WIQ A;  5EX3 A;  3OD2 A;  2A6E A;  1NM2 A;  1RCX B;  3DRY A;  1RHQ B;  3MCS A;  1NHU A;  1FD2 A;  5LSL A;  2QA4 S;  5IT9 U;  4YR0 A;  3KK1 B;  4N5S A;  4KM8 A;  5EUH A;  1TKZ B;  4Q44 A;  3V5R A;  3AOD A;  3BKF A;  1ZS6 A;  2QLW A;  3W66 A;  1VJW A;  1RWW B;  3CJR A;  2OI2 A;  1JLA A;  1RT7 B;  3JYT A;  4LR2 A;  3P8B B;  1LW2 B;  2B7B B;  5M2P A;  1E6V B;  4ZVF A;  3OHB A;  4ZVH A;  3CQZ A;  1HAR A;  1TWA A;  3AA9 A;  2DGQ A;  1RT6 B;  1K1Q A;  1N34 J;  2PT0 A;  3HVW A;  1A7G E;  3VV2 B;  2QSW A;  1Q81 T;  4MKA A;  3W2V A;  4LBP A;  2E5G A;  2IA6 A;  2X3D A;  1HNV B;  1TKX A;  1HR0 F;  1KLM B;  1JJ4 A;  3GTM A;  1T9W A;  2KT5 A;  3PX4 A;  1ZAV A;  3GZ7 A;  3O1L A;  1YX2 A;  4B9T A;  3N9U C;  2UUB J;  1WEY A;  3K5N A;  3AH5 A;  4LR9 A;  3MPY A;  4K4V A;  4IH6 A;  4LK1 A;  3A13 A;  3V6K A;  2GIR A;  3H5Y A;  4DFJ A;  4BBS K;  4JOU A;  4X4O A;  3C16 A;  1FWK A;  5KG5 A;  1NZ8 A;  2NS1 B;  1T03 B;  1IL2 A;  5CYQ B;  4ELU A;  1J98 A;  1MU2 B;  3IWL A;  2GGP B;  3T3F A;  4OZ2 A;  2DIU A;  6FDR A;  4ZJO A;  3LGM A;  2DGW A;  4Y2K A;  2PA8 L;  2HK2 A;  5KAK A;  2M9K A;  1P9Y A;  3UVJ B;  1YK9 A;  1YVF A;  2LU1 A;  2FJW A;  1EFW A;  3HFV A;  2MMY A;  1VQS A;  4B9U A;  1OY8 A;  2YKP A;  3GCX P;  3C66 A;  4A8F A;  1WD6 A;  3QWP A;  2ZHO A;  4RLE A;  2ADC A;  2DGT A;  1I6H K;  1O2A A;  5IT9 Y;  4RKU C;  1TL1 B;  1IBK J;  1KRP A;  1NUE A;  2VU5 A;  2R8G A;  1URR A;  4DV5 J;  1FE0 A;  3ZZT A;  3TR5 A;  4JI0 F;  1SL2 A;  3HHL B;  4M5L A;  4WP3 A;  3GTP A;  2UXB F;  2XI2 A;  3GIR A;  5IYD K;  1HWK A;  1LNQ A;  3MM5 A;  2KTQ A;  1CQN A;  4LF7 J;  3OL6 A;  1RWN B;  3FCH A;  4FM9 A;  2WCX A;  4OJG A;  1K44 A;  3CDU A;  3K5M A;  4U7C A;  2EFV A;  4CH1 A;  1VIO A;  3PYE A;  2R92 A;  3LGN A;  2GV1 A;  3P45 B;  2XMT A;  3IWX A;  2XYH B;  1EQM A;  4CTA B;  1FJG J;  1FRH A;  4Y2C A;  1FX2 A;  4DU7 A;  1C0U B;  3IGV A;  3T1Y J;  4F4Z A;  3GFZ A;  1VBX A;  3OL7 A;  4QPT A;  1WG5 A;  2FQO A;  1Y1W A;  4YR3 A;  3FK4 A;  1KVI A;  3MM6 B;  5KFX A;  2F40 A;  2D69 A;  3QO9 B;  3SFU A;  4AND A;  2CPD A;  3D5M A;  3MAH A;  2QL9 B;  4HT7 A;  4N41 A;  3Q23 A;  4DR4 F;  3GTO K;  1EP4 B;  1GEH A;  5E3Q A;  1T11 A;  5DQH A;  1FT8 A;  2C2Z B;  3CCZ A;  3OR1 B;  1HHQ A;  4CZC A;  3NS7 B;  1WHW A;  4M5H A;  2UXC F;  3HVT A;  1IJE B;  2HQD A;  5ETT A;  5M5W K;  3GV8 B;  2VDI A;  1FFS B;  1RAH B;  3H42 A;  1Q53 A;  2ZKU A;  2GNK A;  3D6M B;  4I0W A;  4DV2 J;  4KH0 B;  3R2D J;  2IJF A;  3H90 A;  1DCH A;  1KSP A;  5GMD A;  4NAS A;  1U1M A;  3A8I A;  1OY6 A;  4WJ4 A;  4UOH A;  3R6L B;  2J6S A;  2A6O A;  3CCW A;  1TTH B;  4NLG A;  1LK5 A;  1WG4 A;  4J9M A;  4LBI A;  4X2B A;  3OXG A;  2VPX B;  3I9Z A;  1TFW A;  1RAC B;  3AD8 C;  2QC3 A;  1S9E B;  4OYZ A;  4X84 A;  4ZK7 M;  3QYY A;  1LW0 B;  1AUD A;  1CBK A;  2VC1 A;  1FX4 A;  4UUW A;  2AGO A;  3ZZP A;  4PQA A;  1GMW A;  3GFH A;  2COL A;  3UDL A;  1GMV A;  3FSI A;  1DQ8 A;  1SKW A;  3AY0 A;  3E2E A;  4WYL A;  3O44 A;  4OLO A;  3MCM A;  1Q79 A;  3QFH A;  1R9T K;  2E9Z A;  3WX4 A;  1IKW A;  2HBZ B;  2J6U A;  4D3H A;  4C8Y A;  2NVY K;  3SDE B;  2JNJ A;  5I3U A;  3BN4 A;  4WTY A;  2YKO A;  1I6J A;  1YDL A;  2NPF A;  4NXM F;  4PYA A;  5A2Q Y;  2PI4 A;  1I51 B;  2OML A;  4J9N A;  4JK1 A;  4KMD A;  2SXL A;  1DLO B;  1K83 K;  1S12 A;  1JLC B;  1RTH A;  1I50 C;  2MB0 B;  3AJD A;  1JK9 B;  1QE1 A;  3AT1 B;  4OYX A;  3ETO A;  1FTC A;  4OHX A;  2HAI A;  2BKP A;  2HHQ A;  4GRS A;  2NYI A;  4AQY F;  3SI8 A;  4PRF A;  1XMQ F;  2MZQ A;  4MT1 A;  1MML A;  2MLY A;  3SCJ E;  2WB1 D;  2V2K A;  4NA2 A;  3ZZO A;  4ZCM A;  3IRX A;  2DTJ A;  2JA5 K;  1QDU B;  1GXT A;  4CM2 A;  1R0C B;  2NXN A;  1F2H A;  2IYG A;  2BE2 B;  4KRW A;  4FDF A;  4DPT A;  4C8Z A;  1G3O A;  3W62 A;  3HUL A;  3UN3 A;  2EK6 A;  1RT4 B;  3P3D A;  3UN5 A;  4TU7 A;  4KH1 B;  3DOM B;  5LXY A;  4YME A;  1C4A A;  2Z2L A;  4EYI B;  3M6U A;  4B08 A;  4A3J K;  4IO9 Q;  3FNN A;  4A3F C;  3LAM A;  3BGU A;  4NRU A;  2RHQ B;  4CIO A;  3PO2 C;  5KFC A;  2HHH J;  4ECV A;  1WCM K;  1XJW B;  1K9M T;  4L3N A;  2VUM K;  1ZA1 B;  3KLH B;  2DNH A;  4DFP A;  4H4M B;  2E1A A;  1S57 A;  4YFK A;  1Q16 B;  5HP1 A;  2DO4 A;  2E2J C;  4USI A;  2HEK A;  3PNI A;  4K59 A;  8RUC A;  1I94 F;  2V6S A;  2VJU A;  2CJA A;  1PIL A;  2X7I A;  4USU A;  2VON A;  2G2Y A;  3RB4 A;  3R8Y A;  1SL1 A;  3DRS A;  2XQC A;  2U1A A;  4TLQ A;  1RTD B;  2J7K A;  4NLX A;  1FEE A;  2CQ0 A;  2HZC A;  5DDQ C;  5G0R A;  1ZOT A;  1D8Y A;  1WKJ A;  3GWC A;  4DR1 J;  4QIF A;  3T5J A;  1SUQ A;  3TAM A;  4YS2 A;  4W90 B;  4IH5 A;  1TK0 A;  4G7H A;  5SUH A;  2CFA B;  3P96 A;  3TAQ A;  1L5U A;  4KDD A;  1HQ2 A;  1TZ0 A;  2CPZ A;  1GTH A;  5C24 B;  4PYD A;  3MTK A;  2HPU A;  2CNN B;  1HMV A;  2VPY B;  5DM7 Q;  2YU9 A;  3TJ8 A;  1NJZ A;  3HK2 A;  3OL9 A;  4GKJ F;  5E41 A;  4DS4 A;  2BXJ A;  2Z30 B;  1VQL S;  1DAR A;  4F26 A;  2XWX A;  1Z2L A;  4F3M A;  2EKY A;  1REG X;  5J1P A;  3TA1 A;  1T05 B;  1BS2 A;  4JI1 F;  1EIY B;  2F9D A;  3D28 A;  3H25 A;  1ZM2 A;  5KFD A;  1EKS A;  3SFG A;  1Q8L A;  1WEL A;  5KG2 A;  3KK3 B;  4DR2 F;  1LV5 A;  2JZ5 A;  4LF5 F;  4LR7 A;  4ZVE A;  2BE5 A;  2EK1 A;  3LPE A;  3EZO A;  4X4V A;  2I2Y A;  3EVO A;  4B9V A;  3O8W A;  2VBY A;  1FF2 A;  2JJ4 D;  4GTF A;  4QWA A;  2CQ3 A;  3S8S A;  4B3T J;  2J5A A;  4X66 F;  2R9L A;  1JLB A;  2QFI A;  3IBF B;  2HBY B;  3UDE A;  4CWB A;  3N0B A;  2I5J B;  1LQ9 A;  1QM9 A;  3OV7 A;  2NXE A;  2YWE A;  4N8N A;  2VQF F;  3GTJ C;  5LJ5 Y;  3MM8 A;  5IXU A;  2YNH B;  1DQA A;  1U1L A;  2QYG A;  4A3M K;  2ZUA A;  2DO0 A;  3THP A;  3E8O A;  3QX3 A;  5FLM K;  2C3M A;  4EBE A;  3J7Y I;  1SQG A;  2B5J A;  1T9Y A;  5A0Y A;  3G6X A;  1LWX A;  4DUZ J;  1S5Z A;  2FYX A;  2H5E A;  1E6Y B;  4V1A k;  2V8V A;  3QMQ A;  4CLW A;  4MEY A;  2YVS A;  3TNV A;  4QWD A;  4K4S A;  1U4B A;  1DTT B;  3V81 B;  1CJU A;  3I0S A;  4MTP A;  4K5S A;  5KFS A;  4FVC A;  1HBU A;  2RML A;  2LVW A;  5DS7 A;  4ZPC A;  1AB8 A;  2W9C B;  5CYM A;  1TWH A;  1N4L A;  4X4P A;  4G7O A;  1YIJ S;  4OI4 A;  3GR1 A;  3NS5 A;  4Y65 A;  1U49 A;  3T9N A;  2LFV A;  5D8H B;  4RU9 A;  3ZZZ A;  1I50 A;  2JC0 A;  4R8U A;  1R89 A;  2ZH9 A;  4HEA 9;  4OYM A;  4F2R A;  1RB0 A;  3G82 A;  3M32 A;  1TL3 A;  3QZ8 A;  2IIH A;  1KHV A;  3T19 A;  2AW0 A;  2DRD A;  1GNK A;  5KTQ A;  2DCL A;  4KKO B;  1DRZ A;  1VGX A;  4KFB B;  2R7Z K;  2FZK B;  2KVQ E;  3CE8 A;  3RJM B;  2JRS A;  1HR0 J;  2RH6 A;  4HHU A;  1RT3 B;  4YQW A;  3JSM B;  2VOO A;  4P9S A;  2CQI A;  4CH7 A;  2UXD F;  4ETZ A;  5E3P A;  1T94 A;  5HAO A;  3KLF B;  1JLE B;  4I2Q A;  1C1B A;  3S2D K;  3L7U A;  2J7W A;  1IM4 A;  2VKR A;  2KDO A;  3HHK A;  4K4X A;  1MRO A;  3MCO A;  2QMU B;  4PG7 A;  2WRM A;  2RUG A;  2PN6 A;  5K20 B;  4QYR A;  1TEL A;  4USV A;  4KHP J;  1IQT A;  3BM7 A;  1RI7 A;  3HOV K;  3H0P A;  1WOP A;  4URG A;  2LDY A;  4DPW A;  2VG7 B;  2B63 A;  4MYT A;  4MJK A;  3R27 A;  1F1B B;  4BBS C;  4QW8 A;  2RU3 A;  1NSQ A;  4PCQ A;  4KT0 C;  1VIX A;  1JIH A;  3MMB B;  1FCA A;  3JST A;  1ZYQ A;  3BGR A;  4R5P B;  4Y2I A;  2XMV A;  2BA9 A;  3A8E A;  4JI5 F;  1SVD A;  1V3S A;  3C15 A;  4A3D K;  1G6B A;  1X4B A;  2IJN A;  2ZDO A;  1GX6 A;  1EQ0 A;  1RBL A;  1N54 B;  1ZZN A;  1JLG A;  2PA8 D;  3CC2 S;  3DLJ A;  1RBO B;  1J5O A;  4DN9 A;  4DG1 A;  4M94 A;  3DU5 A;  4ZVO B;  5M2U A;  3CTR A;  4TY8 B;  4DSE A;  1BHN A;  3U1M A;  5J2M A;  3R2C J;  2YNG B;  4B3R F;  2LQ9 A;  1ZAW A;  3AXK A;  3CW2 C;  2Y8Y A;  2W7O A;  1T9X A;  2R7T A;  5IYD C;  3OT9 A;  5F8G A;  3DLK B;  2RQK A;  3NL0 A;  1U1N A;  2G2Z A;  2ACY A;  1B3T A;  1NRK A;  3MMC B;  1O8B A;  2D74 B;  1F9N A;  1I3Q A;  4Q0B B;  8AT1 B;  2BUN A;  4LQY A;  2XG8 A;  5AXK A;  2MHN A;  2XS7 A;  3QFW A;  3GJR B;  4LF6 J;  4Q43 A;  1JXL A;  4TYA A;  2R7X A;  2GMJ A;  4ITS A;  1FEH A;  4I2P B;  1U2C A;  2OH2 A;  4KIA A;  4UT4 A;  2GSO A;  2D3O 1;  1NK4 A;  4DV3 F;  1ZM3 A;  1ARO P;  3RR7 A;  2WVD A;  3NEK A;  2GO9 A;  4BCA A;  4L3K A;  2JLF A;  5F8I A;  1AUS L;  4QIW D;  3H7H B;  2F4F A;  4CH0 S;  4HH1 A;  3QIP A;  2UXC J;  2CPY A;  3I0R A;  4USJ C;  2VG6 A;  3BDP A;  2OPP A;  2O5I A;  2FZC B;  3D3B J;  5KG4 A;  2UU9 J;  3CMA S;  2DPJ A;  3W9H A;  5HVG A;  2XLK A;  1FRJ A;  3GTO C;  4USM A;  4FKY A;  1RAI B;  1HNX F;  1FFG B;  1RKJ A;  5F8H A;  4K4W A;  3NWR A;  3R1H A;  2ZIT A;  4RW7 A;  3BKU A;  5RUB A;  3KLG A;  3KNG A;  2F4V F;  3C14 A;  4YFX A;  5B0D A;  1S4F A;  1WAC A;  3DLH A;  4DEZ A;  3AJ2 A;  4X62 F;  4I6Y A;  4RBV A;  4LRA A;  3IPJ A;  2ZJP Q;  2H51 B;  1CS4 B;  3Q0A A;  3VZI A;  1SKU B;  4L6V 3;  1RSC A;  2V69 A;  2ZUF A;  4UY8 5;  4DFK A;  4KHR A;  4RW9 B;  5ETQ A;  2CPJ A;  2E1R A;  1RHK B;  3MOZ A;  1TWF A;  3AHP A;  3AB4 B;  3S01 A;  4WFB Q;  4A8O A;  1D0E A;  1EZZ B;  5GAD U;  3D9B A;  2QA4 G;  4ZCK A;  3MAQ A;  4IFV A;  4ZVG A;  1BE4 A;  4OI6 A;  4Y7N K;  1N32 F;  2UP1 A;  1R9T C;  2V68 A;  3EX7 B;  5B0G A;  3C6T A;  3H98 A;  4G1Q A;  2L9W A;  4NLS A;  2NVY C;  2OEM A;  4OX8 A;  2GJF A;  4NLT A;  1IQ0 A;  4WFZ A;  2XNR A;  5A8W A;  1FVS A;  3IGN A;  3BP3 A;  1NJY A;  2E2H A;  3T9Z A;  4WCE Q;  1OQ6 A;  3GR0 A;  1RU2 A;  1HQU A;  4LSN A;  4P2S A;  5M3F K;  4WIL A;  4RL1 A;  1RBA A;  1KQK A;  2RNE A;  4ELT A;  1JLA B;  3JYT B;  1VC5 A;  1HWU A;  4KV8 B;  5A8R A;  7FD1 A;  1U48 A;  1TP7 A;  3IM9 A;  7FDR A;  4P7V A;  3EUN A;  3M3Y K;  5L38 A;  1B64 A;  3BO2 A;  5C4X K;  5HMY A;  5AE1 A;  4LQ3 A;  2E5J A;  2BRK A;  3P49 B;  1RKI A;  4PXE A;  4Y0F A;  2AEJ A;  2JA5 C;  2YX4 A;  3OFE A;  2ZM6 F;  3KG1 A;  3BS9 A;  5D0E A;  1SKS A;  3E51 A;  4IO1 A;  4A3E K;  1WC5 A;  3PM9 A;  1JOE A;  1HWJ A;  3VQS A;  2CPF A;  1JB0 C;  3TJ9 A;  2DNM A;  2ZFH A;  5FDL A;  1UWA A;  2HHS A;  2R8K A;  4A3J C;  4K50 A;  2GVD B;  3T41 A;  1HBM A;  3NGT A;  4B3O A;  1S9F A;  2DH7 A;  1L3U A;  3GV7 B;  2HYI B;  1WCM C;  2B8P A;  4ZIV A;  4JI7 F;  2VUM C;  2GZO A;  4DPX A;  2NXJ A;  3GMG A;  3J7A 1;  5EGY A;  5H9E K;  3MR5 A;  1IR0 A;  3H8Y A;  4X4S A;  1BQX A;  2ZD1 B;  2ZC4 A;  5HK4 A;  3EXC X;  4NCG B;  2L08 A;  1R0B G;  3BO3 A;  4BLA A;  4DJB A;  4AT1 B;  2BZ2 A;  4D3G A;  4YB6 A;  2RJZ A;  2A69 A;  3QJP A;  2CG4 A;  3TI0 A;  2BVZ A;  1Q5Y A;  3CD6 S;  1OIA A;  2HNY B;  3D68 A;  1N48 A;  2WVF A;  1NSA A;  2RDD A;  3ITH B;  3VQT A;  1IBM F;  3MEE A;  3Q8U A;  4RJV A;  5KFV A;  2ZOM A;  1HIY A;  3W5Z A;  3Q8R B;  2OLW A;  1PYS B;  4KY3 A;  2YQ1 A;  1FNM A;  3RZO C;  2Z8Q A;  2NYH A;  5AXM A;  3WHI A;  3SZY A;  4FS2 A;  5IP9 K;  2R7V A;  2LYV A;  1OJ4 A;  3MM5 B;  1GH8 A;  2BJE A;  2DHH A;  3DC2 A;  3FJ2 A;  3JTO A;  4EEY A;  3QNW B;  1TKT A;  1R6Y A;  1UWB A;  4H4K C;  3MUR P;  2XM3 A;  1KON A;  4O4G B;  1RAG B;  5IOL A;  1XNR F;  4ECR A;  5L39 A;  1APS A;  1RT5 A;  2BQU A;  3OR2 B;  3UDC A;  1AXQ A;  2YY3 A;  3GTK K;  1XZP A;  4UTG A;  1NB2 A;  1JNR B;  2F1F A;  4QPX A;  1BXN A;  1WHV A;  4DZD A;  3IFE A;  5KFU A;  5AJ3 F;  4TQR A;  1LWE B;  4CLU A;  3HZE A;  2G0J A;  1F9H A;  3NGU A;  4PAB A;  2IYI A;  2V5H G;  1YGY A;  1N5V A;  2BE7 D;  2EFQ A;  1C1C A;  1U0H A;  4RWX A;  4DR7 F;  4AUK A;  3PKM A;  2YWH A;  4C3I K;  1DHM A;  2JFK A;  3J7Z 5;  4X65 F;  1L0W A;  4A8K A;  2QFJ A;  1ZBT A;  3OPF A;  4NI2 B;  3DLE B;  2AGQ A;  1XMO F;  1TQL A;  3BR9 A;  2APO A;  3DYA A;  4ID8 A;  4A3M C;  4LBH A;  4NLO A;  2VOD A;  4NLR A;  4ZS6 A;  2HHV A;  4Z7C A;  4A3C K;  2DR8 A;  5IZH A;  5FLM C;  1BD6 A;  4ZN3 A;  5AE2 A;  1VJE A;  1FK9 A;  3VGV A;  2C42 A;  2DNQ A;  1OSC A;  2F8H A;  2WBR A;  4WFN Q;  2UUA F;  3QRP A;  3JAM Y;  3G86 A;  1CSJ A;  3C19 A;  2W2P P;  1DY3 A;  3B78 A;  2XCA A;  4MIW A;  1N56 A;  5GAG U;  1NK6 A;  2QMX A;  5CA5 A;  3DNC A;  2YPZ A;  1ZET A;  1DJ0 A;  1XZQ B;  2PGC A;  3CCV S;  2OEJ A;  3KK1 A;  4NLU A;  4WJB A;  4LJZ A;  3MTJ A;  1TUV A;  2D1C A;  3PDN A;  3TUI C;  1G51 A;  3PX0 A;  4QR1 A;  5IS2 A;  3S0X A;  1RT7 A;  3GTQ A;  1WSV A;  1EAY C;  2B8Q A;  1RHM B;  1PJ5 A;  1LW2 A;  1IKW B;  2M3D A;  2HS3 A;  1E6V A;  3IG1 A;  3R5C A;  4WZQ A;  3M8R A;  2OP5 A;  2X1B A;  1X5O A;  1SKR A;  2IRX A;  3S15 K;  3AOC A;  3BEG B;  4C45 A;  4GTC A;  5I3U B;  4KMU A;  2CZ4 A;  4MEX A;  1RT6 A;  4RUH A;  3IO1 A;  3BQ1 A;  3PY8 A;  3E3X A;  3QT6 A;  1KQS R;  2XWY A;  4G0W A;  1WF2 A;  5H9F K;  1HLW A;  2LXI A;  3Q86 A;  1M5O C;  2R7Z C;  5JFE A;  5EWG A;  4LLG A;  3S1Q K;  3T6B A;  2KI2 A;  4LFA F;  2YH1 A;  4NXN F;  1TWC A;  1EH1 A;  3N6M A;  5C2G A;  3T6J A;  1HNV A;  1RTH B;  3JQM A;  1H2U X;  1KLM A;  3B8H A;  4RNM A;  4CO5 A;  1WF0 A;  3DRX A;  4DV6 F;  4OFZ A;  3J81 j;  2C2R A;  5LSR A;  3LAP A;  3W5Y A;  4ZPA A;  4KGZ B;  2KU7 A;  1VRT B;  3ZTS A;  1XNQ F;  5IYB C;  2P8I A;  2NVT K;  4ZP8 A;  5LMU J;  3HOX K;  1EKR A;  2MZJ A;  3S2D C;  5KFE A;  1H7W A;  1MWZ A;  3VAJ A;  2NSB A;  1T03 A;  1VS3 A;  2VUG A;  5CYQ A;  4C2M A;  5KFJ A;  3CCT A;  1MU2 A;  3HOV C;  4RW4 B;  2VUM A;  1S6Q B;  4Q5S A;  2W24 A;  1RHU B;  3VCD A;  1TR0 A;  1NSK L;  5DLG A;  3UVJ A;  1RE1 B;  2C3P A;  2V6A A;  2KG0 A;  2YWW A;  4I7F B;  5F0U A;  1F7V A;  4C0B A;  2Y3Y A;  2LEC A;  3QZ7 A;  3PRD A;  3OTO F;  3OVB A;  5B08 A;  1HNZ F;  2R2T A;  4U9R A;  4IUF A;  1C0A A;  3RRH A;  4ZN1 A;  4FPI A;  2Y1L B;  5HP1 B;  3HHL A;  4DV7 F;  2OKQ A;  4J9Q A;  1QD1 A;  1RWK B;  4IR9 A;  3T5L A;  4IKA A;  2A1B A;  2R3V A;  3LQV A;  2ALZ A;  4I56 A;  3KMQ A;  2RIL A;  3QGI A;  4P2X A;  3PRV A;  3N0C A;  5ADZ A;  1IR2 A;  3VAM A;  3MFH A;  3LF0 A;  3W61 A;  3DRS B;  1AZS A;  4DZ6 A;  4J9R A;  1RT1 B;  2J9E A;  4KAI A;  5KFW A;  3MWB A;  3DXJ A;  4CLZ A;  2V9W A;  2ZH2 A;  4BBY A;  1LOU A;  2FLP A;  4QOT A;  2R93 A;  2MY7 A;  3TAM B;  3NCR A;  4O3Q A;  5DGA A;  4A8Y A;  1FHT A;  1RAB B;  3IAM 9;  1C0U A;  4M5J A;  5C4J K;  3NMR A;  2N7C A;  3BGL A;  5HSP A;  3CUL A;  3CCU S;  3CJ4 A;  1M90 T;  2NUU G;  3HXM A;  3CJ5 A;  5IT4 A;  2ASL A;  3U1L A;  2ZNZ A;  3QO9 A;  4ECY A;  1J6X A;  4HLB A;  4K4T A;  3K59 A;  3GFX A;  4J7C A;  1EP4 A;  1XQI A;  4TU9 A;  1USO A;  4IRD A;  2NUH A;  3UFC X;  1J27 A;  3M2U B;  3I5A A;  3GYG A;  1F9F A;  3SSS A;  1Y00 A;  2JLE A;  2GIQ A;  2OPQ B;  3KXD A;  4MMO A;  2W8L A;  4GC6 A;  5FLX U;  1TWG K;  3GP9 A;  5THW A;  1DD5 A;  1CPZ A;  4X62 J;  4NYP A;  2JFD A;  1J5E F;  2LEP A;  4RNH A;  1EX8 A;  5CCM A;  3BH7 B;  4NEZ A;  3KLE B;  1NH8 A;  2IY5 B;  2BX6 A;  1V3Z A;  2WHO A;  4NLV A;  1SFO K;  2NZ4 A;  4K4Y A;  3FEY B;  3BO4 A;  1TK5 A;  3H0G K;  4JUZ A;  3CXC R;  3C46 A;  2X51 A;  2P6T A;  1O24 A;  3FKI A;  3CCE S;  2HVH A;  1S9E A;  1JNZ B;  2P9E A;  1X4F A;  1OPI A;  4ES2 A;  3SYZ A;  1S1W A;  1LW0 A;  1B99 A;  2DR5 A;  4NZ6 A;  5KFY A;  3PO4 A;  1FRK A;  1SH0 A;  3TQE A;  2XBP A;  1N32 J;  3EIC A;  2J9C A;  2C22 A;  2Y1J A;  2ROG A;  3CJK B;  1NPP A;  2JA8 K;  3F56 A;  4H4O B;  4FVM A;  2G1D A;  2E2I A;  1PGZ A;  1ZZF A;  2DNG A;  3GQC A;  1S7H A;  4AD6 A;  1OY9 A;  4X6A K;  3SDE A;  1NKE A;  5MAO A;  4Y7N C;  5EX0 A;  2ACM A;  5BR8 F;  2B0G A;  1HHT P;  2B4P A;  1YBT A;  4UOC A;  4KC5 A;  4BWM A;  4J9U E;  5L1K A;  2UUT A;  5KG7 A;  4OQJ A;  1ISE A;  2J0S D;  1DLO A;  2F63 A;  1JLC A;  3S1M K;  4WII A;  1GX5 A;  5AXN A;  4LFB J;  1YG0 A;  4AL6 A;  1D1U A;  4F0M A;  3Q22 A;  1SH2 A;  3IR5 B;  3K7A C;  4R8U B;  3D1H A;  2CPI A;  3HX9 A;  4GKK J;  4C3K A;  2F8M A;  4M1K A;  4KAS A;  2CW0 A;  1GMU A;  1IKX B;  3L09 A;  5CCL A;  2AIR B;  2C2N A;  5ETL A;  1S9G B;  4PR6 A;  4LJM A;  3N6N A;  4GVB B;  5IV4 A;  1KTQ A;  1S77 D;  2BE2 A;  5DG9 A;  2IPO B;  4FF3 A;  3M3Y C;  5IWA J;  1RT4 A;  5C4X C;  1XXC A;  2V50 A;  3DOM A;  2B43 A;  1SJ4 P;  4JI3 J;  1WQF A;  1N34 F;  4ZPW R;  2CWK A;  4IG0 B;  3TFH A;  2XY7 A;  4A3E C;  5HAN A;  4OHY A;  1VBZ A;  2R8J A;  4NYZ A;  3KLH A;  1F93 A;  4H4M A;  3K57 A;  5J2N B;  1I1G A;  2UUB F;  2J7U A;  1IS1 A;  3CDB A;  2V34 A;  4Y2A A;  4HTJ A;  1GXL A;  3L7O A;  3ZO7 A;  3PZP A;  3GTG A;  4DPY A;  2AX1 A;  5A6W A;  3DDK A;  2QE5 A;  4JV1 A;  3M6V A;  4G3I A;  5DDO C;  2JA7 A;  1FTR A;  3R6G B;  5IV3 A;  4F4Y A;  5KFZ A;  2QMW A;  2XY6 A;  1W26 A;  2YKA A;  2O3D A;  1KC8 T;  4FXD A;  2IVY A;  4F0H A;  2EFN A;  2CFA A;  2FC8 A;  1JLG B;  4NMX A;  4NYO A;  3HOZ K;  1S6P A;  4DU8 A;  4C48 A;  2L3M A;  5ETS A;  5C24 A;  1U7L A;  1FFW B;  3M2V A;  3M9O B;  4ZHR B;  4NML A;  1HD0 A;  3LAL A;  5L8R C;  2HLU A;  4DV5 F;  5KFF A;  2LKZ A;  4L75 A;  5IQ6 A;  5IT0 A;  2MXY A;  1KNZ A;  2V8D A;  4DLG A;  1UET A;  4EO6 A;  3CCL S;  3HJV A;  1HI9 A;  5IP9 C;  1CJK B;  2ZDP A;  4DL3 A;  5M5Y K;  3DKD A;  5GMK a;  4BS2 A;  2RF2 A;  2NVX A;  1RAJ A;  3RRK A;  4LF7 F;  4LF8 J;  1EI6 A;  4KB2 A;  2J8A A;  1SCJ B;  2W9B A;  4G6V B;  1U1R A;  4JI4 J;  3SCL E;  2G2O A;  4O23 A;  2GFF A;  3PRB A;  3GEH A;  3PKY A;  1YKW A;  2YH0 A;  3AOA A;  1ZM4 A;  2QIF A;  3GTK C;  2CQH A;  1FJG F;  3BB5 A;  3UD5 A;  2KFZ A;  2I5J A;  3GTL K;  3T1Y F;  1HQE B;  2M8H A;  3NGR A;  1TAU A;  4URS A;  4YDX A;  4BLG A;  2MKY A;  3QIP B;  4ERD A;  3DCA A;  3I0R B;  4OJ1 A;  2VG6 B;  2YNH A;  1X31 C;  3BJY A;  2NQP A;  4DOZ A;  5DLF A;  3W1Y C;  3UD4 P;  1HNW J;  1BC6 A;  1NDP A;  2CYY A;  3VTI A;  1H72 C;  4C3I C;  3NRB A;  1S97 A;  1RYR A;  3NXZ A;  2W25 A;  1LK7 A;  2FQT A;  2BJ9 A;  3HXA A;  5TMF A;  3HSZ A;  4AYB D;  5DDR C;  1Y1V A;  2FHM A;  3IXQ A;  2RB7 A;  4RW7 B;  3MUT P;  4BXX K;  5IFM A;  1E6Y A;  1X5P A;  3EM1 A;  2RAQ A;  4QYZ J;  4YY3 J;  4A3C C;  2V4R A;  2HVZ A;  1O2F B;  4W98 A;  2OD4 A;  2ROP A;  5EGH A;  2GCF A;  4X4Q A;  2NVQ K;  3ZFV A;  3DI6 B;  3R7S B;  3M8Q B;  2DRB A;  3V81 A;  4DV2 F;  3S1N K;  1NDK A;  2ZH4 A;  2KYX A;  3QT5 A;  3HT3 A;  2V6T A;  3MED B;  4WTO B;  2W9C A;  2VAS A;  4AE5 A;  1TUG B;  2A3J A;  4GO5 X;  2W9A A;  3MDF A;  3KJN B;  1H2V Z;  5D4D A;  4WFA Q;  3AQP A;  3SV4 A;  2F9J A;  2PE8 A;  3VGT A;  3JQK A;  3D3C J;  4OZJ A;  3R5D A;  4P2F A;  3N0V A;  2AYB A;  3MF5 A;  4ZLJ A;  1C0T B;  3QAE A;  4KBI A;  4PG4 A;  3SCK E;  5HQL A;  4XPE A;  1L3S A;  4XPC A;  3OL8 A;  2BAC A;  2WK4 A;  1ZQ1 C;  4NA1 A;  2M4M A;  2HG4 A;  4GT9 A;  1IN0 A;  4KKO A;  1SJR A;  1S0V A;  4KFB A;  1U2R A;  3BSC A;  1X8D A;  3C6T B;  3VF0 B;  1M5S A;  3W63 A;  4IDK B;  3S15 C;  2BQ3 A;  1X7V A;  1RT3 A;  3JSM A;  3GIJ A;  4OIP A;  2I9S A;  4LIR A;  3EYZ A;  2B4U A;  1Z2Z A;  1JXE A;  4HI1 A;  4PPD A;  1YJT A;  2AHO B;  2ZH3 A;  5I3Q A;  3KLF A;  1JLE A;  2YX1 A;  2AF6 A;  3LP1 A;  3ILJ A;  3S1Q C;  3TA0 A;  3TZY A;  2XYP B;  2RS2 A;  4KB4 A;  4P72 A;  1HQU B;  3TO8 A;  2DNN A;  3FEX B;  5K8M A;  5A8R B;  4ZCI A;  4OI3 A;  2JEJ A;  2NXC A;  4CLL A;  2E7W A;  1UW9 A;  2NVT C;  2VG7 A;  4C8K A;  3HOX C;  3IN5 A;  4NLW A;  4X4U A;  4QJV B;  3MPW A;  2EEY A;  3GEE A;  3QPI A;  1WC4 A;  3HJF A;  5ETV A;  1KR4 A;  3I5B A;  3ICL A;  2A0F B;  3R7B B;  2MYF A;  4U96 A;  5D4O A;  1N33 J;  3L4K A;  1YCL A;  2FZG B;  2OEL A;  4R5P A;  2XLI A;  1T95 A;  1M1K T;  2KXF A;  4FBU A;  1F5B A;  2GIF A;  1D8Z A;  5SZT A;  4DV7 J;  4ZLP A;  4FBT A;  3KWM A;  1SJF A;  1MLA A;  4ICL B;  5D3G B;  4V19 X;  1BQM B;  4U7U D;  1FA0 A;  2ZVI A;  3AJ1 A;  2CXE A;  3P4U B;  1R0A B;  1K73 T;  3K2Y A;  1W25 A;  2AP6 A;  2HHH F;  2OSR A;  4TY8 A;  4C11 B;  5EWF A;  2DIS A;  3WBZ A;  5JVH Q;  2H4W B;  2B3T B;  4QWC A;  2XZW A;  4LRC A;  2BYC A;  3MD3 A;  1XR6 A;  4UST A;  3KG0 A;  3NP5 A;  2ZHB A;  3GJT B;  3DLK A;  2KRR A;  2HK3 A;  5L1L A;  3MMC A;  4UZB A;  4C3H K;  4NWB A;  4Q0B A;  5B0A A;  4E8U A;  1K0T A;  4Q7A A;  1RYS A;  2GAH C;  1L3K A;  1NND A;  2EFP A;  1BDF A;  2WON A;  4O0I A;  4OZN A;  2CNO B;  2MJN A;  2HWI A;  5HLF B;  3SIP B;  3THV A;  4DR1 F;  4I2P A;  2Q1L A;  5GAH U;  4F4X A;  1B0T A;  2E1M C;  2RDJ A;  3FOE A;  3FBC A;  4C3J K;  5C4J C;  4KQZ A;  2X1G A;  4C6A A;  4XLP A;  2MSS A;  4M1X A;  1Y9O A;  4K8R A;  4CP5 A;  2KYZ A;  3HPO A;  2ZBI A;  4U8V A;  3PYF A;  1NPR A;  4OV6 A;  1Q0N A;  1VHI A;  2BAN A;  4LRF A;  2J6T A;  1V6H A;  4DR3 J;  1SBR A;  1UKU A;  1IQZ A;  2GO8 A;  4IRK A;  1R8B A;  3TVK A;  3HHD A;  2EBB A;  4P52 A;  1DTQ B;  3AOB A;  3TX0 A;  3NOG A;  2PSZ A;  1IKV B;  4LVN P;  3IS9 A;  4PWD B;  1TWG C;  1Y5I B;  5D0G A;  2AJ4 A;  3K5P A;  3N5B A;  4BLB A;  3C6U B;  5JVO A;  2D9O A;  2C2K B;  1NHK L;  1CS4 A;  2RGR A;  4FYX B;  2GHP A;  4JYA J;  5FD1 A;  2P9C A;  3H0G C;  5KG0 A;  1Y5N B;  3EDQ B;  3CIM A;  4PG8 A;  1M5P C;  1KLN A;  1NEE A;  3FFI B;  3FRY A;  2CA9 A;  5GAG I;  1U0S A;  4H54 A;  4JI2 J;  2Q66 A;  2HFO A;  3FRZ A;  4P73 A;  3SEO A;  3OJS A;  5KG6 A;  2HMI B;  4DQS A;  1FE4 A;  3MZI A;  3NAI A;  5D0H A;  4B3M J;  1Q7L B;  1O25 A;  1D9A A;  2PI5 A;  1YJW S;  3HO1 A;  1FK9 B;  1UA0 A;  4LK0 A;  4P5A A;  1VQ5 S;  4DUZ F;  4XO0 A;  2JA8 C;  3FBB A;  3CQZ K;  1TWA K;  4RBT A;  3S17 K;  5E68 A;  2HAF A;  4ZP6 A;  1F60 B;  2XMK A;  2ZFZ A;  4I68 A;  3I4N K;  2RH3 A;  1WC3 A;  2DVI A;  4X6A C;  1SV5 B;  5C42 B;  2Z4P A;  2HQF A;  5IC6 B;  2JHE A;  3M4O K;  4EBC A;  4LIW A;  1UFW A;  2HHX A;  2EW9 A;  5GAE U;  2MGZ A;  3GTM K;  2AJ1 A;  3V4I B;  3DM2 B;  2GJ2 A;  3HD2 A;  4GTB A;  4M5G A;  4ZJQ A;  3S1M C;  2V0N A;  4IYQ A;  2CJB A;  5E5N A;  4KV8 A;  1A9N B;  4YDD B;  1FKO B;  3TVZ A;  3BZQ A;  4YFN A;  4DS5 A;  1EK8 A;  5DZ6 A;  4Q8F A;  3IG1 B;  4F02 A;  2VFU A;  4NZ7 A;  1WIH A;  2F5G A;  1WHX A;  2BM0 A;  2Y3P A;  3HZG A;  2P5M A;  2O5D A;  3BUE A;  2ERR A;  4WJ3 M;  4QZV B;  1YBU A;  4OZL A;  2CNL B;  3BDE A;  3HMJ G;  1FKP B;  2OMO A;  4A47 A;  5IOR A;  1VBK A;  4MK7 A;  5IC4 B;  2DHS A;  2MLX A;  3TVY A;  2AT1 B;  1UV7 A;  2FY1 A;  2G4B A;  2GQ2 A;  4DSF A;  3R5A A;  1A6L A;  4BY7 K;  5K8O A;  1TVR B;  3E01 B;  1OO0 B;  4PKD B;  3LUY A;  1GMW D;  2OJ3 A;  2GVD A;  3OHA A;  5D6G A;  5EHH A;  1LWC B;  4ZLN A;  1N36 J;  2AD9 A;  2F3J A;  2VV5 A;  4WXO A;  1T8E A;  3SCI E;  3GTP K;  1TUW A;  1UAW A;  2IAJ B;  4TN2 A;  4QWB A;  2MZS A;  1XR7 A;  2RKI A;  3WOD A;  4KHP F;  4G1P A;  2ZD1 A;  3DU6 A;  3UNG C;  4FKX A;  4NCG A;  1VI7 A;  4UUX A;  5CJ9 A;  3TYT A;  2PMZ L;  2K1R A;  3AB2 B;  2N4D A;  4C8O A;  3T1A A;  2E9R X;  1Z1Z A;  4XTT A;  4UZC A;  5HI7 A;  1REV B;  3R1L A;  4RR5 A;  2R92 K;  2DD8 S;  2HNY A;  3ZTQ A;  4DHV A;  5M2R A;  2IM3 A;  3ITH A;  1UJ5 A;  1OSD A;  2DGU A;  3RBZ A;  1U2F A;  1YTY A;  1DCP A;  3FCV A;  3W8P A;  1N5Y A;  1CC8 A;  4KR0 B;  3BBC A;  2HND B;  4B9N A;  2BEF A;  1Y1W K;  3CGI A;  2HZV A;  4IH7 A;  4PUO A;  1P1T A;  1DAX A;  1NB7 A;  1Y7P A;  3M8P B;  2ZH5 A;  1U6F A;  3POT B;  3HOZ C;  3RUB L;  2QGF B;  1O6X A;  2RT3 A;  3QJJ A;  1AZS B;  3HP6 A;  3SZZ A;  3W3S A;  1RHR B;  2AU0 A;  3HFK A;  3JQJ A;  3OFH A;  1N0V C;  4RZR A;  2E5L F;  1QTM A;  4O4G A;  3B4M A;  5J1E B;  2GHV C;  4QIW L;  3OR2 A;  5IP7 K;  4KC6 A;  3CDE A;  2J0Q D;  3DLL Q;  2CRL A;  3BSO A;  4PG6 A;  1B7Y B;  1K8A T;  3MAA A;  3KYL A;  3RB6 A;  3WQP A;  2RHS B;  2IC3 B;  1INN A;  5HMX A;  3L4B C;  4DFM A;  1LWE A;  1TWG A;  5KFG A;  3CME S;  4PZV A;  4WK1 A;  4LF6 F;  4PWU A;  1P6T A;  2JDJ A;  2DHX A;  2KN4 A;  3MEK A;  4EWT A;  1RHJ B;  3CJ0 A;  1TL7 B;  3LW5 C;  2XS5 A;  2DR9 A;  2B51 A;  4UQT A;  1W7W A;  3TUJ C;  3GTL C;  3FSX A;  4DX6 A;  2ATL A;  1W2I A;  1KQG B;  1TK8 A;  3G8S A;  3UW1 A;  3N28 A;  3PG9 A;  4NI2 A;  3DLE A;  4M5M A;  2MQM A;  1BUX A;  2PDA A;  1Q86 T;  3ENA A;  1N88 A;  1WF1 A;  3MPD A;  5A6P A;  3VAI A;  2FJV A;  4PEO A;  3RU0 A;  2AYE A;  2DGS A;  2HQ3 A;  3ULH A;  5CAA A;  2UU9 F;  2PA3 A;  3KUE A;  4NE9 C;  3VR1 A;  1R43 A;  2R2S A;  2B6A B;  2HQG A;  2IVM A;  2DEJ A;  1WSR A;  4BXX C;  4OIX A;  1SJ3 P;  3NUH A;  2W01 A;  4AL7 A;  4M5I A;  3MR7 A;  1RWP B;  4KN7 A;  2MQL A;  3G8T A;  3KHH A;  1WDD A;  4OI1 A;  2V4J B;  4ZJL A;  1PSD A;  1NK5 A;  2QL7 B;  5DG8 A;  2NVQ C;  2DXE A;  4X4N A;  2Y1I A;  1XZQ A;  1MG7 A;  2CG8 A;  3S1N C;  4I64 A;  4ECZ A;  1S1W B;  3CCJ S;  4DR5 F;  1WOS A;  5C25 B;  1WOO A;  1XXA A;  4USW A;  1F5C A;  3KKF A;  2JVO A;  4E98 A;  3P5B P;  4O3N A;  4ZVT B;  2IJR A;  3CPW R;  1FVQ A;  2DKO B;  4FN5 A;  1ZPW X;  2BW7 A;  2EBE A;  1FRM A;  2GJI A;  2FVC A;  2WW8 A;  5D4L A;  2MJU A;  3WC2 A;  2V63 A;  2VFR A;  3G4A A;  5GME A;  4WKR A;  1R6V A;  1M0S A;  5IM0 B;  4IG3 B;  3EGV A;  3NOC A;  3M6W A;  4EGL A;  1LXN A;  3PJX A;  2OO4 A;  1NO8 A;  2QYC A;  1KOO A;  3F44 A;  4LRD A;  1IJF B;  5IYC C;  2XMA A;  2LQ5 A;  4CYU B;  5DDP C;  3DOL B;  5K5M A;  4B3S J;  4FYW B;  4F67 A;  2WVE A;  2A10 A;  3PO5 A;  1X5S A;  2EVZ A;  4G7Z A;  3LO3 A;  1HD1 A;  5H9E J;  2DJW A;  1XR5 A;  3K58 A;  5HQ8 A;  3ZTP A;  3K5O A;  1VRT A;  2OTL S;  1RJJ A;  1WI6 A;  1RLC L;  1NKB A;  2DGO A;  4F3O A;  4NLP A;  2Y1R I;  1VDH A;  1OPZ A;  2BAB A;  1S10 A;  2H5I B;  5ETM A;  3TEH B;  3PW2 A;  4RW4 A;  1JJ2 R;  1S6Q A;  1LWF A;  1YJ9 S;  5MLC V;  4ER8 A;  3QT8 A;  4FYY B;  5KFB A;  4W92 B;  1ZH5 A;  2VG5 B;  2NZC A;  2QLJ B;  4DL5 A;  4LSL B;  3UWT A;  4J9P A;  4EUV A;  1U6Z A;  2U2F A;  4I7F A;  3HM9 A;  2DB1 A;  3QGH A;  3DLG B;  1FJC A;  1VQP S;  4QIE A;  3GG0 A;  4C3L A;  5F3Z A;  4ZPT R;  4NEY A;  4ATN A;  4KB7 A;  4DWI A;  1DBD A;  2A68 A;  3A3N B;  2QRR A;  3W65 A;  3NCP A;  4DPU A;  1YHQ S;  3CD7 A;  1WG1 A;  2MKH A;  4ZVR B;  3ADA C;  3UD3 P;  2Y8W A;  2RD5 C;  1VHF A;  3BF4 A;  4HH0 A;  3SMZ A;  4YFU A;  4ED0 A;  2PPB A;  2YU9 K;  5ETP A;  4UW2 A;  1KVJ A;  2OIH A;  5F8N A;  3HSG A;  5LJ3 Y;  1ICE B;  2PO4 A;  3J81 U;  4P7T A;  2CUY A;  1RT1 A;  2MQP A;  2KO1 A;  2DIT A;  1GQE A;  4OYP A;  2CPX A;  5E3A A;  2MPU A;  2M2B A;  3MHY A;  2QT7 A;  2OFG X;  2I1R A;  4FNI A;  3L95 X;  1JXV A;  1PJ6 A;  2KZM A;  4C98 A;  3LPY A;  1X4C A;  1UVJ A;  4CLK A;  4C3H C;  1RLD A;  2BMB A;  2BDP A;  3D6T B;  3UR0 A;  3OQ2 A;  2HHP A;  2HW3 A;  4CO3 A;  2CAJ A;  2B4O A;  1S6P B;  4OX9 J;  1ZTW A;  4DQR A;  3M2V B;  5C44 K;  2G9O A;  2V2Z A;  4HDG A;  3BV8 A;  1AFJ A;  4RO0 A;  3ET6 B;  4R0E A;  1UA1 A;  2AYG A;  4ID5 B;  2RE1 A;  2R7Q A;  4C3J C;  4KO0 B;  4OIR A;  4XAK A;  3MXH P;  3GTL A;  3MM7 A;  4OYO A;  1HWI A;  2RF2 B;  3M2U A;  1PBU A;  2WVB A;  1MW7 A;  4DR6 J;  3KLI A;  1RAE B;  1VC0 A;  3Q2T C;  7AT1 B;  2OPQ A;  3CJ8 A;  2FTR A;  4JV5 J;  2W9B B;  2FHJ D;  1S4E A;  1RIS A;  2B9X A;  4WKY A;  2Y0S L;  4OI0 A;  2MST A;  1SL0 A;  1X4G A;  3LPX A;  1RAA B;  1YQH A;  2ABY A;  1V3R A;  4ED8 A;  5T7L B;  4A4J A;  1Z4U A;  8ATC B;  2HVD A;  3KLE A;  4LMZ A;  1H2T Z;  2CKW A;  3G6E S;  3K17 A;  3Q89 A;  1YNJ A;  4BKW A;  1U02 A;  4ZVU B;  4OX7 A;  4PXB A;  4MK9 A;  3ENV A;  5KFT A;  3G96 A;  2LLZ A;  3LAK A;  3U7J A;  2LCW A;  5LMN J;  3DHW C;  1TWH K;  2R7S A;  3J81 Y;  4ZPD A;  3H20 A;  4F2S A;  3KTQ A;  4FF4 A;  1NME B;  1QSS A;  3T1H J;  2X1A A;  4CT9 A;  3WZ0 A;  1IE0 A;  2CQP A;  1VQO S;  4EZ6 A;  2G0I A;  3CJK A;  4RWW A;  1ZPV A;  2D9P A;  4H4O A;  4J9V A;  5E3C A;  5KFN A;  1KFD A;  1ELO A;  2EKN A;  1OYE A;  3HHE A;  5F0W A;  5JVG Q;  3D0G E;  2MZT A;  4S0M A;  2HQI A;  3B6B A;  4HAC B;  4M8L A;  1S72 S;  3MGJ A;  2RVJ A;  3IBW A;  4NLD A;  3KUG A;  4GTL A;  3SSR A;  4IOA Q;  5D77 A;  4DUT A;  1USM A;  3CED A;  1VR6 A;  3CQZ C;  3OLA A;  1TWA C;  4GVL A;  3VZH A;  2OSQ A;  3S17 C;  4A3L K;  2VD3 A;  1VQ8 S;  3I4N C;  1B7F A;  3CMQ A;  2CJK A;  1BGW A;  2HVE A;  1O2B A;  5D78 A;  3M4O C;  4EZ9 A;  3MMJ A;  2OTJ S;  1M5K C;  3GTM C;  2ZE2 B;  5I3P A;  4QCL A;  4OHW A;  1HPZ B;  2EPI A;  2ROE A;  2B63 K;  1IKX A;  2BR0 A;  3TFJ A;  1S9G A;  4KN4 A;  1S1U B;  1P9Q C;  4GVB A;  2GS8 A;  4PWW A;  2VFT A;  1BWE A;  1O51 A;  2K06 A;  4N7T A;  1KHW A;  1NZA A;  3NMA A;  1O0P A;  4FS1 A;  4X64 F;  4A8Q A;  2CVE A;  4L73 A;  4QW9 A;  3CSK A;  1N5Q A;  3S1T A;  5LM7 E;  4NPO A;  4ILD A;  4J9O A;  3UCZ P;  2MQ8 A;  3D7S B;  3CNQ P;  1VQN S;  1MWY A;  2NSC A;  1GK8 A;  3LP1 B;  2CQ2 A;  2R7W A;  3NNC A;  1TFY A;  2PC6 A;  4W4M A;  1WQG A;  4IG0 A;  4DL4 A;  2XCP A;  4PG5 A;  5IOT A;  3DHX A;  3TFI A;  1TMJ A;  1Y10 A;  1F3F A;  4BY7 C;  2HSE B;  3KFW X;  2YKN B;  4ZPV R;  2WTF A;  1EAR A;  2R2R A;  5J2N A;  1VQK S;  1U8S A;  1S0N A;  2KXN B;  3D67 A;  1XC9 A;  3GSD A;  5LMU F;  2FD2 A;  2WVC A;  1GXU A;  3GYN A;  4ED3 A;  4FPR A;  5C7P A;  2AKW B;  2AEF A;  3GTP C;  1NBE B;  1TKD A;  3PFO A;  4A8M P;  4DV1 J;  2FVS A;  4CM0 A;  5E3R A;  4F7V A;  5DZ7 A;  1YRT A;  2FHJ A;  3JTP A;  4CO2 A;  2RSQ A;  1IUJ A;  2KM8 B;  4JI8 F;  1I3Q K;  2Z58 B;  2XO7 A;  3D0I E;  2B9E A;  4O44 B;  3KK2 A;  5KFH A;  3JSB A;  3QRR A;  3RZD K;  3L9Z A;  1I6H C;  6FD1 A;  4HT5 A;  2PMZ D;  1HBN A;  1MSW D;  4OMF G;  4IQM A;  3VAL A;  3KNA A;  3W7B A;  2OGU A;  4ZHR A;  4I6A A;  3B4D A;  2KJW A;  3MEG A;  1GT8 A;  3MPU B;  4LR8 A;  4F8R A;  1X0F A;  2E5L J;  1Y1W C;  2ASY A;  5GAH I;  4KGV B;  2HS0 A;  1HL6 A;  4CT8 A;  3VAK A;  1CJK A;  4WF9 Q;  3D6H B;  3H4B A;  3O3L A;  3RBX A;  5F8L A;  3D0H E;  2B56 A;  3OUY B;  3M8W A;  1PYO B;  4KMA A;  3N01 A;  2ZBP A;  4M5K A;  3MCN A;  1UJ4 A;  3EJM A;  4NOH A;  1R8P A;  5AXL A;  4ZP9 A;  3MEC A;  1Q7Y T;  2WON B;  2OPS B;  4CLS A;  2W4C A;  5IP7 C;  3GON A;  3FCW A;  3H3V L;  3JSR A;  3Q8Q B;  3QRQ A;  2GX8 A;  3SZ2 A;  2LQB A;  1BY9 A;  1HQE A;  2DNL A;  3JXO A;  3M8S A;  3DLB A;  4TVA B;  4WU2 A;  1ITP A;  3KUH A;  2KJV A;  3N5F A;  1ZVU A;  3T5K A;  2BV3 A;  3IR6 B;  2EI5 A;  2HRY A;  1RTI B;  5B09 A;  2VB6 A;  3GTJ A;  2V6U A;  2I38 A;  2BAN B;  3KDN A;  3UI3 A;  3GIM A;  4IOC Q;  1NDC A;  2ILZ A;  3TZX A;  1JX4 A;  1ZYR A;  2V2V A;  3K5L A;  3CO9 A;  5HO4 A;  1TWF K;  4LVO P;  1TAQ A;  5F9N A;  3M30 B;  3DRP B;  3BYR A;  1K0V A;  4L74 A;  1YJV A;  5ETO A;  4Y52 K;  5HRO B;  2ZBQ A;  5FJ8 K;  2HGL A;  4M5N A;  3MM9 A;  2K3I A;  2KH9 A;  3IS9 B;  2M70 A;  4GMK A;  2IM0 A;  4QU7 A;  4USH A;  4PAA A;  2LEA A;  4O2D A;  2D3U A;  3VAG A;  2XI3 A;  3DI6 A;  3SQG B;  3M8Q A;  1VRU A;  4HKQ A;  1B70 B;  4DR5 J;  3ZZU A;  2HZA A;  1XK8 A;  3MED A;  2KRB A;  4URQ U;  2GQQ A;  3BQ2 A;  4C0O C;  3PYG A;  3CJT A;  3PYD A;  3LAN A;  3G6V A;  2E2H K;  1UVN A;  3I5C A;  5K8N A;  1RAF B;  3S1R K;  2CJ9 A;  4DUY F;  2XSF A;  4Z7Y A;  2CQB A;  1URN A;  2FHO B;  4CDI A;  1MN7 A;  3PFE A;  2FLN A;  1O26 A;  1C0T A;  4N47 A;  2R7R A;  2MY8 A;  2KFY A;  3QID A;  5GAE I;  2A6H A;  3RRG A;  2H4Y B;  2YX7 A;  2FY8 A;  1VK3 A;  3AXM A;  1KQ4 A;  2YNF B;  5DGB A;  2LXF A;  2FIU A;  3UNY A;  4OZ3 A;  1XWL A;  1ZTT A;  1X0P A;  1TL5 A;  1VFJ A;  2CPE A;  1P27 B;  1SB6 A;  3A1Y G;  1F5A A;  5CZV A;  1JVI A;  3VVT A;  1XIQ A;  3H4D A;  4IDK A;  2CQG A;  1DUR A;  3VAF A;  4XDC A;  1F9E B;  1JLF A;  3WIU A;  2MGZ B;  2BOA A;  4FZV A;  4CLY A;  4XCH A;  4CRJ A;  1UZD A;  1FXR A;  1PAE X;  4EO8 A;  4NCA A;  1K83 C;  3HKW A;  3IM8 A;  3X3U A;  3GU0 A;  4CO4 A;  3T01 A;  4LFB F;  1BWV A;  4LUB A;  5TMC A;  5KT6 A;  4Q2L A;  1U1K A;  2IM2 A;  3GYX B;  1W2B R;  4GKK F;  5F41 A;  3SQO P;  4C4W A;  3HOW K;  1T9U A;  4A8S A;  5C2C A;  2ZC3 A;  4QJV A;  4ANC A;  4A48 A;  1GAO A;  1RTJ B;  3FKB A;  1FER A;  3QWU A;  3EMT A;  3B82 A;  1IKY B;  3FZB A;  4OIO A;  1HYS B;  3IWN C;  4G1I A;  1AB4 A;  1H38 A;  3W9I A;  2P2C B;  1Y0H A;  1PIE A;  3NKY A;  2ZUG A;  2XY5 A;  1T3N A;  2IRU A;  3HFZ B;  5KFK A;  2J76 E;  4OJ3 A;  3NG8 A;  5LT5 A;  5IWA F;  3MOJ B;  3L4J A;  2PFD A;  2NRE A;  4J9S A;  3HD1 A;  2GQC A;  4ICL A;  2CIM A;  4DBQ A;  5D3G A;  2CJX B;  4O4R A;  1BQM A;  4JI3 F;  4JB8 B;  1K47 A;  3R5B A;  2I6W A;  2BQR A;  4TYB A;  1R0A A;  3FEZ A;  2N7Y A;  3ISN D;  4KPY A;  4C11 A;  4A3G K;  4NZ0 A;  2RKI B;  2LEB A;  3OBI A;  5KG1 A;  1SXL A;  3BQ0 A;  1CLF A;  2IRY A;  4DXL A;  2YU9 C;  2DNK A;  2L9D A;  4M5D B;  3CCR S;  2K1R B;  1IVZ A;  2DPI A;  3I6P A;  1H6K X;  4ZOS A;  1WTB A;  1YRU A;  1QY7 A;  4WXW A;  5A2Q U;  4BWJ A;  3PV8 A;  1PC5 A;  2VDH A;  3MUM P;  2VQE J;  4DF8 A;  4V19 J;  4ILR A;  4DCO B;  3OSN A;  3N6L A;  2XHW A;  5HLF A;  1N5Y B;  4BC9 A;  1RA7 A;  1KKH A;  2V8H A;  2HHU A;  5GVQ A;  3VWS A;  1YI2 S;  4GTD A;  1CC7 A;  4PUO B;  1QVG R;  1RT2 B;  4WK3 A;  1T9V A;  2IM1 A;  5KFA A;  5D15 A;  4DF4 A;  3GIL A;  5BXI A;  2EC2 A;  1NKC A;  3CWJ A;  5C44 C;  5LSO A;  4ZVQ B;  4ECQ A;  3FGV A;  1M5H A;  2W7A A;  1YJN S;  4AH6 A;  3X1L B;  2EG2 A;  2MZR A;  5J1N A;  4AXI A;  3H5X A;  2XMW A;  4LOW A;  2KT2 A;  1X9W A;  4KYZ A;  3ZXW A;  2Q3P A;  1VMB A;  3CJ2 A;  3HVR A;  4N8O A;  3GTO A;  4KAT A;  3C2P A;  4EBD A;  3M9N B;  2NCK L;  1DTQ A;  1S1T B;  3NY0 A;  3I4M K;  4LF8 F;  3PW0 A;  1IKV A;  3K0J A;  3MAA B;  2DNO A;  2AJ0 A;  3GLJ A;  4PWD A;  3DDI A;  3O2I A;  2ZHA A;  1NU4 A;  2DIV A;  4JI4 F;  3UO0 A;  4F50 A;  3C6U A;  4DV4 F;  3BPD A;  2XGQ A;  1M1G A;  4HR2 A;  4YUD A;  1Q4R A;  2LXU A;  1ZBS A;  3HHL D;  4AYB L;  2LDI A;  1FKA F;  4XLN A;  3QQC D;  2Y0S D;  2KB2 A;  2P6S A;  2YTC A;  1R27 B;  3UDV A;  3T02 A;  2O5J A;  1F2G A;  2OPR B;  2WBM A;  4ZP7 A;  2QX0 A;  2HIQ A;  4KAW X;  2ZUE A;  2D41 A;  1R8H A;  2HNZ B;  3FFI A;  4FYV B;  4CLT A;  1SC4 B;  2V8G A;  3EE3 A;  5E7O B;  2V94 A;  2ZKT A;  1TWH C;  4K0K J;  3EPI A;  1BGX T;  3F0N A;  1HNW F;  2HMI A;  3Q8V A;  5BYS A;  4QYZ K;  3GTQ K;  4NOI A;  2VHG A;  2JH3 A;  4LF9 J;  3S14 K;  4AXJ A;  1AW0 A;  3BSN A;  1U25 A;  3V6H A;  1JKH B;  5A8K B;  4BBR K;  3EWG A;  1R9T A;  4IFY A;  3R7N B;  2V9K A;  2DRA A;  4YY3 F;  1RWU A;  2VIH A;  2BKN A;  4C8N A;  1SV5 A;  1WHY A;  3OTE A;  4CLF A;  2W2O P;  5C42 A;  2ZBC A;  1EET B;  4ZCL A;  3QSI A;  4F4A A;  2NVY A;  2X3G A;  2YKM B;  3DMJ B;  3IP0 A;  4HVZ A;  1TWC K;  3LAJ A;  3DOK B;  3O6Q A;  1C2P A;  5AE3 A;  4A3L C;  3V4I A;  3DM2 A;  2A2C A;  3L7P A;  1JMT A;  2W2Q P;  2GC8 A;  2O67 A;  4QQB A;  5J2Q B;  1FKO A;  5ETN A;  1K83 A;  1QVF R;  2G13 A;  4IQX A;  4ECU A;  2Q79 A;  1UVK A;  4X64 J;  4C2M K;  2LMI A;  4JI6 J;  2BBE A;  2XCQ A;  3GE9 A;  1HBO A;  2WB4 A;  3JB9 k;  3CJQ A;  4A3B K;  2BE9 B;  1SC1 B;  3MFI A;  1UJ6 A;  3A4T A;  4OIN A;  2RU9 A;  1RTZ A;  1H98 A;  2BJ7 A;  2B63 C;  2XCO A;  3US5 A;  2KL8 A;  3ILL A;  2VF3 A;  2IA0 A;  3K8W A;  1FKP A;  4DSI A;  2WSE C;  2JA5 A;  2O66 A;  2XMU A;  4RUC A;  2H65 B;  3DGV A;  4EU0 A;  5KT3 A;  2O1P A;  2D7S A;  4J5O A;  2FLL A;  2FVP A;  2VL1 A;  2D3Z A;  2VBW A;  1TVR A;  4WFY A;  3E01 A;  4MFB A;  2LQ8 A;  2CDQ A;  2BJ1 A;  1LWC A;  4NX9 A;  2C2E A;  1IBC B;  3QT7 A;  2C2M B;  4J90 A;  2XSJ B;  1AFI A;  2DNY A;  2UUC J;  1UEV A;  1T02 A;  2AYM A;  2IAJ A;  2FHK A;  2DY9 A;  1WCM A;  4CQ1 A;  3RZO K;  4ENO A;  3O5T B;  4C0H A;  1LWF B;  4P2M A;  2K7J A;  4JI8 J;  2YBV A;  4LF4 J;  3LP2 B;  4P71 A;  1CJV A;  2A6M A;  3H59 A;  2JEI A;  4HDH A;  2AGP A;  1IBL F;  2Z2M A;  1XER A;  3OXL A;  2J9D A;  4EMD A;  2KKH A;  3PEH A;  2H5J B;  1REV A;  4JBC A;  2LA4 A;  3OSP A;  2R93 K;  3MPV A;  4WE1 B;  1SPB P;  2IBK A;  1N33 F;  2CQD A;  3TRG A;  4ZVS B;  9RUB A;  3MD1 A;  4ZVP B;  3NS6 A;  3UCG A;  2ADB A;  1I3Q C;  2HGN A;  4LFC J;  3GG1 A;  4A3D C;  3M1V B;  5CXT A;  1NK7 A;  2HND A;  2QG9 B;  5JMN A;  2HRU A;  5CD4 H;  3BYP A;  3VHQ A;  4B17 A;  3TTG A;  5K14 B;  3RZD C;  3PCO B;  5KFP A;  3M8P A;  3P6Y C;  1O5J A;  2HKE A;  2YQ0 A;  3POT A;  2HS4 A;  3CAG A;  5D4N A;  2DCU B;  2W8K A;  2FQQ B;  3S7R A;  2BM1 A;  1UP1 A;  3Q3Q A;  2BOP A;  3NBP B;  2OD6 A;  2B7C B;  4OYB A;  3G9C A;  4ECS A;  5J1E A;  4MKB A;  1I5O B;  3A3P B;  3UN2 A;  2RRN A;  2E1P A;  4H4K A;  2PII A;  4DSJ A;  3FQK A;  3NGS A;  1FDN A;  1YJU A;  3BBF A;  3TAP A;  5J2P A;  2L9N A;  3PHT A;  3CVK A;  1OQ3 A;  4C8M A;  2YNI A;  2IC3 A;  2GVZ A;  2MKC A;  3SBM A;  4YB7 A;  1Y4Z B;  4R25 A;  4WP8 A;  2Z2Z A;  1MNE A;  1EJ7 L;  4Y3C A;  1VQ6 S;  2C2D A;  1TL7 A;  4TKT A;  3ONQ A;  2AV5 A;  2RUS A;  3W2W A;  3FKI K;  4KGK A;  1FD8 A;  1F0X A;  3MM7 B;  1SC6 A;  3HI9 A;  5FII A;  5T14 A;  4DX8 H;  4EI2 A;  1U26 A;  3RYL A;  3KLI B;  3H3V D;  2CNK B;  1SMY A;  2GAG C;  3FQL A;  3AD7 C;  3QLH B;  4OYW A;  3EGZ A;  4EFA C;  2X1F A;  2UUW A;  2XLJ A;  3HKZ L;  2OUG A;  4RW8 B;  3N79 A;  1S1V B;  1V5V A;  4DR3 F;  2QA2 A;  1UFK A;  1TWF C;  1N6Q B;  1YZ6 A;  3BKT A;  2XEX A;  1NK8 A;  2E2I K;  3K8V A;  2B6A A;  3TEG A;  2HFN A;  4Y52 C;  2H3E B;  1HW8 A;  2CZV C;  1U09 A;  1BQN B;  1S1X B;  2V4Q A;  2C1E B;  1FXL A;  3QAT A;  4ZPB A;  2Q6C A;  5EGE A;  1JLQ B;  3BH6 B;  3HCX A;  2BJD A;  1AA1 B;  1R3N A;  5B0E A;  3A12 A;  1I3O B;  2V4J A;  4OZ5 A;  4FXV A;  3HLU A;  3PO3 K;  4DUY J;  5G4D A;  2A18 A;  1FNO A;  3HVA A;  1PC4 A;  1KOH A;  3GEI A;  2DR7 A;  1S48 A;  3KJV A;  4WP9 A;  5K8P A;  2EXU A;  5C25 A;  4JYA F;  5KFR A;  2AQ4 A;  3V2U C;  5KT2 A;  2LA6 A;  4YN3 B;  3GV5 B;  2IBO A;  3W60 A;  1RWX B;  2E2H C;  3MR6 A;  1WUU A;  3S1R C;  2V8P A;  4JI2 F;  5IYB K;  4RMF A;  3AQO A;  2MZ1 A;  4MAK A;  3BSA A;  4KJI A;  1ACM B;  2AZ1 A;  2CQC A;  3RR8 A;  1VRQ C;  3NNH A;  2KFN A;  5IM0 A;  4IG3 A;  4B3M F;  1SIW B;  3NWG A;  4E0D A;  3FMB A;  1TV6 B;  4DCP B;  3UPF A;  3ZZR A;  3IBC B;  4PXD A;  1WC0 A;  1WQH A;  5HQM A;  3R5G A;  4CYU A;  3MI7 X;  3DOL A;  2R7Z A;  4K4Z A;  2PEH A;  5E0O A;  2N3L A;  1H0H B;  3V6J A;  2HQC A;  2HGM A;  4C7Q A;  4KM9 A;  2XGP A;  3EVW A;  3UCU P;  2ZVS A;  5C5J A;  3RG6 A;  3RAQ A;  3RBD A;  1DCO A;  4DV0 F;  2K7K A;  4DSK A;  3PEJ A;  1H3D A;  1HKA A;  5FLX Y;  2ZZM A;  3EGW B;  3CD0 A;  4DMZ A;  2VJV A;  4JI0 J;  2VA2 A;  5DET A;  1UMJ A;  2HFU A;  5HMZ A;  1XMB A;  3QBC A;  2UXB J;  1FI4 A;  4WU3 A;  5CHC B;  2MKK A;  1RCO B;  3IMQ J;  2HIY A;  1N52 B;  1CUL B;  1CJT B;  2XHC A;  1ZXO A;  2VG5 A;  4MYU A;  3GTG K;  3F41 A;  3HOW C;  3CDW A;  4LSL A;  3DRR B;  4PQU A;  3LTO A;  2JA7 K;  3RAM A;  2WOM B;  4ILL A;  5HJX A;  3KOA A;  3DLG A;  5L9N A;  3M8Y A;  4G0U A;  2V2Q A;  3DGP A;  2WAQ L;  4RNN A;  3CC4 S;  4O0N A;  1WNE A;  1HA1 A;  4P6Q A;  4DDF A;  5H1S V;  1AYE A;  1Q95 G;  4KE5 A;  4TXS A;  3TZW A;  3MMA B;  4KGX B;  3KLV A;  1VYA A;  1IM6 A;  3RW6 A;  3DN9 A;  3KDO A;  4XIU A;  3K89 A;  1UEK A;  4DN0 A;  3U27 A;  4LRE A;  4KTQ A;  2BJ3 A;  3TUP A;  2N82 B;  1RAO A;  1N36 F;  3D54 A;  5HBM B;  3GFY A;  2B9Y A;  2R8H A;  2NR0 A;  1L3V A;  3JTN A;  1RWO B;  3PJW A;  4A3G C;  4FNH A;  2RIJ A;  2QO3 A;  1HI1 A;  3L3C A;  3I96 A;  4MIB A;  4DR4 J;  3FUY A;  4CNY A;  1S0O A;  2IMW P;  1O27 A;  2FVQ A;  1KN6 A;  2NVX K;  3M05 A;  2FVR A;  2FJD B;  3V4G A;  4YP3 A;  3QAU A;  3G71 S;  2YXL A;  5HVH A;  3IRW P;  1EB0 A;  3KK2 B;  2F65 A;  3PR4 A;  5L1J A;  2D6F C;  3TAN A;  3G87 A;  2PD1 A;  1HBN B;  4ZMM A;  2ZWP A;  3HSD A;  3ISZ A;  3V6D B;  3OEP A;  3TX8 A;  1RUS A;  4AFF A;  1S99 A;  3MEG B;  4K4U A;  3ET6 A;  1H73 A;  4ID5 A;  1OWX A;  2JL9 A;  2CJY B;  3M2R A;  4MK8 A;  3LP0 A;  4KO0 A;  3SV3 A;  4QU6 A;  1YNN A;  4CNZ A;  3MR3 A;  2FJA B;  4LT6 A;  3B54 A;  5TJ3 A;  2FLO A;  1Y1V K;  3ERE D;  3MEC B;  4BHQ A;  4DV4 J;  3Q83 A;  1LKZ A;  5T7L A;  4RX6 A;  2E7V A;  3I4P A;  2MQO A;  4ES3 A;  3I4M C;  4C97 A;  1F3V A;  3Q24 A;  4MIA A;  3HSJ A;  1ZM9 A;  2C28 A;  2ZZT A;  2ZH6 A;  4J91 A;  4B02 A;  1RAD B;  3D66 A;  1NSP A;  2Z56 B;  3RB3 A;  4MH8 A;  3GB0 A;  1U1P A;  3OFF A;  4NXM J;  2XYG B;  5E33 A;  4NCB A;  5KFO A;  4EK2 A;  1D3W A;  1WTF A;  1XEZ A;  2KXH A;  2YWG A;  2JEF A;  4UY8 T;  1PG5 B;  2XUL A;  3DXB A;  4Q8E A;  2HRT A;  4AQY J;  3PVX A;  2QN6 B;  3MM9 B;  1NK9 A;  1TMM A;  3CCM S;  3K7A K;  1IBA A;  5B7W A;  1XMQ J;  1SQF A;  1UZH A;  3LWM A;  1QUV A;  4RU2 A;  2ASD A;  5DG7 A;  2VBX A;  4F4W A;  3CD5 A;  1VQ7 S;  1OMS A;  3ISN C;  4F36 A;  3GTQ C;  4HAC A;  3PW7 A;  4TLR A;  2KHD A;  2RS8 A;  3S14 C;  1VRU B;  2MDA A;  1QAJ A;  3UQS A;  2L41 A;  5F3T A;  1SI9 A;  2JEG A;  2HVI A;  2DK2 A;  4RW6 A;  3FSY A;  4BBR C;  1RXO B;  3PAC A;  3QGG A;  2P9G A;  1BMQ B;  4NA3 A;  3PIP Q;  2P8T A;  4FF2 A;  2VPZ B;  1T9T A;  2ZWO A;  2DBB A;  4CCH A;  3JSY A;  1OYD A;  2JX2 A;  1TWC C;  1XBW A;  4G65 A;  4I1T A;  1HW9 A;  4I6W A;  2FJE B;  5KG3 A;  3WDO A;  2H1Y A;  2MHE A;  3W2V B;  2QLX A;  2YQ3 A;  2VZ9 A;  2ZE2 A;  3R97 A;  1HNI A;  5CQG A;  2K8G A;  2HHT A;  1TKX B;  2GA7 A;  2RQM A;  2CQ4 A;  1HPZ A;  3BGF A;  4A93 K;  1ZAX A;  3FZ2 A;  5AT1 B;  3ELH A;  3GDZ A;  1I94 J;  2C2O B;  1S1U A;  1I6V A;  2DHG A;  1JJC B;  2VH7 A;  1X4A A;  3NGD A;  4ECT A;  1S0M A;  4ED6 A;  2GW8 A;  4C2M C;  1Y11 A;  5BYR A;  5F8J A;  1FDD A;  3C16 B;  1VJQ A;  2VA3 A;  2R42 A;  4A3B C;  1PJ7 A;  1IW7 A;  1YIT S;  1RDR A;  2EFO A;  3I82 A;  1LXJ A;  3TA2 A;  1PO6 A;  5HAT A;  2J9D E;  4YHH F;  1JLF B;  4UF4 A;  3LH2 S;  1UEU A;  5LL6 d;  3HF5 A;  2WSC C;  3IA0 A;  2M8D B;  1IXK A;  2LP4 A;  3RZA A;  3U02 A;  2EG1 A;  4B3S F;  1G1X A;  1PYT A;  3G6Y A;  5HJY A;  1HFE L;  3D1O A;  2YKN A;  2KHC A;  4X4R A;  3EZ5 A;  1ROF A;  4YB1 P;  3TUZ C;  1FDA A;  5D4P A;  2CWX A;  2DR6 A;  4BC7 A;  3HHL C;  1IBL J;  5L1I A;  1CVJ A;  3JAM U;  4GKJ J;  3R3T A;  4KPC A;  5A76 A;  2L48 A;  1PCA A;  5CD4 A;  4OYI A;  4P10 A;  1SIZ A;  3S6E A;  4RBU A;  4K5R A;  3PW5 A;  2E1C A;  1FXD A;  4JI1 J;  4L76 A;  5CHP A;  4F4K A;  1UTA A;  5I42 A;  2XMJ A;  3G4C A;  4O44 A;  4DR2 J;  1FJE B;  1VQY A;  1RK8 A;  4ED2 A;  4LF5 J;  3AAW B;  5LOQ A;  2R93 C;  4OL8 A;  2W7V A;  2B4V A;  1Q8I A;  2HWH A;  4O3R A;  3OJU A;  4X66 J;  1G2E A;  3G8Q A;  3FDS A;  3KHR A;  4BY1 K;  4ED1 A;  5HMW A;  4UOF A;  2KZZ A;  4XSX A;  2HWT A;  3CJ3 A;  2VQF J;  2PMH A;  3CT9 A;  1VLO A;  2VKZ G;  5BJR A;  4ZIT A;  1B0V A;  1CG2 A;  4YR2 A;  1Y3K A;  4GTE A;  2JA6 K;  1NPK A;  3OUY A;  4JV2 A;  3S16 K;  3TAR A;  4DL0 C;  3HOU K;  1UPP A;  1GE9 A;  4U8Y A;  3T00 A;  4OYA A;  2OPS A;  1R7I A;  1BLU A;  4LF1 A;  4X4T A;  2DGX A;  3HVT B;  3LOU A;  2EC0 A;  1FJ7 A;  4N76 A;  2DXD A;  4P75 A;  1RU1 A;  3J80 U;  2FJX A;  2H9Z A;  4XSZ A;  1M5V C;  2Q6B A;  2EWH A;  4IOB A;  3QJL A;  1IWG A;  2GML A;  3GTK A;  3H2V E;  3S2H K;  3PX6 A;  1A0O B;  4OJH A;  2VC0 A;  1WC1 A;  4OX9 F;  4YOE A;  4JP8 A;  3RB0 A;  1RTI A;  3D2W A;  1DZ5 A;  2UVV A;  2C3Y A;  1AT1 B;  2LU2 A;  4LF2 A;  2P5V A;  2N4C A;  5DQI A;  3FKI C;  3CC7 S;  4DDQ A;  3TJA A;  3J7Z T;  3H5S A;  3M30 A;  3DRP A;  1PKU A;  5HRO A;  3OPK A;  4ZIW A;  3ILO A;  1X4D A;  4DR6 F;  2JLG A;  2JC1 A;  1QLN A;  2CJQ A;  1HHS A;  4MKY A;  2MTL A;  2DXF A;  1TKZ A;  4JV5 F;  4A3I K;  1RWV B; 
#chains in the Genus database with same CATH homology
 1WOO A;  3GEH A;  3GEI A;  1PJ7 A;  3GSI A;  1V5V A;  3AD9 C;  3TFH A;  2GAH C;  3TTG A;  1XZQ B;  1PJ6 A;  3ADA C;  1WOP A;  1XZP B;  1YX2 A;  3GEE A;  3GIR A;  1X31 C;  3AD8 C;  1WOR A;  1WSV A;  1VLO A;  1WSR A;  3A8J A;  4PAA A;  2GAG C;  1VRQ C;  1PJ5 A;  1XZQ A;  5L46 A;  3AD7 C;  1XZP A;  3A8K A;  4P9S A;  3TFJ A;  3A8I A;  4PAB A;  3TFI A;  1WOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...