3HOZK

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 30
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hozK00
3PO2C 1Y1VC 4MEXA 1TWFC 1TWAC 3HOXK 2E2HK 1TWGK 4C2MK 5IP7K 4BBRC 1SFOC 4ZH4A 4G7ZA 2R92K 3H3VL 3S17C 3M3YC 4BXXK 3RZOC 4Y52K 2NVYC 4YFNA 2NVXC 5C4XK 4A3EC 3HKZL 4A3JK 2YU9C 3M4OC 3S15C 5M5XK 1R9TK 4G7HA 4A3BK 2O5JA 1ZYRA 3HOWC 3GTGK 3GTJK 2JA5K 5M3MK 1BDFA 4A3DK 1Y1WC 4LLGA 2NVTK 1I3QK 4A3MK 2A6HA 4MEYA 3HOVC 3S1RC 4BY1K 3S1QK 4GZYA 4BY7K 3GTKK 2R7ZK 4LK0A 4A3FK 2E2HC 5IP7C 5IYDK 3GTQK 1I6VA 2PA8D 5C4XC 4XLNA 3HOYC 3I4NC 4A3LK 2CW0A 1I50K 1R9TC 2VUMK 4A3BC 2B63K 5IYBK 3GTGC 3GTJC 4OIQA 5IYCK 4Q5SA 3HOZK 3I4MK 3S16K 3GTPK 4BY1C 2JA8K 3S1QC 2E2IC 1TWHK 1TWCK 2R7ZC 3GTKC 4A3FC 2PPBA 4X6AK 4OIPA 5IYDC 3PO3C 3GTQC 1YNNA 3GTOK 1IW7A 2E2JK 3RZDK 4MQ9A 4JK1A 2O5IA 4A3CK 5FLMC 3S2DC 2PA8L 5C3EK 1WCMK 2VUMC 1I50C 3GTMK 2PMZL 4BBSK 2JA7K 4A3IK 3HOUK 4G7OA 3I4MC 4NOIA 3HOXC 1TWGC 2R92C 5D4DA 3S1MK 3H0GK 1TWHC 4Y52C 4BXXC 3WODA 4A3JC 2A6EA 4LJZA 3GTLK 2PMZD 5C4JK 4LK1A 2E2JC 2JA5C 3S2HK 5M3FK 4KN4A 4A3DC 5C3EC 4XSXA 2NVTC 3CQZK 1I3QC 1WCMC 4A3MC 1YNJA 3S14K 4OIOA 4BY7C 2Y0SD 2JA7C 5C44K 3HOUC 1SMYA 1I6HK 2WB1L 4QIWD 4YFXA 4OIRA 3S1MC 3S17K 3RZOK 2JA6K 2NVYK 3EQLA 4Q4ZA 4A3KK 2YU9K 4OINA 4C3HK 3GTLC 4A3LC 4XLPA 3DXJA 4C3IK 5C4JC 3K7AK 2B63C 5IYBC 2WB1D 4YG2A 3S2HC 3S1NK 5IYCC 3HOZC 4QJVA 3S16C 3CQZC 5IP9K 3S14C 4A3GK 3GTPC 4QJVB 2R93K 2JA8C 3S1RK 1TWCC 2WAQD 4AYBL 5C44C 1I6HC 4X6AC 3FKIK 2Y0SL 5M5YK 4KMUA 3GTOC 1K83K 4QIWL 3RZDC 4XSZA 4A93K 4A3CC 2JA6C 5TMCA 4A3KC 4Y7NK 3HOYK 4AYBD 2NVQK 3I4NK 3K7AC 3S2DK 1XPPA 5M5WK 3GTMC 3PO2K 1HQMA 2BE5A 3S1NC 4KN7A 3H3VD 4A3IC 1Y1VK 4BBSC 1TWFK 5IP9C 1TWAK 4A3GC 2R93C 1SFOK 4BBRK 3H0GC 3HKZD 2E2IK 4C3JK 3M3YK 2NVXK 4A3EK 3M4OK 2WAQL 2A69A 3FKIC 3S15K 4YFKA 5FJ8K 3PO3K 1K83C 4A93C 2A68A 3HOWK 5TMFA 5FLMK 4Y7NC 2NVQC 1Y1WK 3HOVK
chains in the Genus database with same CATH superfamily
1SFOA 3PO2C 3SZYA 1O24A 4FM9A 2E2IA 4MEXA 2NVYA 4KMDA 3HOXK 2NVXA 4C2MK 1SFOC 2YU9A 4G7ZA 3S17C 3M3YC 2NVYC 2NVXC 4A3EC 2YU9C 4A3JK 1IBAA 4A3DK 4FZBA 2GAHC 4GTLA 1F9NA 4BY1K 3S1QK 1ZXOA 3ADAC 1WOSA 5IP7C 5IYDK 3GTQK 1I6VA 1WOOA 3MMLB 1R9TA 1INNA 3GTJA 3HOYC 2CW0A 1I50K 1R9TC 2B63K 3GTJC 4OIQA 3IPJA 5IYCK 3HOZK 3GTKA 2XCRB 5IORA 2R7ZA 3GIRA 4WJ4A 2XCQA 3A8KA 1TWHK 1ISEA 1TWCK 2R7ZC 3GTKC 4A3FC 4OIPA 3PO3C 1YNNA 2RH6A 3GTOK 3RZDK 1VRQC 2R92A 5JVOA 4BBSK 2GSUA 2JH3A 3TFIA 3I4MC 2R92C 4Y52C 1F7VA 3WODA 1WQFA 5C4JK 4LK1A 2E2JC 4KN4A 4P9SA 4BLBA 1YNJA 4OIOA 1J6XA 4KMAA 1I6HK 3GEHA 2ZUFA 2WB1L 1VH2A 2PHCB 4BKWA 1O25A 5EGHA 1G51A 4Q4ZA 4A3KK 5E68A 4A3LC 3DXJA 3GTPA 1O28A 4QJVA 3S16C 5IP9K 1J6VA 3GTPC 2JA8C 5CHPA 3N3YA 4AYBL 1O2BA 4KATA 3GTMA 3CAGA 5IOTA 4C3IC 5M5WK 3GTMC 2BE5A 2RGRA 1F93A 4KARA 3H3VD 1TWFK 3A8IA 3AD7C 1WOPA 3H0GC 4LQYA 1XZQB 3M4OK 2WAQL 4A93C 3HOWK 5TMFA 4Y7NC 1Y1VA 1TWAA 3S2DC 1YX2A 1VLOA 1Y1VC 5JFEA 1TWAC 4KMHA 1TWGK 4BBRC 1DCHA 4BXXK 4LOWA 5C4XK 2CFAB 3S15C 3BUEA 4G7HA 4A3BK 1ZYRA 3GTGK 5M3MK 4LLGA 2NVTK 1J98A 3HOVC 4MEYA 3S1RC 4G0UA 4P5AA 5EGEA 4GFQA 1RU0A 1IL2A 4C2MC 1C0AA 4LR2A 4XLNA 1WIHA 3I4NC 2VUMK 5IYBK 3LPXA 3N0BA 1PJ5A 1EFWA 4BY1C 3S1QC 2E2IC 3GTQA 4X6AK 5IYDC 1YCLA 3GTQC 1I50A 4MQ9A 4JK1A 1WQHA 2PA8L 1WCMK 1I50C 1ZBSA 2XCOA 1TWHA 2JA7K 3HOUK 4G7OA 1O2FB 1WQGA 5D4DA 1PJ6A 1TWHC 1WSRA 2GAGC 1V5VA 4KB4A 2JA5A 4GTAA 1I3QA 2JA5C 3S14K 1I3QC 4A3MC 1VGXA 4BY7C 1DCOA 4QIWD 1GE9A 4YFXA 2V6SA 5IOQA 3S17K 2W7VA 2JA6K 2NVYK 5IOSA 2YU9K 4GT9A 5C4JC 3K7AK 4YG2A 4KM8A 4A3GK 2R93K 3Q3QA 4GTBA 1I6HC 2GSOA 2Y0SL 1K83K 4A3CC 4XSZA 3AD8C 4A3KC 3BP8C 3JSTA 3HOYK 5TJ3A 3FOEA 4KN7A 4A3IC 5IP9C 4G0VA 1XZQA 2V6TA 4C3JK 4PABA 2A69A 4YFKA 3PO3K 4P5BA 4WJ3M 3NUHA 1TWFA 1Y1WK 5CJ9A 1JQWA 4KC6A 2D6FC 1TWFC 2E2HK 2R92K 4ZH4A 4Y52K 3RZOC 3M4OC 3HKZL 1BS2A 3GDZA 3HOWC 1BDFA 4KB2A 1ZVUA 1JVIA 1O29A 5C4XC 3GTGA 4A3LK 4A3BC 1ZQ1C 3GTGC 3GSIA 5HL8A 4DDQA 4Q5SA 4G0WA 1WSVA 3S16K 3GTPK 2JA8K 1B4AA 3VA7A 4GTEA 2VUMA 3OPFA 1EK8A 5FLMC 5C3EK 2VUMC 4AH6A 2ZFZA 3GTMK 4ILDA 4NOIA 3HOXC 4GTDA 3S1MK 3H0GK 4PAAA 1IS1A 4A3JC 3GTLK 4RMFA 2PMZD 1WCMA 3BP3A 3S2HK 4A3DC 4O2DA 2JA7A 3CQZK 1WCMC 2JA7C 3HOUC 5C44K 1SMYA 1VJEA 4J3NA 3OEPA 4BLAA 3G4CA 4OIRA 2B63A 3HXAA 4OINA 4C3HK 2B63C 1XZPB 5IYCC 1TWCA 3HOZC 3S1NK 3S14C 1DD5A 3S1RK 1USMA 1TWCC 2WAQD 3GTOA 2JA6A 3FKIK 2GSNA 4KMUA 3GTOC 3RZDC 1EH1A 5TMCA 2JA6C 2EBBA 3LAJA 2NVQK 3I4NK 2R93A 3K7AC 1XPPA 3PO2K 1HQMA 1DCPA 4BBSC 4A3GC 2R93C 1SFOK 2P5MA 3TFHA 2E2IK 1K83A 3M3YK 2NVXK 1UV7A 3AD9C 4A3EK 5FJ8K 2KWAA 1BGWA 1K83C 3AQPA 2A68A 3L4KA 1O2AA 2P8TA 3A8JA 3FHZA 5IP7K 3H3VL 4C3JC 3ERED 4YFNA 1WORA 3T02A 2V6UA 1Y1WA 5M5XK 1R9TK 2O5JA 4KM9A 4KAWX 3TFJA 3GTJK 2JA5K 3V4GA 1Y1WC 1I3QK 3T00A 2A6HA 4A3MK 2E2HA 4GZYA 4BY7K 3GTKK 2R7ZK 4LK0A 4A3FK 2E2HC 2PA8D 3AH5A 4GTCA 2Y3PA 1BJTA 1HI9A 3GEEA 3I4MK 1O26A 1EI6A 2CFAA 2PPBA 2FQOA 1PJ7A 3T01A 1IW7A 2E2JK 4A3CK 2O5IA 4KDDA 1JOEA 1F7UA 1O27A 1TWGA 5L46A 2PMZL 4A3IK 1TWGC 1J6WA 4KASA 4BXXC 2A6EA 4LJZA 3GEIA 1B4BA 4M1XA 3LAPA 5M3FK 4C45A 5C3EC 4XSXA 2NVTC 1X31C 3H0GA 2Y0SD 1XXAA 3GTLA 3G4AA 1KQ4A 3S1MC 3QX3A 3RZOK 3EQLA 3GTLC 4XLPA 3CQZA 4C3IK 1XZPA 5IYBC 4WILA 2WB1D 1L0WA 3S2HC 2FQTA 3CQZC 4QJVB 3S0XA 3OREA 5C44C 4X6AC 4GTFA 1USOA 3N0CA 5M5YK 4QIWL 4A93K 4Y7NK 4C3HC 3L4JA 4AYBD 4XCHA 3S2DK 1AB4A 3S1NC 3AQOA 1Y1VK 1TWAK 3FKIA 1IE0A 4BBRK 3HKZD 3SZZA 1EQRA 3TTGA 3FKIC 1XXCA 3S15K 2ZUEA 3FOFA 1XXBA 1IQ0A 5FLMK 2NVQC 3HOVK
chains in the Genus database with same CATH topology
3PO2C 1Y1VC 4MEXA 1TWFC 1TWAC 3HOXK 2E2HK 1TWGK 4C2MK 5IP7K 4BBRC 1SFOC 4ZH4A 4G7ZA 2R92K 3H3VL 3S17C 3M3YC 4BXXK 3RZOC 4Y52K 2NVYC 4YFNA 2NVXC 5C4XK 4A3EC 3HKZL 4A3JK 2YU9C 3M4OC 3S15C 5M5XK 1R9TK 4G7HA 4A3BK 2O5JA 1ZYRA 3HOWC 3GTGK 3GTJK 2JA5K 5M3MK 1BDFA 4A3DK 1Y1WC 4LLGA 2NVTK 1I3QK 4A3MK 2A6HA 4MEYA 3HOVC 3S1RC 4BY1K 3S1QK 4GZYA 4BY7K 3GTKK 2R7ZK 4LK0A 4A3FK 2E2HC 5IP7C 5IYDK 3GTQK 1I6VA 2PA8D 5C4XC 4XLNA 3HOYC 3I4NC 4A3LK 2CW0A 1I50K 1R9TC 2VUMK 4A3BC 2B63K 5IYBK 3GTGC 3GTJC 4OIQA 5IYCK 4Q5SA 3HOZK 3I4MK 3S16K 3GTPK 4BY1C 2JA8K 3S1QC 2E2IC 1TWHK 1TWCK 2R7ZC 3GTKC 4A3FC 2PPBA 4X6AK 4OIPA 5IYDC 3PO3C 3GTQC 1YNNA 3GTOK 1IW7A 2E2JK 3RZDK 4MQ9A 4JK1A 2O5IA 4A3CK 5FLMC 3S2DC 2PA8L 5C3EK 1WCMK 2VUMC 1I50C 3GTMK 2PMZL 4BBSK 2JA7K 4A3IK 3HOUK 4G7OA 3I4MC 4NOIA 3HOXC 1TWGC 2R92C 5D4DA 3S1MK 3H0GK 1TWHC 4Y52C 4BXXC 3WODA 4A3JC 2A6EA 4LJZA 3GTLK 2PMZD 5C4JK 4LK1A 2E2JC 2JA5C 3S2HK 5M3FK 4KN4A 4A3DC 5C3EC 4XSXA 2NVTC 3CQZK 1I3QC 1WCMC 4A3MC 1YNJA 3S14K 4OIOA 4BY7C 2Y0SD 2JA7C 5C44K 3HOUC 1SMYA 1I6HK 2WB1L 4QIWD 4YFXA 4OIRA 3S1MC 3S17K 3RZOK 2JA6K 2NVYK 3EQLA 4Q4ZA 4A3KK 2YU9K 4OINA 4C3HK 3GTLC 4A3LC 4XLPA 3DXJA 4C3IK 5C4JC 3K7AK 2B63C 5IYBC 2WB1D 4YG2A 3S2HC 3S1NK 5IYCC 3HOZC 4QJVA 3S16C 3CQZC 5IP9K 3S14C 4A3GK 3GTPC 4QJVB 2R93K 2JA8C 3S1RK 1TWCC 2WAQD 4AYBL 5C44C 1I6HC 4X6AC 3FKIK 2Y0SL 5M5YK 4KMUA 3GTOC 1K83K 4QIWL 3RZDC 4XSZA 4A93K 4A3CC 2JA6C 5TMCA 4A3KC 4Y7NK 3HOYK 4AYBD 2NVQK 3I4NK 3K7AC 3S2DK 1XPPA 5M5WK 3GTMC 3PO2K 1HQMA 2BE5A 3S1NC 4KN7A 3H3VD 4A3IC 1Y1VK 4BBSC 1TWFK 5IP9C 1TWAK 4A3GC 2R93C 1SFOK 4BBRK 3H0GC 3HKZD 2E2IK 4C3JK 3M3YK 2NVXK 4A3EK 3M4OK 2WAQL 2A69A 3FKIC 3S15K 4YFKA 5FJ8K 3PO3K 1K83C 4A93C 2A68A 3HOWK 5TMFA 5FLMK 4Y7NC 2NVQC 1Y1WK 3HOVK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 C;  1Y1V C;  4MEX A;  1TWF C;  1TWA C;  3HOX K;  2E2H K;  1TWG K;  4C2M K;  5IP7 K;  4BBR C;  1SFO C;  4ZH4 A;  4G7Z A;  2R92 K;  3H3V L;  3S17 C;  3M3Y C;  4BXX K;  3RZO C;  4Y52 K;  2NVY C;  4YFN A;  2NVX C;  5C4X K;  4A3E C;  3HKZ L;  4A3J K;  2YU9 C;  3M4O C;  3S15 C;  5M5X K;  1R9T K;  4G7H A;  4A3B K;  2O5J A;  1ZYR A;  3HOW C;  3GTG K;  3GTJ K;  2JA5 K;  5M3M K;  1BDF A;  4A3D K;  1Y1W C;  4LLG A;  2NVT K;  1I3Q K;  4A3M K;  2A6H A;  4MEY A;  3HOV C;  3S1R C;  4BY1 K;  3S1Q K;  4GZY A;  4BY7 K;  3GTK K;  2R7Z K;  4LK0 A;  4A3F K;  2E2H C;  5IP7 C;  5IYD K;  3GTQ K;  1I6V A;  2PA8 D;  5C4X C;  4XLN A;  3HOY C;  3I4N C;  4A3L K;  2CW0 A;  1I50 K;  1R9T C;  2VUM K;  4A3B C;  2B63 K;  5IYB K;  3GTG C;  3GTJ C;  4OIQ A;  5IYC K;  4Q5S A;  3HOZ K;  3I4M K;  3S16 K;  3GTP K;  4BY1 C;  2JA8 K;  3S1Q C;  2E2I C;  1TWH K;  1TWC K;  2R7Z C;  3GTK C;  4A3F C;  2PPB A;  4X6A K;  4OIP A;  5IYD C;  3PO3 C;  3GTQ C;  1YNN A;  3GTO K;  1IW7 A;  2E2J K;  3RZD K;  4MQ9 A;  4JK1 A;  2O5I A;  4A3C K;  5FLM C;  3S2D C;  2PA8 L;  5C3E K;  1WCM K;  2VUM C;  1I50 C;  3GTM K;  2PMZ L;  4BBS K;  2JA7 K;  4A3I K;  3HOU K;  4G7O A;  3I4M C;  4NOI A;  3HOX C;  1TWG C;  2R92 C;  5D4D A;  3S1M K;  3H0G K;  1TWH C;  4Y52 C;  4BXX C;  3WOD A;  4A3J C;  2A6E A;  4LJZ A;  3GTL K;  2PMZ D;  5C4J K;  4LK1 A;  2E2J C;  2JA5 C;  3S2H K;  5M3F K;  4KN4 A;  4A3D C;  5C3E C;  4XSX A;  2NVT C;  3CQZ K;  1I3Q C;  1WCM C;  4A3M C;  1YNJ A;  3S14 K;  4OIO A;  4BY7 C;  2Y0S D;  2JA7 C;  5C44 K;  3HOU C;  1SMY A;  1I6H K;  2WB1 L;  4QIW D;  4YFX A;  4OIR A;  3S1M C;  3S17 K;  3RZO K;  2JA6 K;  2NVY K;  3EQL A;  4Q4Z A;  4A3K K;  2YU9 K;  4OIN A;  4C3H K;  3GTL C;  4A3L C;  4XLP A;  3DXJ A;  4C3I K;  5C4J C;  3K7A K;  2B63 C;  5IYB C;  2WB1 D;  4YG2 A;  3S2H C;  3S1N K;  5IYC C;  3HOZ C;  4QJV A;  3S16 C;  3CQZ C;  5IP9 K;  3S14 C;  4A3G K;  3GTP C;  4QJV B;  2R93 K;  2JA8 C;  3S1R K;  1TWC C;  2WAQ D;  4AYB L;  5C44 C;  1I6H C;  4X6A C;  3FKI K;  2Y0S L;  5M5Y K;  4KMU A;  3GTO C;  1K83 K;  4QIW L;  3RZD C;  4XSZ A;  4A93 K;  4A3C C;  2JA6 C;  5TMC A;  4A3K C;  4Y7N K;  3HOY K;  4AYB D;  2NVQ K;  3I4N K;  3K7A C;  3S2D K;  1XPP A;  5M5W K;  3GTM C;  3PO2 K;  1HQM A;  2BE5 A;  3S1N C;  4KN7 A;  3H3V D;  4A3I C;  1Y1V K;  4BBS C;  1TWF K;  5IP9 C;  1TWA K;  4A3G C;  2R93 C;  1SFO K;  4BBR K;  3H0G C;  3HKZ D;  2E2I K;  4C3J K;  3M3Y K;  2NVX K;  4A3E K;  3M4O K;  2WAQ L;  2A69 A;  3FKI C;  3S15 K;  4YFK A;  5FJ8 K;  3PO3 K;  1K83 C;  4A93 C;  2A68 A;  3HOW K;  5TMF A;  5FLM K;  4Y7N C;  2NVQ C;  1Y1W K;  3HOV K; 
#chains in the Genus database with same CATH topology
 1SFO A;  3PO2 C;  3SZY A;  1O24 A;  4FM9 A;  2E2I A;  4MEX A;  2NVY A;  4KMD A;  3HOX K;  2NVX A;  4C2M K;  1SFO C;  2YU9 A;  4G7Z A;  3S17 C;  3M3Y C;  2NVY C;  2NVX C;  4A3E C;  2YU9 C;  4A3J K;  1IBA A;  4A3D K;  4FZB A;  2GAH C;  4GTL A;  1F9N A;  4BY1 K;  3S1Q K;  1ZXO A;  3ADA C;  1WOS A;  5IP7 C;  5IYD K;  3GTQ K;  1I6V A;  1WOO A;  3MML B;  1R9T A;  1INN A;  3GTJ A;  3HOY C;  2CW0 A;  1I50 K;  1R9T C;  2B63 K;  3GTJ C;  4OIQ A;  3IPJ A;  5IYC K;  3HOZ K;  3GTK A;  2XCR B;  5IOR A;  2R7Z A;  3GIR A;  4WJ4 A;  2XCQ A;  3A8K A;  1TWH K;  1ISE A;  1TWC K;  2R7Z C;  3GTK C;  4A3F C;  4OIP A;  3PO3 C;  1YNN A;  2RH6 A;  3GTO K;  3RZD K;  1VRQ C;  2R92 A;  5JVO A;  4BBS K;  2GSU A;  2JH3 A;  3TFI A;  3I4M C;  2R92 C;  4Y52 C;  1F7V A;  3WOD A;  1WQF A;  5C4J K;  4LK1 A;  2E2J C;  4KN4 A;  4P9S A;  4BLB A;  1YNJ A;  4OIO A;  1J6X A;  4KMA A;  1I6H K;  3GEH A;  2ZUF A;  2WB1 L;  1VH2 A;  2PHC B;  4BKW A;  1O25 A;  5EGH A;  1G51 A;  4Q4Z A;  4A3K K;  5E68 A;  4A3L C;  3DXJ A;  3GTP A;  1O28 A;  4QJV A;  3S16 C;  5IP9 K;  1J6V A;  3GTP C;  2JA8 C;  5CHP A;  3N3Y A;  4AYB L;  1O2B A;  4KAT A;  3GTM A;  3CAG A;  5IOT A;  4C3I C;  5M5W K;  3GTM C;  2BE5 A;  2RGR A;  1F93 A;  4KAR A;  3H3V D;  1TWF K;  3A8I A;  3AD7 C;  1WOP A;  3H0G C;  4LQY A;  1XZQ B;  3M4O K;  2WAQ L;  4A93 C;  3HOW K;  5TMF A;  4Y7N C;  1Y1V A;  1TWA A;  3S2D C;  1YX2 A;  1VLO A;  1Y1V C;  5JFE A;  1TWA C;  4KMH A;  1TWG K;  4BBR C;  1DCH A;  4BXX K;  4LOW A;  5C4X K;  2CFA B;  3S15 C;  3BUE A;  4G7H A;  4A3B K;  1ZYR A;  3GTG K;  5M3M K;  4LLG A;  2NVT K;  1J98 A;  3HOV C;  4MEY A;  3S1R C;  4G0U A;  4P5A A;  5EGE A;  4GFQ A;  1RU0 A;  1IL2 A;  4C2M C;  1C0A A;  4LR2 A;  4XLN A;  1WIH A;  3I4N C;  2VUM K;  5IYB K;  3LPX A;  3N0B A;  1PJ5 A;  1EFW A;  4BY1 C;  3S1Q C;  2E2I C;  3GTQ A;  4X6A K;  5IYD C;  1YCL A;  3GTQ C;  1I50 A;  4MQ9 A;  4JK1 A;  1WQH A;  2PA8 L;  1WCM K;  1I50 C;  1ZBS A;  2XCO A;  1TWH A;  2JA7 K;  3HOU K;  4G7O A;  1O2F B;  1WQG A;  5D4D A;  1PJ6 A;  1TWH C;  1WSR A;  2GAG C;  1V5V A;  4KB4 A;  2JA5 A;  4GTA A;  1I3Q A;  2JA5 C;  3S14 K;  1I3Q C;  4A3M C;  1VGX A;  4BY7 C;  1DCO A;  4QIW D;  1GE9 A;  4YFX A;  2V6S A;  5IOQ A;  3S17 K;  2W7V A;  2JA6 K;  2NVY K;  5IOS A;  2YU9 K;  4GT9 A;  5C4J C;  3K7A K;  4YG2 A;  4KM8 A;  4A3G K;  2R93 K;  3Q3Q A;  4GTB A;  1I6H C;  2GSO A;  2Y0S L;  1K83 K;  4A3C C;  4XSZ A;  3AD8 C;  4A3K C;  3BP8 C;  3JST A;  3HOY K;  5TJ3 A;  3FOE A;  4KN7 A;  4A3I C;  5IP9 C;  4G0V A;  1XZQ A;  2V6T A;  4C3J K;  4PAB A;  2A69 A;  4YFK A;  3PO3 K;  4P5B A;  4WJ3 M;  3NUH A;  1TWF A;  1Y1W K;  5CJ9 A;  1JQW A;  4KC6 A;  2D6F C;  1TWF C;  2E2H K;  2R92 K;  4ZH4 A;  4Y52 K;  3RZO C;  3M4O C;  3HKZ L;  1BS2 A;  3GDZ A;  3HOW C;  1BDF A;  4KB2 A;  1ZVU A;  1JVI A;  1O29 A;  5C4X C;  3GTG A;  4A3L K;  4A3B C;  1ZQ1 C;  3GTG C;  3GSI A;  5HL8 A;  4DDQ A;  4Q5S A;  4G0W A;  1WSV A;  3S16 K;  3GTP K;  2JA8 K;  1B4A A;  3VA7 A;  4GTE A;  2VUM A;  3OPF A;  1EK8 A;  5FLM C;  5C3E K;  2VUM C;  4AH6 A;  2ZFZ A;  3GTM K;  4ILD A;  4NOI A;  3HOX C;  4GTD A;  3S1M K;  3H0G K;  4PAA A;  1IS1 A;  4A3J C;  3GTL K;  4RMF A;  2PMZ D;  1WCM A;  3BP3 A;  3S2H K;  4A3D C;  4O2D A;  2JA7 A;  3CQZ K;  1WCM C;  2JA7 C;  3HOU C;  5C44 K;  1SMY A;  1VJE A;  4J3N A;  3OEP A;  4BLA A;  3G4C A;  4OIR A;  2B63 A;  3HXA A;  4OIN A;  4C3H K;  2B63 C;  1XZP B;  5IYC C;  1TWC A;  3HOZ C;  3S1N K;  3S14 C;  1DD5 A;  3S1R K;  1USM A;  1TWC C;  2WAQ D;  3GTO A;  2JA6 A;  3FKI K;  2GSN A;  4KMU A;  3GTO C;  3RZD C;  1EH1 A;  5TMC A;  2JA6 C;  2EBB A;  3LAJ A;  2NVQ K;  3I4N K;  2R93 A;  3K7A C;  1XPP A;  3PO2 K;  1HQM A;  1DCP A;  4BBS C;  4A3G C;  2R93 C;  1SFO K;  2P5M A;  3TFH A;  2E2I K;  1K83 A;  3M3Y K;  2NVX K;  1UV7 A;  3AD9 C;  4A3E K;  5FJ8 K;  2KWA A;  1BGW A;  1K83 C;  3AQP A;  2A68 A;  3L4K A;  1O2A A;  2P8T A;  3A8J A;  3FHZ A;  5IP7 K;  3H3V L;  4C3J C;  3ERE D;  4YFN A;  1WOR A;  3T02 A;  2V6U A;  1Y1W A;  5M5X K;  1R9T K;  2O5J A;  4KM9 A;  4KAW X;  3TFJ A;  3GTJ K;  2JA5 K;  3V4G A;  1Y1W C;  1I3Q K;  3T00 A;  2A6H A;  4A3M K;  2E2H A;  4GZY A;  4BY7 K;  3GTK K;  2R7Z K;  4LK0 A;  4A3F K;  2E2H C;  2PA8 D;  3AH5 A;  4GTC A;  2Y3P A;  1BJT A;  1HI9 A;  3GEE A;  3I4M K;  1O26 A;  1EI6 A;  2CFA A;  2PPB A;  2FQO A;  1PJ7 A;  3T01 A;  1IW7 A;  2E2J K;  4A3C K;  2O5I A;  4KDD A;  1JOE A;  1F7U A;  1O27 A;  1TWG A;  5L46 A;  2PMZ L;  4A3I K;  1TWG C;  1J6W A;  4KAS A;  4BXX C;  2A6E A;  4LJZ A;  3GEI A;  1B4B A;  4M1X A;  3LAP A;  5M3F K;  4C45 A;  5C3E C;  4XSX A;  2NVT C;  1X31 C;  3H0G A;  2Y0S D;  1XXA A;  3GTL A;  3G4A A;  1KQ4 A;  3S1M C;  3QX3 A;  3RZO K;  3EQL A;  3GTL C;  4XLP A;  3CQZ A;  4C3I K;  1XZP A;  5IYB C;  4WIL A;  2WB1 D;  1L0W A;  3S2H C;  2FQT A;  3CQZ C;  4QJV B;  3S0X A;  3ORE A;  5C44 C;  4X6A C;  4GTF A;  1USO A;  3N0C A;  5M5Y K;  4QIW L;  4A93 K;  4Y7N K;  4C3H C;  3L4J A;  4AYB D;  4XCH A;  3S2D K;  1AB4 A;  3S1N C;  3AQO A;  1Y1V K;  1TWA K;  3FKI A;  1IE0 A;  4BBR K;  3HKZ D;  3SZZ A;  1EQR A;  3TTG A;  3FKI C;  1XXC A;  3S15 K;  2ZUE A;  3FOF A;  1XXB A;  1IQ0 A;  5FLM K;  2NVQ C;  3HOV K; 
#chains in the Genus database with same CATH homology
 3PO2 C;  1Y1V C;  4MEX A;  1TWF C;  1TWA C;  3HOX K;  2E2H K;  1TWG K;  4C2M K;  5IP7 K;  4BBR C;  1SFO C;  4ZH4 A;  4G7Z A;  2R92 K;  3H3V L;  3S17 C;  3M3Y C;  4BXX K;  3RZO C;  4Y52 K;  2NVY C;  4YFN A;  2NVX C;  5C4X K;  4A3E C;  3HKZ L;  4A3J K;  2YU9 C;  3M4O C;  3S15 C;  5M5X K;  1R9T K;  4G7H A;  4A3B K;  2O5J A;  1ZYR A;  3HOW C;  3GTG K;  3GTJ K;  2JA5 K;  5M3M K;  1BDF A;  4A3D K;  1Y1W C;  4LLG A;  2NVT K;  1I3Q K;  4A3M K;  2A6H A;  4MEY A;  3HOV C;  3S1R C;  4BY1 K;  3S1Q K;  4GZY A;  4BY7 K;  3GTK K;  2R7Z K;  4LK0 A;  4A3F K;  2E2H C;  5IP7 C;  5IYD K;  3GTQ K;  1I6V A;  2PA8 D;  5C4X C;  4XLN A;  3HOY C;  3I4N C;  4A3L K;  2CW0 A;  1I50 K;  1R9T C;  2VUM K;  4A3B C;  2B63 K;  5IYB K;  3GTG C;  3GTJ C;  4OIQ A;  5IYC K;  4Q5S A;  3HOZ K;  3I4M K;  3S16 K;  3GTP K;  4BY1 C;  2JA8 K;  3S1Q C;  2E2I C;  1TWH K;  1TWC K;  2R7Z C;  3GTK C;  4A3F C;  2PPB A;  4X6A K;  4OIP A;  5IYD C;  3PO3 C;  3GTQ C;  1YNN A;  3GTO K;  1IW7 A;  2E2J K;  3RZD K;  4MQ9 A;  4JK1 A;  2O5I A;  4A3C K;  5FLM C;  3S2D C;  2PA8 L;  5C3E K;  1WCM K;  2VUM C;  1I50 C;  3GTM K;  2PMZ L;  4BBS K;  2JA7 K;  4A3I K;  3HOU K;  4G7O A;  3I4M C;  4NOI A;  3HOX C;  1TWG C;  2R92 C;  5D4D A;  3S1M K;  3H0G K;  1TWH C;  4Y52 C;  4BXX C;  3WOD A;  4A3J C;  2A6E A;  4LJZ A;  3GTL K;  2PMZ D;  5C4J K;  4LK1 A;  2E2J C;  2JA5 C;  3S2H K;  5M3F K;  4KN4 A;  4A3D C;  5C3E C;  4XSX A;  2NVT C;  3CQZ K;  1I3Q C;  1WCM C;  4A3M C;  1YNJ A;  3S14 K;  4OIO A;  4BY7 C;  2Y0S D;  2JA7 C;  5C44 K;  3HOU C;  1SMY A;  1I6H K;  2WB1 L;  4QIW D;  4YFX A;  4OIR A;  3S1M C;  3S17 K;  3RZO K;  2JA6 K;  2NVY K;  3EQL A;  4Q4Z A;  4A3K K;  2YU9 K;  4OIN A;  4C3H K;  3GTL C;  4A3L C;  4XLP A;  3DXJ A;  4C3I K;  5C4J C;  3K7A K;  2B63 C;  5IYB C;  2WB1 D;  4YG2 A;  3S2H C;  3S1N K;  5IYC C;  3HOZ C;  4QJV A;  3S16 C;  3CQZ C;  5IP9 K;  3S14 C;  4A3G K;  3GTP C;  4QJV B;  2R93 K;  2JA8 C;  3S1R K;  1TWC C;  2WAQ D;  4AYB L;  5C44 C;  1I6H C;  4X6A C;  3FKI K;  2Y0S L;  5M5Y K;  4KMU A;  3GTO C;  1K83 K;  4QIW L;  3RZD C;  4XSZ A;  4A93 K;  4A3C C;  2JA6 C;  5TMC A;  4A3K C;  4Y7N K;  3HOY K;  4AYB D;  2NVQ K;  3I4N K;  3K7A C;  3S2D K;  1XPP A;  5M5W K;  3GTM C;  3PO2 K;  1HQM A;  2BE5 A;  3S1N C;  4KN7 A;  3H3V D;  4A3I C;  1Y1V K;  4BBS C;  1TWF K;  5IP9 C;  1TWA K;  4A3G C;  2R93 C;  1SFO K;  4BBR K;  3H0G C;  3HKZ D;  2E2I K;  4C3J K;  3M3Y K;  2NVX K;  4A3E K;  3M4O K;  2WAQ L;  2A69 A;  3FKI C;  3S15 K;  4YFK A;  5FJ8 K;  3PO3 K;  1K83 C;  4A93 C;  2A68 A;  3HOW K;  5TMF A;  5FLM K;  4Y7N C;  2NVQ C;  1Y1W K;  3HOV K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...