3HOZK

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 30
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hozK00
1Y1VK 4KN7A 2E2IC 2R92K 2JA6C 4BBSC 3H0GK 2PPBA 3S16C 4YG2A 3GTLK 4LK1A 4A3FK 3EQLA 3GTGC 4A3LC 1TWGK 3GTOC 4A3EC 3S1MK 5C4JK 2PMZD 4AYBD 3I4MK 2O5JA 3HOUC 4LLGA 5M5WK 5IP9K 3HKZD 4MEYA 3K7AK 2E2JC 4OIRA 3H3VD 4BY1C 4G7ZA 4YFKA 4C3JK 4OINA 3S17K 3S14K 2VUMK 3M3YK 1Y1WK 4A3GC 2Y0SL 4OIPA 2NVYK 2WAQD 4QIWD 1SFOC 4BBRC 3S15C 1YNJA 4ZH4A 3S2DK 3S2HK 3WODA 1I50K 2R93C 4XLNA 3GTPC 4A3BK 3S1NC 4A93C 5C4XK 5IYCK 5IP7K 3GTKK 3RZDK 2O5IA 3GTMK 3I4NK 2JA8C 3HOVC 3S1RK 4OIQA 2E2HC 1WCMC 2JA7K 1Y1VC 1K83K 4A3KK 2R92C 4LJZA 3H0GC 4A3JK 3HOXK 4A3DK 4LK0A 4Y52K 3GTLC 4YFXA 4A3FC 2R7ZK 4G7OA 3FKIK 1TWCK 1TWGC 4C2MK 5FLMK 3RZOK 3S1MC 2A68A 5C3EK 2Y0SD 3HOWC 1SMYA 5C44K 3I4MC 4BXXK 5D4DA 3DXJA 1I6HC 3K7AC 4A3MK 2NVTK 4YFNA 3S1QC 1I3QC 3HOZC 3S17C 3M4OK 4BY7K 2VUMC 1R9TK 1IW7A 2JA5K 4G7HA 1Y1WC 5IYBK 3PO2C 4A3CK 4X6AK 4KMUA 3GTOK 3S2DC 3GTJK 3S2HC 1I50C 4XSZA 4A3BC 1TWAK 2YU9C 1TWFC 3CQZK 2B63K 2WB1L 4JK1A 5IYCC 2CW0A 5IYDC 1YNNA 3HOYC 1XPPA 4BY1K 5IP7C 3GTKC 2BE5A 4QJVB 3RZDC 3GTQK 2NVXK 2A69A 4Y7NK 2PA8L 3I4NC 4C3IK 5FJ8K 3S1RC 2NVQK 2JA7C 1K83C 3HKZL 4Y52C 4XLPA 4A3JC 5M5YK 3HOXC 5C4JC 1ZYRA 4A3DC 4KN4A 5TMFA 2A6EA 2R7ZC 4A3IK 3PO3K 3FKIC 3RZOC 1TWHK 5IP9C 1HQMA 5C3EC 4BXXC 5C44C 3HOUK 3S1QK 2E2IK 3S14C 2JA6K 4BBSK 4QJVA 3S16K 3M3YC 4A3MC 3M4OC 4GZYA 2NVTC 4MQ9A 2NVYC 3GTGK 1BDFA 4A3LK 4BY7C 2WB1D 1R9TC 4A3EK 2JA5C 4Q5SA 4A3CC 5IYBC 4X6AC 5C4XC 2PA8D 3GTJC 2E2JK 3HOWK 1TWAC 3GTMC 3CQZC 2B63C 4MEXA 1I6HK 4A3GK 2PMZL 4AYBL 4C3HK 3GTQC 1I3QK 2NVXC 1SFOK 4BBRK 4Y7NC 5M3FK 3S15K 5TMCA 4A3KC 5M3MK 3H3VL 3PO2K 3GTPK 2R93K 4A93K 1I6VA 3S1NK 2NVQC 4XSXA 1TWCC 5FLMC 4Q4ZA 5M5XK 2WAQL 4QIWL 4OIOA 1TWFK 2YU9K 3PO3C 4A3IC 2JA8K 5IYDK 2A6HA 1TWHC 3HOVK 3HOYK 3HOZK 2E2HK 1WCMK 4NOIA
chains in the Genus database with same CATH superfamily
1PJ7A 1Y1VK 3L4JA 5L46A 3S16C 4BBSC 4YG2A 1O28A 3Q3QA 1J6VA 3EQLA 3GTOC 4A3EC 2PMZD 2O5JA 3AH5A 2E2JC 2FQTA 3K7AK 3H3VD 3GSIA 3MMLB 4P5AA 1ISEA 4A3GC 2Y0SL 5IOQA 2NVYK 3S2DK 4PABA 3G4CA 3WODA 1IL2A 4XLNA 1WCMA 3S1NC 5C4XK 2R92A 3GEEA 1WQGA 1ZBSA 4GFQA 2JA8C 3I4NK 4BKWA 3V4GA 3S1RK 4OIQA 1YCLA 4A3KK 4G0VA 3H0GC 4A3DK 3GTLC 1I3QA 4YFXA 4A3FC 3LAPA 3FKIK 4G0WA 1TWGC 2V6UA 3HOWC 1J6WA 3I4MC 1RU0A 1J6XA 2NVTK 1TWFA 4C3JC 3S17C 4GTEA 1AB4A 1Y1VA 3GTOK 3GTJK 1I50C 4XSZA 4A3BC 2YU9C 1ZQ1C 1O26A 5IYCC 1YNNA 1XPPA 4G0UA 5IP7C 3JSTA 1B4BA 3GTKC 2NVXK 2A69A 4Y7NK 5FJ8K 2JA7C 1EH1A 4FM9A 3HKZL 4XLPA 4A3JC 3HOXC 2NVYA 2GSNA 4KN4A 5TMFA 1F93A 1VJEA 3RZOC 1HQMA 4BXXC 2RH6A 3HOUK 2E2IK 2JA6K 4A3MC 3FOFA 3LPXA 1XZPA 3GTGK 1BDFA 2WB1D 1WQFA 2JA5C 4KMAA 4A3CC 2XCRB 3HOWK 1TWAC 3GTMC 1F9NA 4WJ4A 3CQZC 4KATA 1XZPB 1O29A 4KMDA 2ZUEA 3GTQC 1SFOK 3GTPK 1VGXA 3FOEA 4Q4ZA 4QIWL 2YU9K 3GTOA 3PO3C 3T02A 4FZBA 4KM8A 4GTFA 1WCMK 4J3NA 2A6EA 2R92K 3ADAC 2PPBA 2NVXA 3AD7C 3S1MK 4AYBD 2V6TA 4GTLA 4OIRA 1DCHA 4C3HC 2E2IA 4BBRC 4ZH4A 2JA6A 2R93C 4GTBA 1O27A 3GTGA 1PJ5A 3H0GA 1F7UA 3GTLA 3GTMK 1G51A 3TFHA 3HOVC 5JFEA 2E2HC 2ZFZA 4KB4A 1X31C 1SFOA 3IPJA 2R7ZK 1XXAA 2PHCB 3GTPA 2Y0SD 2W7VA 5C44K 4O2DA 4M1XA 3AQOA 2YU9A 4BY7K 3OREA 4RMFA 2VUMC 1Y1WC 3PO2C 4KMUA 3GEHA 3S2HC 2JA7A 2B63K 1F7VA 2EBBA 4QJVB 3RZDC 1L0WA 1K83C 4Y52C 1ZYRA 5IORA 4A3IK 4C2MC 1TWHK 5C3EC 1KQ4A 1O25A 4BBSK 3S16K 3GTMA 4GZYA 3LAJA 1O2BA 1IQ0A 1BGWA 2GAHC 3ERED 4A3EK 1R9TC 3GTQA 4Q5SA 5IYBC 4X6AC 1C0AA 4KARA 5EGEA 2E2JK 1WORA 5E68A 3NUHA 2R7ZA 4MEXA 4A3GK 2RGRA 3PO2K 1PJ6A 1I6VA 3S1NK 5HL8A 2NVQC 4XSXA 2WAQL 2JA8K 1DCPA 3A8KA 2B63A 3S1QC 4KN7A 3H0GK 3GTLK 4LK1A 4A3FK 4A3LC 1TWGK 2GAGC 1YX2A 3I4MK 2P5MA 4LLGA 4MEYA 3AQPA 4BY1C 4C3JK 4OINA 2D6FC 3S17K 1XXCA 3BUEA 1TWHA 1WOOA 4KAWX 4C3IC 3G4AA 4QIWD 3S15C 1YNJA 1J98A 1I50K 4BLBA 4A3BK 4A93C 2CFAA 5IYCK 2GSOA 4KC6A 5IP7K 3GTKK 1JQWA 5IOTA 1IE0A 3BP8C 2JA7K 2CFAB 1Y1VC 1WIHA 4P9SA 4A3JK 3HOXK 4G7OA 1XXBA 3RZOK 1Y1WA 2A68A 1USMA 1SMYA 4BXXK 3VA7A 3DXJA 3K7AC 4A3MK 3A8IA 3CAGA 3L4KA 1IW7A 4P5BA 2JA5K 1O2AA 4G7HA 4A3CK 1B4AA 3S2DC 1TWAK 3CQZK 1TWGA 2CW0A 4BY1K 3HOZC 3GTQK 3I4NC 1O24A 2PA8L 3OEPA 4C3IK 3S1RC 1IBAA 4KM9A 5M5YK 5C4JC 4A3DC 3PO3K 3FKIC 4GTAA 5CJ9A 1I50A 5IP9C 1VRQC 3S14C 1DCOA 3GEIA 4QJVA 3M3YC 3GTKA 1EK8A 3TTGA 1V5VA 3TFJA 2NVTC 4KB2A 1EI6A 1XZQA 2GSUA 2FQOA 1INNA 3GTJC 3FHZA 3SZYA 2PMZL 4C3HK 1IS1A 1XZQB 2NVXC 4BBRK 4Y7NC 3H3VL 2R93K 4KDDA 1EFWA 1BS2A 1TWCC 5FLMC 2JA5A 3BP3A 1HI9A 1ZXOA 4XCHA 1WSRA 2XCOA 2A6HA 2ZUFA 3HOVK 1TWAA 3HOZK 3A8JA 2E2HK 3CQZA 3QX3A 4NOIA 3HOUC 2E2IC 3M4OC 2JA6C 2JH3A 1JVIA 3GTGC 4BLAA 5C4JK 1VH2A 5M5WK 5IP9K 3HKZD 4LOWA 1DD5A 4G7ZA 4YFKA 3S14K 2VUMK 3GIRA 3M3YK 1WQHA 1Y1WK 4OIPA 2V6SA 3AD8C 2WAQD 4GT9A 4PAAA 5JVOA 4LR2A 1SFOC 3S2HK 5TJ3A 3GTPC 4WILA 3RZDK 2O5IA 3TFIA 1WCMC 4ILDA 1K83K 2R92C 4LJZA 1WOSA 4Y52K 4LK0A 3HXAA 1TWCK 4C2MK 5FLMK 2R93A 3S1MC 5C3EK 4GTCA 5IOSA 4AH6A 5D4DA 1I6HC 3N3YA 4YFNA 1I3QC 1USOA 3M4OK 1R9TK 4X6AK 5IYBK 2E2HA 1UV7A 5CHPA 3SZZA 1BJTA 4WJ3M 1TWFC 2WB1L 4JK1A 5IYDC 4C45A 3HOYC 1VLOA 3N0CA 2BE5A 3FKIA 3T01A 2NVQK 2VUMA 1O2FB 3N0BA 2R7ZC 4KASA 2P8TA 3S0XA 5C44C 3GTJA 3S1QK 2Y3PA 4MQ9A 1GE9A 2NVYC 4A3LK 4BY7C 4GTDA 3T00A 2XCQA 1K83A 5C4XC 2PA8D 4KMHA 4LQYA 1TWCA 5EGHA 2B63C 1I6HK 4AYBL 1I3QK 3S15K 5M3FK 3GDZA 5TMCA 1WSVA 5M3MK 4A3KC 4A93K 1R9TA 1EQRA 1WOPA 2KWAA 3AD9C 5M5XK 4OIOA 1TWFK 1ZVUA 4A3IC 5IYDK 1TWHC 3HOYK 1JOEA 3OPFA 4DDQA
chains in the Genus database with same CATH topology
1Y1VK 4KN7A 2E2IC 2R92K 2JA6C 4BBSC 3H0GK 2PPBA 3S16C 4YG2A 3GTLK 4LK1A 4A3FK 3EQLA 3GTGC 4A3LC 1TWGK 3GTOC 4A3EC 3S1MK 5C4JK 2PMZD 4AYBD 3I4MK 2O5JA 3HOUC 4LLGA 5M5WK 5IP9K 3HKZD 4MEYA 3K7AK 2E2JC 4OIRA 3H3VD 4BY1C 4G7ZA 4YFKA 4C3JK 4OINA 3S17K 3S14K 2VUMK 3M3YK 1Y1WK 4A3GC 2Y0SL 4OIPA 2NVYK 2WAQD 4QIWD 1SFOC 4BBRC 3S15C 1YNJA 4ZH4A 3S2DK 3S2HK 3WODA 1I50K 2R93C 4XLNA 3GTPC 4A3BK 3S1NC 4A93C 5C4XK 5IYCK 5IP7K 3GTKK 3RZDK 2O5IA 3GTMK 3I4NK 2JA8C 3HOVC 3S1RK 4OIQA 2E2HC 1WCMC 2JA7K 1Y1VC 1K83K 4A3KK 2R92C 4LJZA 3H0GC 4A3JK 3HOXK 4A3DK 4LK0A 4Y52K 3GTLC 4YFXA 4A3FC 2R7ZK 4G7OA 3FKIK 1TWCK 1TWGC 4C2MK 5FLMK 3RZOK 3S1MC 2A68A 5C3EK 2Y0SD 3HOWC 1SMYA 5C44K 3I4MC 4BXXK 5D4DA 3DXJA 1I6HC 3K7AC 4A3MK 2NVTK 4YFNA 3S1QC 1I3QC 3HOZC 3S17C 3M4OK 4BY7K 2VUMC 1R9TK 1IW7A 2JA5K 4G7HA 1Y1WC 5IYBK 3PO2C 4A3CK 4X6AK 4KMUA 3GTOK 3S2DC 3GTJK 3S2HC 1I50C 4XSZA 4A3BC 1TWAK 2YU9C 1TWFC 3CQZK 2B63K 2WB1L 4JK1A 5IYCC 2CW0A 5IYDC 1YNNA 3HOYC 1XPPA 4BY1K 5IP7C 3GTKC 2BE5A 4QJVB 3RZDC 3GTQK 2NVXK 2A69A 4Y7NK 2PA8L 3I4NC 4C3IK 5FJ8K 3S1RC 2NVQK 2JA7C 1K83C 3HKZL 4Y52C 4XLPA 4A3JC 5M5YK 3HOXC 5C4JC 1ZYRA 4A3DC 4KN4A 5TMFA 2A6EA 2R7ZC 4A3IK 3PO3K 3FKIC 3RZOC 1TWHK 5IP9C 1HQMA 5C3EC 4BXXC 5C44C 3HOUK 3S1QK 2E2IK 3S14C 2JA6K 4BBSK 4QJVA 3S16K 3M3YC 4A3MC 3M4OC 4GZYA 2NVTC 4MQ9A 2NVYC 3GTGK 1BDFA 4A3LK 4BY7C 2WB1D 1R9TC 4A3EK 2JA5C 4Q5SA 4A3CC 5IYBC 4X6AC 5C4XC 2PA8D 3GTJC 2E2JK 3HOWK 1TWAC 3GTMC 3CQZC 2B63C 4MEXA 1I6HK 4A3GK 2PMZL 4AYBL 4C3HK 3GTQC 1I3QK 2NVXC 1SFOK 4BBRK 4Y7NC 5M3FK 3S15K 5TMCA 4A3KC 5M3MK 3H3VL 3PO2K 3GTPK 2R93K 4A93K 1I6VA 3S1NK 2NVQC 4XSXA 1TWCC 5FLMC 4Q4ZA 5M5XK 2WAQL 4QIWL 4OIOA 1TWFK 2YU9K 3PO3C 4A3IC 2JA8K 5IYDK 2A6HA 1TWHC 3HOVK 3HOYK 3HOZK 2E2HK 1WCMK 4NOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V K;  4KN7 A;  2E2I C;  2R92 K;  2JA6 C;  4BBS C;  3H0G K;  2PPB A;  3S16 C;  4YG2 A;  3GTL K;  4LK1 A;  4A3F K;  3EQL A;  3GTG C;  4A3L C;  1TWG K;  3GTO C;  4A3E C;  3S1M K;  5C4J K;  2PMZ D;  4AYB D;  3I4M K;  2O5J A;  3HOU C;  4LLG A;  5M5W K;  5IP9 K;  3HKZ D;  4MEY A;  3K7A K;  2E2J C;  4OIR A;  3H3V D;  4BY1 C;  4G7Z A;  4YFK A;  4C3J K;  4OIN A;  3S17 K;  3S14 K;  2VUM K;  3M3Y K;  1Y1W K;  4A3G C;  2Y0S L;  4OIP A;  2NVY K;  2WAQ D;  4QIW D;  1SFO C;  4BBR C;  3S15 C;  1YNJ A;  4ZH4 A;  3S2D K;  3S2H K;  3WOD A;  1I50 K;  2R93 C;  4XLN A;  3GTP C;  4A3B K;  3S1N C;  4A93 C;  5C4X K;  5IYC K;  5IP7 K;  3GTK K;  3RZD K;  2O5I A;  3GTM K;  3I4N K;  2JA8 C;  3HOV C;  3S1R K;  4OIQ A;  2E2H C;  1WCM C;  2JA7 K;  1Y1V C;  1K83 K;  4A3K K;  2R92 C;  4LJZ A;  3H0G C;  4A3J K;  3HOX K;  4A3D K;  4LK0 A;  4Y52 K;  3GTL C;  4YFX A;  4A3F C;  2R7Z K;  4G7O A;  3FKI K;  1TWC K;  1TWG C;  4C2M K;  5FLM K;  3RZO K;  3S1M C;  2A68 A;  5C3E K;  2Y0S D;  3HOW C;  1SMY A;  5C44 K;  3I4M C;  4BXX K;  5D4D A;  3DXJ A;  1I6H C;  3K7A C;  4A3M K;  2NVT K;  4YFN A;  3S1Q C;  1I3Q C;  3HOZ C;  3S17 C;  3M4O K;  4BY7 K;  2VUM C;  1R9T K;  1IW7 A;  2JA5 K;  4G7H A;  1Y1W C;  5IYB K;  3PO2 C;  4A3C K;  4X6A K;  4KMU A;  3GTO K;  3S2D C;  3GTJ K;  3S2H C;  1I50 C;  4XSZ A;  4A3B C;  1TWA K;  2YU9 C;  1TWF C;  3CQZ K;  2B63 K;  2WB1 L;  4JK1 A;  5IYC C;  2CW0 A;  5IYD C;  1YNN A;  3HOY C;  1XPP A;  4BY1 K;  5IP7 C;  3GTK C;  2BE5 A;  4QJV B;  3RZD C;  3GTQ K;  2NVX K;  2A69 A;  4Y7N K;  2PA8 L;  3I4N C;  4C3I K;  5FJ8 K;  3S1R C;  2NVQ K;  2JA7 C;  1K83 C;  3HKZ L;  4Y52 C;  4XLP A;  4A3J C;  5M5Y K;  3HOX C;  5C4J C;  1ZYR A;  4A3D C;  4KN4 A;  5TMF A;  2A6E A;  2R7Z C;  4A3I K;  3PO3 K;  3FKI C;  3RZO C;  1TWH K;  5IP9 C;  1HQM A;  5C3E C;  4BXX C;  5C44 C;  3HOU K;  3S1Q K;  2E2I K;  3S14 C;  2JA6 K;  4BBS K;  4QJV A;  3S16 K;  3M3Y C;  4A3M C;  3M4O C;  4GZY A;  2NVT C;  4MQ9 A;  2NVY C;  3GTG K;  1BDF A;  4A3L K;  4BY7 C;  2WB1 D;  1R9T C;  4A3E K;  2JA5 C;  4Q5S A;  4A3C C;  5IYB C;  4X6A C;  5C4X C;  2PA8 D;  3GTJ C;  2E2J K;  3HOW K;  1TWA C;  3GTM C;  3CQZ C;  2B63 C;  4MEX A;  1I6H K;  4A3G K;  2PMZ L;  4AYB L;  4C3H K;  3GTQ C;  1I3Q K;  2NVX C;  1SFO K;  4BBR K;  4Y7N C;  5M3F K;  3S15 K;  5TMC A;  4A3K C;  5M3M K;  3H3V L;  3PO2 K;  3GTP K;  2R93 K;  4A93 K;  1I6V A;  3S1N K;  2NVQ C;  4XSX A;  1TWC C;  5FLM C;  4Q4Z A;  5M5X K;  2WAQ L;  4QIW L;  4OIO A;  1TWF K;  2YU9 K;  3PO3 C;  4A3I C;  2JA8 K;  5IYD K;  2A6H A;  1TWH C;  3HOV K;  3HOY K;  3HOZ K;  2E2H K;  1WCM K;  4NOI A; 
#chains in the Genus database with same CATH topology
 1PJ7 A;  1Y1V K;  3L4J A;  5L46 A;  3S16 C;  4BBS C;  4YG2 A;  1O28 A;  3Q3Q A;  1J6V A;  3EQL A;  3GTO C;  4A3E C;  2PMZ D;  2O5J A;  3AH5 A;  2E2J C;  2FQT A;  3K7A K;  3H3V D;  3GSI A;  3MML B;  4P5A A;  1ISE A;  4A3G C;  2Y0S L;  5IOQ A;  2NVY K;  3S2D K;  4PAB A;  3G4C A;  3WOD A;  1IL2 A;  4XLN A;  1WCM A;  3S1N C;  5C4X K;  2R92 A;  3GEE A;  1WQG A;  1ZBS A;  4GFQ A;  2JA8 C;  3I4N K;  4BKW A;  3V4G A;  3S1R K;  4OIQ A;  1YCL A;  4A3K K;  4G0V A;  3H0G C;  4A3D K;  3GTL C;  1I3Q A;  4YFX A;  4A3F C;  3LAP A;  3FKI K;  4G0W A;  1TWG C;  2V6U A;  3HOW C;  1J6W A;  3I4M C;  1RU0 A;  1J6X A;  2NVT K;  1TWF A;  4C3J C;  3S17 C;  4GTE A;  1AB4 A;  1Y1V A;  3GTO K;  3GTJ K;  1I50 C;  4XSZ A;  4A3B C;  2YU9 C;  1ZQ1 C;  1O26 A;  5IYC C;  1YNN A;  1XPP A;  4G0U A;  5IP7 C;  3JST A;  1B4B A;  3GTK C;  2NVX K;  2A69 A;  4Y7N K;  5FJ8 K;  2JA7 C;  1EH1 A;  4FM9 A;  3HKZ L;  4XLP A;  4A3J C;  3HOX C;  2NVY A;  2GSN A;  4KN4 A;  5TMF A;  1F93 A;  1VJE A;  3RZO C;  1HQM A;  4BXX C;  2RH6 A;  3HOU K;  2E2I K;  2JA6 K;  4A3M C;  3FOF A;  3LPX A;  1XZP A;  3GTG K;  1BDF A;  2WB1 D;  1WQF A;  2JA5 C;  4KMA A;  4A3C C;  2XCR B;  3HOW K;  1TWA C;  3GTM C;  1F9N A;  4WJ4 A;  3CQZ C;  4KAT A;  1XZP B;  1O29 A;  4KMD A;  2ZUE A;  3GTQ C;  1SFO K;  3GTP K;  1VGX A;  3FOE A;  4Q4Z A;  4QIW L;  2YU9 K;  3GTO A;  3PO3 C;  3T02 A;  4FZB A;  4KM8 A;  4GTF A;  1WCM K;  4J3N A;  2A6E A;  2R92 K;  3ADA C;  2PPB A;  2NVX A;  3AD7 C;  3S1M K;  4AYB D;  2V6T A;  4GTL A;  4OIR A;  1DCH A;  4C3H C;  2E2I A;  4BBR C;  4ZH4 A;  2JA6 A;  2R93 C;  4GTB A;  1O27 A;  3GTG A;  1PJ5 A;  3H0G A;  1F7U A;  3GTL A;  3GTM K;  1G51 A;  3TFH A;  3HOV C;  5JFE A;  2E2H C;  2ZFZ A;  4KB4 A;  1X31 C;  1SFO A;  3IPJ A;  2R7Z K;  1XXA A;  2PHC B;  3GTP A;  2Y0S D;  2W7V A;  5C44 K;  4O2D A;  4M1X A;  3AQO A;  2YU9 A;  4BY7 K;  3ORE A;  4RMF A;  2VUM C;  1Y1W C;  3PO2 C;  4KMU A;  3GEH A;  3S2H C;  2JA7 A;  2B63 K;  1F7V A;  2EBB A;  4QJV B;  3RZD C;  1L0W A;  1K83 C;  4Y52 C;  1ZYR A;  5IOR A;  4A3I K;  4C2M C;  1TWH K;  5C3E C;  1KQ4 A;  1O25 A;  4BBS K;  3S16 K;  3GTM A;  4GZY A;  3LAJ A;  1O2B A;  1IQ0 A;  1BGW A;  2GAH C;  3ERE D;  4A3E K;  1R9T C;  3GTQ A;  4Q5S A;  5IYB C;  4X6A C;  1C0A A;  4KAR A;  5EGE A;  2E2J K;  1WOR A;  5E68 A;  3NUH A;  2R7Z A;  4MEX A;  4A3G K;  2RGR A;  3PO2 K;  1PJ6 A;  1I6V A;  3S1N K;  5HL8 A;  2NVQ C;  4XSX A;  2WAQ L;  2JA8 K;  1DCP A;  3A8K A;  2B63 A;  3S1Q C;  4KN7 A;  3H0G K;  3GTL K;  4LK1 A;  4A3F K;  4A3L C;  1TWG K;  2GAG C;  1YX2 A;  3I4M K;  2P5M A;  4LLG A;  4MEY A;  3AQP A;  4BY1 C;  4C3J K;  4OIN A;  2D6F C;  3S17 K;  1XXC A;  3BUE A;  1TWH A;  1WOO A;  4KAW X;  4C3I C;  3G4A A;  4QIW D;  3S15 C;  1YNJ A;  1J98 A;  1I50 K;  4BLB A;  4A3B K;  4A93 C;  2CFA A;  5IYC K;  2GSO A;  4KC6 A;  5IP7 K;  3GTK K;  1JQW A;  5IOT A;  1IE0 A;  3BP8 C;  2JA7 K;  2CFA B;  1Y1V C;  1WIH A;  4P9S A;  4A3J K;  3HOX K;  4G7O A;  1XXB A;  3RZO K;  1Y1W A;  2A68 A;  1USM A;  1SMY A;  4BXX K;  3VA7 A;  3DXJ A;  3K7A C;  4A3M K;  3A8I A;  3CAG A;  3L4K A;  1IW7 A;  4P5B A;  2JA5 K;  1O2A A;  4G7H A;  4A3C K;  1B4A A;  3S2D C;  1TWA K;  3CQZ K;  1TWG A;  2CW0 A;  4BY1 K;  3HOZ C;  3GTQ K;  3I4N C;  1O24 A;  2PA8 L;  3OEP A;  4C3I K;  3S1R C;  1IBA A;  4KM9 A;  5M5Y K;  5C4J C;  4A3D C;  3PO3 K;  3FKI C;  4GTA A;  5CJ9 A;  1I50 A;  5IP9 C;  1VRQ C;  3S14 C;  1DCO A;  3GEI A;  4QJV A;  3M3Y C;  3GTK A;  1EK8 A;  3TTG A;  1V5V A;  3TFJ A;  2NVT C;  4KB2 A;  1EI6 A;  1XZQ A;  2GSU A;  2FQO A;  1INN A;  3GTJ C;  3FHZ A;  3SZY A;  2PMZ L;  4C3H K;  1IS1 A;  1XZQ B;  2NVX C;  4BBR K;  4Y7N C;  3H3V L;  2R93 K;  4KDD A;  1EFW A;  1BS2 A;  1TWC C;  5FLM C;  2JA5 A;  3BP3 A;  1HI9 A;  1ZXO A;  4XCH A;  1WSR A;  2XCO A;  2A6H A;  2ZUF A;  3HOV K;  1TWA A;  3HOZ K;  3A8J A;  2E2H K;  3CQZ A;  3QX3 A;  4NOI A;  3HOU C;  2E2I C;  3M4O C;  2JA6 C;  2JH3 A;  1JVI A;  3GTG C;  4BLA A;  5C4J K;  1VH2 A;  5M5W K;  5IP9 K;  3HKZ D;  4LOW A;  1DD5 A;  4G7Z A;  4YFK A;  3S14 K;  2VUM K;  3GIR A;  3M3Y K;  1WQH A;  1Y1W K;  4OIP A;  2V6S A;  3AD8 C;  2WAQ D;  4GT9 A;  4PAA A;  5JVO A;  4LR2 A;  1SFO C;  3S2H K;  5TJ3 A;  3GTP C;  4WIL A;  3RZD K;  2O5I A;  3TFI A;  1WCM C;  4ILD A;  1K83 K;  2R92 C;  4LJZ A;  1WOS A;  4Y52 K;  4LK0 A;  3HXA A;  1TWC K;  4C2M K;  5FLM K;  2R93 A;  3S1M C;  5C3E K;  4GTC A;  5IOS A;  4AH6 A;  5D4D A;  1I6H C;  3N3Y A;  4YFN A;  1I3Q C;  1USO A;  3M4O K;  1R9T K;  4X6A K;  5IYB K;  2E2H A;  1UV7 A;  5CHP A;  3SZZ A;  1BJT A;  4WJ3 M;  1TWF C;  2WB1 L;  4JK1 A;  5IYD C;  4C45 A;  3HOY C;  1VLO A;  3N0C A;  2BE5 A;  3FKI A;  3T01 A;  2NVQ K;  2VUM A;  1O2F B;  3N0B A;  2R7Z C;  4KAS A;  2P8T A;  3S0X A;  5C44 C;  3GTJ A;  3S1Q K;  2Y3P A;  4MQ9 A;  1GE9 A;  2NVY C;  4A3L K;  4BY7 C;  4GTD A;  3T00 A;  2XCQ A;  1K83 A;  5C4X C;  2PA8 D;  4KMH A;  4LQY A;  1TWC A;  5EGH A;  2B63 C;  1I6H K;  4AYB L;  1I3Q K;  3S15 K;  5M3F K;  3GDZ A;  5TMC A;  1WSV A;  5M3M K;  4A3K C;  4A93 K;  1R9T A;  1EQR A;  1WOP A;  2KWA A;  3AD9 C;  5M5X K;  4OIO A;  1TWF K;  1ZVU A;  4A3I C;  5IYD K;  1TWH C;  3HOY K;  1JOE A;  3OPF A;  4DDQ A; 
#chains in the Genus database with same CATH homology
 1Y1V K;  4KN7 A;  2E2I C;  2R92 K;  2JA6 C;  4BBS C;  3H0G K;  2PPB A;  3S16 C;  4YG2 A;  3GTL K;  4LK1 A;  4A3F K;  3EQL A;  3GTG C;  4A3L C;  1TWG K;  3GTO C;  4A3E C;  3S1M K;  5C4J K;  2PMZ D;  4AYB D;  3I4M K;  2O5J A;  3HOU C;  4LLG A;  5M5W K;  5IP9 K;  3HKZ D;  4MEY A;  3K7A K;  2E2J C;  4OIR A;  3H3V D;  4BY1 C;  4G7Z A;  4YFK A;  4C3J K;  4OIN A;  3S17 K;  3S14 K;  2VUM K;  3M3Y K;  1Y1W K;  4A3G C;  2Y0S L;  4OIP A;  2NVY K;  2WAQ D;  4QIW D;  1SFO C;  4BBR C;  3S15 C;  1YNJ A;  4ZH4 A;  3S2D K;  3S2H K;  3WOD A;  1I50 K;  2R93 C;  4XLN A;  3GTP C;  4A3B K;  3S1N C;  4A93 C;  5C4X K;  5IYC K;  5IP7 K;  3GTK K;  3RZD K;  2O5I A;  3GTM K;  3I4N K;  2JA8 C;  3HOV C;  3S1R K;  4OIQ A;  2E2H C;  1WCM C;  2JA7 K;  1Y1V C;  1K83 K;  4A3K K;  2R92 C;  4LJZ A;  3H0G C;  4A3J K;  3HOX K;  4A3D K;  4LK0 A;  4Y52 K;  3GTL C;  4YFX A;  4A3F C;  2R7Z K;  4G7O A;  3FKI K;  1TWC K;  1TWG C;  4C2M K;  5FLM K;  3RZO K;  3S1M C;  2A68 A;  5C3E K;  2Y0S D;  3HOW C;  1SMY A;  5C44 K;  3I4M C;  4BXX K;  5D4D A;  3DXJ A;  1I6H C;  3K7A C;  4A3M K;  2NVT K;  4YFN A;  3S1Q C;  1I3Q C;  3HOZ C;  3S17 C;  3M4O K;  4BY7 K;  2VUM C;  1R9T K;  1IW7 A;  2JA5 K;  4G7H A;  1Y1W C;  5IYB K;  3PO2 C;  4A3C K;  4X6A K;  4KMU A;  3GTO K;  3S2D C;  3GTJ K;  3S2H C;  1I50 C;  4XSZ A;  4A3B C;  1TWA K;  2YU9 C;  1TWF C;  3CQZ K;  2B63 K;  2WB1 L;  4JK1 A;  5IYC C;  2CW0 A;  5IYD C;  1YNN A;  3HOY C;  1XPP A;  4BY1 K;  5IP7 C;  3GTK C;  2BE5 A;  4QJV B;  3RZD C;  3GTQ K;  2NVX K;  2A69 A;  4Y7N K;  2PA8 L;  3I4N C;  4C3I K;  5FJ8 K;  3S1R C;  2NVQ K;  2JA7 C;  1K83 C;  3HKZ L;  4Y52 C;  4XLP A;  4A3J C;  5M5Y K;  3HOX C;  5C4J C;  1ZYR A;  4A3D C;  4KN4 A;  5TMF A;  2A6E A;  2R7Z C;  4A3I K;  3PO3 K;  3FKI C;  3RZO C;  1TWH K;  5IP9 C;  1HQM A;  5C3E C;  4BXX C;  5C44 C;  3HOU K;  3S1Q K;  2E2I K;  3S14 C;  2JA6 K;  4BBS K;  4QJV A;  3S16 K;  3M3Y C;  4A3M C;  3M4O C;  4GZY A;  2NVT C;  4MQ9 A;  2NVY C;  3GTG K;  1BDF A;  4A3L K;  4BY7 C;  2WB1 D;  1R9T C;  4A3E K;  2JA5 C;  4Q5S A;  4A3C C;  5IYB C;  4X6A C;  5C4X C;  2PA8 D;  3GTJ C;  2E2J K;  3HOW K;  1TWA C;  3GTM C;  3CQZ C;  2B63 C;  4MEX A;  1I6H K;  4A3G K;  2PMZ L;  4AYB L;  4C3H K;  3GTQ C;  1I3Q K;  2NVX C;  1SFO K;  4BBR K;  4Y7N C;  5M3F K;  3S15 K;  5TMC A;  4A3K C;  5M3M K;  3H3V L;  3PO2 K;  3GTP K;  2R93 K;  4A93 K;  1I6V A;  3S1N K;  2NVQ C;  4XSX A;  1TWC C;  5FLM C;  4Q4Z A;  5M5X K;  2WAQ L;  4QIW L;  4OIO A;  1TWF K;  2YU9 K;  3PO3 C;  4A3I C;  2JA8 K;  5IYD K;  2A6H A;  1TWH C;  3HOV K;  3HOY K;  3HOZ K;  2E2H K;  1WCM K;  4NOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...