3HOZK

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hozK00
1XPPA 3RZOC 1I6HC 1HQMA 1TWGC 4YFXA 5D4DA 3GTPK 3HKZD 5M3MK 3GTJK 5C44C 3EQLA 4LK0A 2PPBA 2YU9K 3GTKC 3HOUK 4A93K 4MQ9A 4A3JK 4A3GC 1I50C 3DXJA 5C4XK 4Y7NC 3HOXC 2VUMK 2R92K 3S17C 4MEYA 1Y1WK 4A3BC 4OIOA 2A69A 5TMFA 2B63K 2R7ZC 4KN7A 4C3JK 3GTMC 5IYCC 3HOUC 1SMYA 3HOZK 4LJZA 2NVXC 1I50K 4Y7NK 3HOYC 4OIPA 4AYBD 2R92C 3S14K 3GTMK 3HOVK 2PA8D 1I6HK 3I4NK 2YU9C 4LLGA 1YNJA 2JA6K 5IYBC 5C44K 5FLMK 3GTKK 5IP7C 3S1MC 1TWHC 4ZH4A 2NVQK 3CQZC 2E2JC 3S16K 4A3KC 5IP9C 1K83K 3S1QK 1IW7A 4GZYA 2Y0SD 4XSZA 4YG2A 5FLMC 5M3FK 1WCMK 2E2JK 3PO3C 4BXXK 1ZYRA 1I6VA 2NVQC 1K83C 2E2HC 3S16C 4OIQA 1SFOK 3HOWK 3S1NK 1R9TK 3S1RC 5M5WK 3I4NC 4BBSK 2O5JA 2BE5A 3GTQK 3M3YC 3HOZC 2JA5C 1TWCK 5M5YK 3GTQC 4G7ZA 4YFNA 2JA5K 3GTLC 2E2HK 4QIWD 2O5IA 3HKZL 1SFOC 3HOWC 3PO2K 3S17K 1R9TC 3S1NC 2WB1L 4A3EC 4NOIA 4KN4A 2NVTC 1TWGK 3GTPC 2Y0SL 3S1QC 4A3LC 4A3MK 4Y52K 4XSXA 1Y1VK 4QJVA 3K7AK 3I4MC 2R93K 2JA6C 4A3MC 4C2MK 5IYBK 2PMZL 2PMZD 1TWHK 1TWFK 1I3QC 3GTLK 3M4OK 3WODA 3PO2C 2PA8L 3S15K 4A3DK 4A3IC 3HOXK 3RZDC 2NVXK 3H3VD 4BY7C 5C4XC 1Y1WC 3HOYK 4QJVB 3S14C 2B63C 2R7ZK 2A68A 3S1RK 4A3DC 5IYCK 4A3GK 4AYBL 3S2DK 4G7OA 4BY7K 2VUMC 4A3IK 2WAQL 3RZDK 1YNNA 4BBSC 4A3BK 2A6EA 2WB1D 4BBRK 3PO3K 1TWFC 5M5XK 2JA7K 4BXXC 4X6AC 4QIWL 4JK1A 3M4OC 4A3KK 4Q4ZA 5IYDK 5IP7K 3H3VL 3S1MK 4A3CC 3CQZK 4C3HK 5IP9K 5TMCA 4Q5SA 2NVYK 4A3EK 5C3EC 3S2DC 3H0GK 2E2IK 2NVTK 3GTGC 4BBRC 4X6AK 3HOVC 3GTOK 2A6HA 3FKIC 5C4JK 1TWAK 4A3FK 2JA8K 4YFKA 3M3YK 3GTOC 1TWCC 2WAQD 1I3QK 3FKIK 5C4JC 1BDFA 4OIRA 1TWAC 3GTJC 4A3FC 4MEXA 2JA8C 4XLPA 4A93C 5FJ8K 5C3EK 3S15C 1WCMC 2NVYC 4G7HA 1Y1VC 3K7AC 4C3IK 4A3JC 3H0GC 2E2IC 3GTGK 4BY1C 2CW0A 4A3LK 5IYDC 3S2HK 4OINA 4A3CK 3RZOK 4LK1A 3I4MK 2R93C 4XLNA 4BY1K 4Y52C 3S2HC 4KMUA 2JA7C
chains in the Genus database with same CATH superfamily
1XXBA 4LK0A 4G0UA 4A3JK 3OPFA 5C4XK 1WSVA 3HOXC 1C0AA 3AD8C 4GTFA 1Y1WK 3H0GA 2E2IA 3HOZK 5IYCC 3SZZA 3GSIA 3GEIA 2KWAA 1I50K 4LJZA 4Y7NK 5CHPA 4LR2A 3HOYC 1XXAA 3HOVK 2PA8D 1I6HK 4GFQA 1ISEA 4LLGA 3FOEA 4C2MC 5FLMK 5JVOA 3S16K 4GZYA 2D6FC 5JFEA 4XSZA 1GE9A 1YX2A 1WCMK 2E2JK 2GSNA 4PABA 5M5WK 2RH6A 4BBSK 4KDDA 3FOFA 1TWCK 1JOEA 5EGHA 1F9NA 3S17K 1R9TC 3ERED 4KN4A 1B4BA 1TWGK 1XZPA 2Y0SL 3AQPA 4G0VA 3GTLA 3AQOA 2R93K 1EH1A 1EQRA 4KMHA 4ILDA 2XCQA 4FM9A 2PMZD 1TWFK 3FHZA 2GAHC 2PA8L 1J6VA 4XCHA 3HOXK 5C4XC 1Y1WC 4WJ4A 4A3DC 5IYCK 4G7OA 2VUMC 4A3IK 2WAQL 1YNNA 4A3BK 1J98A 4BBRK 5HL8A 1DCHA 5M5XK 2JA7K 4A3KK 2CFAA 1VH2A 5IYDK 2YU9A 1IE0A 4C3HK 5IOQA 4A3EK 1YCLA 4C3IC 4O2DA 1TWAA 2V6TA 1K83A 4X6AK 4KARA 3AD9C 2ZUEA 1VLOA 4A3FK 1ZQ1C 1ZXOA 1TWCC 3GTOC 4OIRA 1O25A 4A93C 4GTCA 3S15C 3GTGA 4GTAA 4A3CK 4GTDA 3RZOK 3N0BA 3I4MK 1X31C 4XLNA 1XZQB 4BY1K 4RMFA 1WQHA 2ZFZA 3LAJA 4DDQA 1HQMA 3GTPK 4YFXA 4A93K 3EQLA 2PPBA 3HOUK 4A3GC 1Y1WA 3DXJA 2R92K 4MEYA 5TMFA 3GTMC 4C3JK 1SMYA 2PHCB 3I4NK 5IOSA 4WJ3M 3JSTA 4GTBA 5IP7C 2NVQK 1TWFA 4A3KC 1K83K 5TJ3A 5FLMC 1IL2A 4C3HC 3S16C 4C45A 4KMAA 1L0WA 3HOWK 2NVXA 3S1RC 2XCRB 2BE5A 3M3YC 3GTKA 1DCOA 5E68A 1I3QA 3GTLC 3PO2K 1JVIA 2JA7A 5IORA 1WOOA 3K7AK 1TWHA 4WILA 3I4MC 2JA6C 4A3MC 5IYBK 3CAGA 1O27A 2PMZL 2R93A 1O2AA 1TWHK 3GTLK 3LAPA 3S14C 4QJVB 2A68A 4J3NA 4BY7K 2R7ZA 3ADAC 2A6EA 2WB1D 1TWFC 1ZBSA 3MMLB 1PJ5A 4KASA 4Q4ZA 5IP7K 4A3CC 1BJTA 5TMCA 4LOWA 1WOSA 2B63A 5C3EC 2NVTK 4BBRC 3HOVC 3TFHA 2A6HA 3QX3A 2GSUA 3A8JA 4KM8A 3M3YK 4KC6A 1PJ7A 1G51A 1WQFA 1I3QK 3FKIK 5C4JC 3TFIA 4A3FC 1WCMC 4C3IK 2GAGC 2CW0A 4A3LK 3S2HK 1RU0A 2JA6A 1O29A 3FKIA 3GTMA 3N0CA 1PJ6A 4KMUA 1J6XA 1AB4A 1IQ0A 1BS2A 3HKZD 2YU9K 2XCOA 1O2FB 1USOA 2VUMK 3S17C 4A3BC 4OIOA 2R7ZC 4KN7A 1USMA 3HOUC 4M1XA 3A8IA 3GEEA 3S14K 4OIPA 2R92C 4KB4A 2W7VA 2JH3A 2VUMA 3S1MC 1KQ4A 3CQZC 2E2JC 5IP9C 1XXCA 1V5VA 2Y0SD 4YG2A 5M3FK 3GIRA 3PO3C 4BXXK 2NVQC 1I6VA 2E2HC 4OIQA 1SFOK 3LPXA 2R92A 3I4NC 4P5BA 3T00A 1O26A 2O5JA 3GTQK 2JA5C 3L4JA 1UV7A 2NVYA 4G7ZA 1Y1VA 5L46A 3HOWC 3L4KA 2WB1L 4A3EC 4NOIA 3GTPC 3S1QC 4A3LC 3BP3A 1WORA 4BKWA 4GTLA 4P9SA 1Y1VK 1VGXA 1O24A 1WQGA 4C2MK 3M4OK 3WODA 3PO2C 3HXAA 1F93A 1TWGA 3BP8C 3S15K 3A8KA 4A3DK 3RZDC 3H3VD 2NVXK 3GTPA 2R7ZK 3N3YA 4AYBL 2JA5A 4BBSC 3T02A 3SZYA 4QIWL 4JK1A 3M4OC 3GTOA 3S1MK 3H3VL 4G0WA 3CQZK 5IOTA 5IP9K 1DD5A 1VRQC 1EFWA 3GTGC 4LQYA 4BLBA 3GTOK 1TWAK 2JA8K 2V6UA 4YFKA 1F7VA 2P8TA 1XZQA 3GTJC 4XLPA 1I50A 5C3EK 4G7HA 3K7AC 4A3JC 3OEPA 1O2BA 1WCMA 5CJ9A 2JA7C 1XPPA 3RZOC 3S2HC 1I6HC 1TWCA 1TWGC 5D4DA 5M3MK 3GTJK 5C44C 3GTKC 4MQ9A 2V6SA 4C3JC 1I50C 4Y7NC 1EK8A 2A69A 2B63K 2NVXC 2EBBA 3V4GA 1B4AA 4AYBD 3GTMK 4KMDA 1HI9A 2YU9C 2JA6K 1YNJA 5IYBC 5C44K 3GTKK 4KAWX 1TWHC 4ZH4A 1F7UA 3AH5A 2Y3PA 3S1QK 1IW7A 1BGWA 1SFOA 1ZYRA 1K83C 4GT9A 3Q3QA 3S1NK 1R9TK 3T01A 3CQZA 4PAAA 3HOZC 5M5YK 1ZVUA 1EI6A 3GTQC 4YFNA 2JA5K 2E2HK 1O28A 4GTEA 1DCPA 3HKZL 4KATA 3OREA 4QIWD 1SFOC 2O5IA 3VA7A 3G4CA 3GEHA 3S1NC 1IS1A 2NVTC 4A3MK 4Y52K 4XSXA 4QJVA 1WOPA 3IPJA 1I3QC 1WIHA 4FZBA 1XZPB 4A3IC 4BY7C 3HOYK 2B63C 3BUEA 3S1RK 4A3GK 1INNA 3S2DK 3RZDK 4AH6A 3PO3K 4BXXC 4X6AC 3GDZA 2GSOA 3AD7C 2FQTA 1VJEA 4P5AA 2P5MA 4BLAA 1J6WA 4Q5SA 4KM9A 2NVYK 2FQOA 3S2DC 3H0GK 2E2IK 4KB2A 1JQWA 2CFAB 3TTGA 3TFJA 3GTQA 2ZUFA 3FKIC 5C4JK 2WAQD 3S0XA 1BDFA 1TWAC 4MEXA 2JA8C 1IBAA 5FJ8K 2NVYC 1Y1VC 3GTGK 3H0GC 2E2IC 3NUHA 4BY1C 5IYDC 3G4AA 4OINA 1R9TA 2E2HA 2RGRA 4LK1A 2R93C 3GTJA 5EGEA 1WSRA 4Y52C
chains in the Genus database with same CATH topology
1XPPA 3RZOC 1I6HC 1HQMA 1TWGC 4YFXA 5D4DA 3GTPK 3HKZD 5M3MK 3GTJK 5C44C 3EQLA 4LK0A 2PPBA 2YU9K 3GTKC 3HOUK 4A93K 4MQ9A 4A3JK 4A3GC 1I50C 3DXJA 5C4XK 4Y7NC 3HOXC 2VUMK 2R92K 3S17C 4MEYA 1Y1WK 4A3BC 4OIOA 2A69A 5TMFA 2B63K 2R7ZC 4KN7A 4C3JK 3GTMC 5IYCC 3HOUC 1SMYA 3HOZK 4LJZA 2NVXC 1I50K 4Y7NK 3HOYC 4OIPA 4AYBD 2R92C 3S14K 3GTMK 3HOVK 2PA8D 1I6HK 3I4NK 2YU9C 4LLGA 1YNJA 2JA6K 5IYBC 5C44K 5FLMK 3GTKK 5IP7C 3S1MC 1TWHC 4ZH4A 2NVQK 3CQZC 2E2JC 3S16K 4A3KC 5IP9C 1K83K 3S1QK 1IW7A 4GZYA 2Y0SD 4XSZA 4YG2A 5FLMC 5M3FK 1WCMK 2E2JK 3PO3C 4BXXK 1ZYRA 1I6VA 2NVQC 1K83C 2E2HC 3S16C 4OIQA 1SFOK 3HOWK 3S1NK 1R9TK 3S1RC 5M5WK 3I4NC 4BBSK 2O5JA 2BE5A 3GTQK 3M3YC 3HOZC 2JA5C 1TWCK 5M5YK 3GTQC 4G7ZA 4YFNA 2JA5K 3GTLC 2E2HK 4QIWD 2O5IA 3HKZL 1SFOC 3HOWC 3PO2K 3S17K 1R9TC 3S1NC 2WB1L 4A3EC 4NOIA 4KN4A 2NVTC 1TWGK 3GTPC 2Y0SL 3S1QC 4A3LC 4A3MK 4Y52K 4XSXA 1Y1VK 4QJVA 3K7AK 3I4MC 2R93K 2JA6C 4A3MC 4C2MK 5IYBK 2PMZL 2PMZD 1TWHK 1TWFK 1I3QC 3GTLK 3M4OK 3WODA 3PO2C 2PA8L 3S15K 4A3DK 4A3IC 3HOXK 3RZDC 2NVXK 3H3VD 4BY7C 5C4XC 1Y1WC 3HOYK 4QJVB 3S14C 2B63C 2R7ZK 2A68A 3S1RK 4A3DC 5IYCK 4A3GK 4AYBL 3S2DK 4G7OA 4BY7K 2VUMC 4A3IK 2WAQL 3RZDK 1YNNA 4BBSC 4A3BK 2A6EA 2WB1D 4BBRK 3PO3K 1TWFC 5M5XK 2JA7K 4BXXC 4X6AC 4QIWL 4JK1A 3M4OC 4A3KK 4Q4ZA 5IYDK 5IP7K 3H3VL 3S1MK 4A3CC 3CQZK 4C3HK 5IP9K 5TMCA 4Q5SA 2NVYK 4A3EK 5C3EC 3S2DC 3H0GK 2E2IK 2NVTK 3GTGC 4BBRC 4X6AK 3HOVC 3GTOK 2A6HA 3FKIC 5C4JK 1TWAK 4A3FK 2JA8K 4YFKA 3M3YK 3GTOC 1TWCC 2WAQD 1I3QK 3FKIK 5C4JC 1BDFA 4OIRA 1TWAC 3GTJC 4A3FC 4MEXA 2JA8C 4XLPA 4A93C 5FJ8K 5C3EK 3S15C 1WCMC 2NVYC 4G7HA 1Y1VC 3K7AC 4C3IK 4A3JC 3H0GC 2E2IC 3GTGK 4BY1C 2CW0A 4A3LK 5IYDC 3S2HK 4OINA 4A3CK 3RZOK 4LK1A 3I4MK 2R93C 4XLNA 4BY1K 4Y52C 3S2HC 4KMUA 2JA7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPP A;  3RZO C;  1I6H C;  1HQM A;  1TWG C;  4YFX A;  5D4D A;  3GTP K;  3HKZ D;  5M3M K;  3GTJ K;  5C44 C;  3EQL A;  4LK0 A;  2PPB A;  2YU9 K;  3GTK C;  3HOU K;  4A93 K;  4MQ9 A;  4A3J K;  4A3G C;  1I50 C;  3DXJ A;  5C4X K;  4Y7N C;  3HOX C;  2VUM K;  2R92 K;  3S17 C;  4MEY A;  1Y1W K;  4A3B C;  4OIO A;  2A69 A;  5TMF A;  2B63 K;  2R7Z C;  4KN7 A;  4C3J K;  3GTM C;  5IYC C;  3HOU C;  1SMY A;  3HOZ K;  4LJZ A;  2NVX C;  1I50 K;  4Y7N K;  3HOY C;  4OIP A;  4AYB D;  2R92 C;  3S14 K;  3GTM K;  3HOV K;  2PA8 D;  1I6H K;  3I4N K;  2YU9 C;  4LLG A;  1YNJ A;  2JA6 K;  5IYB C;  5C44 K;  5FLM K;  3GTK K;  5IP7 C;  3S1M C;  1TWH C;  4ZH4 A;  2NVQ K;  3CQZ C;  2E2J C;  3S16 K;  4A3K C;  5IP9 C;  1K83 K;  3S1Q K;  1IW7 A;  4GZY A;  2Y0S D;  4XSZ A;  4YG2 A;  5FLM C;  5M3F K;  1WCM K;  2E2J K;  3PO3 C;  4BXX K;  1ZYR A;  1I6V A;  2NVQ C;  1K83 C;  2E2H C;  3S16 C;  4OIQ A;  1SFO K;  3HOW K;  3S1N K;  1R9T K;  3S1R C;  5M5W K;  3I4N C;  4BBS K;  2O5J A;  2BE5 A;  3GTQ K;  3M3Y C;  3HOZ C;  2JA5 C;  1TWC K;  5M5Y K;  3GTQ C;  4G7Z A;  4YFN A;  2JA5 K;  3GTL C;  2E2H K;  4QIW D;  2O5I A;  3HKZ L;  1SFO C;  3HOW C;  3PO2 K;  3S17 K;  1R9T C;  3S1N C;  2WB1 L;  4A3E C;  4NOI A;  4KN4 A;  2NVT C;  1TWG K;  3GTP C;  2Y0S L;  3S1Q C;  4A3L C;  4A3M K;  4Y52 K;  4XSX A;  1Y1V K;  4QJV A;  3K7A K;  3I4M C;  2R93 K;  2JA6 C;  4A3M C;  4C2M K;  5IYB K;  2PMZ L;  2PMZ D;  1TWH K;  1TWF K;  1I3Q C;  3GTL K;  3M4O K;  3WOD A;  3PO2 C;  2PA8 L;  3S15 K;  4A3D K;  4A3I C;  3HOX K;  3RZD C;  2NVX K;  3H3V D;  4BY7 C;  5C4X C;  1Y1W C;  3HOY K;  4QJV B;  3S14 C;  2B63 C;  2R7Z K;  2A68 A;  3S1R K;  4A3D C;  5IYC K;  4A3G K;  4AYB L;  3S2D K;  4G7O A;  4BY7 K;  2VUM C;  4A3I K;  2WAQ L;  3RZD K;  1YNN A;  4BBS C;  4A3B K;  2A6E A;  2WB1 D;  4BBR K;  3PO3 K;  1TWF C;  5M5X K;  2JA7 K;  4BXX C;  4X6A C;  4QIW L;  4JK1 A;  3M4O C;  4A3K K;  4Q4Z A;  5IYD K;  5IP7 K;  3H3V L;  3S1M K;  4A3C C;  3CQZ K;  4C3H K;  5IP9 K;  5TMC A;  4Q5S A;  2NVY K;  4A3E K;  5C3E C;  3S2D C;  3H0G K;  2E2I K;  2NVT K;  3GTG C;  4BBR C;  4X6A K;  3HOV C;  3GTO K;  2A6H A;  3FKI C;  5C4J K;  1TWA K;  4A3F K;  2JA8 K;  4YFK A;  3M3Y K;  3GTO C;  1TWC C;  2WAQ D;  1I3Q K;  3FKI K;  5C4J C;  1BDF A;  4OIR A;  1TWA C;  3GTJ C;  4A3F C;  4MEX A;  2JA8 C;  4XLP A;  4A93 C;  5FJ8 K;  5C3E K;  3S15 C;  1WCM C;  2NVY C;  4G7H A;  1Y1V C;  3K7A C;  4C3I K;  4A3J C;  3H0G C;  2E2I C;  3GTG K;  4BY1 C;  2CW0 A;  4A3L K;  5IYD C;  3S2H K;  4OIN A;  4A3C K;  3RZO K;  4LK1 A;  3I4M K;  2R93 C;  4XLN A;  4BY1 K;  4Y52 C;  3S2H C;  4KMU A;  2JA7 C; 
#chains in the Genus database with same CATH topology
 1XXB A;  4LK0 A;  4G0U A;  4A3J K;  3OPF A;  5C4X K;  1WSV A;  3HOX C;  1C0A A;  3AD8 C;  4GTF A;  1Y1W K;  3H0G A;  2E2I A;  3HOZ K;  5IYC C;  3SZZ A;  3GSI A;  3GEI A;  2KWA A;  1I50 K;  4LJZ A;  4Y7N K;  5CHP A;  4LR2 A;  3HOY C;  1XXA A;  3HOV K;  2PA8 D;  1I6H K;  4GFQ A;  1ISE A;  4LLG A;  3FOE A;  4C2M C;  5FLM K;  5JVO A;  3S16 K;  4GZY A;  2D6F C;  5JFE A;  4XSZ A;  1GE9 A;  1YX2 A;  1WCM K;  2E2J K;  2GSN A;  4PAB A;  5M5W K;  2RH6 A;  4BBS K;  4KDD A;  3FOF A;  1TWC K;  1JOE A;  5EGH A;  1F9N A;  3S17 K;  1R9T C;  3ERE D;  4KN4 A;  1B4B A;  1TWG K;  1XZP A;  2Y0S L;  3AQP A;  4G0V A;  3GTL A;  3AQO A;  2R93 K;  1EH1 A;  1EQR A;  4KMH A;  4ILD A;  2XCQ A;  4FM9 A;  2PMZ D;  1TWF K;  3FHZ A;  2GAH C;  2PA8 L;  1J6V A;  4XCH A;  3HOX K;  5C4X C;  1Y1W C;  4WJ4 A;  4A3D C;  5IYC K;  4G7O A;  2VUM C;  4A3I K;  2WAQ L;  1YNN A;  4A3B K;  1J98 A;  4BBR K;  5HL8 A;  1DCH A;  5M5X K;  2JA7 K;  4A3K K;  2CFA A;  1VH2 A;  5IYD K;  2YU9 A;  1IE0 A;  4C3H K;  5IOQ A;  4A3E K;  1YCL A;  4C3I C;  4O2D A;  1TWA A;  2V6T A;  1K83 A;  4X6A K;  4KAR A;  3AD9 C;  2ZUE A;  1VLO A;  4A3F K;  1ZQ1 C;  1ZXO A;  1TWC C;  3GTO C;  4OIR A;  1O25 A;  4A93 C;  4GTC A;  3S15 C;  3GTG A;  4GTA A;  4A3C K;  4GTD A;  3RZO K;  3N0B A;  3I4M K;  1X31 C;  4XLN A;  1XZQ B;  4BY1 K;  4RMF A;  1WQH A;  2ZFZ A;  3LAJ A;  4DDQ A;  1HQM A;  3GTP K;  4YFX A;  4A93 K;  3EQL A;  2PPB A;  3HOU K;  4A3G C;  1Y1W A;  3DXJ A;  2R92 K;  4MEY A;  5TMF A;  3GTM C;  4C3J K;  1SMY A;  2PHC B;  3I4N K;  5IOS A;  4WJ3 M;  3JST A;  4GTB A;  5IP7 C;  2NVQ K;  1TWF A;  4A3K C;  1K83 K;  5TJ3 A;  5FLM C;  1IL2 A;  4C3H C;  3S16 C;  4C45 A;  4KMA A;  1L0W A;  3HOW K;  2NVX A;  3S1R C;  2XCR B;  2BE5 A;  3M3Y C;  3GTK A;  1DCO A;  5E68 A;  1I3Q A;  3GTL C;  3PO2 K;  1JVI A;  2JA7 A;  5IOR A;  1WOO A;  3K7A K;  1TWH A;  4WIL A;  3I4M C;  2JA6 C;  4A3M C;  5IYB K;  3CAG A;  1O27 A;  2PMZ L;  2R93 A;  1O2A A;  1TWH K;  3GTL K;  3LAP A;  3S14 C;  4QJV B;  2A68 A;  4J3N A;  4BY7 K;  2R7Z A;  3ADA C;  2A6E A;  2WB1 D;  1TWF C;  1ZBS A;  3MML B;  1PJ5 A;  4KAS A;  4Q4Z A;  5IP7 K;  4A3C C;  1BJT A;  5TMC A;  4LOW A;  1WOS A;  2B63 A;  5C3E C;  2NVT K;  4BBR C;  3HOV C;  3TFH A;  2A6H A;  3QX3 A;  2GSU A;  3A8J A;  4KM8 A;  3M3Y K;  4KC6 A;  1PJ7 A;  1G51 A;  1WQF A;  1I3Q K;  3FKI K;  5C4J C;  3TFI A;  4A3F C;  1WCM C;  4C3I K;  2GAG C;  2CW0 A;  4A3L K;  3S2H K;  1RU0 A;  2JA6 A;  1O29 A;  3FKI A;  3GTM A;  3N0C A;  1PJ6 A;  4KMU A;  1J6X A;  1AB4 A;  1IQ0 A;  1BS2 A;  3HKZ D;  2YU9 K;  2XCO A;  1O2F B;  1USO A;  2VUM K;  3S17 C;  4A3B C;  4OIO A;  2R7Z C;  4KN7 A;  1USM A;  3HOU C;  4M1X A;  3A8I A;  3GEE A;  3S14 K;  4OIP A;  2R92 C;  4KB4 A;  2W7V A;  2JH3 A;  2VUM A;  3S1M C;  1KQ4 A;  3CQZ C;  2E2J C;  5IP9 C;  1XXC A;  1V5V A;  2Y0S D;  4YG2 A;  5M3F K;  3GIR A;  3PO3 C;  4BXX K;  2NVQ C;  1I6V A;  2E2H C;  4OIQ A;  1SFO K;  3LPX A;  2R92 A;  3I4N C;  4P5B A;  3T00 A;  1O26 A;  2O5J A;  3GTQ K;  2JA5 C;  3L4J A;  1UV7 A;  2NVY A;  4G7Z A;  1Y1V A;  5L46 A;  3HOW C;  3L4K A;  2WB1 L;  4A3E C;  4NOI A;  3GTP C;  3S1Q C;  4A3L C;  3BP3 A;  1WOR A;  4BKW A;  4GTL A;  4P9S A;  1Y1V K;  1VGX A;  1O24 A;  1WQG A;  4C2M K;  3M4O K;  3WOD A;  3PO2 C;  3HXA A;  1F93 A;  1TWG A;  3BP8 C;  3S15 K;  3A8K A;  4A3D K;  3RZD C;  3H3V D;  2NVX K;  3GTP A;  2R7Z K;  3N3Y A;  4AYB L;  2JA5 A;  4BBS C;  3T02 A;  3SZY A;  4QIW L;  4JK1 A;  3M4O C;  3GTO A;  3S1M K;  3H3V L;  4G0W A;  3CQZ K;  5IOT A;  5IP9 K;  1DD5 A;  1VRQ C;  1EFW A;  3GTG C;  4LQY A;  4BLB A;  3GTO K;  1TWA K;  2JA8 K;  2V6U A;  4YFK A;  1F7V A;  2P8T A;  1XZQ A;  3GTJ C;  4XLP A;  1I50 A;  5C3E K;  4G7H A;  3K7A C;  4A3J C;  3OEP A;  1O2B A;  1WCM A;  5CJ9 A;  2JA7 C;  1XPP A;  3RZO C;  3S2H C;  1I6H C;  1TWC A;  1TWG C;  5D4D A;  5M3M K;  3GTJ K;  5C44 C;  3GTK C;  4MQ9 A;  2V6S A;  4C3J C;  1I50 C;  4Y7N C;  1EK8 A;  2A69 A;  2B63 K;  2NVX C;  2EBB A;  3V4G A;  1B4A A;  4AYB D;  3GTM K;  4KMD A;  1HI9 A;  2YU9 C;  2JA6 K;  1YNJ A;  5IYB C;  5C44 K;  3GTK K;  4KAW X;  1TWH C;  4ZH4 A;  1F7U A;  3AH5 A;  2Y3P A;  3S1Q K;  1IW7 A;  1BGW A;  1SFO A;  1ZYR A;  1K83 C;  4GT9 A;  3Q3Q A;  3S1N K;  1R9T K;  3T01 A;  3CQZ A;  4PAA A;  3HOZ C;  5M5Y K;  1ZVU A;  1EI6 A;  3GTQ C;  4YFN A;  2JA5 K;  2E2H K;  1O28 A;  4GTE A;  1DCP A;  3HKZ L;  4KAT A;  3ORE A;  4QIW D;  1SFO C;  2O5I A;  3VA7 A;  3G4C A;  3GEH A;  3S1N C;  1IS1 A;  2NVT C;  4A3M K;  4Y52 K;  4XSX A;  4QJV A;  1WOP A;  3IPJ A;  1I3Q C;  1WIH A;  4FZB A;  1XZP B;  4A3I C;  4BY7 C;  3HOY K;  2B63 C;  3BUE A;  3S1R K;  4A3G K;  1INN A;  3S2D K;  3RZD K;  4AH6 A;  3PO3 K;  4BXX C;  4X6A C;  3GDZ A;  2GSO A;  3AD7 C;  2FQT A;  1VJE A;  4P5A A;  2P5M A;  4BLA A;  1J6W A;  4Q5S A;  4KM9 A;  2NVY K;  2FQO A;  3S2D C;  3H0G K;  2E2I K;  4KB2 A;  1JQW A;  2CFA B;  3TTG A;  3TFJ A;  3GTQ A;  2ZUF A;  3FKI C;  5C4J K;  2WAQ D;  3S0X A;  1BDF A;  1TWA C;  4MEX A;  2JA8 C;  1IBA A;  5FJ8 K;  2NVY C;  1Y1V C;  3GTG K;  3H0G C;  2E2I C;  3NUH A;  4BY1 C;  5IYD C;  3G4A A;  4OIN A;  1R9T A;  2E2H A;  2RGR A;  4LK1 A;  2R93 C;  3GTJ A;  5EGE A;  1WSR A;  4Y52 C; 
#chains in the Genus database with same CATH homology
 1XPP A;  3RZO C;  1I6H C;  1HQM A;  1TWG C;  4YFX A;  5D4D A;  3GTP K;  3HKZ D;  5M3M K;  3GTJ K;  5C44 C;  3EQL A;  4LK0 A;  2PPB A;  2YU9 K;  3GTK C;  3HOU K;  4A93 K;  4MQ9 A;  4A3J K;  4A3G C;  1I50 C;  3DXJ A;  5C4X K;  4Y7N C;  3HOX C;  2VUM K;  2R92 K;  3S17 C;  4MEY A;  1Y1W K;  4A3B C;  4OIO A;  2A69 A;  5TMF A;  2B63 K;  2R7Z C;  4KN7 A;  4C3J K;  3GTM C;  5IYC C;  3HOU C;  1SMY A;  3HOZ K;  4LJZ A;  2NVX C;  1I50 K;  4Y7N K;  3HOY C;  4OIP A;  4AYB D;  2R92 C;  3S14 K;  3GTM K;  3HOV K;  2PA8 D;  1I6H K;  3I4N K;  2YU9 C;  4LLG A;  1YNJ A;  2JA6 K;  5IYB C;  5C44 K;  5FLM K;  3GTK K;  5IP7 C;  3S1M C;  1TWH C;  4ZH4 A;  2NVQ K;  3CQZ C;  2E2J C;  3S16 K;  4A3K C;  5IP9 C;  1K83 K;  3S1Q K;  1IW7 A;  4GZY A;  2Y0S D;  4XSZ A;  4YG2 A;  5FLM C;  5M3F K;  1WCM K;  2E2J K;  3PO3 C;  4BXX K;  1ZYR A;  1I6V A;  2NVQ C;  1K83 C;  2E2H C;  3S16 C;  4OIQ A;  1SFO K;  3HOW K;  3S1N K;  1R9T K;  3S1R C;  5M5W K;  3I4N C;  4BBS K;  2O5J A;  2BE5 A;  3GTQ K;  3M3Y C;  3HOZ C;  2JA5 C;  1TWC K;  5M5Y K;  3GTQ C;  4G7Z A;  4YFN A;  2JA5 K;  3GTL C;  2E2H K;  4QIW D;  2O5I A;  3HKZ L;  1SFO C;  3HOW C;  3PO2 K;  3S17 K;  1R9T C;  3S1N C;  2WB1 L;  4A3E C;  4NOI A;  4KN4 A;  2NVT C;  1TWG K;  3GTP C;  2Y0S L;  3S1Q C;  4A3L C;  4A3M K;  4Y52 K;  4XSX A;  1Y1V K;  4QJV A;  3K7A K;  3I4M C;  2R93 K;  2JA6 C;  4A3M C;  4C2M K;  5IYB K;  2PMZ L;  2PMZ D;  1TWH K;  1TWF K;  1I3Q C;  3GTL K;  3M4O K;  3WOD A;  3PO2 C;  2PA8 L;  3S15 K;  4A3D K;  4A3I C;  3HOX K;  3RZD C;  2NVX K;  3H3V D;  4BY7 C;  5C4X C;  1Y1W C;  3HOY K;  4QJV B;  3S14 C;  2B63 C;  2R7Z K;  2A68 A;  3S1R K;  4A3D C;  5IYC K;  4A3G K;  4AYB L;  3S2D K;  4G7O A;  4BY7 K;  2VUM C;  4A3I K;  2WAQ L;  3RZD K;  1YNN A;  4BBS C;  4A3B K;  2A6E A;  2WB1 D;  4BBR K;  3PO3 K;  1TWF C;  5M5X K;  2JA7 K;  4BXX C;  4X6A C;  4QIW L;  4JK1 A;  3M4O C;  4A3K K;  4Q4Z A;  5IYD K;  5IP7 K;  3H3V L;  3S1M K;  4A3C C;  3CQZ K;  4C3H K;  5IP9 K;  5TMC A;  4Q5S A;  2NVY K;  4A3E K;  5C3E C;  3S2D C;  3H0G K;  2E2I K;  2NVT K;  3GTG C;  4BBR C;  4X6A K;  3HOV C;  3GTO K;  2A6H A;  3FKI C;  5C4J K;  1TWA K;  4A3F K;  2JA8 K;  4YFK A;  3M3Y K;  3GTO C;  1TWC C;  2WAQ D;  1I3Q K;  3FKI K;  5C4J C;  1BDF A;  4OIR A;  1TWA C;  3GTJ C;  4A3F C;  4MEX A;  2JA8 C;  4XLP A;  4A93 C;  5FJ8 K;  5C3E K;  3S15 C;  1WCM C;  2NVY C;  4G7H A;  1Y1V C;  3K7A C;  4C3I K;  4A3J C;  3H0G C;  2E2I C;  3GTG K;  4BY1 C;  2CW0 A;  4A3L K;  5IYD C;  3S2H K;  4OIN A;  4A3C K;  3RZO K;  4LK1 A;  3I4M K;  2R93 C;  4XLN A;  4BY1 K;  4Y52 C;  3S2H C;  4KMU A;  2JA7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...