3HOZK

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 30
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hozK00
1I3QC 1TWAC 3GTLK 4YG2A 1IW7A 3FKIK 2R92C 3GTKC 3GTOC 3I4NC 3S1RC 5IYCK 4QJVB 5IYBK 2NVYK 4Q4ZA 3M4OK 4Y52C 1TWFK 4C3HK 3GTQK 3S2HC 2E2IK 5M5YK 3HOYC 3CQZK 3HOZK 2PA8D 2WAQL 4A3KC 4BBSC 2A6HA 4KN4A 3I4MC 1K83C 5TMCA 4BY1C 4A3LK 4BY7C 1Y1WK 3S17K 2E2HK 3PO3K 4BXXC 3M3YC 4MEYA 1TWHK 4A3IK 4AYBL 1SFOC 3GTPK 4AYBD 3S15C 4OINA 4A3GK 1WCMC 4YFNA 5M5WK 2JA6C 4GZYA 4BBRC 3HOWC 3S2DC 2R93C 4A3BK 2YU9C 1TWGK 3S16C 3H0GK 2NVTK 4XLPA 5C44K 3HOXK 2PMZD 4A3MC 3GTMK 2E2JC 4C2MK 4A93K 4A3EC 3S1QK 4X6AK 3FKIC 4LLGA 2A6EA 4A3CC 2NVXK 2PA8L 2JA7C 5IYCC 3RZOC 3HOVK 3S1NK 2NVYC 1SMYA 3M4OC 4A3DK 1TWFC 2B63C 4QJVA 2NVQK 3PO2K 2A68A 1I6HK 5C4XC 4Y7NK 5FJ8K 1R9TK 4G7ZA 2JA5C 3CQZC 3HOZC 3GTGK 2R7ZK 3S1MK 3K7AK 1BDFA 2Y0SD 2O5IA 2BE5A 3S14C 4A3FK 2VUMC 3RZDK 1Y1WC 1Y1VK 1TWAK 1I3QK 3S17C 5D4DA 3DXJA 3I4NK 1TWHC 3GTJC 5C4JC 4A3IC 4C3JK 3GTOK 3S1RK 3HOUC 1I50C 3HKZL 4NOIA 4C3IK 1TWCC 3HKZD 4Y52K 3S2HK 4A3GC 5IP7C 2A69A 2PMZL 4XLNA 5IYDC 4XSXA 4A3JC 1HQMA 4QIWD 3GTLC 3M3YK 4BXXK 1ZYRA 1XPPA 3GTMC 3S15K 5IYBC 4A93C 5IP9K 3GTQC 1WCMK 4KMUA 2E2IC 2JA6K 4A3BC 4XSZA 5C3EK 2Y0SL 4YFKA 2WB1D 2NVQC 4BBRK 3HOWK 3S2DK 1I6HC 4OIPA 2R93K 1R9TC 2JA8K 4G7OA 4A3LC 5FLMK 2E2HC 3PO3C 4MEXA 3K7AC 5TMFA 4JK1A 5M3MK 4A3FC 4OIQA 4YFXA 2R92K 3GTPC 3H3VD 3GTKK 4LK1A 4ZH4A 5M3FK 2E2JK 4A3EK 4LJZA 4A3CK 2JA7K 3RZOK 1YNNA 3HOYK 4BBSK 2O5JA 4A3KK 4G7HA 4KN7A 2B63K 3I4MK 1K83K 5C4XK 2JA8C 4BY1K 1I6VA 2JA5K 4BY7K 4QIWL 1TWGC 4OIRA 3WODA 2WAQD 3H0GC 2NVTC 3HOXC 4OIOA 5C44C 3S14K 2VUMK 1SFOK 2PPBA 3S1QC 4Q5SA 3GTJK 5C4JK 4X6AC 4MQ9A 2CW0A 3HOUK 1I50K 2NVXC 3S1NC 1YNJA 1TWCK 2WB1L 3HOVC 4A3DC 5IP9C 3PO2C 5IP7K 3EQLA 4Y7NC 5M5XK 2YU9K 3S16K 2R7ZC 5C3EC 3GTGC 3S1MC 4LK0A 3H3VL 5IYDK 4A3MK 4A3JK 3RZDC 5FLMC 1Y1VC
chains in the Genus database with same CATH superfamily
1I3QC 3OPFA 3GTLK 3T01A 3GTKC 3GTOC 1EI6A 5IYCK 4C3HK 4GTFA 5M5YK 2A6HA 4KMDA 4BY1C 2FQOA 4BY7C 1XZQA 1AB4A 1KQ4A 5HL8A 4MEYA 2RH6A 4A3IK 4AYBL 3S15C 1O27A 1WOSA 4A3GK 2R92A 4KM9A 4KAWX 4BBRC 1O28A 3CAGA 2YU9C 1TWGK 3S16C 3H0GK 2B63A 3GSIA 2E2JC 2KWAA 3S1QK 1WSVA 3TFJA 3GEHA 4X6AK 2VUMA 1SMYA 2B63C 2NVQK 1I6HK 3AD9C 3CQZC 1INNA 2Y0SD 5IOQA 2VUMC 1Y1WC 1Y1VK 4LR2A 3A8KA 4LQYA 4Y52K 3GTLA 2W7VA 1J6WA 1WORA 3GTLC 1ZQ1C 4G0WA 3GTMC 1BS2A 1WQFA 5C3EK 2JA8K 2EBBA 4MEXA 3K7AC 5M3MK 4OIQA 3GTKK 1EFWA 1TWGA 3H0GA 4LJZA 1UV7A 3RZOK 1EK8A 4ILDA 2O5JA 4G7HA 4KN7A 1VGXA 5C4XK 4BY1K 1I6VA 2JA5K 4BY7K 1TWGC 2GSOA 3H0GC 4G0UA 2P8TA 3S1QC 4GFQA 5CHPA 3L4KA 4Q5SA 4X6AC 1IS1A 4GTLA 1I50K 1ISEA 1TWCK 2WB1L 1Y1VA 2YU9K 1ZVUA 3S16K 3H3VL 5IYDK 1IE0A 5L46A 3NUHA 1Y1VC 4YG2A 1IW7A 4LOWA 1GE9A 4QJVB 5IYBK 4Q4ZA 4AH6A 4Y52C 3TFIA 3HOYC 3CQZK 4GTCA 4A3KC 4KN4A 1X31C 1Y1WK 1O2AA 3BP3A 1VRQC 1DCHA 1IL2A 4OINA 3Q3QA 2GSUA 4YFNA 4G0VA 4GTAA 3IPJA 1F93A 4XLPA 3HOXK 2Y3PA 1YX2A 3VA7A 3GTMK 2JA5A 2CFAB 2XCQA 3FKIC 2PA8L 3RZOC 2NVYC 4A3DK 3M4OC 4QJVA 2A68A 5C4XC 4Y7NK 2ZUEA 4G7ZA 2JA5C 2R7ZK 3GTGK 1I50A 3K7AK 1TWCA 1ZBSA 2BE5A 1ZXOA 2XCRB 2YU9A 3S17C 3I4NK 3AH5A 5EGHA 4P9SA 4C3JK 3S1RK 1I50C 1TWCC 3HKZD 4FZBA 1BJTA 1L0WA 2PMZL 4XLNA 1WQHA 1EH1A 4PAAA 5IYDC 2FQTA 3CQZA 3M3YK 4BXXK 1IQ0A 1ZYRA 1XPPA 1R9TA 5IYBC 1Y1WA 2PHCB 2JA6K 4A3BC 4XSZA 2WB1D 2R93K 1R9TC 4GTEA 5TMFA 3H3VD 5M3FK 4A3CK 2JA7K 3HOYK 3BUEA 4A3KK 3GTMA 5IOSA 5JVOA 3GEEA 4QIWL 3WODA 3HOXC 4WJ4A 2R7ZA 3GDZA 3GTGA 2CW0A 3HOUK 1YNJA 3TFHA 4A3DC 3G4AA 3EQLA 4Y7NC 5M5XK 4KDDA 2R7ZC 3T02A 3GTGC 1O25A 4LK0A 4RMFA 1RU0A 4A3JK 5FLMC 3FKIK 3I4NC 1JVIA 4C3JC 3S1RC 2NVYK 3M4OK 3GTQK 2E2IK 1HI9A 4BBSC 2PA8D 3V4GA 3I4MC 1K83C 5TMCA 3S17K 2E2HK 2JA6A 4KMHA 3PO3K 4BXXC 3M3YC 1SFOC 3GTPK 2P5MA 2R93A 4AYBD 4DDQA 4M1XA 4GTBA 1F7VA 2JA6C 2RGRA 2R93C 4BLAA 2JA7A 1XZPB 5C44K 2PMZD 3N0BA 3A8JA 3LAJA 2A6EA 4A3CC 2NVXK 2JA7C 4A3BK 2GSNA 1TWFC 3PO2K 1B4BA 4WJ3M 5FJ8K 1R9TK 3HOZC 3S1MK 1F9NA 1V5VA 1WSRA 2O5IA 3RZDK 1TWAK 1TWHC 2D6FC 3HOUC 4NOIA 3S2HK 3AD8C 3FKIA 4C45A 3GIRA 3LAPA 2A69A 4KARA 2NVYA 1XZQB 3GTQA 4KC6A 4A3JC 3A8IA 2E2IA 4QIWD 1J6VA 4KM8A 4PABA 1XZPA 1B4AA 2V6TA 1WOPA 4A93C 4C2MC 2E2HA 3GTQC 1WCMK 4KMUA 2E2IC 4P5AA 3GTPA 3HOWK 3S2DK 4G7OA 5FLMK 4O2DA 2E2HC 3PO3C 1VLOA 4JK1A 4A3FC 4YFXA 3GTPC 4LK1A 4A3EK 3ERED 1O2BA 1YNNA 1VJEA 4GT9A 4KB4A 4BBSK 4C3IC 3FOFA 3I4MK 1K83K 3FOEA 3SZZA 2JA8C 2NVXA 4OIRA 3S14K 4OIOA 5C44C 1SFOK 2GAGC 1DD5A 3GTJK 5C4JK 4MQ9A 2CFAA 2NVXC 3AD7C 1TWAA 5IP9C 3PO2C 5IP7K 2V6UA 1F7UA 3S1MC 1G51A 3FHZA 2ZFZA 3G4CA 3RZDC 1TWAC 1O2FB 2R92C 1PJ7A 3ADAC 3BP8C 1TWFK 4WILA 3S2HC 1IBAA 3HOZK 2WAQL 1EQRA 4A3LK 1WCMA 3AQPA 3L4JA 1TWHK 4BKWA 3T00A 1DCPA 1PJ5A 3LPXA 1WCMC 5M5WK 4GZYA 1O26A 3HOWC 3S2DC 4KASA 3TTGA 2NVTK 3S0XA 1K83A 4A3MC 1XXBA 3OEPA 4A93K 1WIHA 4C2MK 4A3EC 4LLGA 2XCOA 5IYCC 1SFOA 3HOVK 3S1NK 1XXAA 4C3HC 1BGWA 1USMA 3GTJA 3N3YA 3GEIA 1BDFA 1YCLA 3S14C 3SZYA 4A3FK 1I3QK 5D4DA 3DXJA 3GTOK 3GTJC 5C4JC 4A3IC 4KATA 3HKZL 1WOOA 4KMAA 4C3IK 3AQOA 4A3GC 5IP7C 3QX3A 3JSTA 1TWFA 1WQGA 3OREA 4XSXA 4XCHA 1HQMA 4BLBA 5TJ3A 1DCOA 1J98A 3MMLB 3S15K 5IP9K 1O29A 3HXAA 1TWHA 5JFEA 2Y0SL 4YFKA 2NVQC 1I6HC 4BBRK 1JQWA 1O24A 4OIPA 4A3LC 3N0CA 2R92K 4P5BA 2GAHC 4ZH4A 2E2JK 4GTDA 4KB2A 2ZUFA 1C0AA 2B63K 1JOEA 4FM9A 2WAQD 2NVTC 5CJ9A 2VUMK 2JH3A 1USOA 2PPBA 5IORA 4J3NA 1J6XA 5IOTA 3S1NC 3HOVC 5EGEA 1I3QA 5E68A 2V6SA 3GTKA 3GTOA 1VH2A 5C3EC 1PJ6A 1XXCA 4A3MK
chains in the Genus database with same CATH topology
1I3QC 1TWAC 3GTLK 4YG2A 1IW7A 3FKIK 2R92C 3GTKC 3GTOC 3I4NC 3S1RC 5IYCK 4QJVB 5IYBK 2NVYK 4Q4ZA 3M4OK 4Y52C 1TWFK 4C3HK 3GTQK 3S2HC 2E2IK 5M5YK 3HOYC 3CQZK 3HOZK 2PA8D 2WAQL 4A3KC 4BBSC 2A6HA 4KN4A 3I4MC 1K83C 5TMCA 4BY1C 4A3LK 4BY7C 1Y1WK 3S17K 2E2HK 3PO3K 4BXXC 3M3YC 4MEYA 1TWHK 4A3IK 4AYBL 1SFOC 3GTPK 4AYBD 3S15C 4OINA 4A3GK 1WCMC 4YFNA 5M5WK 2JA6C 4GZYA 4BBRC 3HOWC 3S2DC 2R93C 4A3BK 2YU9C 1TWGK 3S16C 3H0GK 2NVTK 4XLPA 5C44K 3HOXK 2PMZD 4A3MC 3GTMK 2E2JC 4C2MK 4A93K 4A3EC 3S1QK 4X6AK 3FKIC 4LLGA 2A6EA 4A3CC 2NVXK 2PA8L 2JA7C 5IYCC 3RZOC 3HOVK 3S1NK 2NVYC 1SMYA 3M4OC 4A3DK 1TWFC 2B63C 4QJVA 2NVQK 3PO2K 2A68A 1I6HK 5C4XC 4Y7NK 5FJ8K 1R9TK 4G7ZA 2JA5C 3CQZC 3HOZC 3GTGK 2R7ZK 3S1MK 3K7AK 1BDFA 2Y0SD 2O5IA 2BE5A 3S14C 4A3FK 2VUMC 3RZDK 1Y1WC 1Y1VK 1TWAK 1I3QK 3S17C 5D4DA 3DXJA 3I4NK 1TWHC 3GTJC 5C4JC 4A3IC 4C3JK 3GTOK 3S1RK 3HOUC 1I50C 3HKZL 4NOIA 4C3IK 1TWCC 3HKZD 4Y52K 3S2HK 4A3GC 5IP7C 2A69A 2PMZL 4XLNA 5IYDC 4XSXA 4A3JC 1HQMA 4QIWD 3GTLC 3M3YK 4BXXK 1ZYRA 1XPPA 3GTMC 3S15K 5IYBC 4A93C 5IP9K 3GTQC 1WCMK 4KMUA 2E2IC 2JA6K 4A3BC 4XSZA 5C3EK 2Y0SL 4YFKA 2WB1D 2NVQC 4BBRK 3HOWK 3S2DK 1I6HC 4OIPA 2R93K 1R9TC 2JA8K 4G7OA 4A3LC 5FLMK 2E2HC 3PO3C 4MEXA 3K7AC 5TMFA 4JK1A 5M3MK 4A3FC 4OIQA 4YFXA 2R92K 3GTPC 3H3VD 3GTKK 4LK1A 4ZH4A 5M3FK 2E2JK 4A3EK 4LJZA 4A3CK 2JA7K 3RZOK 1YNNA 3HOYK 4BBSK 2O5JA 4A3KK 4G7HA 4KN7A 2B63K 3I4MK 1K83K 5C4XK 2JA8C 4BY1K 1I6VA 2JA5K 4BY7K 4QIWL 1TWGC 4OIRA 3WODA 2WAQD 3H0GC 2NVTC 3HOXC 4OIOA 5C44C 3S14K 2VUMK 1SFOK 2PPBA 3S1QC 4Q5SA 3GTJK 5C4JK 4X6AC 4MQ9A 2CW0A 3HOUK 1I50K 2NVXC 3S1NC 1YNJA 1TWCK 2WB1L 3HOVC 4A3DC 5IP9C 3PO2C 5IP7K 3EQLA 4Y7NC 5M5XK 2YU9K 3S16K 2R7ZC 5C3EC 3GTGC 3S1MC 4LK0A 3H3VL 5IYDK 4A3MK 4A3JK 3RZDC 5FLMC 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q C;  1TWA C;  3GTL K;  4YG2 A;  1IW7 A;  3FKI K;  2R92 C;  3GTK C;  3GTO C;  3I4N C;  3S1R C;  5IYC K;  4QJV B;  5IYB K;  2NVY K;  4Q4Z A;  3M4O K;  4Y52 C;  1TWF K;  4C3H K;  3GTQ K;  3S2H C;  2E2I K;  5M5Y K;  3HOY C;  3CQZ K;  3HOZ K;  2PA8 D;  2WAQ L;  4A3K C;  4BBS C;  2A6H A;  4KN4 A;  3I4M C;  1K83 C;  5TMC A;  4BY1 C;  4A3L K;  4BY7 C;  1Y1W K;  3S17 K;  2E2H K;  3PO3 K;  4BXX C;  3M3Y C;  4MEY A;  1TWH K;  4A3I K;  4AYB L;  1SFO C;  3GTP K;  4AYB D;  3S15 C;  4OIN A;  4A3G K;  1WCM C;  4YFN A;  5M5W K;  2JA6 C;  4GZY A;  4BBR C;  3HOW C;  3S2D C;  2R93 C;  4A3B K;  2YU9 C;  1TWG K;  3S16 C;  3H0G K;  2NVT K;  4XLP A;  5C44 K;  3HOX K;  2PMZ D;  4A3M C;  3GTM K;  2E2J C;  4C2M K;  4A93 K;  4A3E C;  3S1Q K;  4X6A K;  3FKI C;  4LLG A;  2A6E A;  4A3C C;  2NVX K;  2PA8 L;  2JA7 C;  5IYC C;  3RZO C;  3HOV K;  3S1N K;  2NVY C;  1SMY A;  3M4O C;  4A3D K;  1TWF C;  2B63 C;  4QJV A;  2NVQ K;  3PO2 K;  2A68 A;  1I6H K;  5C4X C;  4Y7N K;  5FJ8 K;  1R9T K;  4G7Z A;  2JA5 C;  3CQZ C;  3HOZ C;  3GTG K;  2R7Z K;  3S1M K;  3K7A K;  1BDF A;  2Y0S D;  2O5I A;  2BE5 A;  3S14 C;  4A3F K;  2VUM C;  3RZD K;  1Y1W C;  1Y1V K;  1TWA K;  1I3Q K;  3S17 C;  5D4D A;  3DXJ A;  3I4N K;  1TWH C;  3GTJ C;  5C4J C;  4A3I C;  4C3J K;  3GTO K;  3S1R K;  3HOU C;  1I50 C;  3HKZ L;  4NOI A;  4C3I K;  1TWC C;  3HKZ D;  4Y52 K;  3S2H K;  4A3G C;  5IP7 C;  2A69 A;  2PMZ L;  4XLN A;  5IYD C;  4XSX A;  4A3J C;  1HQM A;  4QIW D;  3GTL C;  3M3Y K;  4BXX K;  1ZYR A;  1XPP A;  3GTM C;  3S15 K;  5IYB C;  4A93 C;  5IP9 K;  3GTQ C;  1WCM K;  4KMU A;  2E2I C;  2JA6 K;  4A3B C;  4XSZ A;  5C3E K;  2Y0S L;  4YFK A;  2WB1 D;  2NVQ C;  4BBR K;  3HOW K;  3S2D K;  1I6H C;  4OIP A;  2R93 K;  1R9T C;  2JA8 K;  4G7O A;  4A3L C;  5FLM K;  2E2H C;  3PO3 C;  4MEX A;  3K7A C;  5TMF A;  4JK1 A;  5M3M K;  4A3F C;  4OIQ A;  4YFX A;  2R92 K;  3GTP C;  3H3V D;  3GTK K;  4LK1 A;  4ZH4 A;  5M3F K;  2E2J K;  4A3E K;  4LJZ A;  4A3C K;  2JA7 K;  3RZO K;  1YNN A;  3HOY K;  4BBS K;  2O5J A;  4A3K K;  4G7H A;  4KN7 A;  2B63 K;  3I4M K;  1K83 K;  5C4X K;  2JA8 C;  4BY1 K;  1I6V A;  2JA5 K;  4BY7 K;  4QIW L;  1TWG C;  4OIR A;  3WOD A;  2WAQ D;  3H0G C;  2NVT C;  3HOX C;  4OIO A;  5C44 C;  3S14 K;  2VUM K;  1SFO K;  2PPB A;  3S1Q C;  4Q5S A;  3GTJ K;  5C4J K;  4X6A C;  4MQ9 A;  2CW0 A;  3HOU K;  1I50 K;  2NVX C;  3S1N C;  1YNJ A;  1TWC K;  2WB1 L;  3HOV C;  4A3D C;  5IP9 C;  3PO2 C;  5IP7 K;  3EQL A;  4Y7N C;  5M5X K;  2YU9 K;  3S16 K;  2R7Z C;  5C3E C;  3GTG C;  3S1M C;  4LK0 A;  3H3V L;  5IYD K;  4A3M K;  4A3J K;  3RZD C;  5FLM C;  1Y1V C; 
#chains in the Genus database with same CATH topology
 1I3Q C;  3OPF A;  3GTL K;  3T01 A;  3GTK C;  3GTO C;  1EI6 A;  5IYC K;  4C3H K;  4GTF A;  5M5Y K;  2A6H A;  4KMD A;  4BY1 C;  2FQO A;  4BY7 C;  1XZQ A;  1AB4 A;  1KQ4 A;  5HL8 A;  4MEY A;  2RH6 A;  4A3I K;  4AYB L;  3S15 C;  1O27 A;  1WOS A;  4A3G K;  2R92 A;  4KM9 A;  4KAW X;  4BBR C;  1O28 A;  3CAG A;  2YU9 C;  1TWG K;  3S16 C;  3H0G K;  2B63 A;  3GSI A;  2E2J C;  2KWA A;  3S1Q K;  1WSV A;  3TFJ A;  3GEH A;  4X6A K;  2VUM A;  1SMY A;  2B63 C;  2NVQ K;  1I6H K;  3AD9 C;  3CQZ C;  1INN A;  2Y0S D;  5IOQ A;  2VUM C;  1Y1W C;  1Y1V K;  4LR2 A;  3A8K A;  4LQY A;  4Y52 K;  3GTL A;  2W7V A;  1J6W A;  1WOR A;  3GTL C;  1ZQ1 C;  4G0W A;  3GTM C;  1BS2 A;  1WQF A;  5C3E K;  2JA8 K;  2EBB A;  4MEX A;  3K7A C;  5M3M K;  4OIQ A;  3GTK K;  1EFW A;  1TWG A;  3H0G A;  4LJZ A;  1UV7 A;  3RZO K;  1EK8 A;  4ILD A;  2O5J A;  4G7H A;  4KN7 A;  1VGX A;  5C4X K;  4BY1 K;  1I6V A;  2JA5 K;  4BY7 K;  1TWG C;  2GSO A;  3H0G C;  4G0U A;  2P8T A;  3S1Q C;  4GFQ A;  5CHP A;  3L4K A;  4Q5S A;  4X6A C;  1IS1 A;  4GTL A;  1I50 K;  1ISE A;  1TWC K;  2WB1 L;  1Y1V A;  2YU9 K;  1ZVU A;  3S16 K;  3H3V L;  5IYD K;  1IE0 A;  5L46 A;  3NUH A;  1Y1V C;  4YG2 A;  1IW7 A;  4LOW A;  1GE9 A;  4QJV B;  5IYB K;  4Q4Z A;  4AH6 A;  4Y52 C;  3TFI A;  3HOY C;  3CQZ K;  4GTC A;  4A3K C;  4KN4 A;  1X31 C;  1Y1W K;  1O2A A;  3BP3 A;  1VRQ C;  1DCH A;  1IL2 A;  4OIN A;  3Q3Q A;  2GSU A;  4YFN A;  4G0V A;  4GTA A;  3IPJ A;  1F93 A;  4XLP A;  3HOX K;  2Y3P A;  1YX2 A;  3VA7 A;  3GTM K;  2JA5 A;  2CFA B;  2XCQ A;  3FKI C;  2PA8 L;  3RZO C;  2NVY C;  4A3D K;  3M4O C;  4QJV A;  2A68 A;  5C4X C;  4Y7N K;  2ZUE A;  4G7Z A;  2JA5 C;  2R7Z K;  3GTG K;  1I50 A;  3K7A K;  1TWC A;  1ZBS A;  2BE5 A;  1ZXO A;  2XCR B;  2YU9 A;  3S17 C;  3I4N K;  3AH5 A;  5EGH A;  4P9S A;  4C3J K;  3S1R K;  1I50 C;  1TWC C;  3HKZ D;  4FZB A;  1BJT A;  1L0W A;  2PMZ L;  4XLN A;  1WQH A;  1EH1 A;  4PAA A;  5IYD C;  2FQT A;  3CQZ A;  3M3Y K;  4BXX K;  1IQ0 A;  1ZYR A;  1XPP A;  1R9T A;  5IYB C;  1Y1W A;  2PHC B;  2JA6 K;  4A3B C;  4XSZ A;  2WB1 D;  2R93 K;  1R9T C;  4GTE A;  5TMF A;  3H3V D;  5M3F K;  4A3C K;  2JA7 K;  3HOY K;  3BUE A;  4A3K K;  3GTM A;  5IOS A;  5JVO A;  3GEE A;  4QIW L;  3WOD A;  3HOX C;  4WJ4 A;  2R7Z A;  3GDZ A;  3GTG A;  2CW0 A;  3HOU K;  1YNJ A;  3TFH A;  4A3D C;  3G4A A;  3EQL A;  4Y7N C;  5M5X K;  4KDD A;  2R7Z C;  3T02 A;  3GTG C;  1O25 A;  4LK0 A;  4RMF A;  1RU0 A;  4A3J K;  5FLM C;  3FKI K;  3I4N C;  1JVI A;  4C3J C;  3S1R C;  2NVY K;  3M4O K;  3GTQ K;  2E2I K;  1HI9 A;  4BBS C;  2PA8 D;  3V4G A;  3I4M C;  1K83 C;  5TMC A;  3S17 K;  2E2H K;  2JA6 A;  4KMH A;  3PO3 K;  4BXX C;  3M3Y C;  1SFO C;  3GTP K;  2P5M A;  2R93 A;  4AYB D;  4DDQ A;  4M1X A;  4GTB A;  1F7V A;  2JA6 C;  2RGR A;  2R93 C;  4BLA A;  2JA7 A;  1XZP B;  5C44 K;  2PMZ D;  3N0B A;  3A8J A;  3LAJ A;  2A6E A;  4A3C C;  2NVX K;  2JA7 C;  4A3B K;  2GSN A;  1TWF C;  3PO2 K;  1B4B A;  4WJ3 M;  5FJ8 K;  1R9T K;  3HOZ C;  3S1M K;  1F9N A;  1V5V A;  1WSR A;  2O5I A;  3RZD K;  1TWA K;  1TWH C;  2D6F C;  3HOU C;  4NOI A;  3S2H K;  3AD8 C;  3FKI A;  4C45 A;  3GIR A;  3LAP A;  2A69 A;  4KAR A;  2NVY A;  1XZQ B;  3GTQ A;  4KC6 A;  4A3J C;  3A8I A;  2E2I A;  4QIW D;  1J6V A;  4KM8 A;  4PAB A;  1XZP A;  1B4A A;  2V6T A;  1WOP A;  4A93 C;  4C2M C;  2E2H A;  3GTQ C;  1WCM K;  4KMU A;  2E2I C;  4P5A A;  3GTP A;  3HOW K;  3S2D K;  4G7O A;  5FLM K;  4O2D A;  2E2H C;  3PO3 C;  1VLO A;  4JK1 A;  4A3F C;  4YFX A;  3GTP C;  4LK1 A;  4A3E K;  3ERE D;  1O2B A;  1YNN A;  1VJE A;  4GT9 A;  4KB4 A;  4BBS K;  4C3I C;  3FOF A;  3I4M K;  1K83 K;  3FOE A;  3SZZ A;  2JA8 C;  2NVX A;  4OIR A;  3S14 K;  4OIO A;  5C44 C;  1SFO K;  2GAG C;  1DD5 A;  3GTJ K;  5C4J K;  4MQ9 A;  2CFA A;  2NVX C;  3AD7 C;  1TWA A;  5IP9 C;  3PO2 C;  5IP7 K;  2V6U A;  1F7U A;  3S1M C;  1G51 A;  3FHZ A;  2ZFZ A;  3G4C A;  3RZD C;  1TWA C;  1O2F B;  2R92 C;  1PJ7 A;  3ADA C;  3BP8 C;  1TWF K;  4WIL A;  3S2H C;  1IBA A;  3HOZ K;  2WAQ L;  1EQR A;  4A3L K;  1WCM A;  3AQP A;  3L4J A;  1TWH K;  4BKW A;  3T00 A;  1DCP A;  1PJ5 A;  3LPX A;  1WCM C;  5M5W K;  4GZY A;  1O26 A;  3HOW C;  3S2D C;  4KAS A;  3TTG A;  2NVT K;  3S0X A;  1K83 A;  4A3M C;  1XXB A;  3OEP A;  4A93 K;  1WIH A;  4C2M K;  4A3E C;  4LLG A;  2XCO A;  5IYC C;  1SFO A;  3HOV K;  3S1N K;  1XXA A;  4C3H C;  1BGW A;  1USM A;  3GTJ A;  3N3Y A;  3GEI A;  1BDF A;  1YCL A;  3S14 C;  3SZY A;  4A3F K;  1I3Q K;  5D4D A;  3DXJ A;  3GTO K;  3GTJ C;  5C4J C;  4A3I C;  4KAT A;  3HKZ L;  1WOO A;  4KMA A;  4C3I K;  3AQO A;  4A3G C;  5IP7 C;  3QX3 A;  3JST A;  1TWF A;  1WQG A;  3ORE A;  4XSX A;  4XCH A;  1HQM A;  4BLB A;  5TJ3 A;  1DCO A;  1J98 A;  3MML B;  3S15 K;  5IP9 K;  1O29 A;  3HXA A;  1TWH A;  5JFE A;  2Y0S L;  4YFK A;  2NVQ C;  1I6H C;  4BBR K;  1JQW A;  1O24 A;  4OIP A;  4A3L C;  3N0C A;  2R92 K;  4P5B A;  2GAH C;  4ZH4 A;  2E2J K;  4GTD A;  4KB2 A;  2ZUF A;  1C0A A;  2B63 K;  1JOE A;  4FM9 A;  2WAQ D;  2NVT C;  5CJ9 A;  2VUM K;  2JH3 A;  1USO A;  2PPB A;  5IOR A;  4J3N A;  1J6X A;  5IOT A;  3S1N C;  3HOV C;  5EGE A;  1I3Q A;  5E68 A;  2V6S A;  3GTK A;  3GTO A;  1VH2 A;  5C3E C;  1PJ6 A;  1XXC A;  4A3M K; 
#chains in the Genus database with same CATH homology
 1I3Q C;  1TWA C;  3GTL K;  4YG2 A;  1IW7 A;  3FKI K;  2R92 C;  3GTK C;  3GTO C;  3I4N C;  3S1R C;  5IYC K;  4QJV B;  5IYB K;  2NVY K;  4Q4Z A;  3M4O K;  4Y52 C;  1TWF K;  4C3H K;  3GTQ K;  3S2H C;  2E2I K;  5M5Y K;  3HOY C;  3CQZ K;  3HOZ K;  2PA8 D;  2WAQ L;  4A3K C;  4BBS C;  2A6H A;  4KN4 A;  3I4M C;  1K83 C;  5TMC A;  4BY1 C;  4A3L K;  4BY7 C;  1Y1W K;  3S17 K;  2E2H K;  3PO3 K;  4BXX C;  3M3Y C;  4MEY A;  1TWH K;  4A3I K;  4AYB L;  1SFO C;  3GTP K;  4AYB D;  3S15 C;  4OIN A;  4A3G K;  1WCM C;  4YFN A;  5M5W K;  2JA6 C;  4GZY A;  4BBR C;  3HOW C;  3S2D C;  2R93 C;  4A3B K;  2YU9 C;  1TWG K;  3S16 C;  3H0G K;  2NVT K;  4XLP A;  5C44 K;  3HOX K;  2PMZ D;  4A3M C;  3GTM K;  2E2J C;  4C2M K;  4A93 K;  4A3E C;  3S1Q K;  4X6A K;  3FKI C;  4LLG A;  2A6E A;  4A3C C;  2NVX K;  2PA8 L;  2JA7 C;  5IYC C;  3RZO C;  3HOV K;  3S1N K;  2NVY C;  1SMY A;  3M4O C;  4A3D K;  1TWF C;  2B63 C;  4QJV A;  2NVQ K;  3PO2 K;  2A68 A;  1I6H K;  5C4X C;  4Y7N K;  5FJ8 K;  1R9T K;  4G7Z A;  2JA5 C;  3CQZ C;  3HOZ C;  3GTG K;  2R7Z K;  3S1M K;  3K7A K;  1BDF A;  2Y0S D;  2O5I A;  2BE5 A;  3S14 C;  4A3F K;  2VUM C;  3RZD K;  1Y1W C;  1Y1V K;  1TWA K;  1I3Q K;  3S17 C;  5D4D A;  3DXJ A;  3I4N K;  1TWH C;  3GTJ C;  5C4J C;  4A3I C;  4C3J K;  3GTO K;  3S1R K;  3HOU C;  1I50 C;  3HKZ L;  4NOI A;  4C3I K;  1TWC C;  3HKZ D;  4Y52 K;  3S2H K;  4A3G C;  5IP7 C;  2A69 A;  2PMZ L;  4XLN A;  5IYD C;  4XSX A;  4A3J C;  1HQM A;  4QIW D;  3GTL C;  3M3Y K;  4BXX K;  1ZYR A;  1XPP A;  3GTM C;  3S15 K;  5IYB C;  4A93 C;  5IP9 K;  3GTQ C;  1WCM K;  4KMU A;  2E2I C;  2JA6 K;  4A3B C;  4XSZ A;  5C3E K;  2Y0S L;  4YFK A;  2WB1 D;  2NVQ C;  4BBR K;  3HOW K;  3S2D K;  1I6H C;  4OIP A;  2R93 K;  1R9T C;  2JA8 K;  4G7O A;  4A3L C;  5FLM K;  2E2H C;  3PO3 C;  4MEX A;  3K7A C;  5TMF A;  4JK1 A;  5M3M K;  4A3F C;  4OIQ A;  4YFX A;  2R92 K;  3GTP C;  3H3V D;  3GTK K;  4LK1 A;  4ZH4 A;  5M3F K;  2E2J K;  4A3E K;  4LJZ A;  4A3C K;  2JA7 K;  3RZO K;  1YNN A;  3HOY K;  4BBS K;  2O5J A;  4A3K K;  4G7H A;  4KN7 A;  2B63 K;  3I4M K;  1K83 K;  5C4X K;  2JA8 C;  4BY1 K;  1I6V A;  2JA5 K;  4BY7 K;  4QIW L;  1TWG C;  4OIR A;  3WOD A;  2WAQ D;  3H0G C;  2NVT C;  3HOX C;  4OIO A;  5C44 C;  3S14 K;  2VUM K;  1SFO K;  2PPB A;  3S1Q C;  4Q5S A;  3GTJ K;  5C4J K;  4X6A C;  4MQ9 A;  2CW0 A;  3HOU K;  1I50 K;  2NVX C;  3S1N C;  1YNJ A;  1TWC K;  2WB1 L;  3HOV C;  4A3D C;  5IP9 C;  3PO2 C;  5IP7 K;  3EQL A;  4Y7N C;  5M5X K;  2YU9 K;  3S16 K;  2R7Z C;  5C3E C;  3GTG C;  3S1M C;  4LK0 A;  3H3V L;  5IYD K;  4A3M K;  4A3J K;  3RZD C;  5FLM C;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...